4GKBA

Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, unliganded structure
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
247
Chain Sequence
b'MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYAKLAEIAAKVPLGRRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
molecule tags Oxidoreductase
source organism Burkholderia multivorans
publication title Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, unliganded structure
rcsb
total genus 87
structure length 247
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gkbA00
5CP8A 1QYCA 4X54A 4JIGA 4CQLB 3GFBA 2OXIA 3EZYA 2AG5A 4GL4A 4WE3A 4TRMA 2VT2A 1I3MA 4WNCA 1M75A 2GSDA 3GFGA 4AFNA 1YQGA 3G1TA 3ZU2A 4YPOA 2Y1GA 2UUPA 4WOKA 1G0NA 4XIJA 3RAJA 1DC3A 2VHWA 3VPSA 3PPIA 3DAFA 4I8XA 1E6EA 5C5IA 3I23A 1UXGA 2QZ9A 3L6DA 3F5SA 1R12A 3S2GA 3R0IA 2PLAA 4GQAA 5JY6A 5TGDA 5TT0A 2X6TA 1E1NA 2ZB8A 3IKTA 2ZK7A 4DUPA 1UZNA 1GZ3A 1ZEMA 4P22A 1YB1A 4URFA 4HKTA 3PI7A 3CPSA 5KKAA 2O3RA 5HS6A 1IOLA 1Q0HA 4TMFA 4R4JA 4WJZA 5GMOA 2GN6A 3GMSA 2UV8A 3LF1A 4WCFB 4NBUA 2FPPA 3Q2KA 3DFUA 4WLOA 1U8XX 4J1QA 3KHUA 2ZTUA 3PHLA 5IDYA 2PGDA 1LX6A 2B69A 3U3XA 3LSYA 1KOLA 5KJEA 1P1KA 2HK8A 4YAGA 1GADO 1E5QA 2PKRA 1TT5A 1SO8A 3HFSA 1VC2A 3SVTA 3MJVA 3DAGA 4A2CA 3WOHA 4RVUA 1E92A 5KCZA 5HTOA 4N5MA 3H5AA 3PDUA 1PL8A 1ADGA 1DRWA 1Q7CA 3JQFC 4CV1A 1GQYA 4ND1A 4B7CA 3FF4A 3OP4A 3L4BA 4RPJA 1C1XB 2EP5A 3PFWO 4ZRMA 4Z3KA 4XGKA 4EI2A 3LVFO 4K26A 3E5MA 5G0WA 5I9LA 4BUCA 4E32A 1OOEA 4AL4A 3DZFA 4YAJA 2O3SA 3GRPA 5MDHA 1HETA 3K96A 1CRWG 1XA0A 4BNNA 5I7SA 2POQX 3CUKA 2Q99A 4XX0A 5I8ZA 1YJQA 1VJTA 4WLFA 2TMGA 2NU9A 5TQVA 5B4UA 1XEAA 2NVUB 4AJOA 2GN8A 2OHXA 3ZV6A 2C07A 3JD0A 2P5YA 2GYYA 5JY1A 3TZHA 1K6IA 3WSWA 1HZJA 4CM8B 2Q45A 3OHSX 5T64A 3EUWA 3DC2A 1UH5A 3OQ6A 3PDJA 1GUYA 1LU9A 5BNFA 1NP3A 3HFGA 1N2SA 3OETA 2ZJ0A 4J9VA 1MG0A 3V1TC 5C7OO 4OYRA 4XQ9A 1Z45A 3G49A 3I1JA 3L6EA 2ZB4A 2AQHA 4M55A 3UFXA 4D41A 2I67A 1ORRA 5CEEA 1TXGA 1Z7EA 3U5TA 3C24A 3B1JA 2B4QA 3DZHA 2A35A 1RKXA 2GO1A 3U0BA 3WLFA 3ZWMA 1ONPA 2BGKA 4DWVA 1HDYA 1LSSA 3VPHA 3AUUA 4TWRA 2CFCA 1YBMA 4XJTA 3GPIA 5CG1A 1E7YA 1RWBA 4JP3A 4B4WA 3KSUA 1CDOA 4FR5A 3JD4A 9LDBA 4EYEA 5ENDA 1LXCA 3P2YA 3L0DA 3WNQA 2H9IA 2PD3A 4MO2A 4E5KA 1X7HA 1GDHA 4RPLA 4HBGA 1T4BA 1LC0A 1O6ZA 1ZK1A 1WVGA 2DU8A 1XG5A 3VH4A 3EZLA 3PJGA 4BNHA 1J0XO 3CIFA 2J5KA 1NVGA 3ZU4A 1AN9A 1JQBA 5CDGA 1HLPA 4E5NA 4NFSA 4OQZA 1NYTA 3ROKA 4NJMA 4RPGA 4H15A 4YACA 3KETA 1BVUA 4J2HA 3TN7A 1DOHA 2QG4A 3CZMA 4RF3A 2X0JA 3KOUA 3ONEA 4MP8A 4RVSA 3DMTA 1C3VA 1PGQA 1YO6A 3JQDA 4BNLA 2NTVA 1RJWA 1B7GO 4B7XA 4RQUA 3FCOA 1IZ9A 4HFMA 3OIGA 1YDEA 4RGBA 2RH8A 3NJ8A 3WB9A 5IJZA 3K9QO 4B8ZA 4FC7A 3GH3A 1KEVA 1RM5A 4J6FA 4BVAA 4ALJA 4IY1A 4A27A 2VYVA 3RUCA 1L1FA 2QIOA 4E31A 1E6WA 3I4CA 3D4OA 5BR7A 3DHEA 3GN2A 3I6IA 4DQUA 1LJ8A 1EQUA 4BO8A 4KUGA 3TNLA 1LTHR 1QYXA 4Y6RA 5IDXA 3FR7A 2FHSA 2PY6A 3PYXA 1JN0A 2J3IA 3VPGA 3TZCA 4OGWA 2RBEA 4RLHA 4XA8A 4AJIA 5LDHA 3AU8A 2AE1A 1B8VA 4M89A 2O2SA 5KIAA 3T4EA 4D0SA 2ZQZA 1MC5A 2C7VA 4UUOA 3MZ0A 4K9DA 5K6AA 3D3WB 5HS4A 1F8GA 2AW5A 3ZHXA 3M6IA 3I9NA 1HSOA 3PRJA 1CIVA 2CF6A 4R5HA 1T1RA 4JJGA 4Z0PA 1LC3A 4DIFA 3HSKA 2Y68A 1GCUA 5C7LO 1PS9A 4DC0A 1HDXA 4KQXA 3VPFA 4YAKA 5ICSA 5L45A 2DAPA 3ZW8A 4FFMA 2VHVA 4UUMA 3GZ4A 1QKIA 4CM9D 4QEDA 3WBFA 2V6GA 4XKJA 1WZEA 2H5LA 4B4OA 3X2EA 3FWNA 5F3RA 3QV1A 4B4VA 4CLOA 4Y6SA 1I01A 3MWDB 1BTOA 5IXSA 1B14A 3BMCA 4WKGA 1F17A 2NLOA 2H63A 2PH5A 4DLLA 1UAYA 4BQRA 3ZU5A 4E4YA 1MB4A 3COSA 4L73A 1MUUA 2VTDA 4FJ2A 4DLAA 5F1OA 3OA2A 4RF4A 2NWQA 4JK3A 1KIFA 3EC7A 4IDFA 4CMCA 4LVUA 5JDCA 4BNUA 1J49A 1ZJZA 5JCXA 3WGOA 3DTYA 1I24A 3H8VA 4L4SA 4CMBA 3GG2A 5JMWA 2JCXA 1DFIA 3HDHA 3H3JA 5FI3A 2VN8A 2BI7A 1I2CA 3WQQA 3INRA 3RKUA 2NU6A 3LC7O 2BELA 3UICA 1PWZA 3ENKA 3BTSA 4N5LA 2I99A 1H9BA 4R5MA 2D2IA 2DBRA 5ITVA 4NK4A 3D64A 1N1EA 2ZB7A 3S55A 2VRCA 4D44A 4MKXA 1BRMA 4B4UA 2FP4A 3NT5A 2Y66A 1DC4A 3KVOA 3DONA 1YBAA 4DQXA 2HMWA 2CMDA 2OP1A 3GC6A 4KWIA 4YTEA 4KDFA 4I9HA 4LRSB 5CEFA 2E4AA 1JA9A 1TEHA 1VLLA 5JDIC 1EUCA 3GQVA 2XPCA 1BG6A 2O23A 1DAPA 1JU9A 4AJEA 3PWKA 2Z1MA 3ZZNA 2QRLA 3UCFA 4LW8A 5DBFA 3GOHA 3E03A 3ZHBA 2VHXA 4J1TA 4XB1A 3IKVA 3IS3A 3AOEC 4FJ1A 4IJWA 4IGFA 4Q3EA 4BGUA 1IULA 1UR5A 3JYOA 4AG3A 3QP9A 4W82A 4IZIA 1JKFA 3W8FA 5JPIA 2CDAA 4BKUA 3RWBA 3PZBA 1GZ6A 1D1SA 3WIDA 3BTUA 1R4NA 1GUZA 3BTOA 4TRJA 3AWDA 2D5CA 1NAHA 1G1AA 3WGHA 3LT0A 1ZZEA 4TROA 3BMCB 4OSPA 4Q3BA 2YY7A 4XJSA 4CR6A 2EJVA 1I36A 4P4GA 4CODB 3QLJA 3C1AA 4NJOA 1ADCA 2HDHA 3P19A 3UOGA 4ID9A 2I6TA 2OFPA 3ZW9A 2P9CA 3TOZA 1FMCA 1SB8A 3M2PA 3D7LA 4L4XA 3GEGA 4PFJA 4BV8A 4BKOA 3U9LA 5ILGA 2RH4A 3ONDA 3WSVA 4NPCA 4A26A 1AUPA 8ADHA 3NKLA 3RIHA 5DZSA 3O38A 3PIDA 5A9TA 4AJJA 5K9ZA 3I9MA 4E2YA 1EK6A 1B16A 5THKA 2X58A 2FPIA 5T8KC 3UVEA 4XDYA 4B3HA 3KYCB 4JBHA 1VE9A 4GMGA 4PLPA 4XB2A 4Z9YA 4BO4A 3HNPA 1A27A 3PYLA 1GEGA 1IUKA 4NIMA 1FJHA 2DKNA 1ZSNA 4HADA 3MJCA 4CUJA 1PJ2A 5ILOA 2OL4A 4PRKA 3IDSA 1B2LA 3CTMA 3GR6A 5A1TA 1UP7A 2CVOA 3PGJA 3I3OA 3ON5A 3N74A 2IRWA 3ZI0A 5JXWA 3WBBA 1YJ8A 1NAIA 4FW8A 5EIOA 3DMYA 3HDQA 4NNJA 4IMPA 3H9JA 1CJCA 4XD2A 5L7YA 2VTEA 4ESOA 3ZWVA 1NFRA 1P3DA 3JQBA 3V2GA 1KVTA 4WECA 1NQ5A 1GUFA 2HMUA 4XR4A 3BHJA 1A7KA 5L7TA 4ZVVA 1KEPA 2Y99A 1N9GA 4RORA 2J3HA 1NX6A 1N7HA 2PK3A 3O03A 1XWFA 3H4VA 2G0TA 2WYUA 4Q3AA 4JP2A 4AJ4A 2DUUA 3GUYA 1HF3A 1K89A 1QORA 5A9SA 1CERA 3C7DB 1ZKMA 2C2YA 3F1LA 1M67A 3NAQA 3ROMA 1EDOA 1GR0A 1IE3A 1PQWA 4KDEA 4G2NA 2I3GA 3EVNA 2Q4EA 2J3JA 3K6JA 1DDOA 2BFAA 1YB4A 1NWCA 4JXKA 4EW6A 1VSUA 2BF7A 3TWOA 2ET6A 2QW8A 3QIVA 2O3JA 2FR8A 4TKMA 5IAAA 2GZ1A 4ND3A 3W4IA 2YHUA 1PJ3A 3O4RA 1GYQA 3STHA 3H6KA 3RFVA 4YRBA 5GZ3A 4R69A 1A9ZA 1M2WA 1E3IA 1QG6A 3DDNA 3S2IA 5JDCC 4Z0HO 5EN4A 4DMMA 2RCYA 2WD7A 1TB4A 1ISIA 4GX1A 3ZWBA 3W4JA 1P0FA 4GKBA 4R3WA 5G0TA 1F14A 3LK7A 3B20A 4AJKA 3JQ7B 1U3TA 2P9GA 4FD3A 5DT9A 4D7AA 2FY8A 1PEDA 4AJ2A 1RM3A 1Y8RA 4CM6A 1NM5A 3OH8A 4JROA 3HADA 3TJRA 3QQPA 4GLOA 3F5QA 2PWZA 4BNIA 3DHYA 3JQ7A 5EMHA 5TF4A 2D3TA 3PP8A 2EWMA 1AXGA 4R68A 4IDAA 4CMAA 4DYVA 5F5LA 1EMDA 2AQIA 3KLMX 4OO3A 2IEBA 3AW9A 1KYQA 3H5NA 4ZQHA 3UHAA 5IF3A 1QXSA 1BSVA 3UKOA 3Q6IA 3ULKA 4P38A 5I7EA 3ZWPA 2EERA 3JCZA 1PR3A 2I65A 2GASA 4PLFA 1GYRA 1D4FA 1QV7A 5H81A 1DC5A 5L4SA 1U4OA 2RHRA 4LGVA 2ZATA 3OIFA 3W6ZA 3LLVA 2VWQA 5FYDA 5IN5A 2IXBA 1JLLA 1EDZA 4I1IA 2CVQA 4H3VA 2FR0A 4MVJG 4ALLA 5FWNA 1XIVA 2ZKLA 3NEPX 3V1YA 5LC1A 4BO7A 3UF0A 4CLXA 1DIBA 2EXXA 3GZNA 4LSWA 2PKQO 1B8UA 3K2BA 3ZV4A 3VZPA 4EEZA 4KWHA 4BIIA 4DBZA 1Y8QB 2NNLD 1A4UA 3R3JA 3VH1A 5JCJD 1PGOA 4E33A 3PJEA 3JQ9C 1T24A 1W8DA 2BMAA 3QA9A 1Z7BA 2CF5A 5TS3A 3D5QA 1LDNA 4IBOA 3DOOA 3ZWOA 2VNAA 5ICMA 4IJUA 3G17A 3DOCA 4OOEA 1I8TA 1XQ1A 4BV9A 1W73A 5H82A 2YDYA 3TZKA 1WMBA 2OBNA 4R16A 2B0JA 3OA0A 4CQMA 1WDKA 4B7UA 4HXYA 3BXXA 1HDZA 4YWJA 5K6AC 3AI3A 3IL2A 4IUYA 3RASA 4KMSA 4M1QA 1CEQA 1YBVA 5JSFA 3C85A 1OAAA 3KTDA 1U5AA 3DBRB 1R16A 5JAQA 5AOVA 2BFPA 5CG2A 1HDOA 2QRKA 3H9QA 2DFDA 2QX7A 3GMDA 3JQAA 3ANNA 3LT1A 4HFJA 3OQBA 4UVHA 1C0PA 5HA5A 3C3XA 5T8KA 3Q3CA 4EITA 4LVCA 3ETGA 4PLWA 4KTVE 1XHLA 3K73O 3OJ0A 3DHNA 5I9MA 2X1HA 4IMRA 1HE5A 3GRKA 1PTJA 3GVIA 1DAOA 3RUFA 4DPLA 3QVOA 1QLHA 4R9SA 1P77A 4EUEA 1AE1A 1R0KA 4NHEA 3LC1O 5A5FA 2O3TA 4YT4A 3SLGA 3BMOB 4FJ0A 4FIZA 1VL8A 3MJ4A 5JFOA 1P33A 4J7XA 3L4SO 3X2FA 4E2WA 7ADHA 4EJ6A 2VOJA 3U4HA 3CE6A 1NFQA 1H6AA 3PLRA 2C5AA 1W0CA 1BDBA 1EEHA 4ZHSA 3FTNA 4J43A 1UXJA 1C1DA 2WM3A 2X9VA 4H16A 4MVJH 4JJIA 3RUIA 2WD8A 1AXEA 2QRJA 4RF5A 2Q1SA 3ITKA 1UZMA 4WUVA 4EUFA 2XXJA 1E7QA 3F3SA 3L9WA 2HK9A 3LZ6A 5L51A 2O7QA 3PJFA 4NQZA 5ADHA 3HZZA 2NVBA 2GN4A 3BHMA 3EDMA 3DBLA 1K0UA 1PWXA 3DTTA 2AMFA 1NPDA 3W6UA 1ZMOA 3DO5A 3UUWA 3IJPA 2JCVA 5T5QA 5COQA 4J4HA 4J0FA 1C0IA 3WR5A 2AE2A 3DBLB 4XRRA 2HQ1A 4AJ1A 4WLVA 1U2DA 4GGPA 1B0AA 5T6BA 1MP0A 2CSUA 2NU7A 2GCGA 3WDSA 3SLKA 1U28A 4RLSA 1WMAA 1QYVA 2P5UA 4P4LA 4NI5A 1I33A 1LRLA 1K3TA 3W8DA 2B4TO 3WFIA 2FSVA 1B15A 1PL6A 4CMEC 2CY0A 1GTMA 2Z95A 3D5TA 3NT4A 5G4LA 4IPTA 4O63O 1EVYA 2X23A 2WE8A 4MP6A 1BHSA 2RHCA 3HG7A 3IUPA 5DF1A 4IM7A 4ALMA 4I5EA 2FN7A 4D3FA 4R41A 4RDHA 2GRAA 4FFPA 3GVHA 1NVTA 4GSLA 4OXYA 3VTZA 3ZV5A 3RBZA 4E2ZA 1DJNA 9LDTA 1YVEI 5A04A 4PZEA 3E9NA 5C37A 1LNQA 1O89A 2G5CA 3ZWWA 1L7EA 2DBQA 3JD3A 3KSDO 4CV2A 3VDRA 4E21A 3OICA 1I30A 5IXYA 4ROSA 1HL3A 2AEFA 4OJNA 1MFZA 3O26A 4PLGA 1MG5A 1DBVO 4W4TA 3AUTA 3S2EA 1V3UA 4D79A 3E18A 1DHRA 1NR7A 2JFGA 4TSKA 4IIUA 6LDHA 3GVXA 3EW7A 2FOIA 2J8ZA 4N18A 5GZ1A 3DWFA 2Z5LA 3G3EA 1LSJA 4CMIA 4FGWA 3AY7A 3WWZA 1MXFA 2DT5A 2ZTLA 3G79A 2ZCVA 3IIEA 3U62A 4ZJUA 3WG9A 1E7MA 1SOWA 4FN4A 1XGKA 3A4VA 2LDBA 1O0SA 3DQPA 4QX6A 4D45A 1V8BA 1DIRA 1ZJYA 3NUGA 4IINA 2DPGA 4IDEA 2YQ5A 2IYOA 4U5QA 4NBTA 4L0QA 1NWHA 2C2XA 4IXWA 3ZWXA 4BQPA 5L53A 5L9AA 4Z3DA 1IY8A 2J6IA 4RVGA 2EW8A 4OMUA 4LCJA 3WXBA 2NUAA 3FSRA 2JJYA 1V3VA 3GUCA 4BO0A 4FQ8A 2WEKA 4IQGA 3LC2O 4U0KA 2ZTVA 1N7GA 1YOVB 2VHZA 4ONEA 5C7IO 2G1UA 4IDCA 3E6AA 3KRTA 1ZVMA 4S3MA 3JQ9A 4EEXA 5JLAA 1EE2A 1NNUA 3KYDB 3Q9NA 1TI7A 2C29D 3NYWA 1UDBA 5TJHA 2UYYA 3GG9A 1HWYA 2XF8A 2D1YA 2YV2A 2GZ3A 1HZZA 1Z82A 2TMDA 4WEOA 3GLQA 4XQCA 3WICA 2GN9A 3E82A 5CDYA 1HTBA 4P8RA 4XYEA 1XDWA 1P44A 4IXTA 1DFGA 2E49A 4YR9A 2QYTA 3GA0A 1XYGA 4BB6A 1I2ZA 3G0OA 3QVSA 3PXXA 5KJ1A 2YHIB 4L76A 5THQA 1LDEA 1PQUA 4LCEA 3QWAA 4IDGA 3I5MA 4M86A 1Q1NA 1JWBB 2PFGA 3DZBA 4IDBA 5DN9A 2GPTA 3MWEB 1N1GA 2CD9A 2A94A 4UEOA 1KS9A 3QSGA 5ENVA 3TSCA 4OXNA 1ISMA 5B1YA 4F6LA 4QT0A 5DNAA 1IZ0A 5A4DA 4DTIA 1A72A 4CV0A 1C1XA 4TVBA 4E12A 2OP0A 4CMKA 1Y8QA 1LDBA 3CKYA 4Y8VA 2OUIA 5B4TA 3L07A 1RYDA 1T2EA 2B4RO 2NACA 1LLDA 1BXZA 1QRRA 1R66A 1KBZA 2X0RA 3NV9A 4O6VA 1PU2A 2I5PO 3KB6A 4U7WA 1X0VA 4CMIB 3BMNB 4MJLA 4PLYA 3OIDA 1PSDA 2C5EA 3DL2A 1R0LA 5G0VA 5TIIA 4L4RA 2YQ4A 1E1LA 4KUHA 5IFLA 1D3AA 4E30A 3WGGA 1X1EA 4QFDA 1YL5A 2VWHA 1YXMA 3BMNA 1KVUA 1PJBA 4CUZA 4BNKA 3RQSA 4LSMA 5A9RA 1TLTA 4UVEA 2VT3A 4RZIA 2VZ8A 4NMHA 5EESA 5COBA 1E3SA 4Z6KA 2ZCUA 3OQ1A 4NFHA 1HDCA 1X7GA 4BS9A 5KJ6A 4JJFA 1BWSA 1DRVA 2G17A 4A03A 4ZGWA 1QP8A 3RC2A 5DOVA 1Z74A 2AEJA 1GPJA 3KO8A 1JTVA 5JS6A 4J16A 3WTCA 1DJQA 3VDQA 2EGGA 3H65A 1CETA 5EQDA 3LF2A 3FPCA 5AQ1A 3DR3A 4RPKA 5FF9A 2IYPA 3H2SA 5DP1A 1NQTA 2B5VA 3ZWAA 5ES3A 4OKIA 1TT5B 3W1VA 2PTGA 4LMPA 4UVGA 4OM8A 1A7AA 2HMVA 3F47A 2D4AA 4O5OA 1AHHA 5IDQA 3FR8A 3ZDFA 4BNGA 2FRDA 4BNZA 4CM9A 4DIOA 3PK0A 3QWFA 1KEUA 4KOAA 2PNFA 3IOYA 1JVSA 3HQ4O 1GQ2A 4BO5A 1HLDA 1UP4A 4R01A 4ND2A 5L40A 4YCAA 4R9RA 3WLEA 5JO9A 4C7KA 4F6CA 3UAGA 2R00C 3VKVA 5AXBA 4C4OA 4IDDA 1WAMA 4XEHA 4EJ0A 2FWMX 4HUJA 1WXDA 4JX8A 4ND4A 1LQUA 5EINA 5G4KA 3ZWCA 3I9KA 1A4IA 4NBVA 1Q7GA 1WDLA 1U8FO 2JHGA 3O9ZA 1P9LA 1PGPA 2JHFA 3DOJA 3E8XA 3E9QA 4Q3DA 4E13A 1PGJA 2J5RA 3TFQA 3GF4A 5B4VA 1B8PA 1NPYA 4YQYA 3E9MA 1IHYA 4EJMA 2NVUA 3SEFA 5AXAA 3RJ9A 4S1VA 3DZIA 5TRTA 1ONOA 2BD0A 4OXKA 5EQFA 3TOXA 2A9FA 2Q2VA 4CQLA 5I8WA 3PGXA 2G76A 4MVJD 2ILTA 1U4SA 1XSEA 1U3UA 3K30A 3JYQA 1NFFA 4HY3A 2RIRA 3KBOA 5LCXA 5IZ4A 3B6ZA 1XR3A 3S8MA 5JAZA 4WLNA 4IIVA 1ISGA 3HDJA 4WPGA 4WOJA 3QVWA 5IG2A 3ZHZA 2P4QA 3OM9A 4J2OA 1O8CA 2VUTA 5DOZA 5CDSA 3FD8A 2EHDA 4Q3CA 4WCFA 2O48X 1QR6A 2VYNA 1E77A 1DSSG 2BH9A 3MCVA 1VM6A 1V9LA 1YWGO 3R6DA 1KETA 2B83A 4XYLA 3MJEA 1F0YA 1GD1O 4GMFA 4MP3A 4DIBA 3VH3A 3B1KA 1EBUA 5DBGA 4G81A 5JNLA 3H9UA 1E0DA 1QLJA 1V0JA 1LSOA 4ND5A 4D46A 2AQKA 1SZJG 2Q1UA 3ZWYA 3FHLA 4RO0A 2VRCD 1CWUA 1ZSVA 3AM3A 5FFFA 3BZUA 5JYEA 3TDKA 3CXRA 4KQWA 3NRCA 4RV9A 4BKQA 2AXQA 1T2DA 2Y1EA 1ZH8A 1P1IA 3INTA 4U0JA 4PLHA 1JW9B 4GWGA 4PVDA 4EDFA 3PTZA 1XU7A 3RFTA 2QQ5A 4IZHA 3WGTA 3OJLA 4F46A 3WX0A 3LT4A 1HDGO 4OKNA 3GGOA 3MTJA 3QWHA 5A3JA 1LRKA 4Z9FA 3RBXA 4O59O 3IP3A 3UN1A 2NADA 3B1FA 2PZMA 3ZNPA 2CVZA 1BMDA 1GY8A 3GNQA 3WTBA 1ZO8A 2DBVO 4MVJM 5DP2A 1T1SA 4WLEA 4CMHA 4MIOA 2YYYA 2X22A 2A4KA 4MINA 3VTFA 2PGLA 1KVSA 1SCUA 4Y9DA 4KUEA 4NZ9A 4Q9NA 3A14A 3GGGA 4NU6A 4TQGA 1K6XA 1HXHA 3U4CA 1MC4A 4MDHA 1VL6A 4XRGA 2ZYDA 1P45A 1Q7BA 1Z73A 5DCWA 3NTRA 4E2XA 4CLHA 3RJ5A 3JYNA 1ZEJA 2AA3A 5L95A 5HBRA 3WGQA 1ADFA 2V6FA 4Y6PA 3WJAA 1H0KA 4YVFA 5U4QA 2EJWA 1VI2A 5BT9A 2B5WA 2BFOA 3WGYA 1ZK4A 4YJHA 3WGIA 1Y9AA 2JFHA 4LRTB 1BGVA 1OBFO 4D3SA 4O0LA 4BO6A 4CL8A 4CM8A 3EYWA 1E3WB 2PD4A 4YAEA 3KYCA 3FBTA 3GAFA 2GERA 2FSSA 3D4NA 4TZKA 4J7UA 2BLLA 4TVOA 1ENZA 5A02A 3AFMA 4GPD1 4HNGA 3A1NA 3PJDA 4CLDA 4HNHA 2NQ8A 1SB9A 2P91A 1LRJA 3GY0A 2CDCA 2C54A 2EV9A 4FFOA 1UJMA 2ZJ1A 4FBGA 4CMJA 3K8ZA 3OMLA 2DM6A 1GPDG 4J49A 4YJDA 4K1LA 5JMPA 4CM7A 3JV7A 4AJLA 1QV6A 4L9RA 4MVJI 5U9CA 3JSAA 4NJMB 1GYPA 3IJRA 2DTEA 4RVHA 2X8LA 4FFNA 4LK3A 4ZQBA 1ISHA 2PZJA 1Z6ZA 2QZZA 2Z1NA 1DEHA 1JKIA 3ETEA 4DPMA 1M6WA 3QVTA 5CHEA 3GNSA 3DMTC 1PZFA 1SEVA 5KJFA 4M8SA 3ETDA 2VRBA 3OFSA 4QO8A 4BOYA 5CEJA 4BMNA 1XKQA 1ZSYA 2EP7A 3JQAD 2GZ2A 5GY7A 1MFPA 4NDNE 5J23A 1ML3A 2F00A 2VNSA 1T25A 3MEQA 1G6KA 2WE7A 3AFNA 4FOOA 1A71A 3QE3A 1E1MA 1NQAO 1PJLA 1ZXBA 4RF2A 4ZQEA 5L4NA 3K92A 1BVRA 1OI7A 4J7CA 3TPCA 3PHHA 1EQ2A 4B3JA 1YH3A 3AUAA 5CDUA 3EGOA 3JD1A 1U1IA 4XCVA 5TT1A 3GAZA 3FTPA 2WTBA 3C8MA 3ASUA 2IZ1A 1YS4A 2YFQA 1JDJA 4EGFA 1FDTA 2R00A 3HN7A 3VVBA 2UVDA 4GX0A 4DPKA 4H7PA 2O4UX 2LDXA 1IPEA 3JQ8A 3BTVA 1RYEA 1RM0A 5DULA 3NGXA 4RL6A 1EVZA 1R37A 2P9EA 2OZPA 2I76A 1DXYA 3JQCA 2HJRA 1O5IA 4GGOA 3JD2A 4JQCA 4W7IA 3VKUA 4DL9A 3N7UA 3RUEA 1QMGA 4R1UA 1HDRA 4MIYA 3UGKA 1UP6A 1DB3A 4MVJP 2Q2QA 4ILKA 5JO0A 3PQFA 3HUDA 4WCFC 1EK5A 3F4LA 2BGMA 3TRIA 3WIEA 2JAPA 2W2LD 2E82A 4BMSA 4AJHA 1C14A 5L3ZA 3OEWA 3VZRA 2EW2A 3TL2A 3L4BC 1DRUA 1LLCA 3JYLA 5COAA 1DC6A 2NVWA 2DTDA 3RU9A 2GLXA 4DLBA 1WLYA 2CUKA 3FNHA 3H3FA 4UAGA 4OOFA 3BA1A 3KYBA 4BKRA 1WZIA 3PHGA 5I7VA 1KEWA 1LDMA 1FDVA 1BDMA 1N5DA 1U3WA 4E5MA 3WJ7A 4DYDA 5JC8A 3LT2A 4YB8A 1P0CA 5B37A 1NHGA 3SJUA 2VHYA 4BO9A 2WSBA 3CZRA 4OQYA 3ZH2A 4BGEA 3R3SA 3I4FA 2C20A 4RJTA 1BXGA 1DHTA 5JCJA 4DQVA 1JWAB 1ADBA 2Y1OA 3ROPA 4PCVA 5AXDA 3FNFA 1IYZA 3RU7A 3ADPA 1T2CA 4Q39A 3MOIA 3LYLA 1PJ4A 2FZEA 5BSFA 4MKZA 1MX3A 4J9UE 4FFLA 4QO7A 3T4XA 1NXQA 4PLCA 1CYDA 1LSUA 2Y1CA 1PJCA 1HEUA 3QW2A 3L6OO 4N54A 8LDHA 3JQGA 4FS3A 4RZHA 2Y0CA 5TNXA 1GQQA 1SC6A 3CMMA 2O50A 1FF9A 4LISA 1LA2A 4RQTA 1TA4A 3HJAA 4O1MA 3WQRA 3VZQA 1CF2O 2W8ZA 2WJPA 1ZK3A 4QQRA 2P4HX 2WD7B 2XXBA 4CM4B 2O2YA 5DDIP 5F1KA 2W2KB 1E6UA 2B36A 4M49A 5C3MA 1M66A 2VQ3A 4K6CA 2NV6A 1ENPA 1ULUA 3IC5A 1JVBA 4ZA2A 5JAMA 5EL0A 3W4KA 3RSHA 1E3WA 1GCOA 1X14A 2P68A 2X5JO 4CM4A 2HJSA 4WCDA 1N92A 3V8BA 3ZV3A 3AOGA 3U09A 4XWYA 5KKCA 3A28A 3VHRA 4A7PA 1R15A 1WDMA 3E1KA 3AOEA 3DZGA 3AI2A 1I3KA 4FC6A 3HDYA 4QTZA 3GPDG 1U3VA 3M2TA 1W4ZA 4AJNA 1WNTA 2EGHA 1JAXA 4BL5A 1NVMB 4Q3NA 1VPDA 4PRLA 4AVYA 2IODA 1QYDA 1QYWA 2HSDA 1NPTO 4MIEA 4E5PA 3QWBA 3F46A 3EY4A 4PVCA 4I9NA 3GDOA 3U4DA 4A10A 5JW6A 1R0SA 1Q0QA 1P1RA 5GZ6A 4UUPA 2VZ9A 3DZJA 4FSHA 2OBYA 1I0ZA 1H6BA 1DIAA 1F8FA 1AGNA 1UXIA 2F1KA 2YDXA 5CPFA 4TKLA 4DMLA 1PZHA 1I5RA 3Q9UA 4CLOB 1ZFNA 2GD1O 4NR0A 3CEAA 4WASA 3ANLA 1T26A 3TL3A 4CLRB 1CQIA 1BXGB 5KVVA 4R3NA 4TRRA 4E5YA 4BO1A 2CNBA 2RAFA 3FI9A 2HUNA 1E5LA 4GI2A 1LBEA 4PZCA 2VYND 4YA6A 1NTOA 2BGLA 4QUKA 2GUGA 3DEYX 2X0IA 1HRDA 3AU9A 1VJ0A 4EZBA 3D1LA 1E1KA 1SBYA 3RROA 3DBHB 4GAEA 1LUAA 1E3EA 2PZLA 4OH1A 2D0IA 3JQGB 4FGSA 2YW9A 3QVXA 4YDRA 3C7CB 3EAGA 3M1AA 4FPXA 1LDYA 2HAEA 3K31A 3V2HA 2HRBA 1C0LA 4R51A 4YRAA 2PKQP 5CFZA 1SMKA 3DBHA 3TZQA 3JQ8B 2JD0A 2BRUA 1S7CA 3UH1A 3DB2A 1ZUD1 3NDJA 2UAGA 1MLDA 2W2KA 4DGSA 1X7DA 1Y1PA 3GVPA 3DXFA 2WYVA 2DBZA 5KJCA 4BGIA 1D8AA 4HV4A 1H6CA 3Q0EA 1VKOA 1H9AA 2D5AA 4YT2A 1J4AA 3KLPX 2JKVA 3GK3A 3OJEA 4UEJA 4WLUA 4Y98A 1ZW1A 2J3KA 4L8VA 4HX5A 1JKJA 5CAEA 3WGZA 4HFNA 1WP4A 4K6FA 3RFXA 4UULA 3LDHA 4YYZA 2W98A 5HRUA 2IDZA 1DIGA 4Y67A 4YRDA 3NJ4A 3VVCA 1Y7TA 1PS0A 3RI3A 2PR2A 1LI4A 4ALKA 5BQFA 3GT0A 3RC7A 5KVQA 2NSDA 3RC1A 3ZNQA 3C1TA 4J3FA 1YQXA 1PR9A 5A9SB 3FN4A 5H83A 3NTOA 2Q1WA 3L9XA 2W4QA 3AY6A 4W99A 1QSGA 4PN3A 1ARZA 5AXCA 1J5PA 3ZN2A 4CJXA 1VRWA 4GLLA 4CMGA 3HB5X 1UDAA 4DBVO 3JYPA 4YBZA 1ZK0A 2DQ4A 3BYZA 1C1DB 4W7HA 1RPNA 4E3ZA 3KEQA 4FB5A 1R4NB 3TF5A 4NG5A 2VOEA 1N9GB 1XCBA 3PQEA 2PH3A 4G5HA 4L75A 4BNWA 1OFGA 1I2BA 1V6AA 3DAPA 2OGUA 5L7WA 3D0OA 4P4NA 3GDFA 3T7EA 5KVSA 3F9IA 4CLRA 1WPQA 5I9NA 1EVIA 5KVCA 3LQFA 1UZLA 3PEFA 3JQ6A 4DC1A 2Y67A 3IUSA 4TZTA 2QHXA 2Y1DA 1OC2A 4PLTA 4A5OA 1B3BA 1H94A 5L4LA 2Q4BA 1GU7A 1F12A 4NH4A 3SC6A 1KERA 3I9OA 4BO2A 3VAZA 2E37A 4J0EA 3G1UA 1MGOA 2OOSA 3IMFA 3NT2A 1I3LA 1Y6JA 2JD2A 1O94A 2VYVD 1M6HA 2ZIZA 1PJQA 4W6ZA 3AM4A 2WMDA 5IN4A 4OSOA 2DLDA 4J90A 2HMTA 4BNJA 1P74A 5KTKA 5F5NA 1PIWA 4RVFA 1V3TA 1EUZA 4CLEA 2Q2WA 4D42A 4XDZA 4I5DA 2Q3EA 2O3UA 3RKRA 3TQHA 1YOVA 4ZD6A 2B35A 3DFZA 2I9PA 4I5FA 2X5OA 2XAAA 1PZEA 3D3WA 1IPFA 2QYSA 2VUUA 2VUSA 5F1PA 4ZICA 4J4BA 2R2GA 1VSVA 4MVJF 4YJGA 4G65A 2G82A 3ROQA 1EFLA 3CINA 1E7SA 1G0OA 2FMUA 1ID1A 3AJRA 3WYCA 1EVJA 3PVZA 4INAA 3KZVA 1X15A 1PL7A 2JAHA 4WGGA 4A0SA 1K2WA 4J1NA 3UXYA 1KVRA 4MVJA 4OL9A 1MA0A 2HMSA 2V65A 2V6MA 3RC9A 3I9JA 4HP8A 5BSGA 1NQOA 2DUWA 1FDWA 3KUXA 4W9NA 5A06A 2YHIA 3OSUA 5HWSA 3E48A 3PLNA 1GAEO 2DFVA 4DA9A 1JAYA 4MPDA 1MXHA 4D3DA 2NM0A 4BB5A 1H6DA 4II3A 1SAYA 3BMQA 1KC1A 4B79A 1Q0LA 1P1FA 2OORA 1SNYA 3RD5A 1E7RA 1ENOA 2EKQA 5LDGA 1D7OA 4RCVA 1EFKA 5A05A 4JNKA 4YJFB 5CPBA 5EJ2A 3AI1A 2HCTA 4GH5A 6ADHA 1GV1A 4PG4A 1OZAA 3Q11A 1FXSA 1YONA 3GZNB 3EK2A 1A5ZA 1N8KA 1NBOA 4B3IA 3RUHA 4CM5A 3R1IA 1CQJA 1J6UA 1Y81A 3HHPA 1IB6A 3OEYA 3OF2A 1HE4A 4U6SA 4D0RA 3MJSA 5FEUA 1UXHA 1F06A 1Q2XA 3DBRA 4BNXA 3D3EA 4W9NC 2PZKA 3HB4X 4UREA 1K5HA 2DC1A 3ICCA 4BNTA 4MVJE 4AJPA 1X1TA 1IL0A 3JQAB 4JBIA 4KZPA 2X5KO 4CM3A 3ONFA 4NFYA 4CQMB 3L77A 1GFSA 4CR7A 3SBOA 1Y5MA 1YDWA 3ASVA 3RCBA 3ICPA 1YRLA 2YUTA 1GZ4A 1PJTA 2O4CA 4GKVA 2ZQYA 5TX7A 4CPDA 1OMOA 3NTQA 1E3JA 3SX2A 3KYDA 3JQBC 1R4MA 4N5NA 3WMWA 4U8GA 1EUDA 1KY4A 5G0SA 4ITUA 1U9JA 2JFFA 2X86A 3F6YA 4FFRA 4Z0TA 5JC1A 3LLSA 3QRWA 1OC4A 4YJGB 1BW9A 1R4MB 3NDIA 2DVMA 1YGYA 3M1LA 4LMRA 4XQGA 5FI5A 2P2SA 4BNFA 3ABIA 1I10A 4JGBA 1ZBQA 1MV8A 5IZCA 3DZKA 3GEDA 3RUAA 3FPLA 2NTNA 1DFHA 2CZCA 4UVDA 3SC4A 2UDPA 2W90A 4JLWA 2EKPA 4R1TA 4ZN6A 1NHWA 2PA3A 1AHIA 4UEKA 4CV3A 2VZ0A 2FZWA 7MDHA 4LN1A 4J4TA 1HYEA 3IAHA 5BSHA 4IQ8A 3U4IA 4U6QA 1YL7A 5G2OA 3V1UA 1SPXA 4GVLA 4DRYA 3PWSA 1XELA 4BNVA 3H9GA 3A06A 4PG6A 2IEDA 1ULSA 2WDZA 3KXDA 4FDAA 3TZ6A 1XLTA 3INGA 1X13A 2VWGA 2HLPA 3F4BA 4Z9XA 4YJFA 3WWYA 1P31A 1GEEA 2ZTMA 5HM8A 1H2HA 4IJVA 3V5NA 4RDIA 3JQFA 3P5SA 1YQDA 4I9UA 4PG8A 2FR1A 2JL1A 1HE2A 1P1HA 5EERA 1U7HA 3GVCA 5KOIA 4B8WA 1EBFA 2Q50A 1ZXLA 1YKFA 4NK5A 2GNAA 1W6UA 2H1SA 4A73A 5IZCC 4ZQGA 2IZ0A 4ALNA 1KY5A 1E3LA 3NX4A 5TLSA 1B3RA 2YJZA 3HWRA 3ANMA 3CH6A 3S2FA 5ER9A 1XQ6A 3RVDA 4IJKA 2EIHA 3CSDA 4ALIA 2VCYA 4J91A 1LDGA 1EZ4A 2HRZA 3PQDA 4GSKA 4F3YA 2YV1A 1SEPA 3ZCXA 4E0BA 1I32A 3W8EA 4HWKA 3SJ7A 4PG5A 1FDUA 2Q1TA 4I08A 5AYVA 1O9BA 1Y8RB 2D59A 2WYWA 3C1OA 5IDWA 1ISJA 1HSZA 3O8QB 1UUFA 4QXMA 2EKLA 3ADOA 4I5GA 4PIVA 1S6YA 3WFJA 4YAIA 5T57A 5TSDA 1P1JA 3JQEA 3I9LA 1NR1A 3GHHA 3PYMA 4WNIA 5G0UA 2BHLA 4YT5A 4CMEA 1EE9A 1DIHA 5A3VA 1Z75A 4F45A 5ITWA 1D1TA 4II2A 1BW9B 4E6PA 1B26A 1DLJA 2OMEA 3NGLA 2C7GA 1WWKA 3FBGA 2NTJA 5KWEA 1DPGA 5EPOA 1PS8A 3UCEA 4R1NA 5T67A 4MOWA 1PZGA 3AK4A 3ITDA 1FK8A 3PIIA 3GEMA 4XR9A 2EG9A 3I6QA 3KV3O 1UDCA 2I66A 1T2AA 3EMKA 4R1SA 4RVDA 3ZWNA 4YXFA 2A92A 2E6UX 3PWZA 4BGVA 3MTGA 1ZCJA 1E7WA 5JDIA 4OHUA 3UCXA 3D4PA 3H9EO 3I52A 3HE3A 3QJ5A 1X0XA 4BHTA 1NASA 5U1PA 2Y05A 5AVOA 4DVJA 1U7TA 3RUDA 2W2LA 3HN2A 2UUOA 2BKAA 1SOVA 4XYMA 2GDZA 2YV3A 2E48A 4XYGA 3JTMA 2HU2A 3GDGA 1YE3A 3NDRA 3U49A 3IP1A 4DXHA 2R6JA 2GGSA 3Q1LA 4XZ3A 5BNIA 4PG7A 3E5RA 4QSMA 5K0ZA 3WYEA 1TT7A 2DPHA 2GF2A 5TJ9A 4IGEA 3S1LA 3BIOA 4GVXA 1KVQA 1YB5A 4M54A 3K5PA 4ZQFA 4BNMA 2EF1A 1UXKA 5KNLA 4CUKA 2PV7A 3PFFA 3P7MA 4TRNA 3P2OA 4YJHB 3PHIA 1RM4A 5DBIA 3BAZA 2H6EA 2DTXA 4IS3A 2O3QA 1ZMTA 1M76A 1H2BA 4L74A 2IXAA 1V35A 3OJFA 1PQPA 3FNEA 2WWRA 4RPHA 2IZZA 4YQZA 1ONNA 1C0KA 2CDBA 3H2ZA 1L7DA 1ZK2A 1ISFA 3FWZA 3ORFA 3VOSA 1O95A 5B12A 3CMCO 2YZ7A 1DO8A 2GR9A 3WQSB 4XQEA 2O7SA 3OECA 1YL6A 1GV0A 1XU9A 2AG8A 3BHIA 4NBWA 4YEDA 5ER6A 5JE8A 4NU5A 1BXKA 1R6DA 2ZYGA 3EHEA 4XIYA 3OJOA 2C82A 3WYBA 1Y5RA 3VH2A 5MGBA 1WW8A 4ZU3A 5CDTA 2V6BA 3BMQB 2PD6A 2SCUA 3H5RA 3N58A 2PGJA 4M87A 3B70A 3VC7A 1PX0A 4KTTE 4QFCA 4YT8A 1U5CA 2AEMA 4HFRA 4XYBA 3VZSA 4BNYA 3PHJA 1ZIDA 1LLQA 3LU1A 3RBVA 4CQMD 1IHXA 4NBRA 4UUNA 4UVIA 3V2UA 4WK6A 4ZRNA 2XOXA 4XGIA 4D43A 2HKIA 4XGNA 4FOSA 3EVTA 3F1KA 2AQ8A 1I3NA 3MOGA 3QHAA 4R54A 2C59A 2I3AA 4JN6B 4PZDA 1TVEA 2X0NA 3UW3A 3ZU3A 2YFHA 5JYDA 4J1SA 2JCYA 1LEHA 1HYHA 1PGNA 1KC3A 2X9GA 4FCCA 4BMVA 4IQ0A 5A5EA 2AHRA 3WNVA 2Y0EA 4PLVA 3A9WA 3H7AA 3OBBA 4K28A 2JD1A 1HKUA 3ZNNA 5I7FA 2D8AA 3ZGYA 3ZHYA 2Q49A 4KP7A 4PLZA 4QECA 4C7JA 4CM1A 3GGPA 2Q46A 4MKRA 5BNTA 3MJTA 5A03A 2Y1FA 3QWIA 3PZRA 1HYGA 3DBVO 2V7PA 5JAIA 2HK7A 5TC4A 1ENYA 5JBIA 3K2EA 1HE3A 4PGFA 3O8QA 3GN1A 3VPXA 1T2FA 2IE0A 3AM5A 3C7AA 3GNTA 4GX2A 5F21A 4GWKA 5DCUA 5BSEA 3FRJA 3T7CA 4WEQA 3KM0A 1VJ1A 1T4DA 2X7HA 2BI8A 4CL3A 2OO5A 4BO3A 3BMOA 4EBFA 2BFMA 1LQTA 3KEOA 3SXPA 2NQTA 2HO5A 4AICA 2ZB3A 1GL3A 3WS7A 3IQDB 1PJSA 4IS2A 4BKPA 4GX5A 1U2GA 4N7RA 1H5QA 2B37A 4OIMA 3QY9A 1LLUA 4JCOA 5DCYA 4OAQA 2Y93A 2FPGA 5G4KB 2ZYAA 2X9NA 1FDSA 2X4GA 3ENNA 2C0CA 4EUHA 1K6JA 3AUSA 3I83A 4CR8A 4DREA 1DLIA 1H93A 2EEZA 1HT0A 2VWPA 1VL0A 3FNGA 2NU8A 1UAGA 3KSZO 1Y9EA 3ZNOA 4GBJA 1ZNQO 1A9YA 3TFOA 2J5QA 3GHYA 4JBGA 1VKNA 2Y0DA 3Q2IA 3ST7A 3WMXA 3AY3A
chains in the Genus database with same CATH superfamily
4UMDA 4LMBA 1OVGA 1ZGCA 3D8NA 4OQDA 4QICA 4RA9A 4X54A 4ZOLF 2OXIA 3VSDA 4CQLB 5BMVB 3EZYA 1COZA 4GL4A 3RJMA 5B6PA 4TRMA 1Q7TA 1I3MA 2MDTA 1F6WA 4G1UC 4WNCA 5B30A 2C7PA 2JLAA 1LV7A 1YQGA 3G1TA 3ZU2A 2Q27A 3MMXA 1C80A 1FJ2A 1G0NA 5DX1A 3SC3A 1D4AA 1GFWA 3X1DA 5C5EA 2CEKA 4LFBB 3RAEC 4BWYA 4NYIR 1E6EA 3CHYA 4NMWA 1XMIA 4OL0A 3UJHA 3QVGB 4XTCS 3O0TA 10MHA 1Q7EA 4JWKA 2FKAA 4GW3A 1FSFA 3B38A 3TCNA 4I66A 5CBPA 4I1SA 4G0MA 2JGDB 2ACKA 1B93A 4GVPA 2X6TA 4Q9AA 5KTMA 1FSZA 4KGXA 1NULA 1J00A 3SYKA 3FE2A 4PWZA 3HI4A 3OWOA 1HTTA 1U0EA 2B2CA 3IT2A 4AROA 1XPUA 4K9RA 1FS4A 1TC1A 2VNKA 5JVDB 3GZTB 4MGZR 2R6DA 2JI7A 2B98A 3DMDA 2JFOA 2MSWA 1FP4B 4R4JA 4WJZA 4EM6A 3GMSA 5DGXA 4WCFB 1T35A 3IB6A 2I4NA 4DXDA 4OHCA 3PHLA 1LX6A 2PGDA 1ZR2A 2VPYA 1K68A 1CDEA 5FDFA 1KOLA 2HK8A 4YAGA 5KNDH 2J1LA 3OQMA 3RSGA 5H3HA 1GADO 4K46A 6GPBA 1O6CA 1CBUA 5HZGA 2I55A 5IKXA 1UM9A 1VLMA 5CLJA 4UBNA 3B7PA 4WK0B 2INGX 5CX1A 1S9DA 2X8WA 4PGAA 3UBTA 3HZHA 3BF8A 2P5TB 3LQYA 3MB5A 5EY5B 3MJVA 3DAGA 4RVUA 5EHQA 3N6VA 3AIKA 4N5MA 3H5AA 2FMIA 1PL8A 2J9YB 2Y2UA 3JRXA 4ZOBA 4BB0A 5M29A 3DE3X 4RTSA 3C7TA 1GUBA 1YU9A 2Y0BA 4LRUA 4B7CA 2X1MA 2Z83A 3FF4A 4G37A 3K32A 3K5HA 1G9XA 4DSOA 3GJ3A 1C1XB 2EP5A 1I4OA 4ZRMA 1OU0A 4JL5A 4F5DA 4PPFA 4XGKA 1C5KA 3E5MA 3SYLA 2BHSA 4M38A 2XUOA 1C9JA 4AL4A 2IZ6A 3EXAA 4C6SA 2P5SA 4YMGA 2O3SA 3QU5A 3GEPA 2EQ5A 3ZCTA 5MDHA 1F9AA 3K96A 3UPTA 1D4ZA 3URKA 1XA0A 2I4MA 1T15A 2AS0A 2POQX 4HRYA 3THSA 3NIDB 4WKCA 1E5TA 1Y5NA 4GICA 4ZXPA 4HZIA 5I8ZA 1XAJA 2ETXA 3M34A 2TMGA 2ANCA 5TMEA 2GN8A 1TCAA 2YJ5A 2QWXA 2P5YA 3JD0A 3JQPA 4JFRA 1T2VA 4NCXA 5K1ZA 3W5CA 1G8MA 3FFTA 1T5BA 4AP9A 2IXEA 3MSXA 4EW2A 1WOYA 4CM8B 4ZKDA 3OHSX 4MUIA 3FTQA 5T64A 5IXJA 1N6OA 1A5TA 2WJHA 1GUYA 4UC0A 5J59A 4A8HA 3C98A 4X1KB 1JEEA 1SULA 2BFEB 2JJ1A 1G7RA 2WZQA 2DHRA 3HCEA 3OLVA 4RYDA 1KH2A 1SG0A 3VV3A 2VHUA 4CIXA 1TQHA 4RKWA 4UQOA 1KZ4A 4J9VA 4UZEA 4GKAA 4G09A 4MWSA 3G49A 4KMOA 4HDAA 4F11A 2AQHA 1J09A 2BFEA 4QJBA 1SCIA 2I67A 2JFQA 4D41A 5CEEA 2WWHA 2IU6A 2WTUA 1Z13A 2CXXA 5JS7A 4ERNA 3C24A 3DZHA 1HT2E 2A35A 2H52A 3GW8A 4M37A 5A0FA 5JVDA 4GOKA 3ZWMA 5JAPA 3X44A 3S8EA 1KMMA 5DEOA 1KFEB 3V4FA 2G07A 2XUFA 4TWRA 4U7PB 1DQYA 3P2KA 3VPHA 1HLFA 1YBMA 5CH5A 3GPIA 1TGVA 5FOVA 3H1TA 2PCJA 4JGGA 1YV9A 2R6GA 4FR5A 4UXHA 2AC4A 2YH2A 4XIGS 3ZGVA 2XXAB 1CTQA 3P2YA 2JDIA 4X00A 1A9SA 5HFAA 1X7HA 2R68A 5JNWA 3ELYA 3ILVA 2XITA 2CXNA 2GMWA 4GR5A 3GYBA 1LC0A 3FLMA 4HNAA 4K0RA 3E9CA 1E9BA 3QUAA 4HNQA 1MJNA 1V47A 1J0AA 3VH4A 4BNHA 5CXQA 5EJ6A 1GPKA 3CIFA 4A6DA 5ABPA 4QBKA 4HGOA 1AN9A 1JQBA 1RAAA 3OFND 2R9VA 1D8TA 4E5NA 2YMLA 2JJMA 3QX9A 2P6NA 4JFAA 2JLXA 4NFSA 2VC2B 4OQZA 5ICFA 2WD9A 4YP6A 3ZVKA 1IBKB 4RPGA 4X1IA 4YACA 4F85A 4GMDA 4EHBA 2W6CX 3CX8A 1SA0B 3TN7A 2FNAA 1DOHA 2JZOA 2OFOA 1SVSA 3DEFA 3PDWA 1RZ3A 1X1RA 2H07A 2EFDB 4X63A 2ENUA 3WICA 1EFVA 1XZDA 4RVSA 4CDRA 1ZN7A 3IO3A 3NPMA 1YO6A 3AC0A 3JALA 2HI0A 1RJWA 5AK5A 4B7XA 2Y4OA 4KH1A 3I6MA 4UATA 4L27A 1IZ9A 4WZAB 3U3KA 1YK0A 4CETA 1YDEA 3MWFA 4MDEA 3WB9A 2Q7OE 4JLKA 4FM9A 1MDFA 3FKJA 5JD5A 1DEAA 1AKNA 3FMIA 4PX9A 4YPVA 4PHTA 1WETA 2YC4C 1KS2A 1TW2A 2YJGA 4IY1A 4D9EA 5AVZA 2ZSUA 4BPBA 4A27A 4MPPA 2YXBA 4B83A 3H5VA 3RUCA 4DV3B 1SXGA 1V8ZA 1MAAA 3I4CA 4B3BA 3NAZA 3I6IA 2Z6AA 1JG1A 2HREA 2XGMA 4NZOA 4BO8A 1JHZA 2GK6A 4EG7A 2QUKA 1LTHR 4J8PA 1QYXA 1VMEA 4JBNA 3ANXA 4QTUB 3RWMB 3UG7A 1SQ5A 3FR7A 3LNTA 1JHPA 2PY6A 2J3IA 3AB3A 1SBQA 2HXYA 3PYXA 3VPGA 4BEJA 5EHZA 1P2DA 1FU7A 2PU7A 2RAPA 2RBEA 3GU3A 1J23A 4FGUA 5IH3A 4C30A 4CKYA 4DBLC 4DKJA 4XA8A 5C80A 2ALJA 5H1YA 3EA4A 2VK8A 3QHPA 2PS3A 3U31A 3UJBA 4Y9SA 4BLWA 3IALA 2AE1A 2PQMA 2XLBA 4FOTA 1ZCZA 3VDXA 5KIAA 4NCBA 4REQA 1MAUA 3TK1A 2M98A 3ECCA 4DWOA 4RUKA 5DV9A 4D0SA 5BWLA 5CB4F 4PGHA 1F8GA 3WKDA 2CL0X 3ZDRA 5LBUA 4EW3A 1S9HA 3OF3A 5FR1A 1M5TA 1RJGA 1C9DB 2DPYA 2NYRA 3IP9A 5EZYB 3GLIA 3GFOA 4R5HA 2ZRQA 1VLZA 1YACA 2BRUC 4JOBA 1LC3A 1WX1A 3T7IA 3TZLA 4DIFA 2FUKA 2A5LA 2CUNA 2C3YA 4CEIB 1UBCA 4AF7A 3RQIA 5A4AA 4KQXA 5IMSA 3NBYC 3VPFA 3ELDA 3W9SA 1BOOA 4PC2A 3DNMA 4YRZA 4UUMA 2XQKA 1SVIA 4D80A 4HH3C 2RK6A 3CV3A 1DKQA 1NBHA 3A1VA 4IIXA 1A2BA 3NETA 4XKJA 4B4OA 3X2EA 4DARA 1RJDA 4YNBA 1HH4A 1JFSA 1KYTA 2WG0A 3FCUB 3IDOA 4KLAA 1T5HX 2ZRAA 3FVTA 1I01A 4AF6A 4B6EA 1E61A 4A2PA 1KI1A 4K5QA 3EF1A 5IPFA 5GJBA 3Q9LA 4GZ5A 1LH0A 4R0NA 4WKGA 2A88A 1OTXA 2KWIA 2D1QA 1NW8A 4BLTA 1NKSA 2BM1A 1OWLA 4CHTA 1UAYA 1SZDA 4DDHA 3H1FA 1MB4A 2XVXA 3QVLA 3Q10A 4G8DA 3T5BA 2YASA 4PCLA 1ZPDA 4S12A 4IICA 4MW2A 3TE7A 4AQ7A 1KJ8A 5DK4A 3EGVA 5GM2A 2GLUA 3OA2A 5HMLA 1Q3TA 2EU8A 1KL7A 2KQUA 1OYYA 4XOIA 4EFNA 1ODIA 1LF0A 3EC7A 2CK3D 5LD2C 1C9MA 4LVUA 5ADUS 2WMOB 1O2DA 4BNUA 2GK3A 5JDCA 1J49A 5KC9A 4GBED 3KB2A 4RJLA 3FOZA 1ESCA 4OLFA 3WGOA 3DTYA 1IN7A 1I24A 3AQ4A 3H8VA 4KGVA 2ZRPA 4P3NA 4CMBA 5JMWA 3I09A 4NAVA 4C2AA 3PEYA 4HNUA 2W6IA 1Z5VA 1FYEA 5FI3A 3WQQA 2O8BA 1RYYA 2NPIA 4XB6B 3UICA 4ENPA 1P4SA 4IOLA 2AF4C 4QELA 1B4DA 1X8KA 1X80B 4N5LA 2CC2A 4YP1A 3EXFB 2GPBA 1SD2A 5ITVA 1QIMA 3NHMA 4RE6A 2VTBA 2PSFA 3WMGA 2VRCA 2RDMA 4FFBB 5JO0A 1N34B 1BFKA 5I7AA 2IHYA 1NXVA 1W1WA 2G8LA 2WSIA 4ZVKA 4WFKA 1KFBB 1W0KD 2XMCA 4KHZA 4DQXA 4CGYA 1U6KA 3G7NA 3GC6A 4YTEA 4BLRA 3O84A 5K8UA 4IQFA 4E1VA 5HKOA 2EFHB 3AEUA 3GOQA 1FJXA 3L7NA 2NGRA 3MFYA 3V8VA 1TEHA 1PK7A 3QELA 2VTKA 4MRVA 1EXDA 5JDIC 2RONA 2XPCA 4DV4B 3ROZA 4OI0A 1JU9A 1T6BY 2LRHA 4AJEA 2FVYA 2BN4A 3GOHA 4RMGA 4E94A 4G23A 4IOJA 3IS3A 2WT9A 3KQHA 4JASB 4LKRA 1RPAA 4IGFA 1ATIA 1IULA 2WHRA 4M1KA 3S0JA 4UUAA 1M6EX 4PAGA 3JYOA 2J0EA 3VDMA 2C8JA 4A0FA 4AG3A 2IYVA 3BXEA 3NHAA 3A4YA 1VIDA 1PT7A 2E5FA 3DVLA 4Y1RA 2CDAA 3NBQA 3QF4A 5JPIA 1RCTE 3EQ8A 1BMFD 1EG2A 4GECA 1D1SA 4MLDA 1FOEB 2LNDA 2Q62A 2A1IA 3WGJA 4UQLA 3ZJVA 3BTOA 5LOVA 3LFTA 1MTZA 4TRJA 2HRDA 1CT9A 4HDSA 4ZO6A 3ZGNA 2PUGA 4OLJA 5FBLB 4DS3A 3QF4B 1QTRA 4NZPA 4B47A 1APBA 1KO1A 2GDJA 3IULA 4TMVA 3GA5A 4CCYA 4CR6A 1VLHA 2QENA 1I36A 4P4GA 3EGDB 1QO0D 4L95C 2F17A 5I9IA 3C1AA 1RTKA 2BFNA 2VYFA 2HDHA 4WNAA 2R6ZA 3IHWA 3UOGA 5KOJA 3MHTA 1Z56C 5TPWB 5KI6A 1Z2PX 2I6TA 4GFDA 3TIVA 4ZO7A 4TL7A 1FMCA 2O0JA 2H1OA 2ZJ6A 5EXXA 4OM7A 2ZUSA 4L4XA 3VNQA 4BFZA 5DMHA 1TNDA 3CW2A 5CDFA 5ADWA 1K75A 2CZQA 2VUHB 5CJ2A 4QZVA 4YMLA 3ZJ4A 1N8NA 2ZT7A 4AJJA 1PKEA 1P4HA 4D2IA 3DE5X 3RTAA 5GQSA 1COWD 4E2YA 4I46A 1EK6A 4UHEA 4ARVA 1F8YA 1LV8A 2VP5A 1P29A 1M10A 1GCGA 2BEWA 4CKBA 1QQAA 4N8DA 1KJJA 2CLCX 1XTVA 1FFCA 1Z33A 3FVRA 2QIPA 4JR1A 1ZGHA 3Q15C 4IH4A 4JBHA 1SBZA 2XR1A 1RPJA 3H8JA 3L0OA 4MUGA 1UDRA 4Z9YA 1VYHA 5EJEA 3K0CC 5CCDA 5SZHB 3UENA 3WIVA 1GEGA 3DW1X 1NMQA 5ADVA 4MK4A 3B51X 4XH9B 5BPFA 1VRVA 2I34A 4LQLA 1DP4A 3TGLA 3MJCA 3W3ZB 1PJ2A 3JQQA 3D6VA 1RMQA 1T9ZA 4UNQA 1PQYA 4QPZA 4IP0A 4C2TA 1CRQA 3IDSA 4LOLA 4PRKA 3CTMA 3W5UA 3FHTA 1U0GA 3GR6A 2IBTA 1QE5A 1O97C 2ACEA 2CVOA 1LGYA 2ILVA 3ON5A 4TS4A 3GXBA 3F5DA 2X15A 4UM8B 4E2FA 1EUCB 4AN1A 2HRCA 2OO3A 4RZ2A 4TLDA 1Z47A 4AMYA 1MD9A 1J99A 2AK3A 4I50F 4NNJA 4NX2A 3DTNA 4G67A 4TS3A 2HCFA 1JQEA 1SVOA 3DGEC 2WLTA 4JDUA 4P86A 3ZWVA 1NFRA 3PC3A 1OI3A 4FZRA 4LTDA 1KVTA 1II9A 2FJUA 1Z3IX 3MWYW 4DSAA 4FLEA 2EFGA 1A7KA 4JS0A 3WA7A 4ZVVA 4RDCA 5KWIA 1KH3A 2B2XA 2Y99A 3VR5A 3W78A 4ZDIA 1N9GA 4RORA 3HJCA 4MMXB 3I42A 3AGPA 2PK3A 2WVGA 4Q3AA 2G0TA 3O4GA 4B6SA 2DUUA 1HF3A 1LZKA 5A9SA 4EY8A 5I48A 2G1PA 4TS1A 5ERGB 3F1LA 1E0KA 2C7BA 3QYFA 3ROMA 1EP9A 1HKHA 1EDOA 4KQ9A 2MYUA 1CZHA 1IE3A 1EA5A 1MIOA 1NM5C 1W25A 1XI2A 2GJ8A 2H8KA 3EPRA 3PQ5A 1ULAA 4O29A 4PYKA 2A5GA 4PBRA 1SN7A 3GQBA 3N5KA 1YRAA 5CLLA 2A0WA 2I4LA 3K6JA 3PS9A 4M1WA 1DDOA 3FDZA 2V0CA 1ZGZA 1YB4A 1Z0JA 2J9XB 2A9OA 2PMBA 3BWCA 2ZJ3A 1U0LA 4RPCA 4EW6A 1VSUA 2BF7A 2QS9A 3DMRA 3TWOA 3K5IA 2QW8A 1AUOA 3OQVA 3QIVA 5CA1B 5J1SB 1WDTA 4WBSA 3DWEX 3IV9A 1H3NA 3GQBB 5E9JA 5TXGA 2TMKA 3UWMA 4RM3A 4POOA 1J20A 1NV9A 5IWAB 2IHNA 5BN3B 4KV7A 2JATA 3STHA 2QG6A 2IW1A 5IAKA 5EJIA 3RFVA 1ODCA 1XC7A 2F43B 4C04A 4YRBA 4K6MA 4R69A 1T3ZA 5C1BA 2FPKA 3AUKA 3DDNA 3D6HA 4LDQA 5JDCC 1A4RA 3S2IA 2WJZB 1QRUA 3FCAA 4ZU6X 2HU8A 3ETNA 2IGTA 3KXKA 2FFHA 5EGNA 4GX1A 3WK8A 3W4JA 4LIPD 4R3WA 1BE8A 2D2XA 1F14A 3KWFA 3LK7A 4COOA 3GRUA 1O9GA 2PUHA 1JJBA 2VBCA 3JQ7B 4KX5A 2P9GA 5MN6A 4D7AA 1KJQA 3BRWD 3KOYA 2GJ4A 2GOYA 4OMFG 2FY8A 2VG8A 3GJXC 1JEAA 1VKHA 2WINI 1Y8RA 3C8UA 3LPDA 2XWBF 4CM6A 4N5HX 3GFVA 4X71A 3QQPA 4KI7A 3BEOA 5EMHA 2IP1A 1P2FA 2A67A 2D3TA 3GPBA 4EYKA 4WJLA 1C8LA 1EE1A 1AXGA 3G82C 3S29A 3FCSB 4W5OA 1I2MA 2O0LA 1YHZA 1EMDA 3T7KA 1U1EA 2A1UB 1ZGAA 2ERCA 3VYVA 2O5EA 5EFOA 2Q07A 3H5NA 5ITZB 3UTDA 1ORDA 1SUDA 1W4CA 1R6VA 1BSVA 4M1YA 3RYIA 2OZLA 3D2AA 4NVRA 1AURA 4NJEA 3ZWPA 2JBHA 4DCMA 4AXXA 1PR3A 2WMYA 1EYZA 5T4FA 1FVXA 5K09A 1DINA 1N5KA 1U4OA 4LGVA 3OIFA 3W6ZA 1F8XA 1AZTA 1PLJA 2C4TA 2VWQA 3MWDA 4GLFA 1VRCA 5FYDA 1T43A 2GEBA 5LMCA 2IXBA 1JLLA 4GOND 3U6BA 4GP9A 4DR4B 3H2BA 3DS8A 1A9OA 4ALLA 5FWNA 1N6PA 2AG1A 4OV6B 3IUYA 3AHEA 4U39A 5EOVA 5LC1A 1TIBA 1ELOA 3UF0A 4CLXA 4F6RB 2EXXA 3GZNA 1G42A 4F7DA 2PKQO 3NS7A 4Q4LA 4XARA 2JLZA 3D43A 5C46F 1XCJA 1ESNA 2NNLD 2VF5X 2Y71A 3DWIA 3FY4A 3ITNA 1DDIA 5AI0A 2DYKA 2GQ0A 2Z58A 4Y2HA 3PJEA 3JQ9C 5AVXA 3R4CA 3USCS 1QHIA 1P6UA 1VCNA 1Z7BA 2CF5A 2PUJA 3KLOA 3M33A 3GJ4A 4ZJYA 5CVTA 1LDNA 1Y6FA 2FW9A 3DOOA 1MV5A 2VNAA 3O8RA 2ZR0A 4J75A 1AGYA 4OOEA 4HAWA 3SP1A 1YTLA 4BV9A 1W73A 1XMPA 1P4GA 4LYGA 2RHMA 5FQNA 5JNSA 2YDYA 3AG6A 4AMVA 3TZKA 2UYHA 2OBNA 2C5SA 3EWIA 2B0JA 3NBMA 4TMXA 4EPYA 2W2NA 4B7UA 5JAUA 4PHGA 1F7UA 3HJRA 4Y30A 3GEBA 1HEIA 2R8EA 1ZY2A 3C4QA 3HCRA 5DTQA 1PTKA 1P9OA 2R4QA 3RVPA 5K6AC 3AI3A 2EX1A 3IL2A 1NVAA 1V1RA 4B76A 4RJ2A 3RV4A 3FMPB 2VRWA 4ITVA 1TD1A 3FZNA 1U5AA 2HO4A 1MHPA 3DBRB 3GWGA 1R16A 4O3MA 3E3AA 5TMDA 5C35A 1KWGA 2WQ6A 3ZQ4A 1QHGA 1JDVA 4QJ5A 1HDOA 1AQYA 4KBFA 5F78A 5GONB 2D1TA 1XTJA 3HS3A 1KKUA 3EH1A 3BXOA 2QX7A 3HXQA 1Z08A 3M81A 4U63A 2OSVA 3JQAA 2AVDA 1UJCA 3ANNA 1A77A 4K9OA 1EWYA 2IKQA 3LT1A 3LZDA 5I9BA 1QGOA 4QLBA 5B7NA 4UVHA 3T5AA 4B3TB 4L6IA 1GG2A 3CW8X 2OHGA 2V0GA 1TLLA 1BJRE 4C3UA 1FQKA 1M1YA 4Z1MA 5LQNA 1ZLYA 3Q3CA 3KUDA 2G83A 2F3SA 3ETGA 3KYIB 4KTVE 4LI0A 1XHLA 2CW5A 3HKBB 4LVCA 4QYIA 3TVDA 4EHLA 5CD1A 3BJIC 3KQKA 1PTJA 3GVIA 3HBJA 4PSUA 4FLMA 1R2QA 4R9SA 4EUEA 1BX3A 1GQRA 1M8FA 2P3SA 1RRVA 2XNDA 2XUJA 3CT6A 4Y2UA 4RV5A 5DT2A 5A5FA 2APJA 2W8BA 4X8MA 2QE7D 4QTTB 1FB5A 3EEQA 4FIZA 4IEEA 2UXDB 3MJ4A 4FLFA 1Y3IA 1P33A 1M5RA 1NI3A 1K3FA 2BVNA 3L4SO 5EE1A 3X2FA 2PGIA 3ZXXA 4TT3A 4E2WA 1YTUA 3UMRA 3CE6A 16PKA 2EQAA 4PBTA 2GPWA 2C5AA 3QW4B 4FINA 4RY0A 4BUZA 4ZHSA 3GGSA 2F2TA 4RDXA 2J3MA 1WULS 3FTNA 4ZT2A 1UXJA 2WM3A 2W2PA 1GKIA 2YIDA 4H16A 2O7RA 2X8BA 5JYCA 3FKSA 5AI5A 4D4MA 2XZOA 1F0PA 1O1YA 3NB0A 4AO8A 2HIMA 1RXYA 1YA8A 4JT2A 3S5JA 3WY9A 2R48A 4KNWA 5JXHA 2OV2A 5EUQB 2RI0A 2JBAB 4H7FA 1RQRA 3THOA 1ECBA 5L51A 1SKBA 2O7QA 1XRQA 2PJRA 1RADA 1O03A 3HZZA 2OD9A 4A2QA 3BHMA 1R3UA 1YD7A 4PC1A 1U8CB 3H2KA 4QOGA 4RZSA 4WESB 4GP6A 3S28A 3EDMA 1G5PA 4CKZA 3V4OA 5JWOA 1K0UA 4V3BA 3V33A 4OG2A 3DD1A 2FRXA 3V55A 2BFDB 3ZHVA 3IJPA 1XLTC 1T36A 5T5QA 5COQA 4OB6A 1EXNA 4W5RA 4J0FA 3CR8A 5K3OA 1C0IA 1SCJA 2L82A 3QVMA 3NXKA 5E2AA 3VU3A 3LJKA 4KPYA 4J03A 4JELA 1S8NA 3OZGA 4AJ1A 2V0NA 3H8SA 1U2DA 2F1IA 1PSZA 3V6MA 4B84A 1TVKA 3WDSA 2P9YA 1N2XA 3JARB 3SLKA 4KQFA 3ZHUA 1KJIA 2YV5A 4J7AA 1QYVA 1WF3A 2P2ZA 3I2FA 5JZBA 5EJ8A 3C2QA 4NI5A 2JFYA 4JWTA 1I33A 1LRLA 1K3TA 2QUZA 3EZ2A 3L7MA 2FSGA 4I1UA 5EUMA 3RS5A 1G8FA 3TR0A 3W8DA 4BX9A 2YJ4A 3C14C 1CC1S 3HYRA 5GVSA 2VLIA 4P7KA 2FN9A 2CY0A 1T4MA 2WT8A 3BJRA 2I2BA 1G6Q1 4S1OA 3CH5A 1PV4A 1HMPA 3MJFA 4FFVA 3D4IA 4O63O 2J5BA 4KW7A 4MP6A 4RK4A 1XRLA 3HG7A 1NGSA 1NBWB 5ALOA 4IM7A 4ALMA 4DT1B 2FN7A 2AX4A 3FH0A 2P9BA 3GLUA 3I8OA 3G68A 2ZAOA 3K9CA 3U56A 3NTLA 4QUJA 3CLKA 1OX4A 3COPA 3EG9A 4LC9A 1T0IA 3H4MA 3HA3A 2C04A 3TINA 4QBTA 1I1QB 5I9SA 3H11A 5I4CA 5HF8A 2H1LA 4D8VA 3GNLA 2WTXA 1NC3A 3A6JA 3PQ6A 3J81k 9LDTA 3D02A 3TM4A 2ZVDA 2W8BB 4PZEA 4O4LF 4NOKA 1LNQA 3ZWWA 1JPJA 2GJSA 2G5CA 2H65A 1KARA 4LEIA 2IUTA 3JD3A 5JPCA 5LOVB 3ES9A 3CVUA 5IXYA 1FW6A 4WY2A 2XT6A 2AEFA 4FR2A 4KXXA 2ON6A 3KVYA 1P18A 3AKCA 3AUTA 3LH5A 4YIHA 1BS9A 1OA1A 1ZX1A 3MWKA 1KJZA 3REQB 1DTSA 4RY2A 1EEXB 1NR7A 2JFGA 4TSKA 2AZMA 3GVXA 3EW7A 2FOIA 2GA9A 2RAUA 4OQLA 5BR8B 4IW3B 4N18A 4Q7QA 3VSBA 2VSXA 3VO8A 2QM7A 3G3EA 1LSJA 3I45A 1EVEA 5HCUA 2FCAA 5K0BA 4FDTA 2YZGA 3OFKA 3AY7A 2CE7A 1K6EA 1U8TA 1V4VA 3G79A 1VSBA 2X14A 3WG9A 5E1BA 1P6XA 1XTBA 3GCXA 5DB4A 3W2HA 3A4VA 2JGJA 2FUEA 3MPOA 1V8BA 5G3YA 3NUGA 2AW3A 4IINA 5JCPA 2I8LA 3BUSA 1NMXA 1GXSA 2IYOA 4QXQA 2PZEA 3HLTA 1IY9A 1NWHA 1CNFA 4IV5A 1KJWA 1AZLA 2O2XA 4PSCA 4RVGA 4XX0B 4LCJA 2FEKA 4JBLA 3IA2A 4LRQA 2I78A 1QCZA 3PV0A 3FSRA 3RYHA 2VQSA 1CUEA 2JJYA 3LPAA 1KDYA 1GTSA 2OHJA 2F55A 1HOTA 2WV9A 4JBYA 4TMWA 4DXAA 1QUFA 1FMJA 3VPBA 2QTGA 3ERCA 2OXEA 2HC9A 3UJ8A 4G1CA 2PIAA 1AT1A 1LK0A 2NTEA 2QGNA 2V8OA 2G1UA 3MAJA 1T9BA 4EQ6A 4B4KA 1S3FA 3VH3A 1OT5A 4F91B 2A7QA 1QRDA 2ZSHA 4H7HA 1WCYA 1ZVMA 4CNQA 5KINB 2J5XA 4EF5A 3KAQA 4PYNA 3N2KB 5EHXA 3OTOB 5JLAA 3Q9NA 1NNUA 5IVIA 5ALNA 1KPGA 1PW5A 2VJKA 3FCYA 2XF8A 1D1PA 2YV2A 4TOIA 3FAZA 4XQCA 3LY7A 4Y1EA 4CDNA 1CG6A 3CUSA 1HTBA 3GCZA 4XYEA 5BMOA 5JAHA 1T6YA 2VJLA 4IXTA 5AK6A 4LHYA 2GHIA 4AKGA 4YR9A 2QYTA 2HQOA 3U7QB 1XYGA 4QOJA 3G0OA 2H5EA 4BB6A 1L7MA 1YI0A 2QU7A 4HMOA 5KJ1A 5FR2A 3EXG2 1PQUA 6NULA 1UEIA 1Z0KA 3FMGA 1NJ8A 3S27A 1R0XA 3WGMA 3A9TA 4DCNA 4F5ZA 4LXYA 5DYIA 5K0EA 5DN9A 2C7QA 3K6RA 2CNWD 1RJFA 4KIJA 2XKBA 4GPAA 1N1GA 2IHBA 3REOA 4FE7A 5E3HA 4D8YA 4YCJA 2QUBA 1ZVKA 3LYUA 1E9AA 2H2AA 1NSYA 1MQ8B 3B48A 3EXIA 3NHBA 3PKZA 4LHWA 4YMSA 4F6LA 2C5HA 3EQ9A 1AGPA 1TZCA 5KYUB 1F3OA 4UTPA 3QXHA 2ZKIA 4FOPA 4Q15A 1YJBA 3KQSA 3NLLA 4JXXA 1Y8QA 5FH9A 5JVDF 1J9GA 2H7XA 4LX8A 4Y8VA 4YRSA 1TTQB 3URMA 4C29A 3OEEA 1QVWA 4DR6B 2B6HA 3L07A 3ZDQA 1T2EA 2NACA 2B4RO 4TYWA 3JWJA 4UHBA 2X40A 3PGKA 4U3JA 1AKEA 1R66A 1KBZA 3NV9A 1YZKA 1FYVA 4MVWA 3OLCX 3CBGA 4LJKA 4MJLA 3F5FA 1PSDA 4PC6A 3UMFA 1MIHA 3A9VA 1IZ8A 4H0NA 3AERA 3LKVA 4L4RA 1NI4A 1ZZGA 4GXQA 2QTVB 2P3QA 3UXHA 2JFZA 5IFLA 3QLUC 1EM8A 4K0KB 3H8WA 3JASB 2GVDC 2SICE 2BT4A 4FI3C 1A95A 1V2HE 1N57A 3EZFA 3O8BA 5DBOA 5GOZA 4ZV7A 4CUZA 2FWJA 1X94A 1KYWA 5CK4A 4CQNA 2VT3A 3RIEA 4RZIA 2C9ZA 2Q8QA 1RJEA 4Q4JB 4WH0A 4X1KA 4EY5A 3DE6X 1EGMB 1I5OA 1X7GA 2OM2A 2PL1A 5GTDA 3WL3A 4LBWA 4OP2A 2IPLA 3CPEA 5ECGC 2JHPA 4H4DA 3ZC3A 2GN1A 4IH1A 2XECA 1S01A 3VGJA 1Z74A 3KAPA 5CFQA 1JIVA 3RS7A 3QKTA 2WI8A 3JX9A 4IIGA 3RB8A 1JDSA 3VDQA 4GZMA 2GAJA 3CNQS 2PMFA 3BWEA 5E6RA 5IC5A 4KQEA 1VYVA 1WXGA 3B2EA 3N6XA 3QPWA 3W3AH 5AQ1A 4UBKA 1MW8X 2I4TA 4RPKA 4KV9A 2JKZA 3HFJA 3HXMA 2NXJA 3H2SA 5ENZA 2C95A 3EIFA 3PI6A 5DP1A 4B7AA 4HB2A 2ECQA 4R7GA 5ALHA 3THYA 4V02A 1Z2OX 5F33A 1CQXA 3NHKA 5J5AA 3UANA 4GIBA 1GTRA 4IMJB 1JHRA 2WTNA 1GPYA 3E35A 1OH7A 2D4AA 3K71B 1AHHA 2BZ1A 2DHQA 2FRDA 1YFZA 3PR3A 1T5DX 2GUWA 4IGIA 1NBEA 1BCSA 4ZVRA 3RIMA 1VE3A 3M83A 3QWFA 2XD9A 1TEVA 2QN1A 1TM4E 1D5WA 2B20A 4MX8A 4KOAA 1E0SA 1VSTA 5GIOE 1KMIY 1GQ2A 4ZALA 4P54A 3R20A 3OZFA 2ZS7A 4R9RA 4MKIA 2E9SA 4C22A 3NNDA 1TJNA 4TL8A 3L6CA 1G5IA 1JU4A 1T4CA 3TXAA 1E5VA 2FWMX 3K70D 5FL7D 5KYUA 1QIHA 2ZIVB 5FJJA 2AEEA 4ND4A 1GGJA 4TV9B 2PQ0A 1RRPA 2B82A 5G4KA 3T41A 1G5FA 1NMSA 3I9KA 5HYVA 4IXMA 3SEAA 2C7OA 2JHGA 3O9ZA 1PGPA 2JHFA 2VK2A 1E1CA 1PGJA 1YJAA 5FV7A 3BVPA 1N9ZA 2DY1A 4JLSA 3ZXUB 3SM9A 1BS1A 3FYTA 2ONKA 3E9MA 3DOFA 4IX9A 4Q7JB 2AMYA 1XWIA 5FWYA 3VYTB 4Z49A 3SEFA 4CIYA 4RJIA 2MR6A 2R62A 2R8YA 3GGCA 5DN6A 1MOPA 4DANA 5TRTA 1NYQA 1F2TB 1YRQA 2BD0A 2WSMA 3TOXA 2ECFA 2R7LA 3K0EA 4U6NA 1SC1A 4CQLA 5I8WA 2G76A 3EFOB 1XVUA 4LJ5A 4DMRA 4BQQA 3OVMA 2CHVA 4CCAA 1QDUA 1FY2A 2QVLA 4Q24A 4RD6A 4XPIB 3FPSA 1ABFA 4FYPA 4I4CA 4P80A 3GT3A 1KR5A 4MUAA 4UBMA 5JAZA 1C9EA 5AI6A 4J2TA 1ISGA 3HDJA 3Q12A 3Q41A 5T6MA 3SK0A 3TQOA 2HWYA 4H2DA 3ZHZA 2KJQA 4I36A 3MCWA 1G66A 5A7GA 4UHDA 2EHDA 3W6NA 1PV2A 4YP9A 5J4HA 1C0EA 1OR8A 1UK9A 2VYNA 3OPNA 2D13A 1DSSG 4Y2SA 3IBCA 3SFTA 3MCVA 4RZ3A 1DNPA 1UOEA 1J8DA 4Q02A 1V9LA 2CFRA 1ZGGA 3MXOA 4BV2A 4G0PA 2B83A 5H3CA 4XYLA 1UBUS 2DCMA 3L7CA 4H4EA 3R3YA 5JD3A 3ZDAA 5DBGA 4H1TA 3HCBA 2X42A 4EG6A 3SHWA 5JNLA 3ZJ5A 1I6MA 5AM5A 3N2ZB 1V0JA 2C78A 1LSOA 2VKTA 2Q1UA 4S35A 4RO0A 2G4VA 3GRZA 1CWUA 1VG9B 1ZRMA 3BZUA 1KZHA 1T3LA 2C5BA 3TDKA 3CXRA 3G23A 4W63A 2OUKA 4TV9F 1AHPA 2OQIA 2RGUA 4KQWA 4QUDA 1OKKA 2AXQA 3OIUA 1YSCA 3L84A 3IT1A 3G0GA 4GWGA 4LZWA 4QIHA 4WOBA 3RFTA 5DJ5A 3AUXA 3L46A 4IZHA 1XLUA 2JC3A 1WD5A 2VQDA 4MS1B 3W1WA 1Z25A 1M34A 1Q91A 1NT4A 1W87A 2HY7A 3QWHA 1RWOA 2I9KA 3QFSA 3JWGA 1WY5A 1S2DA 3KZNA 3NEAA 3AEKB 3QSYA 2XKJE 2F9LA 4P84A 2BH2A 1V96A 2CXQA 3R2JA 4YR7A 1D0VA 4A6EA 1GY8A 1FNDA 1M34B 1ZO8A 1QZXA 4G8CA 3F5MA 2DBVO 1DTWA 4JJKA 4L5JA 5DP2A 4WLEA 4F9EA 4CMHA 2HHJA 2A4KA 1JIIA 4BP8A 4D02A 4KRGA 5EZSA 2GO7A 1SU6A 2C1EA 2W2QA 3ELUA 1RRKA 2O5RA 3ESQA 3O3MB 4KUEA 1D5CA 1NX9A 4XVQA 5H8WA 2FFQA 3A14A 5DSXA 2GXAA 3AUJB 2P69A 1QVVA 3HU2A 4V1CA 1HXHA 4XRGA 1MC4A 4Y1FA 5CA0F 5FWYB 4HDQB 4MAMA 1NMEA 3WBKA 1P45A 3ZIUA 2HBYA 3QI2A 3CZAA 4FILA 2CDNA 1JR3D 4DWJA 2CMHA 1GZ5A 5IS2A 1U9YA 1KBOA 4YVFA 5LYYA 3EZGA 2VVTA 1D07A 3V8EA 3AW8A 2CV0A 1BE0A 3Q7QA 1YB7A 1NJSA 3COVA 1YKGA 1M0WA 1CVRA 4WFJA 3R44A 1BGVA 4M0LA 3RVRA 3PNSA 1M0TA 2OILA 5EGSA 5CRIA 5CFMA 4CM8A 2R65A 3N3BC 3P0FA 3SS8A 3DMNA 4WMLA 3EXEB 4YRQA 1A9XB 4WXMA 5FFNA 3TAUA 1MX1A 1FNSA 3FPJA 4JGIA 4L50A 1CEXA 1XD8A 1KAGA 3GJRA 2E4YA 1XZMA 1PNOA 3D4NA 3NV7A 2Q5JA 4PNPA 1HR0B 1WXXA 2WVJA 3FSGD 1AQIA 3PXUA 2BY4A 2HMYB 1JHVA 5LBTA 4Z51A 3RRXA 5A02A 3A1NA 5FO0A 1EFPA 3PJDA 3MS7A 2VPZA 4EG5A 1J9ZA 3FX2A 2UUBB 3K1JA 2XVMA 1LRJA 4Q16A 4MRNA 1CZNA 3FIJA 4NEGA 1UJMA 3EVZA 3K0KA 4FBGA 1UBSB 4D9FA 5HUHA 2HSEA 3OMWA 3OMLA 3A26A 1GPDG 1K92A 3G88A 3MTQA 3NWJA 4M46A 4YJDA 5JMPA 2EX0A 4TQAA 5EMJA 5F7ZA 4E46A 3ZLBA 4L9RA 1YAHA 4YV2A 3OT1A 3D2BA 3JSAA 3L8DA 4NJMB 3JWPA 2UYQA 1Y8AA 3IJRA 2X8LA 3KVVA 4R05A 4ZT4A 4LK3A 3ZLTA 3WYGA 4EL5A 4PPQA 3O73A 1USUA 4XWWA 4DPMA 1DEHA 3BREA 5AK3A 1JALA 1XJQA 2VHQA 4EJFA 1NVUQ 3DMTC 4HDMB 4F4IA 1SEVA 4YJ3F 1BO6A 3ETDA 3CZ9A 1TMKA 1YR2A 3G9UA 4AO7A 4BOYA 5GPBA 2J41A 4BMNA 4MAFA 3K9BA 5LP6F 4MMZB 1OFIA 4QM7A 3F9CA 3IOEA 2KE5A 2NZUG 4PZZA 1WCXA 2IGBA 3QE3A 1E1MA 1T0JB 2D3WA 2L18A 2H5JA 3BGSA 3M9XA 8ABPA 4RF2A 3IQFA 4CDGA 4MHTA 2AUNA 3LQRA 3K92A 4C4AA 4KG7A 2PWYA 3UJ3X 4TTRA 2VHCA 3BFXA 3EIHA 3F97A 2P30A 1EQ2A 4PGGA 5F2EA 3GGJA 3JD1A 4C7OA 5TT1A 4GSYA 2G1AA 3UWKA 3VTKA 2ZR8A 3DKIA 3OM0A 3FTPA 4G0VA 1C81A 1KQ3A 1YQQA 1IJKA 3EVFA 4Q48A 1ZDMA 1TAHA 4ZMBA 3DJFA 4D9KA 4RHEA 1UPAA 1SIWA 2LDXA 5GJVC 4OI4A 2IH2A 1IPEA 2P9TA 2VZLA 3JQ8A 5IAOA 4RY8A 1O3YA 1MRNA 3QUCA 4HH0A 3NBZC 2FPIB 2H0QA 4RL6A 4L78A 4LOKA 4KRXA 1TUBB 3JQCA 3OIVA 1O5IA 1YUNA 2QAIA 4GM0A 4RLQA 1N5JA 4XSHA 4DIUA 3ND6A 5F9MA 3BMXA 3KSRA 5EHIA 4AU1A 1A5BB 2IPOA 4ILKA 4WCFC 2O1WA 4YS6A 1QFXA 2ZJOA 4EECA 2BGMA 3WIEA 3WAKA 4DIMA 2W2LD 3EB9A 2HZBA 2J4FA 2XODA 4FYJA 1CR6A 5L3ZA 3TDNA 3VZRA 2EW2A 3D6TB 4IG9A 3D6AA 3ONWA 4Q7LA 1EFPB 1DRUA 1SH7A 2ROQA 5CJJA 3WLTA 4C2BA 1DAMA 3VBCA 4Z9BA 2ERYA 2ZAMA 3EAFA 2GLXA 3FNHA 4UAGA 3EGXB 4BKRA 4OOFA 3PHGA 5KYWB 1PUIA 1LDMA 2VDWB 3IEMA 2AYXA 4R7TA 1U3WA 3K70C 3EYAA 1JMVA 3HKDB 4JVSB 3NP7A 4LWOA 1YBHA 3LDGA 3GDHA 2CJYA 4B2LA 1K86A 4XCQA 3B5JA 4INJA 5FAXA 3VR1A 4HLNA 4CKWA 1ORIA 2ZYIA 2V7QD 3PPXA 4GXRA 4IO1A 5KTTA 1YA6A 3TD6A 4OQYA 2YYZA 1SWVA