4GKBA

Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, unliganded structure
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
247
Chain Sequence
MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYAKLAEIAAKVPLGRRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, unliganded structure
rcsb
source organism Burkholderia multivorans
molecule tags Oxidoreductase
total genus 87
structure length 247
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gkbA00
3JYNA 1ZO8A 5JBIA 1OC2A 3DTTA 3GUCA 3I5MA 4Y9DA 1EE2A 3JSAA 4XKJA 3D7LA 2Y99A 4WEOA 2IEDA 4BNUA 3WTCA 3HADA 2PH5A 3TF5A 5TJ9A 4E21A 3FNEA 3HFSA 3N7UA 3V5NA 1HDXA 2O7SA 3PK0A 5JAIA 2ET6A 2O3UA 5KJCA 3ZWOA 5JY1A 3O8QB 1KOLA 4WASA 5H81A 4PZEA 4UVGA 3PJDA 5BSEA 5AXDA 1E5QA 2PKQP 4XRRA 2X0NA 4Q3AA 4OXYA 4ZQEA 3FBTA 5BR7A 1FDVA 4KZPA 3VPGA 1GPJA 1KS9A 1Z7BA 3QVOA 3ST7A 3KHUA 3OJEA 3PRJA 3QWIA 4FD3A 4O5OA 3I9MA 2Y66A 5F1KA 1F17A 4OHUA 4D42A 3WDSA 3HDJA 2VHZA 4NFSA 1J0XO 5B4UA 5LC1A 4PVCA 1O95A 5TF4A 1A7AA 4B4VA 3K8ZA 4QT0A 3V1UA 2Q2QA 1WZIA 1K5HA 3H3JA 1LDGA 3ETDA 1YVEI 1QYXA 3NGLA 5JE8A 3P2YA 2P2SA 2A9FA 3OQ1A 1E3SA 3PZRA 5F3RA 4M86A 3GC6A 4BNVA 3GH3A 3ZWYA 5ER9A 5KKAA 1EK6A 1VSVA 3S1LA 3WBBA 2NQ8A 2E49A 1B2LA 2GNAA 3O4RA 2FSSA 3PWZA 4R68A 3LT2A 3PHJA 3DBVO 5L4NA 3LF2A 2X5JO 2GN9A 4M1QA 2GRAA 4QXMA 3Q2IA 5TSDA 4CLOB 2V65A 1U3UA 3HNPA 4PLZA 3OJ0A 4JK3A 2JFGA 1CETA 1J4AA 1NWHA 5HS6A 1HYEA 3H2ZA 3IKTA 1LLDA 3VC7A 3WBFA 3GAFA 5KVSA 2C59A 3JCZA 2DFVA 2F1KA 3OICA 2O7QA 4II2A 3WGHA 3ZWWA 1NNUA 1JDJA 3GGGA 2G1UA 4OL9A 5IDQA 3IJRA 4HBGA 4DYVA 3E18A 4W99A 2OOSA 3RC9A 2ZTVA 1ADBA 3DHNA 1HDGO 3CH6A 3QHAA 4J0EA 5EINA 3GNSA 4J1NA 1GUFA 4OH1A 1AUPA 3MOGA 4EI2A 1GEEA 2YFQA 3INRA 2Y1DA 4R16A 2OP1A 3WXBA 5JDCC 3QJ5A 3ZNOA 4B79A 3WYEA 2QW8A 3INGA 2Z95A 2QZ9A 3MEQA 4J16A 1SB9A 4YT4A 3S2IA 4BKQA 3JQAD 4KDEA 3BMOA 1UZLA 4IXWA 4N7RA 1LQTA 1NTOA 2PZJA 4RQTA 4NI5A 2WD7B 4HFNA 1WLYA 3QVWA 5IXSA 4KP7A 1EVZA 1LDMA 4ZQHA 1QV6A 3NTOA 4J9VA 4KQXA 1Y5RA 4J6FA 3C7AA 4XJTA 4BNIA 5JY6A 4DQXA 1O5IA 1PJCA 1PQPA 3ICCA 2EEZA 1EQUA 3IMFA 4J43A 3GPIA 4L4RA 3FPCA 4ZN6A 3QWAA 2AQIA 2H5LA 3DOOA 4CMEA 5ICMA 4D44A 1ADGA 3DHEA 2PH3A 1U5CA 3B20A 3IAHA 4NBWA 4HNGA 4OSOA 2Q1UA 3DOCA 3HJAA 4CMIA 1Y8RA 3TOXA 4N54A 2NADA 4A2CA 1M6HA 3L4BC 1GFSA 3HN7A 4GSLA 1CEQA 1V0JA 2CF5A 1A4UA 3KSUA 4JQCA 2ZJ0A 3H9JA 1DJQA 1MFPA 4XJSA 4CM9A 1RWBA 3LK7A 3NT4A 3BIOA 4BB6A 1K6JA 1NVTA 4KUEA 4MVJG 1EBUA 4I5EA 3UFXA 3ZDFA 5IF3A 4H3VA 4Z0HO 4IDCA 4YBZA 2GO1A 1W0CA 1ZIDA 1XR3A 3E1KA 1B26A 4OQYA 1ISFA 1YDEA 3C1TA 5CEEA 1EQ2A 1Y81A 4QFDA 2Y1EA 4WNIA 3B1FA 3D4NA 4B8ZA 1X1EA 1QMGA 4P4NA 4ZU3A 5L7TA 1I30A 3KLPX 4FC6A 3G49A 4BNMA 3WJAA 3FBGA 4ND3A 3WIDA 3ZV6A 5JFOA 4DMMA 4RZHA 5C37A 3TZKA 4IUYA 4CQMA 2E82A 5I7VA 4AJEA 3P5SA 5F1PA 1B8UA 4XYMA 5BNFA 2YHIA 2B35A 4E5PA 2VZ8A 2IEBA 1Q0HA 4RF4A 3Q11A 1OAAA 5T6BA 1E3EA 3JYLA 4YYZA 2X23A 3H3FA 3HG7A 4YAKA 1NHWA 4IIVA 2I3GA 4AL4A 2I65A 2IYOA 2J3IA 1I32A 4E0BA 1I01A 1WMBA 2O3RA 5U9CA 3UAGA 3RFTA 4BNTA 2X0IA 4IDEA 3PJGA 3ZCXA 4XGIA 4PLTA 3RQSA 4FBGA 1R4NA 5JLAA 4NBVA 2VUUA 4R4JA 4K6CA 5A3JA 1XQ1A 5IJZA 2AQHA 1VC2A 3GY0A 1R15A 4EJMA 3K9QO 1H6AA 4QX6A 4Y6SA 3DR3A 3RBVA 1I3MA 1X7HA 5DBFA 1UAYA 1U4OA 2O23A 3KYDA 1YBMA 4MP8A 2D59A 2JFHA 3AK4A 3DMYA 4LCJA 3M6IA 1IULA 5JMPA 4TSKA 2GPTA 2E6UX 4CM8A 4WOJA 2SCUA 4BMNA 1PS8A 4I5FA 4K6FA 3Q9NA 4NNJA 2JCXA 2NU6A 3H9EO 1DBVO 2VWGA 4AG3A 2DLDA 5C7IO 5U1PA 2G5CA 3U4HA 1F8GA 2YV3A 1GZ6A 3LT0A 1PJ3A 3VH3A 4IBOA 4XD2A 1YL6A 1X0XA 2BHLA 2HO5A 3R0IA 3RUEA 2BMAA 1UP4A 4E2YA 1JVSA 2HUNA 3K2BA 1NQAO 2VRBA 4XYEA 1YQGA 1ISJA 4WLFA 4DVJA 3CE6A 1MUUA 3CZRA 2C07A 1IE3A 3VZRA 4D3FA 3QRWA 4Q3DA 4JX8A 2YY7A 5K9ZA 1LDBA 4Z3DA 1N2SA 2DM6A 3QVTA 1PSDA 5GMOA 3D0OA 3ZU4A 3CINA 5K6AA 2CDBA 2TMGA 1VKOA 2I76A 1KIFA 1YL5A 1GYQA 3N74A 2Z1NA 5JO0A 1ZK1A 4XIYA 4U7WA 1I5RA 4CQMB 3UICA 1ZCJA 4CUJA 2O4UX 3HN2A 4CMKA 2ZK7A 2J3KA 4WNCA 2PKQO 4E5NA 1E3IA 1QR6A 1P1HA 2WJPA 3NJ8A 1I36A 1WDKA 4BNWA 4E33A 3DZIA 4NJOA 4HUJA 4XB1A 3KEQA 4AJHA 1AGNA 2TMDA 2RH8A 3FPLA 2IRWA 3ZWNA 3IUPA 4WCDA 1BDMA 1NQ5A 4CV0A 2W2LD 4BNNA 1NPDA 2P91A 1GL3A 3B70A 4O63O 4TKMA 4E30A 3AM5A 2GCGA 2BI7A 2C7VA 1R16A 4K26A 1PGJA 4HP8A 2BF7A 2G76A 1W4ZA 1R4NB 5KJFA 1WNTA 4YA6A 3RROA 4L4XA 4HFRA 1B7GO 1Z73A 4LRTB 3SJUA 1BW9A 1Y5MA 1SCUA 5AYVA 1ORRA 4FSHA 4C7KA 4QECA 1MC5A 3NDJA 4FFMA 2G0TA 3GZNA 2X22A 2AQ8A 4IJUA 2ZCUA 2VRCA 3GMDA 5DP1A 3OQBA 4J2OA 1Z7EA 1MG5A 5G0SA 2B83A 3Q1LA 2FR1A 2PD3A 1HDOA 4M49A 1DC5A 4IZIA 1YOVB 2OP0A 4RCVA 2GSDA 2NTJA 3ZW8A 3K2EA 4NHEA 2UUOA 3ZNQA 1HZJA 2PWZA 3WGGA 4M89A 3WIEA 1MB4A 2I5PO 2ILTA 5KNLA 2WM3A 1UZNA 3RVDA 2XAAA 1K3TA 4BNYA 4PLFA 4D7AA 2R00C 4RPJA 4R1TA 2DPHA 5CEFA 4O6VA 2WD8A 4QSMA 2P68A 3WGIA 3BMQA 3EDMA 4OGWA 1PIWA 1QYWA 4DPLA 4XDZA 4GX0A 1NFFA 2D4AA 5JYEA 1HE3A 1NPYA 1F06A 5TS3A 5JMWA 4Z9XA 2QIOA 3QWFA 1ADFA 2AEJA 4NZ9A 1PWZA 4JJGA 4A03A 2WWRA 1NAIA 2EJVA 4R9RA 1I0ZA 3H2SA 4CM4A 4BL5A 3ZWVA 1LX6A 3I83A 4HY3A 4EEZA 5U4QA 2EGGA 4GBJA 4CV1A 2Y0CA 5G4KA 4RZIA 5JCJD 2Q1SA 1G1AA 3BAZA 1HZZA 2HMSA 2XXJA 2VUTA 5A06A 3OA2A 3U4DA 5KJ6A 2O48X 3ZU3A 1EMDA 3JQ8A 3IS3A 3EZLA 4BNXA 5A1TA 3ORFA 4WLVA 8LDHA 3MJ4A 4P4LA 4YXFA 5A03A 4I9UA 2NUAA 5EERA 2YYYA 3V2HA 5DOVA 1DPGA 2BFOA 1NR7A 3W4KA 5A5EA 1V35A 4XDYA 2ZIZA 3L77A 5AXCA 4B4WA 4BKRA 2OBNA 4CMHA 2IODA 3ENNA 1TXGA 2CMDA 2WMDA 1NHGA 3K73O 4FGWA 4XYLA 5KJEA 1DDOA 1K89A 5T8KA 4IJKA 2VYVD 4BO3A 3TZHA 1JN0A 1N92A 2WE8A 2ZJ1A 3NGXA 2VOJA 4AJNA 3RCBA 4TVBA 3A28A 5B37A 3M1LA 1PJ4A 1C1XA 3ETEA 3OF2A 1BW9B 1UAGA 2W2KA 2CVQA 2H63A 1U3TA 2EIHA 2W98A 3GG9A 1DC6A 3MCVA 4OJNA 4XQGA 5L9AA 3GZNB 1TEHA 3TQHA 3PHIA 3OEYA 4ESOA 3IL2A 4PG5A 3LC1O 2CFCA 2NVBA 2CUKA 3ZHXA 2VT3A 1J6UA 4J7CA 2ZQYA 2Q2VA 2DAPA 3ITKA 1ZFNA 3PZBA 3F6YA 1C0LA 4KUHA 3UCXA 1VM6A 3OM9A 2CNBA 5A9SA 3DTYA 4Z3KA 3OA0A 3RFVA 1LDNA 3PQEA 1MC4A 4HFMA 4R01A 4ZQFA 3U09A 4I5DA 1O9BA 4EZBA 1H6CA 4QFCA 1JA9A 1BWSA 2VHXA 3E9MA 3GA0A 3JQBA 5TJHA 4E2WA 5KJ1A 2B5WA 3I9LA 1E7RA 1M75A 2G17A 1UDBA 3WR5A 3QWBA 3GHHA 3PWKA 1JLLA 3PQDA 3X2EA 1ZEMA 2NTVA 3RJ9A 2D8AA 4E6PA 1ZH8A 3ZWPA 2DUUA 1DSSG 3BTUA 2PGDA 2ZTLA 1OZAA 4YDRA 4BNGA 5DCWA 3WG9A 1R37A 1I24A 3GOHA 1P3DA 1MG0A 2OUIA 3U49A 3C85A 4BO4A 1DAOA 2RH4A 1KY4A 2CY0A 5FF9A 5JAMA 5KKCA 1KEVA 3FR8A 1ZNQO 3VH4A 3JQ8B 4YEDA 5IXYA 1O6ZA 4G5HA 3SC6A 5TRTA 3PIDA 2OXIA 3S55A 3PVZA 2JD2A 4FB5A 4NJMA 4HKTA 4YJDA 1JU9A 4OXKA 3F4BA 2BKAA 4FFLA 5I9LA 5JO9A 2JL1A 4JGBA 1X14A 3KV3O 1XGKA 1SEPA 1RPNA 4AVYA 3U3XA 2YJZA 2EG9A 1UUFA 2ZKLA 3AU9A 1E7MA 1ZSYA 3EUWA 2NACA 4YAIA 4CM5A 4RF3A 3AUAA 1GAEO 4LMPA 3PYMA 4UULA 3DXFA 4B7CA 1ARZA 1C1XB 3MJCA 4KDFA 3LSYA 1RM4A 1W8DA 4GWGA 4I9NA 3VKUA 2DC1A 1I3LA 4JNKA 2RIRA 3AUTA 3GAZA 4OOFA 4W6ZA 2PKRA 1LC0A 1GTMA 4CL3A 4GPD1 2C54A 4BV8A 4K28A 2IZ0A 4A7PA 1E1NA 1OC4A 2FMUA 4JBHA 2GF2A 1E3LA 5ENVA 3I1JA 1DXYA 2A94A 3D4OA 3ZWBA 3NT2A 1E92A 2LDXA 5JDIA 1E0DA 1I2CA 3LLSA 3TWOA 1H9BA 3KSZO 2BI8A 5A9SB 1T4BA 4CL8A 3P2OA 4CUKA 4DPMA 1DC3A 5TX7A 2Q49A 5ITVA 1H6BA 4RF2A 3DBHA 4PLVA 3H65A 1D1SA 1R0LA 5KOIA 3MJSA 1EVJA 2ZCVA 2C29D 1GD1O 4Z9FA 1LUAA 2XF8A 4AJJA 3GVPA 1FDWA 3GEGA 4EGFA 3E9NA 5CPFA 4J1SA 1T24A 3D4PA 2B36A 3VVCA 1NXQA 4MVJD 2X5KO 2EXXA 3WGZA 4JP2A 1IPEA 1U8FO 4N5NA 3DB2A 2DQ4A 5DF1A 1E6WA 1H6DA 3H7AA 5IDWA 5EMHA 1U3VA 1HTBA 4NFHA 4W7HA 1E3JA 3H6KA 4L8VA 4DPKA 2WDZA 1B14A 3VDQA 3B6ZA 2JAPA 4IDDA 1P1RA 4YJGB 4Z0TA 3W4JA 9LDTA 2X7HA 1FF9A 1N9GA 1V6AA 5A9RA 2FR0A 3TN7A 1P33A 1E7WA 1DRUA 1HE4A 1V8BA 3R1IA 4RPHA 3LF1A 4YVFA 3WFIA 4E2ZA 4QO8A 2OBYA 2R2GA 5KCZA 3MWEB 1ADCA 1YQXA 3PDJA 4OYRA 4G2NA 2P4QA 4D45A 1EUCA 5CHEA 2EP7A 2OFPA 3SJ7A 2HAEA 2Q4BA 4H16A 2C20A 4U5QA 2O50A 3C1AA 5EPOA 4IQ8A 2DUWA 1KVQA 5K0ZA 4EYEA 2IDZA 1P45A 2DFDA 4GGOA 4I5GA 1N1EA 2V6GA 2NV6A 1TLTA 3FWNA 1WDMA 3CZMA 4XCVA 1YBAA 4BNLA 2UV8A 3F3SA 4PLYA 1B3RA 2BLLA 3TPCA 2I6TA 2HMVA 4OOEA 3FNHA 4ZA2A 3RUAA 3RKRA 3S8MA 3FCOA 1A4IA 3WJ7A 4A10A 4CLHA 3B1JA 3LT4A 1G0NA 2YV1A 2O3SA 3ETGA 2W90A 5DULA 3ZHYA 1PZHA 1DFGA 4D3DA 4LSMA 4YAEA 3AFNA 1DRWA 1K6IA 2P4HX 2EGHA 3DBRA 5LDGA 1NVMB 3K30A 1PTJA 2J5QA 4R41A 4BGUA 5CDSA 2NU9A 2GUGA 2YUTA 3FD8A 3VPSA 4NQZA 1GZ4A 1NQOA 3W8EA 4WLNA 3BHMA 3DBHB 1I33A 2D0IA 3DEYX 1KC1A 5ER6A 2CVOA 3DL2A 3STHA 3JD4A 5KVQA 1LXCA 4NPCA 1Z75A 3SLKA 3RKUA 1O89A 2J3JA 3GVHA 1R66A 3NKLA 2QQ5A 3DMTA 3TL3A 1D3AA 1JTVA 2NWQA 3WGOA 1GUZA 4IDGA 3UF0A 3GEDA 2UAGA 4XEHA 4XWYA 4MPDA 5IG2A 3WNVA 1CDOA 1HKUA 1GPDG 2WYUA 3JQEA 1FK8A 4BO8A 1LLQA 4NG5A 1OOEA 4JJFA 4XR4A 5H82A 3PYLA 5I7FA 4C4OA 1ZEJA 1HL3A 4S1VA 5C5IA 1IB6A 1JWAB 1BXZA 2XOXA 7ADHA 1JKJA 4R1NA 1DFIA 2GERA 3GK3A 3HHPA 3DHYA 3DQPA 2NLOA 3CKYA 2H9IA 2PGLA 3ZZNA 2WSBA 4DUPA 4ALKA 3G1UA 1Z45A 3EY4A 4UUMA 4NR0A 3TSCA 3WOHA 4DXHA 4W82A 1H2HA 2UDPA 1I3NA 3JQFC 1WZEA 3VAZA 1RYEA 4RDHA 4EEXA 1NFQA 2Q1WA 1AXEA 3VTFA 5I8WA 1A27A 2OMEA 3OSUA 5AXBA 3JYPA 3BHIA 4EUEA 2JD0A 3H9QA 2Q46A 3CTMA 4PLCA 3FR7A 1ZJYA 4BO1A 5C7OO 3PWSA 2JKVA 1M66A 2WE7A 1LSOA 1YRLA 3HE3A 4R54A 1D4FA 4GL4A 3NTQA 4Y6RA 1FDTA 3Q6IA 1YBVA 4G81A 3C7CB 2EKPA 2RCYA 4EUFA 4YT8A 2HK8A 3T4XA 1JVBA 3EVNA 4MVJP 1PZGA 1PL8A 3HQ4O 3T4EA 3H5RA 3ZNNA 3DBRB 5DNAA 1P1FA 5THKA 2VTDA 2IZ1A 3RSHA 3RAJA 1WDLA 3ZNPA 2V6BA 3ZV4A 1ID1A 4ZGWA 4UUPA 2YQ5A 1C14A 1PQUA 3ZHZA 4D41A 3GPDG 4IQGA 4KWIA 2O3JA 2VYNA 5AOVA 4U6SA 4IMRA 4D79A 3RBZA 1O8CA 2EW8A 4ZHSA 4WE3A 1SB8A 3ZV5A 1B8VA 1BTOA 4RLSA 4IY1A 1BXGA 4PGFA 4ALMA 3G79A 1R4MA 1BGVA 1O0SA 1DC4A 1TB4A 5IN5A 3RBXA 4AJ1A 5KTKA 4FFOA 1F0YA 2DTXA 4R51A 1P31A 1BRMA 4AJ2A 1G6KA 2B4RO 2C5AA 4MVJF 3U9LA 1ISMA 2E48A 5I9MA 3LVFO 2HMWA 5L95A 5A5FA 3WGYA 4XB2A 2QHXA 4PLGA 5IFLA 3GF4A 4Q3CA 3TFOA 1P74A 4NU6A 4UVEA 2PY6A 4J91A 4BKUA 4WCFA 2EV9A 4BQPA 3HB4X 3BMOB 3RU7A 4ONEA 4E5MA 2P9EA 4LCEA 3AFMA 3PJEA 1WWKA 5AVOA 1ISIA 4OMUA 1ZVMA 4BB5A 1T2DA 4AJLA 1A71A 3EAGA 2VZ9A 5GZ1A 4B8WA 1DLJA 3L6DA 1I8TA 2Q2WA 4K9DA 3VKVA 4TVOA 1WP4A 4JP3A 2X9VA 3V2UA 2DBZA 4FJ1A 4UEOA 1U1IA 4BMSA 3SC4A 2HLPA 1XKQA 4TRJA 4GMGA 3SBOA 2HRBA 4CR7A 1HE5A 1SC6A 1YQDA 4WJZA 4XQCA 2YDXA 4WOKA 1JWBB 1YL7A 3B1KA 5TC4A 2A35A 2X0JA 4FS3A 4AFNA 1GUYA 1ZJZA 5F5LA 3VHRA 4AJPA 5DBGA 4CMIB 3GFBA 2Y1FA 3DOJA 3PLRA 1Y8RB 5GZ3A 4R1UA 3KTDA 3MTGA 4YJFA 5ILGA 1YO6A 4IDFA 4KTVE 1GZ3A 5G0UA 1Z6ZA 3RUDA 3GEMA 1PJQA 1VL8A 2RAFA 1VL0A 2JAHA 2Z5LA 2AE2A 1MA0A 4MVJH 2VCYA 1IZ0A 1YWGO 1ZSVA 3G0OA 4CLRA 1RJWA 3IIEA 4PLPA 4KUGA 4IPTA 4NBRA 5I7SA 4MIOA 1XWFA 4LVUA 3GFGA 1OMOA 4MIEA 3TRIA 5CG1A 1PU2A 2JCVA 3F1LA 2YDYA 4E31A 4N5LA 3I9OA 2FR8A 3QP9A 4YQZA 5LDHA 4W7IA 3WSVA 3DBLA 1TVEA 2DBQA 3S2GA 4NK4A 2QRLA 3I9KA 4JLWA 5AXAA 1T2AA 2Y1OA 3WQSB 4A26A 1F8FA 1E5LA 1VJ0A 2Q50A 3RC2A 2YHIB 1A9ZA 4CMAA 5G0WA 2Y68A 3BYZA 1BVRA 4R3NA 4D0RA 3KYCA 4FFPA 3GDOA 4GMFA 1SAYA 3JD2A 3KEOA 4Y67A 3W8FA 1BDBA 4B7XA 4CPDA 3F5QA 4NBUA 1R4MB 4FFRA 3A9WA 4FOOA 1A72A 3AU8A 1XYGA 1BMDA 3E8XA 1HE2A 4ZJUA 4CR6A 2AHRA 2JD1A 2PD6A 2Y1CA 2DPGA 3RD5A 1CQJA 1J5PA 2B0JA 2BRUA 3AWDA 2DU8A 4PIVA 4HV4A 4MVJI 4YRAA 2O4CA 4DQUA 3PI7A 4IDAA 4J7UA 1GV0A 2VZ0A 4FR5A 1NWCA 5ILOA 1FXSA 1PGNA 4CQLA 4DQVA 5JW6A 4WCFB 4M8SA 4YQYA 2PNFA 3I9JA 4NDNE 3I9NA 3JV7A 3H4VA 5BSFA 2DTEA 3KRTA 3RWBA 3WGTA 1DO8A 4BV9A 2NU8A 2HMUA 3A14A 1NQTA 3VZSA 4FW8A 5COBA 1JAXA 5CEJA 1YH3A 1M6WA 3KYDB 4MVJM 2VQ3A 5L53A 1HETA 2VT2A 4CM8B 5IN4A 2HSDA 4FFNA 4JXKA 5A02A 3JYOA 5LCXA 3MWDB 2GN8A 1LSSA 1IHYA 5B12A 4E2XA 4J7XA 3K96A 1P0CA 2JHGA 4UAGA 1YE3A 1SOVA 2B69A 3KZVA 1UP7A 3U4IA 2FHSA 2YW9A 3GNTA 4L74A 1NYTA 3IDSA 1P44A 3H9UA 3VDRA 1KEUA 5TT1A 4YJFB 1LLCA 3RU9A 4U0JA 3PP8A 5DDIP 4CLEA 1TT5A 1V3TA 2Y0DA 4J0FA 3GZ4A 4GI2A 8ADHA 1PJBA 2QG4A 2I99A 3GVCA 2DTDA 2OORA 4CLRB 1F12A 1MXFA 3CSDA 5TNXA 1IOLA 1R12A 1WMAA 2W8ZA 5A04A 4IZHA 3SVTA 2AXQA 1TI7A 2PZMA 3E6AA 1ENPA 1UR5A 3TZQA 1LJ8A 2Y05A 5THQA 3TNLA 1UXJA 4TKLA 4WK6A 1DJNA 3DBLB 4S3MA 4DLBA 1HDZA 1RYDA 2O3QA 2YZ7A 4OAQA 1N7GA 1NBOA 1YJ8A 4GX5A 2B4QA 2VNAA 3GNQA 3JQ9C 3UVEA 1QYVA 4CLXA 5CG2A 2ZYDA 3GR6A 3LC7O 3WYCA 2QYSA 3NV9A 3PHHA 3VPHA 4R9SA 2HJRA 4D43A 3AJRA 3O38A 3F9IA 4RQUA 5ENDA 3FWZA 4UEJA 3KYCB 3FSRA 3S2EA 1IYZA 3I23A 3ON5A 1ONOA 3K6JA 1ISGA 4P8RA 1HYHA 3C3XA 4WGGA 3E5RA 4ITUA 4INAA 4UEKA 2GN4A 3JQAA 2X8LA 1N8KA 2FOIA 3DAFA 5I9NA 2OL4A 5JXWA 3E9QA 5JDCA 5A4DA 5JS6A 4PN3A 4DLLA 3Q9UA 3JD0A 3IOYA 4LGVA 1ZXBA 4BHTA 4W4TA 1WXDA 3I6QA 4CQLB 4GH5A 3ZN2A 4DC0A 1DAPA 1Q0LA 4L4SA 3DFUA 1PL6A 1UJMA 1RM3A 4BVAA 4Q9NA 1UH5A 3WYBA 1T2EA 4GQAA 3AW9A 4N5MA 5COAA 2UYYA 1DRVA 2GZ3A 4U8GA 3QQPA 2VHYA 4ILKA 4XYGA 4CMEC 1KEPA 3VZQA 1RM5A 3GDFA 3ZU2A 5L51A 1HLDA 4EUHA 3C7DB 1HEUA 3ZWXA 3QY9A 4QO7A 3OH8A 4KOAA 3GLQA 1UXHA 1DLIA 2C82A 2LDBA 3PIIA 4RVDA 4XYBA 4MKXA 1Y9AA 3DZBA 3EC7A 1QSGA 5B1YA 4URFA 3QSGA 4TWRA 5EQDA 2X0RA 3I3OA 3L4BA 4Z0PA 3ENKA 3BMCA 5JPIA 3BMQB 1BSVA 3ADPA 4CM9D 1H5QA 1FDSA 1E6UA 3AM3A 3UW3A 3UOGA 1CWUA 3TFQA 2WYWA 4TRRA 4BOYA 5CPBA 2JHFA 4NIMA 1QG6A 2FSVA 5J23A 1B15A 5JC1A 4CMGA 5A9TA 4DLAA 2OZPA 3HDYA 2P5UA 4CM4B 2P9CA 1LU9A 4EJ6A 4RV9A 4DBZA 3BMNA 1C1DA 1SPXA 2Q4EA 1MGOA 4YJHA 3ZWCA 1CERA 1XEAA 2XPCA 4B4OA 3EW7A 5G4KB 4KMSA 4CM3A 4CQMD 1CQIA 1E1MA 1ZW1A 3JQ7A 3PHLA 2GN6A 4OQZA 3HFGA 3FTPA 3ROKA 4CJXA 3RC7A 3UCFA 2EKQA 4YR9A 4A5OA 3GHYA 4PG6A 2CD9A 2FWMX 2A92A 1CJCA 1C0PA 1AE1A 1KVRA 1VI2A 4E12A 4BUCA 3WLEA 3ZGYA 3WX0A 1GCUA 1B3BA 3IKVA 3SX2A 2EERA 1PJLA 1EVYA 1KVTA 4ZICA 3M1AA 3JQAB 1D7OA 4WLEA 4YCAA 2NNLD 3D64A 4L76A 5CAEA 3KBOA 4OIMA 3TZ6A 4IXTA 4NK5A 3O8QA 2RBEA 5COQA 4FOSA 4UUOA 3WFJA 2HRZA 1XDWA 4RPLA 2BD0A 2W2KB 2Y0EA 1IL0A 5JNLA 4BGVA 4E13A 3T7CA 5BNTA 4CLDA 3E5MA 5L4LA 1ONNA 1QV7A 2PFGA 4BGIA 1SZJG 3JTMA 4ZVVA 5ITWA 5GY7A 3HWRA 4WLOA 3HDHA 1ML3A 4FCCA 4LW8A 4RVFA 3COSA 5JAQA 1R0SA 3OETA 4DA9A 4OXNA 4QTZA 6ADHA 2DKNA 2CSUA 3AI2A 1KETA 3O03A 1QRRA 2QRKA 4W9NC 1V3UA 2HU2A 3R3JA 1BG6A 3ZWAA 1B16A 1MV8A 1T4DA 2IXAA 1LLUA 2VHWA 3U5TA 3PFWO 1EFKA 2E37A 3LZ6A 4CUZA 4IS2A 1J49A 4P4GA 1UXKA 3W6ZA 3PGJA 1DIAA 1MLDA 3NEPX 3BMCB 4PRLA 4BO9A 1PGQA 2UUPA 2C2XA 1N5DA 5IDYA 1P1IA 3S2FA 1PWXA 3CMCO 1YONA 3KXDA 1GCOA 1SNYA 1U28A 2WEKA 2UVDA 2BFPA 2X9GA 3NAQA 3UKOA 5B4TA 3GN2A 5L4SA 4HWKA 1DIHA 1GYRA 4LVCA 4OKNA 3CXRA 1HDRA 4BGEA 4U6QA 4YAJA 4EBFA 1Z82A 7MDHA 4L73A 1NVGA 4MO2A 1DIBA 4YT2A 3BMNB 1C1DB 4J3FA 3EYWA 1AHIA 4YJHB 2BGLA 4XQ9A 1PGPA 2FPIA 3A06A 1JKFA 4J2HA 4GLLA 1PX0A 2V7PA 3JQ7B 2BGKA 1IHXA 2P9GA 2R6JA 1NAHA 2GR9A 4ID9A 5HBRA 1U7HA 4PG7A 5KWEA 4BNHA 2Y1GA 1R0KA 3W6UA 1HXHA 1LSJA 3MJTA 3W1VA 1KEWA 2C0CA 2GLXA 1ISHA 4NJMB 2GASA 3LC2O 4YB8A 3MZ0A 3H8VA 4TMFA 4TROA 3SEFA 4JJIA 3Q2KA 1QLJA 5EJ2A 2WD7A 3LLVA 3NJ4A 4IMPA 3ABIA 3OIFA 1SO8A 2JJYA 3G3EA 3NX4A 3RFXA 1OI7A 1VSUA 4R1SA 2X5OA 3O26A 4YWJA 3BTOA 2AMFA 3RI3A 2D3TA 1VKNA 3ICPA 2OGUA 4AICA 5T67A 2OHXA 4ROSA 3CPSA 3H5NA 3OMLA 3BXXA 3VH2A 4MKZA 4O0LA 1YB1A 4XRGA 4YRBA 2YQ4A 3A4VA 4YPOA 3L9WA 3GDGA 4M87A 2AW5A 2VRCD 2ZB7A 5EN4A 3WQQA 4LSWA 4BNJA 3KVOA 2B5VA 2D2IA 2IXBA 4PVDA 4MP6A 1E1LA 4F45A 3EHEA 3ANLA 5T64A 4NBTA 2QZZA 1ZSNA 3FI9A 5DOZA 5BQFA 3ROPA 2WTBA 3HDQA 1LSUA 4R5HA 5KIAA 2V6FA 4RVGA 4ND5A 1PZFA 1YJQA 2DVMA 3ASUA 3KB6A 3A1NA 3E48A 2X58A 3G1TA 3ZV3A 2HMTA 1ZK4A 2HCTA 4IGFA 4E5KA 1EVIA 5CFZA 1WVGA 2ZB8A 4PZDA 4PG8A 5FI5A 3OJOA 2VTEA 3VTZA 2R00A 2IYPA 3GGPA 2Y93A 2W4QA 2X6TA 4KWHA 1HSZA 4QEDA 1S6YA 4XA8A 1VJ1A 5HRUA 1GEGA 1QORA 5ES3A 2ZTUA 4PRKA 4DGSA 1ENYA 4O59O 3V1TC 2HQ1A 1K6XA 1DIRA 2JCYA 4Y8VA 2O2YA 1QP8A 5JCJA 2HK7A 2FZWA 3GUYA 1U3WA 4NH4A 4RDIA 1P1KA 5C3MA 2DBRA 1LC3A 5FYDA 3JQGA 4UUNA 3WWZA 3BHJA 5IDXA 3OP4A 4PG4A 3UHAA 5EESA 2OO5A 4TRNA 3JQ9A 1N9GB 5ICSA 1UP6A 5KVCA 2GD1O 2ZYGA 2O3TA 4CMBA 4F6LA 3H5AA 1VE9A 1I3KA 2J3HA 3WB9A 4CM7A 3CMMA 3QVSA 5HA5A 5DCYA 4RVHA 4BO5A 1PR9A 1SMKA 1XA0A 2AE1A 5T8KC 2C2YA 2VYVA 1ULUA 3FTNA 3OECA 2QRJA 2I66A 3I4CA 3TZCA 3V8BA 4EITA 3GG2A 4MVJE 3JD3A 3VPFA 4K1LA 4UVIA 4DL9A 4ZRMA 4ALJA 3LU1A 4B4UA 3PLNA 1KC3A 4J4TA 1EE9A 1YB5A 1T25A 3H9GA 3ROMA 3ADOA 4JBGA 4WKGA 2BELA 3DZHA 1WAMA 2IZZA 3X2FA 5L45A 3U4CA 1L7DA 1JW9B 4J49A 4TQGA 3DZJA 3TJRA 3L07A 4ALLA 3CUKA 5H83A 5T57A 4BKOA 4JBIA 3R6DA 5GZ6A 3FHLA 2X86A 4JN6B 4MOWA 5G0TA 3KETA 2J6IA 3ONDA 2YV2A 4D3SA 3RASA 2HDHA 3I52A 4RORA 4GKVA 1QYCA 3DFZA 3WLFA 4GGPA 2GYYA 3ZU5A 4HFJA 3JQDA 1U7TA 1LRJA 3F46A 3JQBC 1ZZEA 5I8ZA 4TZKA 4J1QA 2V6MA 4GX1A 4Y6PA 4KTTE 4GSKA 3WMWA 1MX3A 4Q3NA 2CF6A 5L40A 3DO5A 3V2GA 4ZQBA 2C7GA 4B3IA 4L75A 1QKIA 3K5PA 2O2SA 4I9HA 4MJLA 1SOWA 1H93A 3GVIA 4BNZA 4RPKA 3N58A 1KY5A 1GQ2A 2PLAA 3PTZA 3D3WA 4JIGA 4R5MA 3MOIA 5CDYA 4I08A 1M67A 5TIIA 2EWMA 4AJKA 1H9AA 3E82A 3PXXA 1OFGA 2FPPA 4GLOA 3GRPA 3IQDB 1EK5A 1WW8A 3WNQA 2ZB3A 3W4IA 4NFYA 1QYDA 3INTA 4CMJA 2QYTA 1MXHA 3ROQA 4GAEA 3JQGB 1DB3A 1E3WA 1T2CA 2FN7A 3LQFA 2BH9A 3RIHA 1P0FA 3AOEC 4EDFA 4Q3EA 5DCUA 1C0IA 2PD4A 4NU5A 4BO7A 3C1OA 5IZ4A 3IP1A 3PYXA 4UREA 1I2ZA 3TOZA 4FPXA 3D5QA 4YTEA 1FDUA 1PEDA 3EZYA 5KVVA 2PGJA 3FF4A 4J90A 2QX7A 5CDGA 5MDHA 4FC7A 3QWHA 4E4YA 3WGQA 4F3YA 4DIFA 4IJWA 4LRSB 5DBIA 4R3WA 5L7YA 3GRKA 1YS4A 4RPGA 2AEFA 2AQKA 3NDIA 4M54A 3WWYA 1UXIA 1LNQA 4IIUA 1GADO 5TLSA 1YKFA 5EIOA 5FEUA 2CDAA 3OQ6A 5CP8A 2G82A 1N1GA 5A3VA 3ANNA 3C24A 1PS0A 3IUSA 1NASA 1UXGA 3PHGA 2HKIA 3JYQA 3HZZA 3JQ6A 4G65A 4BIIA 1PJSA 1LRKA 1XQ6A 1MP0A 4TZTA 2NVUA 1YOVA 1EFLA 1M2WA 2GDZA 1NX6A 3SLGA 3BTVA 3WMXA 3TL2A 5JDIC 1EUZA 3DC2A 1PJTA 3D1LA 2ZQZA 1NFRA 5A05A 4BMVA 3L9XA 3JQCA 1I10A 4XZ3A 3UUWA 2AEMA 1HSOA 3DAPA 1Y8QA 3NTRA 1Q0QA 4II3A 1BVUA 4CMCA 4ALIA 4W9NA 5EL0A 3HB5X 2Z1MA 4BNFA 2GZ2A 3FN4A 4WEQA 1E7YA 2Y67A 3UN1A 5HS4A 4L9RA 2B37A 4Y98A 1HLPA 2J8ZA 3OBBA 3QE3A 4MKRA 2VWPA 5TGDA 3HUDA 4M55A 4MVJA 1O94A 5IZCC 4PFJA 5DN9A 5FFFA 1HWYA 1Q1NA 3L6EA 3ZI0A 5I7EA 3E03A 5C7LO 4ZRNA 2NU7A 3QA9A 1BXGB 3U62A 3D3WB 2GGSA 3ASVA 3LDHA 1ULSA 4J4BA 4WLUA 4E5YA 4CV2A 1GYPA 4YT5A 3ZHBA 3ONFA 4Q39A 5JYDA 3RC1A 1ONPA 5TT0A 1FMCA 4BO0A 4E32A 3OFSA 1EUDA 1X7GA 3AM4A 1LRLA 3M2PA 1LTHR 1A5ZA 3NT5A 1E3WB 3K31A 3RJ5A 3VOSA 4FGSA 1DOHA 3L6OO 4MDHA 5F21A 3VZPA 4B3JA 3AY3A 1K2WA 1PJ2A 2ZB4A 1PL7A 3RUCA 1KYQA 5BNIA 1NR1A 3QVXA 1P1JA 2CDCA 1U9JA 1N7HA 4BQRA 1H0KA 2HK9A 4MINA 1EEHA 4HADA 1U2GA 2Q99A 1AXGA 1P77A 2AG5A 5JAZA 1A9YA 1R6DA 3BTSA 1NM5A 2D5CA 2X9NA 1LI4A 5G4LA 5BSGA 2EHDA 4U0KA 3KOUA 1GV1A 2EP5A 4P38A 2Q3EA 4IDBA 1KBZA 4RGBA 3PDUA 1L7EA 4EW6A 4XGKA 4H15A 4AJIA 1D1TA 4QQRA 1ZK3A 3M2TA 3D5TA 1PZEA 2POQX 2I3AA 3MJEA 1U2DA 1WPQA 6LDHA 1HRDA 1U4SA 4BS9A 1K0UA 4BO6A 4IS3A 4JCOA 4BNKA 1GQQA 3CEAA 4D0SA 1EDOA 1X15A 4NMHA 3AUUA 1AHHA 3GVXA 3PFFA 2NVUB 1GQYA 2VUSA 2DT5A 2NSDA 4J9UE 4RF5A 1TA4A 4N18A 2H1SA 4YAGA 1PS9A 3IP3A 2H6EA 5DZSA 4I8XA 1M76A 4DTIA 1Q2XA 3KSDO 3FRJA 4HX5A 1PQWA 4FQ8A 3F5SA 5HM8A 1ZK2A 1Y7TA 1LA2A 3WTBA 1U5AA 2VN8A 1Y8QB 3NUGA 3VH1A 3L4SO 3PGXA 1T1RA 4GVXA 9LDBA 4RVUA 3UGKA 1X7DA 4WPGA 4JROA 5BSHA 3EVTA 3JD1A 3KYBA 4FJ0A 4R69A 2FRDA 4FDAA 1FJHA 1YXMA 3GN1A 1RKXA 4XGNA 5EQFA 4BKPA 4RO0A 5IAAA 1LQUA 1VL6A 3Q3CA 1W73A 1DEHA 4Z9YA 3RUIA 1Q7GA 4DRYA 3DMTC 1LBEA 2PTGA 3AI3A 1C3VA 4WECA 2VNSA 2EF1A 3OJLA 2A4KA 3K92A 1GU7A 2X1HA 5F1OA 1Q7CA 1S7CA 4LISA 1Y6JA 2EW2A 5AQ1A 4D46A 4FN4A 1QLHA 1B8PA 1JAYA 3DDNA 4WUVA 4CM6A 3AI1A 1ZBQA 1IZ9A 1BXKA 1YB4A 4CM1A 4I1IA 2DBVO 4B3HA 4J4HA 1XSEA 3OIGA 1UZMA 2VHVA 2EJWA 4MP3A 1E7SA 1CIVA 2B4TO 3QIVA 3DZFA 3T7EA 4DC1A 4QUKA 2JFFA 2Q45A 4H7PA 4ALNA 4RVSA 3VPXA 3Q0EA 3I4FA 1E1KA 4LK3A 2HJSA 4DMLA 3PEFA 4ZQGA 2AG8A 1LDEA 1EBFA 1GY8A 2NVWA 2PV7A 1W6UA 4TRMA 3WSWA 1IUKA 2J5RA 3DAGA 1T2FA 3PQFA 5DT9A 3LYLA 4DIOA 4CV3A 5HTOA 1YGYA 2P5YA 3UH1A 1L1FA 1PGOA 3U0BA 1V9LA 1HDYA 3GGOA 1ENOA 3JQFA 1E7QA 4OO3A 3R3SA 4ZD6A 1TT7A 2I9PA 3WICA 3OIDA 2FZEA 4Z6KA 4OSPA 3ITDA 4GKBA 5B4VA 1H2BA 1I2BA 2BFAA 1E6EA 1XELA 2VWQA 4GWKA 4AJOA 1IY8A 2AA3A 5JC8A 1ZMTA 3OHSX 4PZCA 4XIJA 3WS7A 2F00A 4HXYA 3O9ZA 3ONEA 5F5NA 1GR0A 3BA1A 3KLMX 5BT9A 3IC5A 1TT5B 3PPIA 4KQWA 1Q7BA 2NM0A 4IJVA 2PR2A 1KERA 1HT0A 4FIZA 2RHCA 4ND4A 3GMSA 5L7WA 1JQBA 1SEVA 4F6CA 1HF3A 1QXSA 2FY8A 1AN9A 4IGEA 1XU7A 4YRDA 1BHSA 3GQVA 4C7JA 3AY7A 4EJ0A 4FJ2A 4A73A 3ANMA 1XIVA 3GT0A 1XHLA 2XXBA 2E4AA 1LEHA 1G0OA 5DP2A 4GVLA 1C0KA 2NQTA 3W8DA 3P7MA 4ND1A 4LMRA 3EGOA 3MTJA 1Z74A 3DWFA 1CRWG 1SBYA 2VYND 2C5EA 4L0QA 4XR9A 3DONA 1XU9A 4RL6A 4PCVA 2PA3A 2BGMA 3PJFA 2D1YA 3ZWMA 3D3EA 3CIFA 1ZXLA 3DZGA 1EDZA 5T5QA 4YJGA 4WCFC 3FNFA 2VWHA 5FI3A 4DREA 5CDUA 3F4LA 4HNHA 1ZUD1 1E77A 2GZ1A 2IE0A 2BFMA 4A27A 1LDYA 3AUSA 3ZW9A 3AOEA 3WQRA 1X13A 2PK3A 1XLTA 1NPTO 5FWNA 1U8XX 1VJTA 1VPDA 3KUXA 1UDCA 2YHUA 3BZUA 3OEWA 3QV1A 5MGBA 3MJVA 3NYWA 1VLLA 4X54A 1VRWA 4GX2A 3VVBA 4AJ4A 1KVUA 4Q3BA 3F1KA 5G2OA 1YDWA 4DYDA 4ND2A 4F46A 3FNGA 1ZMOA 1CF2O 3RUFA 3NRCA 4J1TA 3UCEA 3F47A 5G0VA 4RJTA 2VOEA 5TQVA 3TDKA 3IJPA 3SXPA 2I67A 3C8MA 4OKIA 1DHTA 3UXYA 3HSKA 4LN1A 1DIGA 1X1TA 2CVZA 3AY6A 3ULKA 4MIYA 5CDTA 1NP3A 5JSFA 4UVHA 4UVDA 4DIBA 2PZLA 5HWSA 4O1MA 4CR8A 1IPFA 1D8AA 2EKLA 2ZTMA 5L3ZA 2ZATA 1A7KA 5ADHA 1P9LA 4IINA 3RUHA 4DBVO 3G17A 1V3VA 1UDAA 3OJFA 2YFHA 4RLHA 4XX0A 1DHRA 2FPGA 1DFHA 1B0AA 4CLOA 1GDHA 1Y1PA 3I6IA 4YACA 1XCBA 4IQ0A 3V1YA 4A0SA 5K6AC 3QW2A 4BO2A 2CZCA 1H94A 2Q1TA 4B7UA 2D5AA 2PZKA 3ZH2A 1MFZA 3EK2A 2X4GA 4OM8A 3NDRA 1Y9EA 1F14A 5JCXA 2WYVA 1PR3A 3KM0A 4P22A 3KO8A 1OBFO 3LT1A 4PLWA 1KVSA 1EZ4A 1XG5A 3AOGA 4IM7A 4E3ZA 1ZK0A 1X0VA 1HYGA 1RM0A 2NTNA 3EMKA 3L0DA 2J5KA 3P19A 1JKIA 1T26A 2FP4A 3DZKA 1T1SA 4XQEA 4CODB 4DWVA 2ZYAA 4PLHA 5IZCA 1HDCA 3QLJA 1ZKMA 2RHRA 2W2LA 1ENZA 1CYDA
chains in the Genus database with same CATH superfamily
4F92B 3I5UA 2GCPA 4PC1A 2YMLA 1P18A 3D8RA 5IDVA 1SOUA 5KU1A 1C80A 2ZTSA 4GI1A 4QJBA 3MFQA 4BNUA 3WTCA 2AXPA 2QLJA 3C87A 1OFHA 1T0BA 4AMBA 4ENUA 2FF7A 3TF5A 3HFSA 3N7UA 3UANA 3V5NA 3VYSB 1ZVVA 2CFOA 5JAIA 3HLKA 2WJWA 1Q7RA 2V5UA 2NV0A 2PMKA 2H17A 5JAPA 3GLGB 5JY1A 3O8QB 2RAPA 2VT6A 3SHVA 5H81A 3CWQA 3VKGA 3Q7PA 2ZYSA 1OXKB 1MX1A 2PKQP 3OLZA 4Q3AA 4UTPA 2QAGC 1U3FA 2I6GA 1NNI1 4KXVA 4WJKB 3K0HA 5KWJA 4GIBA 3MFYA 4QPZA 1Z7BA 1RHQA 2GBGA 2J0UB 3NNDA 3V1KA 3PRJA 2IUEA 4PFQA 2F43A 4O5OA 1DELA 1DI0A 3R74A 4G63A 1E5TA 4X5OA 2IU6A 1DZ3A 3RK0A 1GDTA 4D42A 3BEOA 2IYZA 3ZTTA 1A88A 2HA0A 1YMUA 1ND5A 4YRCA 4G5OA 4ER7A 3QX8A 1QBGA 4F0JA 1E1QD 2I55A 1IHDA 3ND6A 1F3OA 4FEAA 5LC1A 3S27A 1RPAA 2YQZA 4DUYB 1W76A 5TF4A 4DAOA 5EQJB 4DB2A 3SJAA 2Q3FA 3JWPA 2B4AA 2OGTA 1K5HA 2X2PA 5FTJA 3ETDA 3NGLA 5JE8A 1YC5A 4CI0B 1YFKA 5BOVA 4ER3A 1DAGA 1NSTA 3MCWA 4XVRA 3ZWYA 1CY7A 4U9UA 5DYNA 5ER9A 2RGGA 1DWUA 2TMKA 2OWEA 1B2LA 3ND8A 1TM4E 2I78A 4N0MA 4Z8YA 1KI3A 2FSSA 3O4RA 1BJTA 2HDOA 4R68A 3LF2A 3U60B 3D3KA 1UAAA 1WHTA 4HAYA 3S70A 5LQJA 2GRAA 2YWBA 1QG0A 2QS9A 2HEGA 2IP4A 3ODGA 1TIBA 1SXJA 4YBRA 5TSDA 1UMDA 4BWYA 3KKZA 5KDLA 2W2VA 2BDEA 4I4TF 4MLPA 3WV5A 1K63A 3EH1A 3LP5A 1CETA 2BR3A 1ZOLA 2COEA 2GFIA 3AMVA 5HS6A 5I7AA 1HYEA 2O2XA 2P9TA 2V3WA 4KVGA 3MOSA 3VNRA 4MEJA 1RXIA 1LLDA 2OESA 2W00A 4PBSA 4F1WA 3MCTA 3GAFA 1CR4A 1R2QA 3JYHA 4O4IB 5JSZA 5KVSA 1ULAA 3ZQJA 2F1KA 4NLLA 4W5RA 2FUKA 3OTOB 4RKFA 1DAMA 2JRLA 4Q4JA 4CCSA 1BMFA 1FLNA 3FDXA 3FAZA 5AKGA 4U2BA 2DHCA 2QJFA 3E18A 2OOSA 3LGXA 2Q5CA 4JUDX 3RC9A 4FGZA 1P61B 6Q21A 5K4HA 4M7PA 3GNSA 3OQNA 4G0WA 3B2NA 4J1NA 4MLZA 4OH1A 3INYA 5EUQB 1U0LA 3EIHA 3L7YA 4G4IA 4RY9A 3ZIDA 1ICIA 4D9GA 1ZX1A 4EI2A 4HZIA 1FDOA 2RGRA 2ZSJA 4Q47A 4G5QA 3CUEF 2OP1A 5JWOA 3LDGA 1F51E 3I04M 4MXDA 4AXBA 3AFGA 3EA5A 4GF5A 1G8KA 1N0UA 3H1BA 4TKUB 3AHCA 1EK1A 1S9DA 2IUTA 2QZ9A 3INGA 3JR7A 1F20A 4OK3A 4BKQA 4D8TA 3JQAD 4WXRA 1FSSA 3BMOA 4QIHA 1TUBB 1QOPB 1AB6A 3GB9A 2ZBFA 3QYFA 3RVSA 4CF6A 4ND8A 2JJQA 2L69A 3E9CA 1NTOA 1QCYA 1TCBA 2WWFA 4I50F 4KVZA 1Q1EA 4PRZA 2WD7B 4OLJA 4RQTA 3E7PA 3A2LA 3B2QA 2XR1A 1WLYA 3E22B 4M1OA 1YFJA 4AZ0A 1WXWA 3SC2A 1J70A 4N8EA 3NTOA 4OK6A 4J9VA 1BS2A 2OYRA 1BH2A 1SU4A 3C7AA 2HSWA 3NZEA 1OCEA 4XJTA 1O5IA 1R6TA 1IH8A 2OTCA 3ICCA 4FSDA 4HEJA 5DFAA 1EQUA 4J43A 3AKDA 1NUUA 3GPIA 1W1UA 1JSZA 1Y1LA 3AR6A 3OKCA 3QWAA 4IMJB 2PO7A 4CMEA 1Y48E 2HSEA 3CBGA 1JT9A 2PH3A 3PFCA 3IAHA 2F43B 2QU7A 4U4AA 3LQKA 5AKEA 1L7MA 5E1MA 1ST2A 2Z83A 3BWYA 4OSOA 4ZO4A 1RQXA 8MHTA 4N5IX 2DKFA 5EE1A 4AIRA 3R0ZA 3G9UA 4WGFA 2PGOA 2NADA 1OLSA 2IFTA 4QRDA 1M6HA 3TW4A 2Q6TA 2P7HA 4Z4EA 1CEQA 1M1NB 1PK7A 1V0JA 2CF5A 4QEKA 5F7JA 5IUKC 2JHCA 4ZYZA 1A4UA 4M1TA 4G1MB 1L4MA 4LEIA 3H9JA 1DJQA 2WTNA 1C8VB 2XYRA 4WN3A 5DPMA 4BB0A 4CM9A 3NT4A 3W06A 4UFNA 3SQDA 4BB6A 3KHSA 4UU1A 3OIUA 5JARA 3UFXA 1Y4UA 3BZBA 3DEFA 3GCXA 3ZDFA 4RTRA 2O0LA 3ZGZA 1XEFA 3QLVA 3QITA 2GPBA 5HCUA 1U2TA 5J5VA 3E1KA 1YMQA 3JZFA 1ISFA 5F98A 4C4ZA 3C1TA 4I8DA 1EQ2A 3TQQA 1N8SA 1EEXB 1WHTB 4WADA 3ZXXA 1X1EA 1NBWB 4EQ6A 4G0MA 4NNOA 3RTGA 2W37A 1I30A 5L7TA 3L49A 1SXJB 3G49A 4LI3X 1Q20A 1UMDB 2NUTA 3T3MB 3OQOA 3FBGA 1G66A 4FT2A 1E64A 3E70C 4GR9A 1F5NA 2G77B 4M0KA 3WIDA 2O1XA 3MQ4A 3TZKA 4IUYA 4URYR 4Q7EA 1GCIA 1NUSA 2J3EA 4IFTA 2YVQA 3P5SA 4LZNA 5I7VA 3LVBA 4KFRA 4NF2A 1N2GA 2XODA 3FHOA 3ETJA 1SGWA 1YHYA 3FPFA 3H5IA 5DCLA 4POOA 4ZT2A 5JSZB 2VZ8A 3K0FA 1Q0HA 4RF4A 2GA8A 2ZB2A 4YV2A 1I6MA 4D5GA 5DBEX 1KARA 3H3FA 5D7BA 4NZOA 2F4VB 2VP5A 4IIVA 2WPNA 5B6PA 4OY3A 5DHRA 2R65A 2Q6IA 4CTOA 1G8HA 2CYBA 2IYOA 4EPVA 3KCNA 4FKZA 2FN8A 2VPIA 3NOVA 4E0BA 2NO9A 4O0MA 2P5TB 5KYXB 1J0EA 3UAGA 4FD2A 4TGLA 4OQFA 2X0IA 3CRMA 1XAJA 2E6KA 3O94A 4Q9AA 2V7QD 4XE5A 3LOQA 3NM6B 2A9OA 2JB9A 3R6TA 2P4SA 1IK6A 1R4NA 4AKSA 1C7RA 4U2EA 1K97A 3P9NA 5UKDA 4K6CA 4UHCA 4Z54A 1KO7A 1WMSA 1D07A 4M0EA 2XT0A 1GNRA 3PXBA 1W29A 1RXCA 5A1JA 1D09A 1WMFA 4LCBA 4ND8B 3K9QO 3O4FA 4PCLA 3EAQA 4X1KA 3MIIA 4UM5A 1Z8NA 2IHBA 4LX0A 4WXEA 4Y2GA 5CIWA 3I5XA 5FOVA 4B9EA 1MJNA 1N57A 2FRVA 5EYPA 1IXRC 1FTNA 1JG6A 3QHPA 3CZPA 4LHEA 4AZ0B 3HRIA 3L8EA 1AK2A 1R8QA 1VG8A 1VHTA 3D8BA 4WFQA 1CP2A 2WHQA 3KOYA 4ZCSA 3LQYA 2W71A 3NXKA 3OPXA 3P5BA 3PA6A 1VBKA 4WOJA 4D0LB 4BMNA 2OV2A 3WLEA 2XYVA 1EFRA 1KXZA 3GQBA 5BW6B 1HFJA 1QX4A 2ATXA 2C8KA 3H9EO 4LUCA 1R0YA 1Z36A 3BIXA 5D6OA 3HU5A 2PWBA 1E5DA 5JWHA 5U1PA 3WO1A 5C7IO 3WK6A 1EAYA 1L6IA 3G7SA 3QNMA 3ROXA 4KRFA 1QIKA 2YV3A 2C99A 1PJ3A 3VH3A 1HT2E 4DMGA 3EFEA 1YL6A 2FH5B 3HABA 2YHAA 4NMLA 1FU7A 5JXIA 3L6CA 4WY2A 1QUFA 3RUEA 1OLSB 3A0UA 2GM9A 3FKSA 1RCTE 2XGMA 2Q4OA 3K9LA 4E2YA 2ZCJA 4EPYA 2HQSA 1P4HA 4L27A 2H18A 2JGIA 3C43A 4HLUC 1MUUA 1AKWA 3CZRA 2C07A 2C0QA 3GCWA 4JSRA 4LY3A 2XT9A 2GJAA 3FVWA 2B9VA 4PZ9A 4BCDA 4MKFA 4D3FA 1AOXA 1AQJA 1JHUA 1XI2A 2ANCA 4LNHA 4IGAA 1BU5A 3LVQE 1GL9B 1WULS 4R8VA 1J7JA 2FXVA 2LR0A 2CCJA 2WQZA 4JX8A 3VVLA 1G21A 4LDRA 4QT4A 5IULC 1VDZA 4KV7A 1PJ8A 2ZSAA 5DXFA 3CWZA 3ICEA 2DM6A 1IHOA 3ZG6A 5SYAA 4HWRA 3STYA 3EVGA 1E2FA 3RRYA 3OF3A 3ZCVA 1QIFA 4EQ6B 1FW6A 4AY6A 1ZCFA 2CE2X 1YFZA 2TMGA 2WIBA 3LI2A 4EZIA 2NUTB 3CSUA 2Z6VA 1L5LA 3W6OA 3BH0A 2Z1NA 2JZNA 2CHGA 3DOEA 1ZK1A 1Y8CA 4XIYA 4YONB 3DL4A 2XCIA 3OE4A 1V9CA 3ZEIA 4DLXA 2B4KA 4C89A 1Q21A 1D1QA 2DFNA 1SQFA 2XVMA 2P0EA 3C45A 4L7VA 2WP8J 1WQ1R 2J3KA 1BYUA 3W78A 4DEVA 1E3IA 1QR6A 1RACA 2WJPA 3PGLA 4X44A 4E5NA 2YIVX 2EAUA 4E33A 1ZVQA 5SZIA 4HUJA 4ARVA 3PKIA 2C2GA 2JKYA 4JWKA 2RH8A 2MSCB 5AIAA 3RARA 3IA2A 1IQUA 5CK5A 4RD0A 2G08A 1N8NA 2CLFB 1NE2A 3OX3A 5PNTA 3TXXA 1NVBA 1GL3A 1I4OA 2RK4A 3A9VA 3B70A 4WHMA 3FF1A 5LB2A 5DRTA 3FCAA 3TRDA 1N5KA 4E30A 4HZUA 4F1KA 1KQFA 2FA9A 2WG0A 3V4FA 2GCGA 1P1CA 5F7XA 1XNRB 3EZ6A 4R1QA 5K0LA 5JMOA 3H1GA 4KVFA 1U63A 4JH0A 1TIPA 5C1BA 1AKVA 1W4ZA 1R4NB 1J9GA 3MILA 4P08A 4ZVKA 1VECA 3RVNA 3TSZA 2AOUA 4L4XA 4HFRA 1DX6A 1XZ8A 3IQHX 3B78A 4RTNA 2NSHA 3KKLA 1HG1A 2HA6A 1EUYA 4IUBS 1ORRA 1NBHA 1E61A 3PCTA 4GP6A 3IURA 2OBLA 3G9ZA 4C7KA 1MC5A 1Y89A 3NDJA 2R48A 2FPOA 1IJFA 4WI1A 5EYPB 2AQ8A 2OOKA 3AG5A 1QHEA 1Y5IA 4OUDB 1Z7EA 2B83A 2HCJB 4LGCA 5T4HA 1FNCA 2PX3A 3A05A 1F0PA 2OP0A 1XF9A 5DXAA 5B58T 2ESRA 5EJMA 4B74A 3L1IA 4IIEA 2UUOA 3ZNQA 3AIIA 4DM4A 4F11A 3VHXB 5LYYA 3EZGA 5LUAA 5BR1A 3BF8A 3WLAA 1W4AA 5KNLA 4DSTA 4MR9A 2G40A 3GCZA 3TKAA 1UZNA 1EHYA 3RVDA 1U8CB 1OLOA 1RWVA 2BW0A 2ZGVA 4BNYA 4PLFA 4RPJA 5K1ZA 2HZ7A 3G7UA 5C5EA 4O6VA 4QSMA 2XA1A 4B3XA 5C2JB 5I45A 1I1QB 2AOWA 2H5JA 3NW9A 2P40A 4UKDA 3EDMA 2R4TA 3SSMA 5BWLA 3KU4A 4Y1RA 1N34B 3W9SA 3DEHA 2WWIA 3EIQA 3DLHA 1P7YA 2UZIR 3VNUA 1HE3A 1X74A 4AURA 3K6KA 3VHLB 5TS3A 4CG2A 1KEKA 5ALHA 4YJ2A 1Y7LA 3UMMA 5JMWA 3SOZA 4RELA 5KYVA 3PRKE 1XHFA 3K8QA 4FX2A 5ISMA 2HT1A 1G21B 4G24A 4NZ9A 4OFWA 2NYAA 4KYTA 4NOKA 4OP1A 4A03A 2I4RA 1Z28A 4C88A 1QTIA 3A9RA 1I0ZA 1PQ4A 2NU7B 3H2SA 4P58A 4E15A 5K0SA 3W6NA 4L5BA 5K6RA 4CGZA 1K2VN 4DLUA 4YJKA 2O0JA 3GELA 1UKCA 3Q0TA 1RYMA 4O4HA 4YMGA 3VNBA 1HZZA 4KKXB 2IDMA 2XXJA 3S7ZA 1OXMA 4QELA 3U4DA 5A06A 1ORWA 3UQYS 5KJ6A 1OR8A 1P2SA 4FZRA 1KDYA 3IQWA 1O4WA 3HR4A 4R84A 4PNZA 3TDMA 2X2FA 2YOFA 4QXRA 3A6KA 3O91A 4RIFA 4U7JA 4WLVA 2KJQA 2WRZA 4MQEA 4P4LA 2OBBA 3T9FA 5A03A 5FX2A 4I9UA 2NUAA 4EARA 3G9XA 3O2SB 5DKFA 3V2HA 5DOVA 1DPGA 5JCZA 1N0VC 1VSTA 1XB2A 3PV0A 1E6MA 4RMNA 4E1AA 5C81A 3HUEA 1V35A 4PAQA 1NYQA 1QFXA 5JNTA 5JXHA 5F2KA 4TTJA 3PR2B 2JDID 1Y63A 2N42A 2WMDA 3H75A 3K73O 2F3RA 4FGWA 4GKKB 4NEHB 1JYSA 1K89A 2DHRA 5BSUA 5T8KA 5E6RA 4BO3A 4GE3A 1TC1A 1N92A 2ZJ1A 1P2FA 1UJBA 1K7SN 1RW4A 2XKAA 4W9RA 4DGQA 5AESA 2JLAA 5B37A 4GBED 4QUEA 1F6DA 1PJ4A 5MF6A 3KQYA 3ETEA 4KJZA 1XZMA 4OXQA 4R98A 4EJSA 5M04A 4QOHA 2JGDB 1U3TA 2EIHA 3K5WA 5HKKA 1DC6A 1E2DA 3I2IA 5L9AA 2AMJA 1BHQ1 3FNQA 3PHIA 3OEYA 2H0AA 2XLCA 4UBIA 4ESOA 4PG5A 1R0BA 4MR7B 5KO2A 3IULA 1GPWB 3D1JA 5EIWA 3CUSA 2P90A 4URVR 3TLGA 2RJ3A 1CUUA 2LKCA 3ITKA 1BCRA 4ENPA 1W49A 2O14A 1I2DA 2RHMA 3G1WA 1Z7GA 3PZBA 1X3SA 2D4HA 2HPVA 3HXTA 4YRMA 4FNGA 1AKEA 2I2FA 3DTYA 3OA0A 1KAOA 4UHHA 3RFVA 4HFMA 2R0QC 4F2GA 5KNDH 4MR9B 4ZQFA 5HOEA 4I5DA 4DEYA 3TECE 3U09A 1JKMA 3MCZA 1D5WA 3F73A 2BGGA 1GKLA 2ICAA 3GJ8A 4OQXA 4DLYA 4YMTA 1JDUA 1BWSA 4ZVMA 5TJHA 2AFIA 2HADA 5TQJA 3PFIA 5KJ1A 2O20A 5B64A 2D1FA 1Y6ZA 4PAWA 2XF2A 4OP2A 3QNUA 3NAGA 4OHKA 1H2YA 5ED4A 4TYQA 4HDQB 1NDQA 4ES6A 4UU7A 3QWBA 4O8CA 3KCQA 1EDBA 4YJ2B 3KP1A 4B80A 4D74A 1FQOA 1ZEMA 3MYYA 1CNEA 4XI9A 2IHUA 3NAMA 1A5AB 5GM2A 1ZH8A 1N25A 4OHMA 3ZWPA 2P9HA 3EXHC 4QHYA 2J0VA 3CW2A 1OTYA 1XJQA 2PGDA 3NQ41 3DOUA 4RQBA 4XFKA 3KB1A 4BNGA 4JB8A 2WAXA 5CNMA 1V5IA 3GOHA 1NY6A 1CRLA 3C85A 4NP6A 2RH4A 1NT2A 3DAOA 3ESZA 3PTLA 1LZKA 5AJWA 3NVKI 4Z99A 1KEVA 2Q8QA 2X3FA 1N2BA 3RTCA 5ALSA 5F2EA 3IT1A 3RJTA 1UEIA 1WZUA 4OL0A 3D0KA 4YEDA 4C4AA 3CRNA 5TRTA 4H7JA 3EFHA 4LYJA 4MQEB 4O4IF 5JNUA 1TEZA 2RC5A 3S55A 3FMFA 3M6VA 4KOEC 4OH7A 1D4AA 4XVQA 2MDTA 2BKAA 1DC7A 2BI4A 2HRRA 5I9LA 2W11A 3AF1A 4JGBA 5CDHA 3CHYA 4UFOA 1XKTA 5EFZA 3U3XA 4EPWA 1QK3A 2XMPA 2M6SA 2CLEB 4C0WA 1TCUA 1M5TA 1G63A 4MRSA 1NT4A 5E6RB 3R23A 3Q8KA 2NACA 4YAIA 3N6XA 1DEOA 2VDOB 2Y3IA 4LMPA 5J43A 3C98A 1Z2OX 4NU8X 1WUKS 3DXFA 4FFSA 1E66A 3LSYA 1W8DA 3L5KA 4ZWNA 3VKUA 1L8XA 3WGNA 4EJSB 1E2PA 1VB5A 3IR5A 2ZVPX 3AUTA 3D6AA 4JNKA 1POXA 1X7YA 3FLEA 4W6ZA 4RK7A 2PKRA 5FNVA 2JATA 3B5JA 5LN1A 1GTMA 1PN3A 3E15A 1FX0B 4IVNA 5FTWA 1T9HA 2ZZNA 4P5EA 5JEDA 4I6JA 3A70A 4DMUB 1OC4A 2FMUA 1XTBA 4JBHA 2GF2A 1NBMA 1PDOA 2I1LA 2WLSA 2XB4A 3N39C 4MYSA 4LYAA 4D9MA 1RJ9A 4F5YA 5KKNB 3I1JA 3D4OA 3EN0A 3R44A 5DBHX 3TH5A 3H2HA 3T9EA 4PAGA 1UOOA 4JJKA 1BCRB 5CCXA 3LKBA 1E92A 4NU0A 4JYBA 4BJ5A 1GA4A 1RAIA 2LDXA 3TWOA 1ESDA 1K7FB 3IUMA 5DLQC 2PUDA 3RRNA 2V6JA 5LM3A 3KSZO 4MULA 4DCUA 4DG9A 2R47A 2E2WA 5HFJA 3CW8X 1V25A 1WVIA 5FV4A 1VCNA 3P27A 4GYYA 1CUWA 3I8SA 4DPMA 5TX7A 5ITVA 3D6TB 3HP1A 2GYVA 4RF2A 3DBHA 3IIIA 3OLXA 4PLVA 4QBKA 1LBTA 1Z68A 3B82A 3DEKA 1EVJA 2FK8A 2ZCVA 2WF7A 4YP0A 1D9ZA 3VGPA 4LDQA 2AFIB 4D9HA 3SD7A 4B87A 4Y9TA 5A4KA 2ODWA 5L6MB 3C5HA 4Z4CA 4TN5A 1W4RA 1HQCA 5D3MA 4HLUA 5KWIA 4RE5A 1R18A 3GEGA 4EGFA 3L82B 1M0TA 5CPFA 2I4LA 3D4PA 5E8JA 3IB6A 3VVCA 3WGZA 1NXQA 1E3DA 4R8LA 2EXXA 2W70A 1TYBE 3HGQA 1J0AA 2RFLA 5ALQA 3DB2A 1SVNA 2DQ4A 2P1DA 2RDMA 4L5JA 3WQBA 4GDMA 2WNIA 3EG9A 1WVMA 3NHRA 2B2NA 2FEAA 3Q0IA 4ZRDA 4WKNA 3WAJA 1HTBA 4W7HA 4TPKA 3H6KA 1PG5A 4DPKA 5JVDA 4R9VA 2JAPA 1P1RA 4AB1A 2GBLC 4W5TA 2O8DA 3T7TA 9LDTA 3FLAA 2PUTA 4CKYA 3FIUA 1V6AA 2ERCA 3KTAA 5TVKA 5A9RA 4P1ZA 5CNJA 3TN7A 3UY4A 1DRUA 1HE4A 1UBGA 2KPOA 2IOFA 3WFIA 3NV7A 4AUMA 4E2ZA 1ZUIA 1TA9A 1AURA 5DNWA 3W6PA 4V1CA 1CPYA 3W2TA 5KCZA 4Z9BA 3JAMA 2PL9A 3EEFA 4JP8A 2W2OA 1GQFA 1Q15A 4G2NA 1G5QA 4EYKA 3QSYA 3E53A 2C2WA 3QBTA 2EP7A 3KR2A 4LJKA 4N65A 4U5QA 2QP3A 1Z13A 2C20A 2HN9A 1E2MA 3L7NA 1UDRA 1RC1A 4BWGA 1KSFX 2DQZA 3QTBA 5JXJA 4PPGA 1DUVG 1E1RA 3QELB 1CFZA 1N1EA 3C3YA 4Y9UA 3DKIA 1YDMA 3WZMA 1QKKA 1MU0A 1TLTA 1BFUA 2JLZA 3S2ZA 1WDMA 3CZMA 1VIDA 1UWVA 1ZMBA 2BMWA 4ZO6A 4IZ6A 5HMLA 2WSYB 4BNLA 5LWHA 2WYIA 2XMSA 4EKNB 1GM5A 4D4IA 2WT8A 3QYPA 4KXYA 5K4AA 4YCLA 2BLLA 4QBIA 2I6TA 3P2JA 5ALLA 4F8EA 3OD5A 3RUAA 1UPUA 1X7YB 3FH0A 1OA0A 5FNVB 2Q21A 1N0IA 1G8AA 3RKRA 5THXA 2AYXA 3FCOA 4A10A 1R1DA 3AO0B 3JALB 1NOKA 2PWPA 1G0NA 2YV1A 3OCUA 1OIWA 1C0EA 2O3SA 4CFYA 4EFKA 2CNOA 1AGRA 2X15A 2W90A 4KU4A 5CNIA 3EGIA 2GO7A 2G5TA 1QO0A 3QKIA 1RJ9B 3V42A 4U39A 1LLFA 4PYIA 1WLSA 1LX7A 1BE0A 2JJ1A 3K09C 2R4UA 3EZFA 2YXPX 4MZXA 3TFWA 3VUFA 4BGUA 2IVFA 4WUTA 3B36A 3ORRA 3HKBA 2LIVA 4EHFA 5BVHA 3FD8A 4HH0A 3VPSA 3GDHA 2NYRA 5C46F 3LA8A 1ZGZA 1OBOA 1Z5UA 4HNRA 3S81A 1MVLA 1GZ4A 1NQOA 3W8EA 2NO4A 3GRYA 4B4DA 1RNLA 4ZVNA 3DBHB 4YRRA 4CIXA 1I33A 2GEDA 2Y77A 2OAGA 1RQGA 1JMYA 2EJCA 1E79A 2IEYA 3DL2A 1GTZA 3KQQA 4U00A 3STHA 4EA6A 4EHLA 4RSGA 4ROTA 4PZUA 4PO8A 4UZEA 3LQ1A 5KVQA 3DOFA 1KSHA 4NPCA 4XWOA 3RIEA 2XUPA 3ET5A 2EC5A 2J3JA 3WYNA 1JDBC 3UV6A 1W46A 2O0MA 3BREA 3SHQA 5KNBA 3MNFA 1WJGA 3Q3GE 2XKBA 4IDNA 1YMVA 3ANTA 4QBHA 1RRVA 4MPDA 1L3BA 2OAQ1 1CDOA 4EAAA 4JI0B 2G63A 1RABA 2HXGA 3PGVA 1FX1A 2E3JA 4QOFA 5LNK1 4TMKA 3WFZA 2AI1A 3BBLA 4A6EA 4KGVA 4ZEWA 2FW6A 3JQEA 5JVDB 2VJNA 1C41A 3DEZA 4LI0A 4DJEC 1LY1A 1OZGA 2Y2UA 1VL2A 4JJFA 3G8YA 3C5CA 4XR4A 1NG1A 1NLFA 5H82A 2B8NA 3KZMA 4I46A 4UJ3A 3BWDD 1Z4JA 2F3PA 3KTAB 5G1PA 5I7FA 1MABA 1ZEJA 3BD6A 3FHTA 1IB6A 1WXEA 1ZD3A 3BSWA 4V1CB 3AVUA 1YFLA 3EUEA 1K88A 4JJ7A 4WKCA 2BFDA 2R751 3DQPA 4M0DA 4EAQA 1HRKA 4S0ZA 1YR3A 2H9IA 1CY6A 2F8MA 1LD3A 4YAFA 5IAGA 4ZJZA 4ZPJA 3S1SA 4MUKA 2ZANA 1L8AA 1EG2A 4MVYA 5FPTA 3RVRA 3WOHA 3X43A 4UTVA 3RW9A 1N6OA 1TK3A 2GCIA 4N7JA 3VO9A 1IUOA 1RYEA 3Q9LA 2YL2A 4KXMA 3JWEA 5KQSA 1F1BA 1L8QA 1WX1A 4HI0E 1PVDA 1PW5A 2FSFA 2WKWA 3IP8A 4LXQA 2V1UA 3MLAA 4BE4A 1SKMA 2FPLA 1PBTA 3W77A 3G2HA 3CTMA 3QPDA 2IUYA 4OEHA 1U65A 3I01M 3K4QA 6PFKA 4RTPA 1VKZA 3G85A 1KMIY 2OK8A 3PWSA 2JKVA 5C7OO 1M66A 1YRLA 2XZLA 1DCFA 2ZWAA 3OI7A 1JR6A 1ODTC 1C4OA 4GL4A 2XWPA 1K5GA 3C16C 4G81A 4QAJA 4QXPA 5G1NA 3MAGA 3FUUA 2EKPA 2RCYA 1FMTA 3U39A 1ONSA 1EJBA 3ZWBA 5C1PA 2NZ2A 1OPXA 1PZGA 3MJHA 1QDLB 1XMOB 4MPTA 1PFKA 1SKYB 2Z2YA 4YROA 1Q95A 4M0FA 5E9WA 1M6NA 3QJGA 5DIZA 4C2BA 2PZEA 2O7VA 1WDLA 2XVAA 4TLBA 3W04A 1YE8A 4LC9A 4Q1CA 4UUPA 1QRUA 1MEOA 3IH5A 3L8GA 4Z8XA 4D41A 4P34A 4ZOLB 3P2MA 3RT9A 3KE9A 4ZCRA 3AGPA 5LL6P 1VBNA 3P0RA 4DIKA 1EG7A 3VJRA 5I9TA 5B3JC 3O2QB 2B7BA 1B8VA 2WWXA 4PGFA 4ALMA 2OECA 4YQEA 4Y1EA 2FSGA 4X85A 3O95A 1TB4A 4HQFA 4G2TA 4QDZA 5IN5A 1KZ7B 4PFSA 4CKBA 2BSQA 3ESXA 3LQ4A 4AJ1A 4FFOA 1F0YA 4QXOA 3SF8B 1P31A 5EWLA 3GT3A 4JT4A 1GAQA 1HI9A 4AY4A 2IYQA 3EXHA 3X1MA 4CIBA 1ISMA 2E89A 4FOLA 3BDAA 4G89A 2HNAA 4ICIA 4QUGA 4YMIA 2HMWA 3JW8A 1DAHA 5E1OA 4BVHA 2GPNA 3C3MA 3GEIA 4KO2S 4XB2A 2QHXA 5JD5A 1RVV1 2O8VA 3HYCA 3TFOA 4DG8A 3U3ZA 4G0NA 5B3KA 5CB4A 3VYRB 4EM6A 3DDSA 4IFEA 1KGDA 1TECE 2GVZC 3RU7A 3S6JA 2P9EA 3RANA 3AFMA 3SI7A 1SURA 2WFZA 3PJEA 5AOCA 1GUAA 4EMTA 4OMUA 1DV1A 1ZVMA 3N3BC 5B7PA 4BB5A 4ZVTA 3MJDA 3HYRA 2F1RA 1B0ZA 4B8WA 3HO1A 2A2ZA 2C04A 5FH9A 3OT4A 2Q2WA 2RGXA 3ZD6A 4L57A 3T5PA 2DBZA 4BMSA 3OTIA 2PMBA 1QIDA 4X0EA 4C87A 1XKQA 2V59A 4BQNA 3BSYA 2XGJA 3MHTA 4UMEA 2HRBA 4Q9DA 5I3CA 4B6EA 2D2EA 1XDUA 1TJNA 3WLMA 2YDXA 5H68A 2W6QA 5FPQA 2VHTA 3TSAA 3SDZA 4NZYA 2PSFA 3TW6A 1TCVA 4QXAA 3FKJA 1FUYB 5F5LA 3VHRA 5DBGA 2G4CA 2ASVA 2XRFA 3AHFA 3GFBA 3KR1A 1C1YA 3EGXB 3P20A 3SE7A 4FGLA 5GZ3A 3E1GA 3GAAA 2F8SA 3MTGA 3K32A 1PV2A 3A9UA 4YJFA 2HL6A 1YO6A 1WCV1 4R7GA 4I3GA 2JA2A 3HYTA 3KQSA 4JMPA 2C4NA 4HDRA 3VDNB 4MPJA 5KC8A 2X2OA 4N4AA 1MT3A 4KPFC 1F2UA 1ZMXA 4MVJH 5J5CA 1IZ0A 2YKGA 1YWGO 1Q7EA 2P41A 1V7PC 4JFAA 1EGVB 2ZAMA 4JLBA 3RV4A 2GD6A 3O7WA 4C4RA 4PLPA 3VC1A 3HFRA 2AUNA 4KSYA 1Y7IA 3NRBA 5KOJB 1ZLXA 1J2YA 1OHHD 4HTAA 1RBZA 3QOWA 4JLDA 5HCIA 2BKLA 5CG1A 2JCVA 3LD9A 1NI4A 2YDYA 3B7WA 4UE2A 2MYNA 1CR1A 1YRHA 3NVDA 2WY2D 2NP6A 3AR3A 2P2NA 1SBZA 3AESA 3DBLA 3HNRA 3LOUA 1NZDA 2PIDA 1BC5A 1WB5A 2OHIA 3ISJA 5JJCA 1G291 2Y27A 4HB2A 2I91A 2YS6A 2OY0A 3LY5A 3TQCA 4FIDA 1A2BA 2QIPA 2YHIB 4HQ6A 4D92A 1DCMA 7YASA 1GA1A 3P9KA 4QUBA 3L0PA 3GDOA 2DY0A 3IQXA 3MT9A 4A8JC 4EPRA 2Q5HA 1GTL1 2WB4A 1QU3A 2QVBA 3KEOA 3VR2A 4B7XA 3A6GA 4NBUA 3OZFA 4X60A 4X3PA 1JZQA 4B71A 4XCQA 3D2CA 2VNKA 4FMDB 2WJVA 2IS1A 5IC4A 1HE2A 2I2WA 1ZQ1A 2I1QA 2AHRA 4B3BA 5EWLB 4JJ6A 1C8KA 4G1UC 4D0NA 3N28A 4LF4B 1J5PA 2O19A 3EXHB 4UAUA 2X0EA 2Z6UA 4EBBA 2BRUA 2GBCA 4X6UA 2DU8A 1L8OA 1XX6A 3M83A 3U19A 4XEUA 4XM2A 2BUBA 4IDAA 4D8XA 1V39A 3OE1A 4J7UA 3VR5H 4DQUA 5NULA 2GAOA 4GECA 1FXSA 4IOKA 4CQLA 2QTWB 3RVJA 4DQVA 5C8ZA 4YQYA 2QTVA 1ZOPA 3SHFA 3I9JA 5E2BA 2ZPUA 2PT9A 3PQ8A 2VYCA 2CBXA 2GZHA 5BSFA 2DTEA 4LJ9A 3UMFA 1JEYB 4US2R 4KDRA 5C8VA 4BV9A 3G89A 1UFRA 5DJ5A 3TLXA 3VZSA 4FW8A 5CEJA 4GEGA 1CNMA 3SSOA 1GP2A 1ZHOA 4ZOCA 4D9BA 4L28A 1W7AA 1HETA 2ZI6A 1GRQA 3KTFA 4G26A 4BQQA 1H4QA 1JDSA 4CM8B 2HSDA 1Z47A 3HB1A 4MW2A 2EIXA 2K5UA 3E3LA 2RG7A 3TIGA 3JYOA 3UGTA 4MKHA 5LCXA 4KQJA 4LE1A 1LPOA 1ODCA 3UWDA 2ZBGA 1ZD5A 5AVYA 3WQHA 4GS5A 1JJVA 3GNTA 4L74A 5J4YA 4DV6B 5C0OE 1BMQA 2I6QA 1FCJA 2GAIA 3GLTA 3IDSA 1E98A 3WE7A 4QU9A 5LNK6 1RZ3A 3A32A 1O95D 4JR2A 4YJFB 4MCJA 3RU9A 3Q98A 3UA4A 3ILVA 1E0JA 1IQPA 1OUMA 1BE6A 4B33A 1AQLA 1FSZA 4XUDA 5JFGA 4GI2A 1XEWY 3B2EA 3PR1A 1CHDA 2YWEA 2DTDA 3RBAA 3FDFA 3CSDA 1UEXC 2R87A 3BX1A 2WWVD 3FLBA 2BKUA 3MIZA 3MMZA 1QNLA 1U0FA 2M6KA 2K87A 1NU6A 4I2NA 3A3YA 2P77A 4CMAA 2FCRA 5EIEA 1MB3A 2FZ5A 2QTBA 3EFOA 3IEPA 1ENPA 1I7NA 4PSCA 1NI3A 4ZO7A 3TKLA 4DDWA 1C9YA 1D2HA 1UR5A 3FCSB 4B6RA 1T29A 1NUAA 4ZP1A 4CDNA 5SYMA 2J1LA 2Y05A 2JI6A 5G02A 1DJNA 3AESB 3DBLB 2HHLA 4S3MA 5BN5A 4FHCA 5TMBA 4OAQA 4OFXA 2ODTX 4OJQA 1XZJA 1QIIA 2EQBA 2ZYDA 3OSZA 5AUQA 5GV7A 4KRYA 5TXGA 2AWOA 2H2WA 2OZVA 3IEXA 4R9SA 1VYVA 4FSXA 3QH4A 5LBIA 5HDQA 3PE4A 4MS4B 4ZO9A 4J0JA 3F9IA 3VTKA 3DS8A 2JJ2D 1UQTA 2IPMA 3Q88A 2VPZA 3GZTB 4MUHA 1ONOA 2J3QA 3DYBA 3GPCA 1DE0A 3K6JA 2W5UA 3CH4B 3QFRA 5ALGA 4AWXA 4Q1BA 3SDSA 3DG9A 5CRIA 1OYWA 1KK1A 1U1CA 4UEKA 2V45A 5I7OA 4F6RA 4DV3B 1N8KA 3T1OA 2FOIA 3VX4A 5JXWA 4Q4AB 1DXOA 1Z34A 3E9QA 4W9NA 5JDCA 3CX8A 5JS6A 5JXGA 1RI3A 4MK4A 4KQIA 2A0WA 1SC3A 1CZKA 1ZCZA 4J0QA 1B8NA 2C5GA 4W4TA 2QWXA 2YOHA 4CEJA 4L5YA 4GH5A 4CQLB 4DC0A 4H1WA 3ERCA 5CCEA 1Q0LA 3IO5A 4DDVA 1UJMA 1RM3A 3VPAA 2K7ZA 1PV1A 4C43A 4NXMB 4XFJA 3D2BA 2QJOA 5COAA 1XMPA 3TVTA 4GR4A 3VC2A 3CVVA 3AONB 3R5JA 3OMXA 4Q18A 1LPNA 2VHYA 1NVXQ 3VHQA 3VZQA 2I7TA 4IXDA 3ZU2A 5TMEA 5KYYA 1K7EB 3EF3A 1IOWA 2Z5GA 3Q8LA 3R3HA 1SHJA 4D5EA 2ZM5A 2P3QA 3AGQA 3L1UA 5BV7A 4F85A 2DWOA 4IJ5A 5E0KB 2DWCA 3HBFA 1QIGA 4DF3A 4L8LA 2C82A 3FGOA 3PIIA 5CFPA 1PR2A 3C15C 1F48A 4KE7A 2CLSA 5BWMA 1VE3A 3S0JA 4ZI2A 3TOVA 3QSGA 3KKOA 5EQDA 1QDEA 3L4BA 3ZX4A 1ZGAA 4PYKA 1JHPA 4JC4A 5LLDA 4Y9RA 5JAOA 1HFEL 3HM9A 2HK6A 3DDHA 3GCDA 1WPRA 3EAFA 4N7BA 3AM3A 2IC5A 5KYUA 4S2UA 3GJ3A 1CWUA 5JNWA 4DABA 2JLUA 4DV1B 2MR6A 5DBOA 3L0IB 4PHFA 5FA8A 1NW6A 3NPMA 3UWKA 4BOYA 4K2AA 2ZJ4A 3KAPA 4QL3A 2FG5A 4U9IS 4NIMA 4B82A 4I1SA 4GGMX 3OCVA 3R7AA 4N6NA 4DLAA 4PX5A 3HDYA 5KNDA 4KR9A 2ONKA 3KKPA 1KO4A 2P5UA 5TPZA 3F97A 2CWDA 1LU9A 3G8DA 1LZLA 2VK1A 3JQRA 4KGDA 3GDWA 4EELA 2OQIA 1CERA 1XEAA 2ZUUA 4Z4QA 1QHGA 2I6UA 5G4KB 4KMSA 5GPBA 4RKYA 1ZW1A 3UJPA 3JQ7A 2H16A 4ENRA 4GPTA 4X24A 2WF5A 5G41A 3HFGA 4O02B 3ROKA 1KAQA 3RC7A 3T5BA 2F17A 4JGGA 3CLVA 2O54A 3CUTA 1BEEA 1K4MA 1QF7A 5B3JA 2JBHA 1N5MA 4EGQA 1RJFA 1Z88A 1QWSA 2FWMX 3B6EA 2BDUA 3PVSA 4TLDA 4KSBA 4UCXA 1NVUQ 3IO3A 4R3UC 3HCNA 5DNCA 3V48A 2R6CA 3DEAA 1WKCA 1B3BA 1YDGA 2PH1A 2EERA 3HBMA 4I9GA 4AECA 1G19A 3WMRA 1KVTA 4ZICA 1TEXA 4F6RB 4ZXFA 3ANXA 2N3ZA 1XZCA 3X44A 4A1OA 1N6NA 2NNLD 4TXLA 3R7WA 2QMHA 2JFWA 2FUNB 4KW7A 2ZRBA 4L76A 3WHIA 4K86A 4BBAA 3S2UA 3KBOA 3TZ6A 4EUKA 2VJKA 1C29B 3R5TA 4WV3A 2QEQA 1JZSA 1AN0A 4Q5IA 5COQA 1YZQA 4CEJB 3ER9A 1VMIA 1U7ZA 3M9WA 5JVDF 4DNFA 2W2KB 2Y0EA 4E5UA 5JNLA 4BGVA 1BNCA 2XA2A 3L1JA 3Q15C 4ZOAA 1XDZA 2O6HA 3CLRD 4MW1A 1QV7A 2XTZA 2E1PA 1MHTA 3AUFA 3JTMA 2Q41A 2Z4SA 3DVLA 5ITWA 1E20A 2VQSA 1JQLB 4LW8A 4RVFA 5AHKA 5KHLB 4YRLA 1HK7A 3KNZA 1QDUA 1R0SA 3CTPA 5KYYB 4JQSA 2AEEA 4ITRC 4QTZA 1MX9A 2P2GA 3ACDA 5EIBC 5AI5A 4PYLA 1RAGA 3UJBA 1JQJC 2QRKA 3ITEA 2O9JA 3JAKA 1T6NA 1EFVA 1V16A 1V3UA 1H8HD 2HU2A 4N3GA 2P30A 3UGJA 2RHTA 4L6CA 2A9JA 3F98A 4DHWA 1LLUA 1MTOA 2CL6X 3GCGA 5TPWB 1UC9A 2E37A 4AQDA 2DWPA 3LZ6A 5FBKA 2RK6A 4IS2A 3ZEAA 5DTMA