4GKJO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4gkjO00
4DV3O 4LF9O 4DV0O 1KUQA 1IBLO 1YZBA 4AQYO 4LF8O 4X65O 1DK1A 4LFCO 4X66O 2ZM6O 1J5EO 1XNQO 2F4VO 2DOSA 1HNWO 4DUZO 4K0KO 1HR0O 4LF6O 4DR1O 4OX9O 4OPAA 1I94O 2UXBO 4JI0O 4JI2O 3J80N 5FLXN 1FYJA 4GKJO 4JYAO 4X64O 1N36O 2E5LO 4DV1O 3T1HO 4DR3O 1AB3A 4LF5O 1X59A 1XNRO 2UXDO 4JI1O 1A32A 2VQFO 5LMNO 1HNZO 2ZKOA 3R66A 1F7YA 4JI6O 2UXCO 4LF4O 1NS1A 3RT3C 1R1BA 4JI4O 1HNXO 2N74A 3J7AU 2VQEO 2UUCO 4JI5O 4LFBO 1XEQA 1D2DA 2FKXA 5A2QN 3T1YO 5BXZA 4DUYO 1IBMO 5IWAO 1XMQO 4LFAO 1FJGO 4JV5O 4DV5O 4DR2O 2JRIA 5BR8O 1N32O 3J81N 2DJVA 3M8AA 1IBKO 4B3TO 2UUBO 5H5NA 2HHHO 4DV2O 4DR7O 3JAMN 4B3RO 4B3SO 4A5UB 2AGAA 4YY3O 5BY1A 3SDLA 4NXNO 2UUAO 4DV4O 4YHHO 2UU9O 4X62O 3F5TA 4DR5O 4LF7O 4KHPO 1G1XB 1R6TA 4DR4O 2LW7A 4DV7O 4JI3O 4OPHA 5LMUO 4DR6O 4DV6O 2Z0AA 3O65A 3OTOO 1AILA 4B3MO 4JI7O 1N33O 4GKKO 5IT9N 1FKAO 1XMOO 1N34O 5LL6Y 4JI8O 4NXMO
chains in the Genus database with same CATH superfamily
3F7VC 5J2UA 2YEVA 4G28B 4NB5A 5IY5C 3ZHTA 1N36B 3LNMB 2CH7A 3PN1A 1AR1B 2ZM6O 4I9WA 3SYAA 5JVDA 1MA1A 1L0NH 5JCOA 3FD9A 1MMMA 2ZD9A 1YITV 3N27A 5EBWC 1EZVH 5LA6B 5KAFZ 3DC6A 3AG2B 5GTHZ 4JAUA 3T1HO 4LF5O 1PNKA 2DYRB 2UXDO 1VP7A 3SYOA 1VQ9V 3HKEA 2WA3A 3LSQA 5E79Z 3RYHB 1R1BA 2WPDG 3FAVA 3KKYA 3W7SA 3J7AU 3CXHF 1K8AW 4JI5O 2JEUA 1JJ2U 1WA8B 2JVDA 3GVMA 3ZMSA 1H8EG 5CA1A 4FLYA 2EIKC 5LHIA 1OV9A 4JV5O 3QTCA 4DV5O 3MHSC 1SA0B 2BOBC 2WLJA 1XILA 1WLEA 1IBKO 1L8DA 4B3TO 3H1LH 1ZAUA 4X8AA 5H5NA 4DR5B 1N4CA 3H1HH 3KZIZ 1PPJH 4J11A 3MD0A 1K7DA 1M56B 3JARA 3IC9A 3OTFA 4A5UB 4O4IA 5JCOC 4LH7A 2O57A 2Q0OC 4NR1A 3BHPA 1L1FA 4WCEV 4X1YA 3VQVA 1AI7A 4B7KA 4DV7O 2Q0AA 1S72V 1P49A 2WA4A 1OJHA 2BSKA 4YIOA 2R9IA 4FPPA 4ZI7B 4X20B 4MW8A 1FXKB 3RVYA 4PJ0Z 3DTUB 3ZHSA 4X65O 1M90W 1VIBA 4X1IA 2R72A 3ABUA 2CGOA 4DRXB 1JCHA 2X6AA 1UPGA 2XAHA 1JFFB 3CHXA 4K0KO 2WAMA 3TGUH 1JQ0A 4JYBA 4X1KB 2QKAA 4BWAA 1QU7A 4PDRA 5B66Z 2RJZA 5FLXN 2NNUA 5EBMC 3T1YB 1XHZA 1FS0G 2HR3A 2LQTA 4JI6O 5CN0A 2CUGA 4JI4O 3T1HB 2UXDB 2M6YA 4UCRA 4TV8A 1PKXA 1XEQA 1W2BU 2OIGA 4UCTA 2JK5C 2Q69A 3WFVA 5J9PC 4IIJB 2WWWA 3B4SA 4NXNB 5ITZB 2A0LA 4DV5B 4U3FH 5L3CA 1BHAA 5GTIZ 1NKDA 2Y0IA 1TUBA 4TSFG 5B1BC 2YICA 1CXZB 3JAWB 3B77A 4UB6Z 2IJJA 2NR5A 4KXRA 5CA0B 4R7CA 3FYIB 2QR4A 4DV0B 1KD1W 5LYJA 3CCMV 1IDSA 3ZRWB 2IU3A 1E1QG 4D7SA 4JYYA 1K34A 4ZIBA 4B3MO 4DV7B 1Q6UA 2PGGA 5IJ0A 5KMGB 4JI0B 3JALA 3CRAA 1GMGA 2AZ0A 4JGSA 4E4EA 4FLXA 3HKBA 3RYIA 2HP8A 4B7EA 3RN4A 4MTXA 4CZZA 4DV1B 3FB5C 1J5EO 4KL1A 3T1CA 3ZS8C 2X6CA 1HNWO 3OW2U 2XAGA 2JGDB 1Y4MA 3ABTA 4AI8A 4K0KB 5GW7A 2V7QG 4NTYA 2RDCA 3MHHC 2F66C 1SQXH 3X2QB 1X59A 3K5OA 2VQFO 2V4DA 5KUKA 5L3DA 2HJDA 4WFAV 3OGIB 3SPHA 4TWKA 2QSAA 1AJPA 3H1KH 4RUFA 3AG3B 4FZ1A 2ZINA 4LNUB 1KBHA 4P9PA 3DSQA 2KG7A 1XL6A 1VQPV 2E75B 2EIKB 2EJRA 2YXLA 4EFBA 1S5JA 5B1AB 5KUMA 5DM6V 4BIZA 3QNEA 1NVPD 1WB7A 5B5EZ 2QM8A 2HHHO 1EN6A 1W59A 1OCCB 3P30A 3D36A 1LNQA 2B1IA 1VARA 1PD3A 1R3LC 2RQ6A 2F93B 2AGAA 1YSCA 2YEVB 1SQFA 1QVFU 4PA9A 4J9YB 3E22B 4LF9B 2CH7B 5L3FA 4ZBMA 5JVDB 4TQFA 1YJNV 1MZEA 4MS2A 4IHJA 1MSWD 1SERA 4JI3O 4WBNA 1QHTA 2B9ZA 2F1MA 3CCSV 1U97A 3CRCA 1L0LH 3HKEB 1OZ0A 4ASUG 4P30A 3ZMTA 4LFCO 1Q5OA 3FAVB 1RM1C 2OTJV 1J5EB 2BTOA 4OPAA 3AG4B 4E2LA 4JI2O 3G80A 5CA1B 2YDEA 1Y76A 3ABKB 1FYJA 3ML0A 1K9MW 2ZDIC 5D5PA 3LDCA 4B3RO 3SPJA 1Z2GA 3HPLC 5L3BA 4DR2B 3ZCCA 1K73W 2EILC 2VQFB 4L87A 3CCEV 1K92A 5KHJA 1H2MA 1JJOA 3JARB 2FKXA 3N2GA 4MVQA 1IURA 4O4IB 5KHKA 1LUVA 4FJCC 1FXHA 3AK2A 4MTFA 2WLLA 1SZTA 4X1YB 3L70H 2Y4TA 1N32O 4PDLA 3H01A 4X62B 3P3PA 1VQ7V 1BQ0A 2R9AA 2BSKB 2C2AA 3OFNG 4DR7O 2ZIOA 3SGIA 1BZKA 3OTOB 3SYPA 5LOVA 3OAAG 5FPOA 1WAZA 4JPRA 4DV3B 3U10A 1YXBA 2QEXV 1ENVA 4I5SA 4AQYB 4P9OA 4LF7O 2P22C 4X89A 1N0NA 1PV0A 4DR4O 2PI4A 5LMUO 3A2FA 3SJQC 1YHQV 1V55B 1Q3EA 4WFBV 5LL6Y 2N05A 1S0VA 1ZWIC 3JD4A 2ILMA 4NTXA 2GTAA 1IBLO 2ZQMA 4LF8O 2FMLA 3K9SA 1KQSU 2XT9A 2VS0A 2YUAA 1K4DC 1VEWA 5IE9A 4TV8B 5D5QA 5LGUA 4LFCB 3LNNA 1GKFA 3AG1C 2UXXA 4I55A 4OX9O 3ABMB 4H33A 1Q7YW 2UUCB 1JVMA 3A0RA 1U96A 2HEPA 3UT5A 3ETEA 1JA8A 1N36O 1DGSA 1VF6A 3CS5A 1V9PA 5IWAB 4WFGA 1XMQB 1A32A 3ZRXA 2EIJB 3WB1A 3GWOA 1FFXA 4B3RB 3W7XA 1TUBB 4WF9V 1QLEB 1NQTA 3ETQA 2W0XA 3S3XA 4LFBO 2IJHA 3RYFA 5LXTA 2K9PA 3OUSA 1WJZA 4B3SB 3E8FA 5C8YA 3ABLC 5LYJB 3RYCA 3LSSA 3TJTA 2Q73A 5KLVH 3ZHUA 1SESA 4DV4B 2BOCC 2ZE6A 2XTAA 1TVKA 4KHPB 5B1NA 3SYCA 1FXVA 3K5NA 3FFQA 4MVOA 5IJ0B 2P5OA 1EM1A 3ZHQA 3JALB 4GX5A 5L3EA 1F23A 3OGCC 3JSLA 1AR5A 4RWUA 5LP6C 5KHGA 5BY1A 2CAZC 3HKBB 3RYIB 1O9GA 2NN4A 3F5TA 4DR5O 1QNMA 3NR7A 4MVZA 2Y48A 2Q7GA 5IYCO 5KX5A 1AI4A 2ZT9B 4OPHA 1UFIA 1AI5A 1YCIA 4LF6B 1NTZH 1RPRA 2YXHA 5IDJA 2UXBB 4HYOA 4J10A 4TV9A 2GHYA 1YTFB 2DMXA 4X9QA 2W0FC 5JH7A 1BQZA 2DYSC 2LW1A 3SYQA 5CA3A 5H2FZ 1RM1B 2VRZA 3G71V 1K5QA 3J80N 1Q86W 1P4RA 5DN6G 3Q4HA 4Q6GA 1VQOV 2KG7B 4I50A 3I55V 1VQ4V 4QNHB 5LMNO 3R66A 1F7YA 2DQ0A 1M57C 1FPOA 1TUEB 3OD4A 3T4ZA 1E1RG 2WLHA 4RQEA 3ETGA 1B3QA 2XAJA 5CMUA 1VMGA 1WN7A 4PI0A 4LC1A 4LFBB 3O9OA 3T1YO 3BA8A 3OEEG 1GH6A 1QR8A 2YC0A 1Y67A 3JATA 3UO3A 2JRIA 4RO2A 4IHJB 4UV9A 3WB2A 4YHHB 2CTQA 5FPRA 2OIEA 5JQGA 3I5DA 4WBNB 2PI5A 2Y69B 4DV2O 2WLMA 3CEIA 5JJEB 4UFZA 1VQKV 3B2EE 4DV6B 3E89A 5J2TA 1AJQA 3B8NA 4NXNO 2YI9A 4IYIA 2FTKA 5CB4A 1MNGA 4KUMA 3K5LA 5LBQA 2FB5A 5KHIA 2OTLV 4DK0A 4JI7O 1Y76B 4JAAA 2PTMA 3K9AA 4DV0O 2ZCEA 3E83A 4H13B 1I0HA 4LR3A 1Q82W 4TQDA 1YTFD 2Y0PA 1GM7A 2QWRB 5FL7G 2Q8VA 4O2BA 2QWPB 4Z1VA 5LHHA 3QO7A 2W6IG 3N2GB 1I94O 4JI0O 4J7KA 3AEIA 2X0LA 4CC5A 3CJHA 1SQQH 3T4DA 3JD1A 2WLLB 3D8CA 4LWSA 2XAFA 5H6RA 3ZEDA 2LO1A 2H3OA 4DV1O 3CB2A 2UXCO 1FJGB 5EC1C 3K0DA 2EZPA 2VWJA 1NS1A 1B04A 5KAIZ 2BE3A 5LMNB 3JYCA 2EINB 1BE3H 1QCEA 4CS4A 3LUTB 4EEQA 3CXCU 3W7TA 4GCZA 1Y6XA 3OM3B 2RMKB 1Q8IA 1I5YA 1BMFG 3S3WA 2HJFC 2L6LA 4TOIA 1YJWV 2Z5UA 2UUAB 3M8AA 1CPYA 1Q43A 1HWYA 5LHGA 4O4JA 3DXRA 1CP9A 1D5AA 2DE0X 1XOUA 3C3SA 3K06A 4DV2B 2CTWA 4GLXA 3UQ8A 1H2NA 4GKKB 5JWPA 2CGNA 3SJAC 1KKCA 3SJBC 1GM8A 2L35A 1NVPB 2GSMB 1AI6A 3ZN1A 4I55B 4UVCA 3OT7A 4MVMA 3JASA 4DUZB 4JF3A 3O65A 1HP8A 4HZ3A 1N33O 2ZNIA 3CX5F 3UT5B 2IU0A 1KYOF 4LF9O 4JI7B 1UJWB 1THZA 1VF7A 4IGGA 2FL4A 2JIZG 4QIWF 4RAIA 1FFXB 1ZUQA 1FAFA 2ZXWB 2QKSA 2OCCB 4LF4B 4MVUA 1V54B 3RYFB 5EIBD 3ASNC 3WG7B 5C8YB 5FNVA 1I94B 2QTOA 1H2KA 2EIMC 4DUYB 2QKCA 4RQFA 3CE2A 2R9RB 3ICXA 1TVKB 5IY5B 2XNDG 4PDMA 2UXCB 1IX9A 2IJIA 4WFEA 4GT1A 4YJ3A 1YIJV 2HG5C 1US6A 1G6UA 2DWEC 3STZC 5CBFA 4G27B 3HKDA 1H38A 3SR2C 4DR2O 4ICGA 4I4TA 5F2VO 3CCUV 2ZE7A 3EHBB 3E8GA 3J81N 4FFBA 4FK5C 5KX5B 4L8JA 2CK3G 3IC7A 3KCYA 4IL6Z 2MW2B 3FX7A 4TV9B 4UXNA 4UCOA 1IZ3A 1N34B 3L71H 2XUMA 4HAMA 4JI8B 2YIDA 4PA6A 4XBFA 2QWOB 3SDLA 4B08A 5JH7B 3U0ZA 4X62O 3N2KB 2WLIA 1XUQA 1SQBH 5B3SC 2GV9A 2NLJC 1I5XA 4DK1A 4X66B 1W0JG 2YSUB 2ZDIA 2F43G 3OTOO 1M9NA 3W7UA 4O2AA 4J41A 1NJIW 4NKGB 5GONA 3Q4HB 3ZN0A 5J2UB 4DV3O 3HKCA 1K4CC 3G6EV 1N33B 4I50B 3K59A 4OGQB 4AQYO 3K58A 3SJCC 4X64B 5DEDA 1SRYA 3JCUZ 1VQLV 2E5LB 4AILC 1QBZA 4DXWA 1WB8A 1H2GA 5HFMA 1LR1A 1S77D 3ZJZA 1R6KA 3CC2V 3RGBA 3ZHRA 4PA3A 4K35A 4PDVA 1FD9A 2IH1C 3LSUA 1OCZC 3JATB 4P2ZA 4R6ZA 1JPXA 4JASA 1AB3A 4F6EA 4LFAB 1IXMA 4FM1A 3CSXA 1S76D 5JQGB 3K79A 1XBLA 2UUCO 5J2TB 1WP7A 2QA4V 5EZYA 2H8PC 5BXZA 5IWAO 1MZFA 1XMQO 4NTWA 5CB4B 1JMKC 2DJVA 1TAEA 1D5NA 3OMAB 4FLTA 1G8MA 2IH3C 4LH6A 2X6BA 2Z3YA 4B3SO 3B8MA 3ZMUA 1AP6A 2OYQA 4I0XA 3BCCH 4W4KA 1AVMA 1ZLZA 4DV4O 1OCOC 4O2BB 2P06A 4KHPO 2DWDC 3WU2Z 1DTOA 2BTQA 1XNQB 1XL4A 4PI2A 4LP8A 3CJHB 3IAYA 4ZKIA 1GTOA 3OEHG 2DYRC 4NXMO 4LWSB 1BS3A 2EULA 5B1BB 3P3NA 1RSOA 3OR7C 2ITCC 2E3CA 4X1IB 4F4LA 1H8HG 1J95A 2Q6AA 3CC7V 1BSMA 3H9VA 1EN4A 4LF6O 4BIOA 1HNXB 5KHHA 2UXBO 2LFRA 1Y66A 5IJ9A 2EX3A 3UO2A 1H2SB 2JJ1G 4W4LA 1R6NA 1AP5A 1SZXA 1NTKH 4JAVA 2A3QA 1M56C 4O4JB 3DXRB 5LP6A 1S5HC 4XDJA 2UUBB 3ZRVA 4GX0A 4FVMA 1GN3A 3K0GA 1I08A 4GX2A 3W7WA 1Q6HA 1COWG 1ZSPA 4MSWC 3BFRA 3CWBH 3FB6C 3L75H 1PL0A 4YY3B 3OE7G 2LP7A 4WFFA 4Z2WA 3VQXA 2G38A 2UU9B 3CRRA 2QJ1A 3JASB 1OCRC 4OXSA 5K1PA 3VBBA 2UXNA 3IGAC 1FXKC 4IYHA 3T2MA 1EFRG 2QDOA 1JOYA 2WLNA 1VQ8V 1XMOB 2IBZH 4BAYA 3STLC 1EBOA 4F6RA 2IW5A 1N0JA 4FLVA 4YHHO 4LBEC 1FFTB 1G1XB 1F51A 1QQCA 1EN5A 2F4VB 2JS3A 5B3SB 1SQGA 4DV6O 2Z0AA 4UCSA 2LGWA 5FNVB 1Q90D 4RUEA 2PYLA 4I7ZB 3E35A 4NXMB 3ETDA 4QPJA 4AHCA 4N23A 1XNRB 3SPIA 5BZBA 3GWKC 3LDDA 1HNZB 4YJ3B 2R70A 2ZNJA 1JX9A 2A9HA 3F5WC 2VQEB 4CS2A 3APQA 1NZ6A 4FLWA 2QWQB 3HKDB 5K1XA 3C3TA 4I4TB 2Q9LA 4GYCB 5KA6A 4FIPC 4FFBB 2HLDG 4JI1O 4UUJC 1OCZB 2HVKC 5BR8B 3DC5A 2DN9A 3K57A 1SQVH 1VQMV 1EZJA 5E1AC 3TCUA 1D2DA 3U11A 2PY5A 3E2EA 4X88A 2WLIB 1FJGO 5H9CA 5IYZA 1LUWA 1YDXA 1GN2A 1KC8W 1PP9H 5CBGA 2EBOA 3K5MA 5CBHA 1K3EA 1NR1A 1KKDA 2JDIG 4O2AB 3JAMN 5EK0A 5GONB 2EILB 3HKCB 3OR6C 1KMIZ 2JEXA 4CC6A 2UUAO 3E22A 3CMAV 4R50A 3VOUA 1MG1A 2QE7G 1OCOB 1K5SA 4UVBA 4J7ZA 3EFFK 3BPZA 4QE7A 2YIBA 4ZOLA 4DR1B 4GKKO 4FM2A 4MW3A 1FKAO 4K8XA 4CBCA 5HFLA 3X2QC 4FM0A 4JZ2A 1YZBA 3ASOC 4GKJB 3FB8C 4PD4F 4FZ0A 3A8TA 4DO2A 3ZBHA 1H2LA 4CH5A 3K3WA 3AG3C 3JD2A 4DUZO 5LGTA 1E79G 4MTOA 1YJ9V 1GRJA 1ZL8A 5TISZ 4UVAA 4UB8Z 2H94A 5EZYB 3UCSC 3CP1A 1NR7A 1R3KC 2ZE8A 4BR6A 5B1AC 3L74H 1SF9A 1GN6A 4DR3O 2ZKOA 5EYPA 1OCCC 3RWRD 4LF4O 4PA4A 2QM4A 4JI1B 3IFXA 4HBNA 2QGNA 2HVJC 4K3AA 1M93A 4H0LB 1IVSA 4I0XB 3AG1B 4DUYO 1VF5B 3BEHA 2PYJA 2W6JG 4H37A 2P7TC 1NBMG 1VQNV 2AW9A 1BHBA 1HW7A 3KCXA 1I7FA 3L9DA 2BTQB 3FYEB 2DQ3A 3THOA 4J7JA 3RW0A 3QF7A 3H1IH 4Q20A 1TGOA 2EJ7A 2FYUH 1BCCH 3E8BA 3QG5A 1OCRB 4GUNA 3VQWA 4NVPA 5LOVB 1RSOB 1AR4A 4FLZA 4QPKA 1HDJA 5B1OA 4U7NA 4CH6A 3ABLB 3ZMZA 1MSDA 3AG4C 3CRQA 2ZM6B 3A0BZ 5BMVA 1ZX3A 3ABKC 2KKWA 4TUYA 2Y4UA 3ZX6A 5IJ9B 1N34O 3L72H 1GAXA 4JI8O 4WFHA 1KUQA 5IYBO 4X66O 1XREA 4LF5B 5LP6B 4YJ2A 4N21A 4ABMA 1NU1H 3P32A 3EXAA 2HFEC 2A7WA 5LGNA 2YS8A 2BCCH 1P84F 1DF5A 3UM7A 4JI5B 3E8HA 4JYAO 2LJ2A 2XASA 4X64O 1Z5VA 1VQ5V 2E5LO 2P90A 3BAAA 1SS3A 4JV5B 2AZ2A 2N04A 3I56V 5JJJB 4EB6A 4DR3B 4O4LA 1NTMH 2YXYA 3D3QA 1VQ6V 1URFA 1IBKB 4B3TB 2DYSB 2WSSG 1N8RW 3LDEA 1O9HA 1AROP 5LXTB 1KU9A 4UCUA 4IT5A 1YI2V 2P67A 4F6RB 1IBMO 3RYCB 4LFAO 1QR9A 2A79B 4UCVA 1S5LZ 2GTSA 4BW5A 1WPBA 1V55C 2JS5A 5AG2A 4XDKA 4FFKA 1M57B 3B09A 3ZHVA 3DGEA 4JTCB 3BABA 3G67A 1GO3F 3ZIAG 1P7GA 1R3IC 3ABMC 4X65B 3BA9A 4XDLA 3G4SV 2GUZA 4NYKA 1RPOA 4GZRB 4HNAA 4ZHQA 1XQ8A 4DR6O 1AILA 1PNLA 3RBZA 1BL8A 5IT9N 2F95B 2KSDA 2EIJC 4K8ZA 4G2KA 1DK1A 5KA5A 2OCHA 1M5IA 2D2CB 1QLEC 1BGYH 1XNQO 3ASOB 5H6QA 3UKMA 4JI6B 1HR0O 2Q68A 4JI4B 1JR9A 2E76B 1GN4A 3JAKA 4I9QA 1KP3A 2WLKA 4O4HA 2K1EA 3VQYA 3HB3B 3M7MX 4U3JA 4MVRA 2GBOA 3ZMVA 1Y74A 5IYZB 4CS3A 3H1JH 3CCVV 2QM7A 2XOKG 4JYAB 1CEZA 3TXSA 3B40A 3EVKA 1K97A 2VWKA 3BY6A 2RCVA 3RT3C 1HNXO 4LCUC 3TK1A 1Q6IA 3TXQA 2PUSA 5A2QN 2AXTZ 1X4TA 2ETNA 2KB1A 2GDSA 5LA6A 3IJ4A 2Q7HA 5EC2C 4BW9A 1GK9A 1IBMB 2B5UA 3WB0A 3APOA 2UUBO 3CCQV 3RYHA 3JD3A 2AHZA 2ZIMA 4ZOLB 2XHBA 2HKOA 2PZSA 5L3GA 4J42A 1G4YB 4MVSA 4B3MB 3CPWU 1WA8A 4YY3O 1ROPA 3D3IA 3QVNA 4QJFB 1R73A 4U7OA 2UU9O 3HR0A 1XDCA 5JJNB 2RNBA 3JSNA 3FKSG 1IXBA 1SA0A 3QO8A 2EZOA 2ODMA 1WPXA 1ZL8B 1SQPH 1HNWB 3K04A 2IJKA 2CE4A 1XMOO 1GM9A 4DR6B 1P7BA 4J80A 3C90A 3SPGA 5EYPB 4KFMA 1NI8A 3D36C 2MK3A 3QO5A 3GB7C 3RVZA 2F4VO 4H44B 2DOSA 1B6QA 2CDYA 1KP2A 4FMTA 3AG2C 2OT5A 1HR0B 5C93A 3CCRV 2ZR3A 4JTDB 4PELA 2Q5ZA 2XAQA 4BIUA 2RN9A 1DLBA 4ZI7A 4X20A 2OWOA 1FXKA 4QGPA 1XNRO 2D3OW 1QVGU 2Y69C 1HNZO 3FB7C 3F7YC 1TA8A 1T5EA 4DRXA 1S3JA 2ZE5A 1JFFA 2VQEO 2X7RB 1NH2B 4DW0A 2Q67A 1F4NA 2HHHB 1YVWA 4X1KA 3CYOA 2P4KA 5IYDO 5DECA 2DW4A 3ASNB 3AK1A 1DF4A 4FLUA 2QWNB 3K03A 4D6TH 3JD0A 4KP4A 5BR8O 3BRCA 4JZGA 1OHHG 2EIMB 2V1DA 3OMNB 2KQXA 5BMVB 3TETA 1SKVA 4R8CA 1W0KG 4TUYB 4CH4A 2ADQB 4JI3B 3CCLV 2PF4E 2QTSA 3MAQA 2YIBD 3K08A 3ZRSA 1YF2A 3CC4V 4EFEA 1KB9F 5EIBC 1QLNA 3AK3A 2CTPA 4YJ2B 2YIAA 3A0HZ 4IIJA 4MTGA 1XHXA 3G6BA 1R6TA 5ITZA 2AHYA 1RFYA 1R3JC 1WP8A 2Q4PA 4YIPA 1WNSA 4UV8A 2E74B 3E86A 3OMIB 3JAWA 4JI2B 2JGUA 4J9ZB 1PL4A 5A9GA 4PHZA 5CA0A 2EINC 4EB6B 4O4LB 3RFRA 1AJNA 2P6JA 5EBLC 1M1KW 3ZRWA 3R65A 2ADPA 4C7UA 4DR1O 4DW1A 1XI1A 4JTAB 3BVOA 4PA7A 1F4MA 1ZTEA 1YEWA 3CRMA 4GKJO 1Z5WA 2A06H 2M7WA 5KMGA 1KECA 3CMEV 1M4UA 2CTRA 4PV1B 4GX1A 1MOFA 1N32B 2N74A 3NXSA 2Q7EA 1RP3B 3M99B 4EKWA 2LFSA 3CCJV 3OUFA 1NT2B 2JGDA 2F23A 1PM9A 4DYLA 4DR7B 3PJSK 1NH2D 3JCZA 2IM9A 1ORQC 4TT3G 2GUZB 3L73H 1BT8A 2P4VA 2B1GA 1Q81W 4LF7B 4HNAB 4JYCA 4ZHQB 2ZR2A 4QE9A 3SPCA 4DR4B 1VF6C 3AG7A 5LMUB 3MDSA 1SETA 1K33A 4CH3A 2JJ2G 2ZXWC 4LNUA 2OCCC 3CD6V 2LGQA 2ITDC 1IBLB 1V54C 4D7TA 1MABG 4LF8B 3N2KA 3KG2A 1PNMA 3WG7C 2ARHA 2LW7A 3JAKB 4YXWG 4O4HB 4Z1MG 4U3JB 4MT8A 4OX9B 2ATKC 2YI8A 1Y74B 1SC5B 1B06A
chains in the Genus database with same CATH topology
4DV3O 4LF9O 4DV0O 1KUQA 1IBLO 1YZBA 4AQYO 4LF8O 4X65O 1DK1A 4LFCO 4X66O 2ZM6O 1J5EO 1XNQO 2F4VO 2DOSA 1HNWO 4DUZO 4K0KO 1HR0O 4LF6O 4DR1O 4OX9O 4OPAA 1I94O 2UXBO 4JI0O 4JI2O 3J80N 5FLXN 1FYJA 4GKJO 4JYAO 4X64O 1N36O 2E5LO 4DV1O 3T1HO 4DR3O 1AB3A 4LF5O 1X59A 1XNRO 2UXDO 4JI1O 1A32A 2VQFO 5LMNO 1HNZO 2ZKOA 3R66A 1F7YA 4JI6O 2UXCO 4LF4O 1NS1A 3RT3C 1R1BA 4JI4O 1HNXO 2N74A 3J7AU 2VQEO 2UUCO 4JI5O 4LFBO 1XEQA 1D2DA 2FKXA 5A2QN 3T1YO 5BXZA 4DUYO 1IBMO 5IWAO 1XMQO 4LFAO 1FJGO 4JV5O 4DV5O 4DR2O 2JRIA 5BR8O 1N32O 3J81N 2DJVA 3M8AA 1IBKO 4B3TO 2UUBO 5H5NA 2HHHO 4DV2O 4DR7O 3JAMN 4B3RO 4B3SO 4A5UB 2AGAA 4YY3O 5BY1A 3SDLA 4NXNO 2UUAO 4DV4O 4YHHO 2UU9O 4X62O 3F5TA 4DR5O 4LF7O 4KHPO 1G1XB 1R6TA 4DR4O 2LW7A 4DV7O 4JI3O 4OPHA 5LMUO 4DR6O 4DV6O 2Z0AA 3O65A 3OTOO 1AILA 4B3MO 4JI7O 1N33O 4GKKO 5IT9N 1FKAO 1XMOO 1N34O 5LL6Y 4JI8O 4NXMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 O;  4LF9 O;  4DV0 O;  1KUQ A;  1IBL O;  1YZB A;  4AQY O;  4LF8 O;  4X65 O;  1DK1 A;  4LFC O;  4X66 O;  2ZM6 O;  1J5E O;  1XNQ O;  2F4V O;  2DOS A;  1HNW O;  4DUZ O;  4K0K O;  1HR0 O;  4LF6 O;  4DR1 O;  4OX9 O;  4OPA A;  1I94 O;  2UXB O;  4JI0 O;  4JI2 O;  3J80 N;  5FLX N;  1FYJ A;  4GKJ O;  4JYA O;  4X64 O;  1N36 O;  2E5L O;  4DV1 O;  3T1H O;  4DR3 O;  1AB3 A;  4LF5 O;  1X59 A;  1XNR O;  2UXD O;  4JI1 O;  1A32 A;  2VQF O;  5LMN O;  1HNZ O;  2ZKO A;  3R66 A;  1F7Y A;  4JI6 O;  2UXC O;  4LF4 O;  1NS1 A;  3RT3 C;  1R1B A;  4JI4 O;  1HNX O;  2N74 A;  3J7A U;  2VQE O;  2UUC O;  4JI5 O;  4LFB O;  1XEQ A;  1D2D A;  2FKX A;  5A2Q N;  3T1Y O;  5BXZ A;  4DUY O;  1IBM O;  5IWA O;  1XMQ O;  4LFA O;  1FJG O;  4JV5 O;  4DV5 O;  4DR2 O;  2JRI A;  5BR8 O;  1N32 O;  3J81 N;  2DJV A;  3M8A A;  1IBK O;  4B3T O;  2UUB O;  5H5N A;  2HHH O;  4DV2 O;  4DR7 O;  3JAM N;  4B3R O;  4B3S O;  4A5U B;  2AGA A;  4YY3 O;  5BY1 A;  3SDL A;  4NXN O;  2UUA O;  4DV4 O;  4YHH O;  2UU9 O;  4X62 O;  3F5T A;  4DR5 O;  4LF7 O;  4KHP O;  1G1X B;  1R6T A;  4DR4 O;  2LW7 A;  4DV7 O;  4JI3 O;  4OPH A;  5LMU O;  4DR6 O;  4DV6 O;  2Z0A A;  3O65 A;  3OTO O;  1AIL A;  4B3M O;  4JI7 O;  1N33 O;  4GKK O;  5IT9 N;  1FKA O;  1XMO O;  1N34 O;  5LL6 Y;  4JI8 O;  4NXM O; 
#chains in the Genus database with same CATH topology
 3F7V C;  5J2U A;  2YEV A;  4G28 B;  4NB5 A;  5IY5 C;  3ZHT A;  1N36 B;  3LNM B;  2CH7 A;  3PN1 A;  1AR1 B;  2ZM6 O;  4I9W A;  3SYA A;  5JVD A;  1MA1 A;  1L0N H;  5JCO A;  3FD9 A;  1MMM A;  2ZD9 A;  1YIT V;  3N27 A;  5EBW C;  1EZV H;  5LA6 B;  5KAF Z;  3DC6 A;  3AG2 B;  5GTH Z;  4JAU A;  3T1H O;  4LF5 O;  1PNK A;  2DYR B;  2UXD O;  1VP7 A;  3SYO A;  1VQ9 V;  3HKE A;  2WA3 A;  3LSQ A;  5E79 Z;  3RYH B;  1R1B A;  2WPD G;  3FAV A;  3KKY A;  3W7S A;  3J7A U;  3CXH F;  1K8A W;  4JI5 O;  2JEU A;  1JJ2 U;  1WA8 B;  2JVD A;  3GVM A;  3ZMS A;  1H8E G;  5CA1 A;  4FLY A;  2EIK C;  5LHI A;  1OV9 A;  4JV5 O;  3QTC A;  4DV5 O;  3MHS C;  1SA0 B;  2BOB C;  2WLJ A;  1XIL A;  1WLE A;  1IBK O;  1L8D A;  4B3T O;  3H1L H;  1ZAU A;  4X8A A;  5H5N A;  4DR5 B;  1N4C A;  3H1H H;  3KZI Z;  1PPJ H;  4J11 A;  3MD0 A;  1K7D A;  1M56 B;  3JAR A;  3IC9 A;  3OTF A;  4A5U B;  4O4I A;  5JCO C;  4LH7 A;  2O57 A;  2Q0O C;  4NR1 A;  3BHP A;  1L1F A;  4WCE V;  4X1Y A;  3VQV A;  1AI7 A;  4B7K A;  4DV7 O;  2Q0A A;  1S72 V;  1P49 A;  2WA4 A;  1OJH A;  2BSK A;  4YIO A;  2R9I A;  4FPP A;  4ZI7 B;  4X20 B;  4MW8 A;  1FXK B;  3RVY A;  4PJ0 Z;  3DTU B;  3ZHS A;  4X65 O;  1M90 W;  1VIB A;  4X1I A;  2R72 A;  3ABU A;  2CGO A;  4DRX B;  1JCH A;  2X6A A;  1UPG A;  2XAH A;  1JFF B;  3CHX A;  4K0K O;  2WAM A;  3TGU H;  1JQ0 A;  4JYB A;  4X1K B;  2QKA A;  4BWA A;  1QU7 A;  4PDR A;  5B66 Z;  2RJZ A;  5FLX N;  2NNU A;  5EBM C;  3T1Y B;  1XHZ A;  1FS0 G;  2HR3 A;  2LQT A;  4JI6 O;  5CN0 A;  2CUG A;  4JI4 O;  3T1H B;  2UXD B;  2M6Y A;  4UCR A;  4TV8 A;  1PKX A;  1XEQ A;  1W2B U;  2OIG A;  4UCT A;  2JK5 C;  2Q69 A;  3WFV A;  5J9P C;  4IIJ B;  2WWW A;  3B4S A;  4NXN B;  5ITZ B;  2A0L A;  4DV5 B;  4U3F H;  5L3C A;  1BHA A;  5GTI Z;  1NKD A;  2Y0I A;  1TUB A;  4TSF G;  5B1B C;  2YIC A;  1CXZ B;  3JAW B;  3B77 A;  4UB6 Z;  2IJJ A;  2NR5 A;  4KXR A;  5CA0 B;  4R7C A;  3FYI B;  2QR4 A;  4DV0 B;  1KD1 W;  5LYJ A;  3CCM V;  1IDS A;  3ZRW B;  2IU3 A;  1E1Q G;  4D7S A;  4JYY A;  1K34 A;  4ZIB A;  4B3M O;  4DV7 B;  1Q6U A;  2PGG A;  5IJ0 A;  5KMG B;  4JI0 B;  3JAL A;  3CRA A;  1GMG A;  2AZ0 A;  4JGS A;  4E4E A;  4FLX A;  3HKB A;  3RYI A;  2HP8 A;  4B7E A;  3RN4 A;  4MTX A;  4CZZ A;  4DV1 B;  3FB5 C;  1J5E O;  4KL1 A;  3T1C A;  3ZS8 C;  2X6C A;  1HNW O;  3OW2 U;  2XAG A;  2JGD B;  1Y4M A;  3ABT A;  4AI8 A;  4K0K B;  5GW7 A;  2V7Q G;  4NTY A;  2RDC A;  3MHH C;  2F66 C;  1SQX H;  3X2Q B;  1X59 A;  3K5O A;  2VQF O;  2V4D A;  5KUK A;  5L3D A;  2HJD A;  4WFA V;  3OGI B;  3SPH A;  4TWK A;  2QSA A;  1AJP A;  3H1K H;  4RUF A;  3AG3 B;  4FZ1 A;  2ZIN A;  4LNU B;  1KBH A;  4P9P A;  3DSQ A;  2KG7 A;  1XL6 A;  1VQP V;  2E75 B;  2EIK B;  2EJR A;  2YXL A;  4EFB A;  1S5J A;  5B1A B;  5KUM A;  5DM6 V;  4BIZ A;  3QNE A;  1NVP D;  1WB7 A;  5B5E Z;  2QM8 A;  2HHH O;  1EN6 A;  1W59 A;  1OCC B;  3P30 A;  3D36 A;  1LNQ A;  2B1I A;  1VAR A;  1PD3 A;  1R3L C;  2RQ6 A;  2F93 B;  2AGA A;  1YSC A;  2YEV B;  1SQF A;  1QVF U;  4PA9 A;  4J9Y B;  3E22 B;  4LF9 B;  2CH7 B;  5L3F A;  4ZBM A;  5JVD B;  4TQF A;  1YJN V;  1MZE A;  4MS2 A;  4IHJ A;  1MSW D;  1SER A;  4JI3 O;  4WBN A;  1QHT A;  2B9Z A;  2F1M A;  3CCS V;  1U97 A;  3CRC A;  1L0L H;  3HKE B;  1OZ0 A;  4ASU G;  4P30 A;  3ZMT A;  4LFC O;  1Q5O A;  3FAV B;  1RM1 C;  2OTJ V;  1J5E B;  2BTO A;  4OPA A;  3AG4 B;  4E2L A;  4JI2 O;  3G80 A;  5CA1 B;  2YDE A;  1Y76 A;  3ABK B;  1FYJ A;  3ML0 A;  1K9M W;  2ZDI C;  5D5P A;  3LDC A;  4B3R O;  3SPJ A;  1Z2G A;  3HPL C;  5L3B A;  4DR2 B;  3ZCC A;  1K73 W;  2EIL C;  2VQF B;  4L87 A;  3CCE V;  1K92 A;  5KHJ A;  1H2M A;  1JJO A;  3JAR B;  2FKX A;  3N2G A;  4MVQ A;  1IUR A;  4O4I B;  5KHK A;  1LUV A;  4FJC C;  1FXH A;  3AK2 A;  4MTF A;  2WLL A;  1SZT A;  4X1Y B;  3L70 H;  2Y4T A;  1N32 O;  4PDL A;  3H01 A;  4X62 B;  3P3P A;  1VQ7 V;  1BQ0 A;  2R9A A;  2BSK B;  2C2A A;  3OFN G;  4DR7 O;  2ZIO A;  3SGI A;  1BZK A;  3OTO B;  3SYP A;  5LOV A;  3OAA G;  5FPO A;  1WAZ A;  4JPR A;  4DV3 B;  3U10 A;  1YXB A;  2QEX V;  1ENV A;  4I5S A;  4AQY B;  4P9O A;  4LF7 O;  2P22 C;  4X89 A;  1N0N A;  1PV0 A;  4DR4 O;  2PI4 A;  5LMU O;  3A2F A;  3SJQ C;  1YHQ V;  1V55 B;  1Q3E A;  4WFB V;  5LL6 Y;  2N05 A;  1S0V A;  1ZWI C;  3JD4 A;  2ILM A;  4NTX A;  2GTA A;  1IBL O;  2ZQM A;  4LF8 O;  2FML A;  3K9S A;  1KQS U;  2XT9 A;  2VS0 A;  2YUA A;  1K4D C;  1VEW A;  5IE9 A;  4TV8 B;  5D5Q A;  5LGU A;  4LFC B;  3LNN A;  1GKF A;  3AG1 C;  2UXX A;  4I55 A;  4OX9 O;  3ABM B;  4H33 A;  1Q7Y W;  2UUC B;  1JVM A;  3A0R A;  1U96 A;  2HEP A;  3UT5 A;  3ETE A;  1JA8 A;  1N36 O;  1DGS A;  1VF6 A;  3CS5 A;  1V9P A;  5IWA B;  4WFG A;  1XMQ B;  1A32 A;  3ZRX A;  2EIJ B;  3WB1 A;  3GWO A;  1FFX A;  4B3R B;  3W7X A;  1TUB B;  4WF9 V;  1QLE B;  1NQT A;  3ETQ A;  2W0X A;  3S3X A;  4LFB O;  2IJH A;  3RYF A;  5LXT A;  2K9P A;  3OUS A;  1WJZ A;  4B3S B;  3E8F A;  5C8Y A;  3ABL C;  5LYJ B;  3RYC A;  3LSS A;  3TJT A;  2Q73 A;  5KLV H;  3ZHU A;  1SES A;  4DV4 B;  2BOC C;  2ZE6 A;  2XTA A;  1TVK A;  4KHP B;  5B1N A;  3SYC A;  1FXV A;  3K5N A;  3FFQ A;  4MVO A;  5IJ0 B;  2P5O A;  1EM1 A;  3ZHQ A;  3JAL B;  4GX5 A;  5L3E A;  1F23 A;  3OGC C;  3JSL A;  1AR5 A;  4RWU A;  5LP6 C;  5KHG A;  5BY1 A;  2CAZ C;  3HKB B;  3RYI B;  1O9G A;  2NN4 A;  3F5T A;  4DR5 O;  1QNM A;  3NR7 A;  4MVZ A;  2Y48 A;  2Q7G A;  5IYC O;  5KX5 A;  1AI4 A;  2ZT9 B;  4OPH A;  1UFI A;  1AI5 A;  1YCI A;  4LF6 B;  1NTZ H;  1RPR A;  2YXH A;  5IDJ A;  2UXB B;  4HYO A;  4J10 A;  4TV9 A;  2GHY A;  1YTF B;  2DMX A;  4X9Q A;  2W0F C;  5JH7 A;  1BQZ A;  2DYS C;  2LW1 A;  3SYQ A;  5CA3 A;  5H2F Z;  1RM1 B;  2VRZ A;  3G71 V;  1K5Q A;  3J80 N;  1Q86 W;  1P4R A;  5DN6 G;  3Q4H A;  4Q6G A;  1VQO V;  2KG7 B;  4I50 A;  3I55 V;  1VQ4 V;  4QNH B;  5LMN O;  3R66 A;  1F7Y A;  2DQ0 A;  1M57 C;  1FPO A;  1TUE B;  3OD4 A;  3T4Z A;  1E1R G;  2WLH A;  4RQE A;  3ETG A;  1B3Q A;  2XAJ A;  5CMU A;  1VMG A;  1WN7 A;  4PI0 A;  4LC1 A;  4LFB B;  3O9O A;  3T1Y O;  3BA8 A;  3OEE G;  1GH6 A;  1QR8 A;  2YC0 A;  1Y67 A;  3JAT A;  3UO3 A;  2JRI A;  4RO2 A;  4IHJ B;  4UV9 A;  3WB2 A;  4YHH B;  2CTQ A;  5FPR A;  2OIE A;  5JQG A;  3I5D A;  4WBN B;  2PI5 A;  2Y69 B;  4DV2 O;  2WLM A;  3CEI A;  5JJE B;  4UFZ A;  1VQK V;  3B2E E;  4DV6 B;  3E89 A;  5J2T A;  1AJQ A;  3B8N A;  4NXN O;  2YI9 A;  4IYI A;  2FTK A;  5CB4 A;  1MNG A;  4KUM A;  3K5L A;  5LBQ A;  2FB5 A;  5KHI A;  2OTL V;  4DK0 A;  4JI7 O;  1Y76 B;  4JAA A;  2PTM A;  3K9A A;  4DV0 O;  2ZCE A;  3E83 A;  4H13 B;  1I0H A;  4LR3 A;  1Q82 W;  4TQD A;  1YTF D;  2Y0P A;  1GM7 A;  2QWR B;  5FL7 G;  2Q8V A;  4O2B A;  2QWP B;  4Z1V A;  5LHH A;  3QO7 A;  2W6I G;  3N2G B;  1I94 O;  4JI0 O;  4J7K A;  3AEI A;  2X0L A;  4CC5 A;  3CJH A;  1SQQ H;  3T4D A;  3JD1 A;  2WLL B;  3D8C A;  4LWS A;  2XAF A;  5H6R A;  3ZED A;  2LO1 A;  2H3O A;  4DV1 O;  3CB2 A;  2UXC O;  1FJG B;  5EC1 C;  3K0D A;  2EZP A;  2VWJ A;  1NS1 A;  1B04 A;  5KAI Z;  2BE3 A;  5LMN B;  3JYC A;  2EIN B;  1BE3 H;  1QCE A;  4CS4 A;  3LUT B;  4EEQ A;  3CXC U;  3W7T A;  4GCZ A;  1Y6X A;  3OM3 B;  2RMK B;  1Q8I A;  1I5Y A;  1BMF G;  3S3W A;  2HJF C;  2L6L A;  4TOI A;  1YJW V;  2Z5U A;  2UUA B;  3M8A A;  1CPY A;  1Q43 A;  1HWY A;  5LHG A;  4O4J A;  3DXR A;  1CP9 A;  1D5A A;  2DE0 X;  1XOU A;  3C3S A;  3K06 A;  4DV2 B;  2CTW A;  4GLX A;  3UQ8 A;  1H2N A;  4GKK B;  5JWP A;  2CGN A;  3SJA C;  1KKC A;  3SJB C;  1GM8 A;  2L35 A;  1NVP B;  2GSM B;  1AI6 A;  3ZN1 A;  4I55 B;  4UVC A;  3OT7 A;  4MVM A;  3JAS A;  4DUZ B;  4JF3 A;  3O65 A;  1HP8 A;  4HZ3 A;  1N33 O;  2ZNI A;  3CX5 F;  3UT5 B;  2IU0 A;  1KYO F;  4LF9 O;  4JI7 B;  1UJW B;  1THZ A;  1VF7 A;  4IGG A;  2FL4 A;  2JIZ G;  4QIW F;  4RAI A;  1FFX B;  1ZUQ A;  1FAF A;  2ZXW B;  2QKS A;  2OCC B;  4LF4 B;  4MVU A;  1V54 B;  3RYF B;  5EIB D;  3ASN C;  3WG7 B;  5C8Y B;  5FNV A;  1I94 B;  2QTO A;  1H2K A;  2EIM C;  4DUY B;  2QKC A;  4RQF A;  3CE2 A;  2R9R B;  3ICX A;  1TVK B;  5IY5 B;  2XND G;  4PDM A;  2UXC B;  1IX9 A;  2IJI A;  4WFE A;  4GT1 A;  4YJ3 A;  1YIJ V;  2HG5 C;  1US6 A;  1G6U A;  2DWE C;  3STZ C;  5CBF A;  4G27 B;  3HKD A;  1H38 A;  3SR2 C;  4DR2 O;  4ICG A;  4I4T A;  5F2V O;  3CCU V;  2ZE7 A;  3EHB B;  3E8G A;  3J81 N;  4FFB A;  4FK5 C;  5KX5 B;  4L8J A;  2CK3 G;  3IC7 A;  3KCY A;  4IL6 Z;  2MW2 B;  3FX7 A;  4TV9 B;  4UXN A;  4UCO A;  1IZ3 A;  1N34 B;  3L71 H;  2XUM A;  4HAM A;  4JI8 B;  2YID A;  4PA6 A;  4XBF A;  2QWO B;  3SDL A;  4B08 A;  5JH7 B;  3U0Z A;  4X62 O;  3N2K B;  2WLI A;  1XUQ A;  1SQB H;  5B3S C;  2GV9 A;  2NLJ C;  1I5X A;  4DK1 A;  4X66 B;  1W0J G;  2YSU B;  2ZDI A;  2F43 G;  3OTO O;  1M9N A;  3W7U A;  4O2A A;  4J41 A;  1NJI W;  4NKG B;  5GON A;  3Q4H B;  3ZN0 A;  5J2U B;  4DV3 O;  3HKC A;  1K4C C;  3G6E V;  1N33 B;  4I50 B;  3K59 A;  4OGQ B;  4AQY O;  3K58 A;  3SJC C;  4X64 B;  5DED A;  1SRY A;  3JCU Z;  1VQL V;  2E5L B;  4AIL C;  1QBZ A;  4DXW A;  1WB8 A;  1H2G A;  5HFM A;  1LR1 A;  1S77 D;  3ZJZ A;  1R6K A;  3CC2 V;  3RGB A;  3ZHR A;  4PA3 A;  4K35 A;  4PDV A;  1FD9 A;  2IH1 C;  3LSU A;  1OCZ C;  3JAT B;  4P2Z A;  4R6Z A;  1JPX A;  4JAS A;  1AB3 A;  4F6E A;  4LFA B;  1IXM A;  4FM1 A;  3CSX A;  1S76 D;  5JQG B;  3K79 A;  1XBL A;  2UUC O;  5J2T B;  1WP7 A;  2QA4 V;  5EZY A;  2H8P C;  5BXZ A;  5IWA O;  1MZF A;  1XMQ O;  4NTW A;  5CB4 B;  1JMK C;  2DJV A;  1TAE A;  1D5N A;  3OMA B;  4FLT A;  1G8M A;  2IH3 C;  4LH6 A;  2X6B A;  2Z3Y A;  4B3S O;  3B8M A;  3ZMU A;  1AP6 A;  2OYQ A;  4I0X A;  3BCC H;  4W4K A;  1AVM A;  1ZLZ A;  4DV4 O;  1OCO C;  4O2B B;  2P06 A;  4KHP O;  2DWD C;  3WU2 Z;  1DTO A;  2BTQ A;  1XNQ B;  1XL4 A;  4PI2 A;  4LP8 A;  3CJH B;  3IAY A;  4ZKI A;  1GTO A;  3OEH G;  2DYR C;  4NXM O;  4LWS B;  1BS3 A;  2EUL A;  5B1B B;  3P3N A;  1RSO A;  3OR7 C;  2ITC C;  2E3C A;  4X1I B;  4F4L A;  1H8H G;  1J95 A;  2Q6A A;  3CC7 V;  1BSM A;  3H9V A;  1EN4 A;  4LF6 O;  4BIO A;  1HNX B;  5KHH A;  2UXB O;  2LFR A;  1Y66 A;  5IJ9 A;  2EX3 A;  3UO2 A;  1H2S B;  2JJ1 G;  4W4L A;  1R6N A;  1AP5 A;  1SZX A;  1NTK H;  4JAV A;  2A3Q A;  1M56 C;  4O4J B;  3DXR B;  5LP6 A;  1S5H C;  4XDJ A;  2UUB B;  3ZRV A;  4GX0 A;  4FVM A;  1GN3 A;  3K0G A;  1I08 A;  4GX2 A;  3W7W A;  1Q6H A;  1COW G;  1ZSP A;  4MSW C;  3BFR A;  3CWB H;  3FB6 C;  3L75 H;  1PL0 A;  4YY3 B;  3OE7 G;  2LP7 A;  4WFF A;  4Z2W A;  3VQX A;  2G38 A;  2UU9 B;  3CRR A;  2QJ1 A;  3JAS B;  1OCR C;  4OXS A;  5K1P A;  3VBB A;  2UXN A;  3IGA C;  1FXK C;  4IYH A;  3T2M A;  1EFR G;  2QDO A;  1JOY A;  2WLN A;  1VQ8 V;  1XMO B;  2IBZ H;  4BAY A;  3STL C;  1EBO A;  4F6R A;  2IW5 A;  1N0J A;  4FLV A;  4YHH O;  4LBE C;  1FFT B;  1G1X B;  1F51 A;  1QQC A;  1EN5 A;  2F4V B;  2JS3 A;  5B3S B;  1SQG A;  4DV6 O;  2Z0A A;  4UCS A;  2LGW A;  5FNV B;  1Q90 D;  4RUE A;  2PYL A;  4I7Z B;  3E35 A;  4NXM B;  3ETD A;  4QPJ A;  4AHC A;  4N23 A;  1XNR B;  3SPI A;  5BZB A;  3GWK C;  3LDD A;  1HNZ B;  4YJ3 B;  2R70 A;  2ZNJ A;  1JX9 A;  2A9H A;  3F5W C;  2VQE B;  4CS2 A;  3APQ A;  1NZ6 A;  4FLW A;  2QWQ B;  3HKD B;  5K1X A;  3C3T A;  4I4T B;  2Q9L A;  4GYC B;  5KA6 A;  4FIP C;  4FFB B;  2HLD G;  4JI1 O;  4UUJ C;  1OCZ B;  2HVK C;  5BR8 B;  3DC5 A;  2DN9 A;  3K57 A;  1SQV H;  1VQM V;  1EZJ A;  5E1A C;  3TCU A;  1D2D A;  3U11 A;  2PY5 A;  3E2E A;  4X88 A;  2WLI B;  1FJG O;  5H9C A;  5IYZ A;  1LUW A;  1YDX A;  1GN2 A;  1KC8 W;  1PP9 H;  5CBG A;  2EBO A;  3K5M A;  5CBH A;  1K3E A;  1NR1 A;  1KKD A;  2JDI G;  4O2A B;  3JAM N;  5EK0 A;  5GON B;  2EIL B;  3HKC B;  3OR6 C;  1KMI Z;  2JEX A;  4CC6 A;  2UUA O;  3E22 A;  3CMA V;  4R50 A;  3VOU A;  1MG1 A;  2QE7 G;  1OCO B;  1K5S A;  4UVB A;  4J7Z A;  3EFF K;  3BPZ A;  4QE7 A;  2YIB A;  4ZOL A;  4DR1 B;  4GKK O;  4FM2 A;  4MW3 A;  1FKA O;  4K8X A;  4CBC A;  5HFL A;  3X2Q C;  4FM0 A;  4JZ2 A;  1YZB A;  3ASO C;  4GKJ B;  3FB8 C;  4PD4 F;  4FZ0 A;  3A8T A;  4DO2 A;  3ZBH A;  1H2L A;  4CH5 A;  3K3W A;  3AG3 C;  3JD2 A;  4DUZ O;  5LGT A;  1E79 G;  4MTO A;  1YJ9 V;  1GRJ A;  1ZL8 A;  5TIS Z;  4UVA A;  4UB8 Z;  2H94 A;  5EZY B;  3UCS C;  3CP1 A;  1NR7 A;  1R3K C;  2ZE8 A;  4BR6 A;  5B1A C;  3L74 H;  1SF9 A;  1GN6 A;  4DR3 O;  2ZKO A;  5EYP A;  1OCC C;  3RWR D;  4LF4 O;  4PA4 A;  2QM4 A;  4JI1 B;  3IFX A;  4HBN A;  2QGN A;  2HVJ C;  4K3A A;  1M93 A;  4H0L B;  1IVS A;  4I0X B;  3AG1 B;  4DUY O;  1VF5 B;  3BEH A;  2PYJ A;  2W6J G;  4H37 A;  2P7T C;  1NBM G;  1VQN V;  2AW9 A;  1BHB A;  1HW7 A;  3KCX A;  1I7F A;  3L9D A;  2BTQ B;  3FYE B;  2DQ3 A;  3THO A;  4J7J A;  3RW0 A;  3QF7 A;  3H1I H;  4Q20 A;  1TGO A;  2EJ7 A;  2FYU H;  1BCC H;  3E8B A;  3QG5 A;  1OCR B;  4GUN A;  3VQW A;  4NVP A;  5LOV B;  1RSO B;  1AR4 A;  4FLZ A;  4QPK A;  1HDJ A;  5B1O A;  4U7N A;  4CH6 A;  3ABL B;  3ZMZ A;  1MSD A;  3AG4 C;  3CRQ A;  2ZM6 B;  3A0B Z;  5BMV A;  1ZX3 A;  3ABK C;  2KKW A;  4TUY A;  2Y4U A;  3ZX6 A;  5IJ9 B;  1N34 O;  3L72 H;  1GAX A;  4JI8 O;  4WFH A;  1KUQ A;  5IYB O;  4X66 O;  1XRE A;  4LF5 B;  5LP6 B;  4YJ2 A;  4N21 A;  4ABM A;  1NU1 H;  3P32 A;  3EXA A;  2HFE C;  2A7W A;  5LGN A;  2YS8 A;  2BCC H;  1P84 F;  1DF5 A;  3UM7 A;  4JI5 B;  3E8H A;  4JYA O;  2LJ2 A;  2XAS A;  4X64 O;  1Z5V A;  1VQ5 V;  2E5L O;  2P90 A;  3BAA A;  1SS3 A;  4JV5 B;  2AZ2 A;  2N04 A;  3I56 V;  5JJJ B;  4EB6 A;  4DR3 B;  4O4L A;  1NTM H;  2YXY A;  3D3Q A;  1VQ6 V;  1URF A;  1IBK B;  4B3T B;  2DYS B;  2WSS G;  1N8R W;  3LDE A;  1O9H A;  1ARO P;  5LXT B;  1KU9 A;  4UCU A;  4IT5 A;  1YI2 V;  2P67 A;  4F6R B;  1IBM O;  3RYC B;  4LFA O;  1QR9 A;  2A79 B;  4UCV A;  1S5L Z;  2GTS A;  4BW5 A;  1WPB A;  1V55 C;  2JS5 A;  5AG2 A;  4XDK A;  4FFK A;  1M57 B;  3B09 A;  3ZHV A;  3DGE A;  4JTC B;  3BAB A;  3G67 A;  1GO3 F;  3ZIA G;  1P7G A;  1R3I C;  3ABM C;  4X65 B;  3BA9 A;  4XDL A;  3G4S V;  2GUZ A;  4NYK A;  1RPO A;  4GZR B;  4HNA A;  4ZHQ A;  1XQ8 A;  4DR6 O;  1AIL A;  1PNL A;  3RBZ A;  1BL8 A;  5IT9 N;  2F95 B;  2KSD A;  2EIJ C;  4K8Z A;  4G2K A;  1DK1 A;  5KA5 A;  2OCH A;  1M5I A;  2D2C B;  1QLE C;  1BGY H;  1XNQ O;  3ASO B;  5H6Q A;  3UKM A;  4JI6 B;  1HR0 O;  2Q68 A;  4JI4 B;  1JR9 A;  2E76 B;  1GN4 A;  3JAK A;  4I9Q A;  1KP3 A;  2WLK A;  4O4H A;  2K1E A;  3VQY A;  3HB3 B;  3M7M X;  4U3J A;  4MVR A;  2GBO A;  3ZMV A;  1Y74 A;  5IYZ B;  4CS3 A;  3H1J H;  3CCV V;  2QM7 A;  2XOK G;  4JYA B;  1CEZ A;  3TXS A;  3B40 A;  3EVK A;  1K97 A;  2VWK A;  3BY6 A;  2RCV A;  3RT3 C;  1HNX O;  4LCU C;  3TK1 A;  1Q6I A;  3TXQ A;  2PUS A;  5A2Q N;  2AXT Z;  1X4T A;  2ETN A;  2KB1 A;  2GDS A;  5LA6 A;  3IJ4 A;  2Q7H A;  5EC2 C;  4BW9 A;  1GK9 A;  1IBM B;  2B5U A;  3WB0 A;  3APO A;  2UUB O;  3CCQ V;  3RYH A;  3JD3 A;  2AHZ A;  2ZIM A;  4ZOL B;  2XHB A;  2HKO A;  2PZS A;  5L3G A;  4J42 A;  1G4Y B;  4MVS A;  4B3M B;  3CPW U;  1WA8 A;  4YY3 O;  1ROP A;  3D3I A;  3QVN A;  4QJF B;  1R73 A;  4U7O A;  2UU9 O;  3HR0 A;  1XDC A;  5JJN B;  2RNB A;  3JSN A;  3FKS G;  1IXB A;  1SA0 A;  3QO8 A;  2EZO A;  2ODM A;  1WPX A;  1ZL8 B;  1SQP H;  1HNW B;  3K04 A;  2IJK A;  2CE4 A;  1XMO O;  1GM9 A;  4DR6 B;  1P7B A;  4J80 A;  3C90 A;  3SPG A;  5EYP B;  4KFM A;  1NI8 A;  3D36 C;  2MK3 A;  3QO5 A;  3GB7 C;  3RVZ A;  2F4V O;  4H44 B;  2DOS A;  1B6Q A;  2CDY A;  1KP2 A;  4FMT A;  3AG2 C;  2OT5 A;  1HR0 B;  5C93 A;  3CCR V;  2ZR3 A;  4JTD B;  4PEL A;  2Q5Z A;  2XAQ A;  4BIU A;  2RN9 A;  1DLB A;  4ZI7 A;  4X20 A;  2OWO A;  1FXK A;  4QGP A;  1XNR O;  2D3O W;  1QVG U;  2Y69 C;  1HNZ O;  3FB7 C;  3F7Y C;  1TA8 A;  1T5E A;  4DRX A;  1S3J A;  2ZE5 A;  1JFF A;  2VQE O;  2X7R B;  1NH2 B;  4DW0 A;  2Q67 A;  1F4N A;  2HHH B;  1YVW A;  4X1K A;  3CYO A;  2P4K A;  5IYD O;  5DEC A;  2DW4 A;  3ASN B;  3AK1 A;  1DF4 A;  4FLU A;  2QWN B;  3K03 A;  4D6T H;  3JD0 A;  4KP4 A;  5BR8 O;  3BRC A;  4JZG A;  1OHH G;  2EIM B;  2V1D A;  3OMN B;  2KQX A;  5BMV B;  3TET A;  1SKV A;  4R8C A;  1W0K G;  4TUY B;  4CH4 A;  2ADQ B;  4JI3 B;  3CCL V;  2PF4 E;  2QTS A;  3MAQ A;  2YIB D;  3K08 A;  3ZRS A;  1YF2 A;  3CC4 V;  4EFE A;  1KB9 F;  5EIB C;  1QLN A;  3AK3 A;  2CTP A;  4YJ2 B;  2YIA A;  3A0H Z;  4IIJ A;  4MTG A;  1XHX A;  3G6B A;  1R6T A;  5ITZ A;  2AHY A;  1RFY A;  1R3J C;  1WP8 A;  2Q4P A;  4YIP A;  1WNS A;  4UV8 A;  2E74 B;  3E86 A;  3OMI B;  3JAW A;  4JI2 B;  2JGU A;  4J9Z B;  1PL4 A;  5A9G A;  4PHZ A;  5CA0 A;  2EIN C;  4EB6 B;  4O4L B;  3RFR A;  1AJN A;  2P6J A;  5EBL C;  1M1K W;  3ZRW A;  3R65 A;  2ADP A;  4C7U A;  4DR1 O;  4DW1 A;  1XI1 A;  4JTA B;  3BVO A;  4PA7 A;  1F4M A;  1ZTE A;  1YEW A;  3CRM A;  4GKJ O;  1Z5W A;  2A06 H;  2M7W A;  5KMG A;  1KEC A;  3CME V;  1M4U A;  2CTR A;  4PV1 B;  4GX1 A;  1MOF A;  1N32 B;  2N74 A;  3NXS A;  2Q7E A;  1RP3 B;  3M99 B;  4EKW A;  2LFS A;  3CCJ V;  3OUF A;  1NT2 B;  2JGD A;  2F23 A;  1PM9 A;  4DYL A;  4DR7 B;  3PJS K;  1NH2 D;  3JCZ A;  2IM9 A;  1ORQ C;  4TT3 G;  2GUZ B;  3L73 H;  1BT8 A;  2P4V A;  2B1G A;  1Q81 W;  4LF7 B;  4HNA B;  4JYC A;  4ZHQ B;  2ZR2 A;  4QE9 A;  3SPC A;  4DR4 B;  1VF6 C;  3AG7 A;  5LMU B;  3MDS A;  1SET A;  1K33 A;  4CH3 A;  2JJ2 G;  2ZXW C;  4LNU A;  2OCC C;  3CD6 V;  2LGQ A;  2ITD C;  1IBL B;  1V54 C;  4D7T A;  1MAB G;  4LF8 B;  3N2K A;  3KG2 A;  1PNM A;  3WG7 C;  2ARH A;  2LW7 A;  3JAK B;  4YXW G;  4O4H B;  4Z1M G;  4U3J B;  4MT8 A;  4OX9 B;  2ATK C;  2YI8 A;  1Y74 B;  1SC5 B;  1B06 A; 
#chains in the Genus database with same CATH homology
 4DV3 O;  4LF9 O;  4DV0 O;  1KUQ A;  1IBL O;  1YZB A;  4AQY O;  4LF8 O;  4X65 O;  1DK1 A;  4LFC O;  4X66 O;  2ZM6 O;  1J5E O;  1XNQ O;  2F4V O;  2DOS A;  1HNW O;  4DUZ O;  4K0K O;  1HR0 O;  4LF6 O;  4DR1 O;  4OX9 O;  4OPA A;  1I94 O;  2UXB O;  4JI0 O;  4JI2 O;  3J80 N;  5FLX N;  1FYJ A;  4GKJ O;  4JYA O;  4X64 O;  1N36 O;  2E5L O;  4DV1 O;  3T1H O;  4DR3 O;  1AB3 A;  4LF5 O;  1X59 A;  1XNR O;  2UXD O;  4JI1 O;  1A32 A;  2VQF O;  5LMN O;  1HNZ O;  2ZKO A;  3R66 A;  1F7Y A;  4JI6 O;  2UXC O;  4LF4 O;  1NS1 A;  3RT3 C;  1R1B A;  4JI4 O;  1HNX O;  2N74 A;  3J7A U;  2VQE O;  2UUC O;  4JI5 O;  4LFB O;  1XEQ A;  1D2D A;  2FKX A;  5A2Q N;  3T1Y O;  5BXZ A;  4DUY O;  1IBM O;  5IWA O;  1XMQ O;  4LFA O;  1FJG O;  4JV5 O;  4DV5 O;  4DR2 O;  2JRI A;  5BR8 O;  1N32 O;  3J81 N;  2DJV A;  3M8A A;  1IBK O;  4B3T O;  2UUB O;  5H5N A;  2HHH O;  4DV2 O;  4DR7 O;  3JAM N;  4B3R O;  4B3S O;  4A5U B;  2AGA A;  4YY3 O;  5BY1 A;  3SDL A;  4NXN O;  2UUA O;  4DV4 O;  4YHH O;  2UU9 O;  4X62 O;  3F5T A;  4DR5 O;  4LF7 O;  4KHP O;  1G1X B;  1R6T A;  4DR4 O;  2LW7 A;  4DV7 O;  4JI3 O;  4OPH A;  5LMU O;  4DR6 O;  4DV6 O;  2Z0A A;  3O65 A;  3OTO O;  1AIL A;  4B3M O;  4JI7 O;  1N33 O;  4GKK O;  5IT9 N;  1FKA O;  1XMO O;  1N34 O;  5LL6 Y;  4JI8 O;  4NXM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...