4GKJO

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4gkjO00
1R6TA 4LF8O 2LW7A 1A32A 1HNWO 1XNRO 4DR7O 1KUQA 2ZM6O 4DV4O 2DJVA 1FKAO 3J7AU 4LF9O 3M8AA 1HR0O 1XNQO 3O65A 4DR1O 2HHHO 1G1XB 3J80N 1I94O 1AILA 4DUZO 4LFCO 1HNZO 4B3TO 4JI6O 4K0KO 4X64O 1FJGO 4DR3O 4X66O 1IBLO 4JYAO 1AB3A 4OPAA 1YZBA 4JI3O 1HNXO 4DV6O 1N36O 5BR8O 4A5UB 5BY1A 4DV2O 5IWAO 2UUCO 1DK1A 4DV7O 4GKKO 1FYJA 4GKJO 4DR6O 5A2QN 2UXBO 1X59A 4DV3O 2JRIA 2F4VO 1XEQA 5BXZA 4YHHO 2E5LO 5LMNO 2UXCO 1F7YA 4JI4O 1N32O 2FKXA 1D2DA 3J81N 1IBKO 4B3SO 1N34O 4B3RO 4X62O 2AGAA 4DR2O 4LFBO 5LMUO 1IBMO 1NS1A 4LF6O 3RT3C 3JAMN 4YY3O 4JI7O 3F5TA 3R66A 4X65O 4AQYO 4LF4O 4B3MO 2Z0AA 4JI0O 2VQEO 2UXDO 4DR4O 4DV1O 2N74A 4DR5O 4DUYO 4JI1O 4NXMO 2ZKOA 3SDLA 3T1YO 4DV5O 1XMQO 4LF5O 1XMOO 4JI5O 2DOSA 4JI2O 3T1HO 4DV0O 1R1BA 2VQFO 2UU9O 4LF7O 5LL6Y 5H5NA 5IT9N 1J5EO 4LFAO 4OPHA 4JI8O 4OX9O 3OTOO 4JV5O 4NXNO 4KHPO 2UUAO 5FLXN 1N33O 2UUBO
chains in the Genus database with same CATH superfamily
5D5PA 1BQZA 4Q6GA 1XREA 1HNWO 2ZD9A 3AK3A 1Q86W 4RQEA 3M8AA 4TV8B 4J7JA 1AILA 1NQTA 5KHJA 1HNZO 1K5QA 4HNAA 4J10A 2XTAA 4X66O 3ZHUA 1S5JA 1T5EA 4PDMA 2A06H 3ABLC 3OM3B 5IY5B 1N36O 3K04A 1RPOA 3JATA 1MOFA 2VQEB 2OWOA 1GK9A 1RFYA 2CK3G 1FXHA 3ZRWA 2NNUA 3OR6C 1RPRA 1NR1A 2DYRC 3MAQA 4J11A 4FIPC 3K57A 3A0RA 4K35A 4O2BA 1O9HA 5JCOA 1SRYA 2WWWA 4CS4A 3VBBA 4I5SA 2R9AA 1N34O 2PF4E 1P84F 2P22C 4WFFA 2W0FC 4WFHA 4BWAA 4AILC 2JJ1G 4CC5A 4JI2B 3RT3C 4UFZA 4TV8A 4K0KB 4EB6B 4I50B 4AQYO 4DR3B 1IBLB 2Q68A 2Q8VA 3WFVA 4JF3A 3H1HH 4U7NA 1AJPA 5B3SC 2UUCB 5JH7B 5DEDA 1H2SB 3N2KB 2QM4A 4GKKB 3FFQA 1XMQO 3CRCA 2EZOA 3T1HO 1R1BA 2UXBB 3MDSA 1J5EO 3K0DA 4MVMA 4X64B 5CB4B 4J80A 4LBEC 2L6LA 3BAAA 1QLNA 2YC0A 2ZNJA 4B3RB 2ZM6O 3SJQC 4LF9O 3X2QB 5KA5A 4IT5A 2D3OW 3K5MA 3O65A 1WB8A 1G1XB 1KKDA 2XAFA 3D36A 4ICGA 1AP5A 2Q0OC 1MMMA 3SGIA 4GT1A 3BA8A 1B3QA 1NZ6A 4JI3O 4O4LB 4TQFA 4EB6A 1YCIA 2WAMA 2YI8A 4I50A 2GDSA 1GRJA 1MA1A 2ZR3A 4BW9A 4YJ3B 3OEHG 2EINB 3HKCA 4QE9A 4UB6Z 3G6EV 2WLLA 5CBFA 2ZIMA 4IHJA 1YTFB 1SQVH 2QSAA 3AG4B 3AK1A 2F4VO 4ZI7B 1EBOA 3CPWU 3CX5F 2BSKB 4UCSA 2OCCC 5JVDB 3L70H 2FYUH 4YJ2B 3SJCC 4U7OA 3D36C 1YJ9V 2EIJB 3CMEV 2Q4PA 4K3AA 3ZJZA 1WP8A 3ZBHA 4CS2A 4N21A 5LA6B 3MHHC 4LWSA 4DW1A 1Y74A 2XAGA 1VQMV 2JDIG 4DK1A 4KUMA 2RQ6A 1PD3A 2WPDG 4JYAB 4DO2A 4I7ZB 4L8JA 4NTWA 3ABUA 4FM1A 2Y4UA 1ZL8B 2YXYA 2B5UA 1KQSU 1MSDA 1VMGA 4UV9A 4GKJB 3L72H 4YJ3A 2F95B 2BOBC 4X1IA 1NTMH 5IDJA 1N0NA 1AI5A 3SYOA 2WA3A 3L75H 4JI6B 1FFXA 3F7VC 1M57C 3Q4HB 1AI7A 3OTOO 4JV5O 2FTKA 5JVDA 3ZRXA 1M56B 2P4VA 1OCRB 3BRCA 4YJ2A 4FZ1A 4LF8O 4Z1MG 2VRZA 5LHHA 1HR0O 3JAKB 4TT3G 4O4JB 4DR2B 2GBOA 3K58A 3CCEV 5LA6A 1YJWV 3SYQA 1QLEB 4R8CA 2Y0PA 4I55B 3CXHF 1HNXO 4ZOLA 5K1XA 4YHHB 4DV6O 1H2KA 4UB8Z 1B04A 2UXCB 4UCTA 1N32B 1KP2A 3RYFA 1URFA 1EN4A 4QIWF 1ZL8A 5LBQA 1BHAA 3K9SA 4KL1A 1V55B 3FB7C 2JRIA 2DN9A 1YITV 4G27B 1GN3A 4P30A 4IYHA 4H37A 2FKXA 1S5LZ 4B3SO 2Y4TA 2RMKB 1OCZB 1FXKB 1F4NA 1Q82W 2NN4A 1VQ7V 2AZ2A 5FPRA 4H13B 1YSCA 4C7UA 4FZ0A 4O4JA 3F5TA 3L9DA 3HKBB 3RYCA 4BR6A 2CTRA 1MG1A 3TETA 4HAMA 4DR4O 2ZNIA 1CP9A 4WCEV 4MS2A 2OT5A 2H94A 1NTZH 3UM7A 1BE3H 5KHKA 1XMOO 4JI5O 2X7RB 2MK3A 4PA4A 2UU9O 1SS3A 4FLZA 4CH4A 2ITDC 3WB1A 1FPOA 3H1LH 5D5QA 4JPRA 1E1RG 1IURA 5AG2A 5B1AB 1Y6XA 2YXLA 3ETDA 4R7CA 2UUBO 3ASNB 3RYHA 2LW7A 4AHCA 1KUQA 3K59A 1P7GA 3JAWB 1VQLV 1B6QA 3OGIB 2JJ2G 2EILC 1YZBA 1GM8A 3G6BA 1W0JG 1JR9A 3VQVA 3DXRB 1Z5VA 4JI0B 4PA6A 3EXAA 4GUNA 2LO1A 3T4DA 3SR2C 5LGTA 1S72V 3RFRA 2P06A 3CS5A 2BTOA 2E76B 3ZX6A 4QPJA 3RVYA 2IH3C 2RN9A 3I55V 4NXNB 3HPLC 1I5XA 2LFSA 2FB5A 2QWOB 2QM8A 1IBKO 2UXDB 2KB1A 2Z5UA 1HNWB 3KCXA 1YVWA 1ZX3A 4UCOA 3B09A 3JSLA 1NT2B 2XT9A 3R65A 3BHPA 1HNZB 4YY3O 1GM7A 4JZ2A 5H6RA 3QO5A 3S3WA 3W7TA 4DXWA 3JALA 1N36B 1W59A 5B66Z 4H44B 4DV1O 3DSQA 2P7TC 3FKSG 5BZBA 2Y0IA 2YIDA 3O9OA 4PV1B 2Q7GA 4BAYA 2ZT9B 2FMLA 1K33A 5LL6Y 4OGQB 2CTPA 2X6BA 3CCMV 1L1FA 1K34A 1QNMA 1H2NA 1X4TA 5LP6B 1QVGU 1WNSA 4JYYA 3FAVA 3TGUH 1N33O 2DE0X 2RNBA 4F4LA 4DR7O 1YXBA 1ZTEA 5IJ9B 1N34B 5FL7G 3TCUA 1GN2A 4B7KA 1K9MW 4EFBA 4UXNA 1Q5OA 4LNUA 1I94O 3G67A 1GKFA 2Q9LA 3T2MA 3BY6A 3VOUA 3GB7C 4HBNA 2P4KA 1Q6UA 3U11A 4HYOA 1QR9A 4JTDB 1QHTA 1Z2GA 4L87A 2XAJA 2ZDIA 1SA0A 4PA3A 1XMQB 4LP8A 2BTQA 2CTWA 5C8YB 3OMIB 1X59A 3ASOC 1SETA 1GH6A 4LFBB 2CGOA 3TJTA 1RM1C 1IBMB 1DGSA 2YIBD 4LH6A 3F7YC 4HZ3A 3JD4A 4KXRA 3I5DA 4MW3A 1D2DA 1K3EA 1RSOA 4MVUA 4DRXB 5BMVA 4X62O 1F4MA 2H3OA 3BCCH 2UXNA 1OCOB 3JSNA 2DYSC 4RO2A 1JOYA 2HVKC 2EJ7A 3CWBH 5TISZ 2ZDIC 1V9PA 2KKWA 2N04A 4E2LA 3G80A 1MSWD 2A3QA 1SERA 3E83A 2CH7A 5LGUA 4DR5O 3WG7B 1US6A 4LF5O 3HKEA 3W7WA 1JX9A 1WN7A 1GAXA 3EHBB 4B3TB 2F4VB 1H8EG 4TQDA 1N0JA 2ODMA 1JQ0A 4F6RA 4UV8A 1JFFA 3JCUZ 2IJJA 3CYOA 3JARB 1A32A 2KG7A 3OD4A 3JD3A 5IYZB 4DV4O 1H2MA 2IJIA 1DF5A 2Y69C 1OHHG 4BW5A 3FB5C 2QDOA 4FLVA 1NH2B 1P7BA 2YUAA 5GW7A 1UPGA 1PL4A 2WLNA 4DV2O 5L3CA 1AJNA 3ZMTA 2M7WA 4MSWC 4FLWA 1NBMG 3L71H 5CA3A 3AG2C 5CA1B 2XNDG 4ZKIA 3OUSA 3CC4V 2NR5A 4U3JA 4FFKA 3IGAC 4ZHQA 2AXTZ 2HKOA 3AEIA 5B5EZ 1MZEA 4ZBMA 1ZSPA 4FM2A 1KBHA 1F7YA 3NR7A 4QNHB 2PYLA 1L8DA 4O4IB 1F51A 4W4KA 2YICA 1H38A 1ZAUA 2E3CA 3JASB 4NR1A 1BT8A 3CRMA 1JA8A 2P6JA 1HP8A 3R66A 3BABA 3ZEDA 2V7QG 1HNXB 3CRRA 3FB6C 5CBGA 2ZE7A 4B3MO 2GHYA 1CPYA 2ZXWC 1Q6HA 3A0BZ 3C3TA 4NXMO 3DC5A 2PYJA 3CJHB 3T1YO 3AG3B 1Y67A 2AW9A 4FFBB 3TK1A 4J41A 4LF7O 5CA1A 2YIAA 2R72A 1GM9A 3A2FA 2ITCC 1VQOV 5FLXN 1V54B 3SPHA 5BR8B 1Q90D 1G8MA 1U96A 5JCOC 4O4IA 1R3IC 4BIOA 4FVMA 4D7SA 4DUZO 1K7DA 2ILMA 2QWRB 3K5NA 1VF6A 2NLJC 1SQBH 2P90A 5IYDO 4PI2A 1AR1B 1I08A 3CRAA 3CCUV 2E5LB 3KKYA 4PI0A 4AI8A 5IWAO 1BS3A 2RJZA 4JI4B 4DR4B 3E35A 4BIUA 1WJZA 3GWKC 2JVDA 3CCRV 2UXXA 1XMOB 3RYIB 1I0HA 3K08A 4ABMA 3OW2U 2CUGA 3CP1A 4FFBA 5IY5C 3JD1A 2DQ0A 4QJFB 5DECA 2QE7G 3RWRD 2YI9A 1CEZA 1NI8A 2P5OA 1VF6C 1QBZA 1ZLZA 2ZE6A 4LH7A 1XDCA 2B1IA 4DW0A 2QKCA 5JH7A 4UCUA 1KU9A 3E8FA 3N2KA 5LMUO 2G38A 1S3JA 1NVPD 1Y76B 4DV0B 4I0XB 4JI7O 4MTXA 4LF4O 2V4DA 4IGGA 3QTCA 1NKDA 1UFIA 2OTLV 3K5OA 5CB4A 3APOA 3CCSV 1BQ0A 1OCCB 1XL6A 2XHBA 1XBLA 2ADQB 2YEVB 1OJHA 3RVZA 1VQ6V 3K06A 2EBOA 3RYIA 2Q7EA 4LFAO 4JI8O 1R73A 1K4CC 4Z2WA 4JAVA 1FS0G 3IJ4A 4O4LA 1ZWIC 1R6TA 3K5LA 2DJVA 1B06A 3OMAB 1SESA 5B1BB 1LR1A 1D5AA 2HHHO 2ZINA 4F6EA 3E22B 1LNQA 3SPCA 4UVCA 2GTSA 4EEQA 2X6AA 4FLYA 4I0XA 1XI1A 4YIOA 1AI6A 4ZI7A 3KZIZ 2BSKA 3B8MA 3X2QC 5BY1A 3C3SA 3ZMZA 5J9PC 1KYOF 4O2AB 4U3FH 1VEWA 1YDXA 2HLDG 3LSSA 1WLEA 4WFAV 1Q6IA 4IYIA 5BXZA 4IL6Z 3ZN1A 3VQYA 5KX5B 1H2LA 1VARA 1ZUQA 1WB7A 2EINC 2EIKB 1N33B 3M99B 4J7ZA 3MD0A 1PL0A 2WLHA 2ATKC 3AG4C 1OZ0A 3RGBA 1NU1H 1M5IA 3SYPA 5C93A 2IU3A 1BZKA 5LXTB 1I94B 2IM9A 4D6TH 5FNVB 2LGQA 5JJJB 2MW2B 2EIJC 2A7WA 2EIMB 2R9IA 1W2BU 2EILB 1KKCA 1ORQC 2QWNB 3Q4HA 2EZPA 4XDJA 4DUYO 3B4SA 4E4EA 1P4RA 3SDLA 3U10A 1HW7A 1PM9A 2P67A 5EC2C 1QR8A 3UT5B 4JI2O 3ZHVA 4FLUA 4DR1B 1YJNV 3JAKA 1YI2V 3OFNG 4OX9O 1TVKB 3BPZA 3CCQV 1E1QG 1I5YA 4WFGA 2R9RB 4I55A 5KX5A 2CDYA 3LSUA 3J7AU 4X62B 3IFXA 2GUZB 3ZRSA 4X64O 4G2KA 5LXTA 3ZMVA 1M56C 5L3EA 3E2EA 2QTSA 5EK0A 1SC5B 3K0GA 4PELA 5LHGA 5LMNB 1M93A 1SQXH 3H9VA 4QGPA 1EM1A 2HEPA 1MZFA 4DR6O 3CCJV 5K1PA 1FXKA 3UCSC 2GTAA 4TOIA 2HVJC 3JD0A 1EN6A 3HR0A 4MVRA 2JEXA 2Q0AA 2LJ2A 4X65B 4X9QA 1TVKA 1PPJH 4FJCC 3HKBA 5A9GA 1V55C 2WA4A 3QO7A 1H8HG 3QO8A 4WF9V 2GUZA 2X0LA 2R70A 2JGUA 4PD4F 3ABKB 1VF5B 3FX7A 3IC9A 2IJKA 1COWG 5IE9A 1FXVA 1EZJA 4KHPB 2B1GA 3JD2A 4H0LB 1BMFG 1Y4MA 2QKSA 1R6KA 5H9CA 4TSFG 3STLC 2DOSA 2ETNA 2JIZG 5JQGB 4JZGA 3DGEA 2QJ1A 3JAWA 3ZCCA 1JCHA 1YF2A 4W4LA 4X66B 1ENVA 1K4DC 1EN5A 2EULA 4YIPA 1SQFA 5EIBC 2OYQA 3DXRA 1R6NA 1OV9A 1DTOA 1Q81W 4PDRA 4LFCO 1GO3F 4J9ZB 4JI6O 4I9WA 3F5WC 1R3KC 1M90W 3B8NA 1AB3A 4J7KA 3WB0A 2XAHA 2DYSB 3ASNC 1R3LC 1K97A 4GX0A 5KMGB 3HKDB 4A5UB 1ROPA 1VF7A 1DK1A 5GONB 4DV7O 3ZMUA 1AR4A 3CB2A 3T1YB 5LYJB 5ITZB 2W6JG 3EVKA 3G71V 4YHHO 2WLIB 1YEWA 3OR7C 3SPIA 1XILA 2HR3A 2CE4A 4AQYB 2UXCO 1N32O 2ZR2A 2HJDA 3BVOA 5EYPB 1MABG 3MHSC 5KA6A 2Q69A 2AGAA 3ETQA 3L73H 4IIJB 4PA9A 5HFMA 1NJIW 5KHHA 2D2CB 3AG1B 4DUZB 2AHYA 4LF6O 3ABMC 2YSUB 3T1HB 1VQNV 1J5EB 1PNKA 1PKXA 4XDKA 2JS5A 3SYAA 1IZ3A 4MW8A 1LUWA 2OIGA 1K92A 2XAQA 5E79Z 5LP6A 4RAIA 4JI1O 5KMGA 3HKDA 3ICXA 3BA9A 2LFRA 4DV5O 5KUMA 2ZM6B 5IJ9A 4LF9B 1THZA 5L3FA 4EKWA 2VQFO 2XUMA 4XDLA 5H5NA 4X1YB 1SKVA 4TV9B 5LYJA 5ITZA 3VQXA 5B1NA 3UKMA 3K3WA 4JI3B 1F23A 4CBCA 3ABLB 2AHZA 3CC7V 2ZIOA 4QPKA 1XNQO 1AJQA 3J80N 1YTFD 1XL4A 4MTOA 3D3IA 2CGNA 2CAZC 1XHXA 2DYRB 1PV0A 4JI7B 5C8YA 3QVNA 3BFRA 4UVBA 5KHIA 2QTOA 3IAYA 2Q6AA 1SQGA 4HNAB 1VQKV 4DRXA 1PP9H 3FYIB 3CC2V 1BGYH 4CH6A 1S0VA 1UJWB 1XEQA 1KECA 3W7XA 1IXMA 1Q3EA 4JAAA 2H8PC 3JATB 2O57A 1W0KG 3H1JH 1LUVA 4TV9A 3ZRWB 2JK5C 2Q73A 4FMTA 1QVFU 3G4SV 3A0HZ 3B2EE 2OTJV 1KC8W 5B3SB 4O2BB 1TA8A 2HHHB 3H1KH 3JAMN 1KMIZ 2PI4A 4PDLA 3OTOB 4JV5B 4UCVA 2UXDO 5KAIZ 1OCOC 5J2TB 4LF8B 2VWKA 4DK0A 3LUTB 3JARA 1HR0B 5IYZA 1BHBA 4LR3A 3VQWA 4P9PA 2Q5ZA 3E86A 3OAAG 2UUAO 2KSDA 3WG7C 4DV6B 1BL8A 1XNRO 4MVZA 4KP4A 5B1OA 3A8TA 1JVMA 1JPXA 1Z5WA 3ZHRA 2WSSG 1Q8IA 5IJ0B 1KP3A 1FJGO 3P30A 1DLBA 1AI4A 1VP7A 4Z1VA 5EZYB 5LHIA 1VQPV 3QF7A 2OCCB 2QR4A 4TUYB 4GLXA 4NTYA 4B3SB 4DUYB 4UCRA 1J95A 5J2TA 5IYBO 5A2QN 1JJ2U 4DV3O 2Q67A 4J9YB 5DN6G 4PA7A 2F23A 3JASA 4UUJC 4OX9B 1E79G 2K1EA 4GX2A 3HKCB 1EFRG 1SQPH 1PNLA 3OGCC 2WLLB 3WB2A 3QNEA 1VQ4V 4IHJB 3M7MX 1VQ9V 5EIBD 4P9OA 4LFBO 4JI5B 1IBMO 3CJHA 2UU9B 1Q43A 1KD1W 5IJ0A 1S5HC 1GN6A 3SJAC 5L3DA 4GCZA 4O4HB 1M57B 1QCEA 2PTMA 2L35A 1IXBA 2YS8A 5EZYA 5DM6V 3ZHSA 2UUBB 4LWSB 5GTHZ 4TUYA 1Y74B 1WP7A 2C2AA 4DR6B 4EFEA 2DQ3A 2IW5A 2IJHA 5L3BA 3ZIAG 5KHGA 2QWPB 3AG3C 1N4CA 3HB3B 1D5NA 4X1IB 4MVSA 4MTFA 1FFXB 4NB5A 4B3TO 1GTOA 2XASA 4UVAA 4XBFA 2IU0A 1V54C 2M6YA 4NTXA 2DWEC 1K5SA 2JS3A 2YIBA 4X88A 2LP7A 2PY5A 1QQCA 4GYCB 3L74H 1AROP 1TAEA 4O4HA 1IBKB 3GWOA 1FYJA 3PN1A 1WPXA 1K8AW 1YHQV 4RUFA 5EBLC 3PJSK 2QEXV 1WAZA 2Z3YA 2QA4V 4ZOLB 2HP8A 4MT8A 4YY3B 3KG2A 1Y76A 3RYFB 3STZC 2V1DA 5E1AC 2K9PA 5CBHA 3J81N 4CH3A 4NYKA 4DV1B 2LQTA 3APQA 4LFCB 4JYCA 3JYCA 4GX1A 2QM7A 2FL4A 2YEVA 4MVQA 1VQ5V 4KFMA 3D3QA 4OXSA 3D8CA 1XUQA 4G28B 3JCZA 3CXCU 2Q7HA 2RDCA 2IH1C 3ETGA 4MTGA 4JTCB 5LGNA 3LDDA 2VQEO 2N74A 3U0ZA 4DR7B 4DV7B 2HFEC 1XOUA 1WPBA 4NVPA 3RYCB 2Y48A 2F66C 5IT9N 1SZXA 2VS0A 3E22A 3LDCA 2EJRA 4RUEA 4WFEA 3H1IH 3CD6V 1PNMA 4FPPA 1RP3B 4B7EA 1OCCC 5EBMC 2PGGA 1AR5A 2QGNA 3B40A 3C90A 1I7FA 4JAUA 1XHZA 2ZE5A 4JTAB 2ADPA 4O2AA 1G4YB 1MNGA 2B9ZA 3ZS8C 2X6CA 4K0KO 4LF6B 3GVMA 4DR3O 1IBLO 2PZSA 2IBZH 5H6QA 3FD9A 2YXHA 3RYHB 3P3PA 5BR8O 2VWJA 1CXZB 2XOKG 5B1BC 2UUCO 3SPJA 2QKAA 4GKKO 4JI1B 4DV5B 4CS3A 1U97A 2UXBO 1VIBA 2VQFB 1EZVH 2W0XA 3CSXA 5KAFZ 1OCRC 3BEHA 2E5LO 3K9AA 5FNVA 2E75B 4BIZA 1SF9A 4JI4O 2JEUA 3NXSA 5JWPA 3K03A 5HFLA 3CCVV 4B3RO 3E89A 3CMAV 4DR5B 3T4ZA 1SQQH 3UO2A 1XNQB 3LDEA 3OUFA 1QLEC 4LF5B 3UO3A 4CC6A 3UT5A 3K79A 1JJOA 2EIKC 4ASUG 5EC1C 3ML0A 2Z0AA 2WLMA 1S76D 1FFTB 2W6IG 5KLVH 2ZCEA 2ZKOA 2ZQMA 3ETEA 4DYLA 3RN4A 3IC7A 3OE7G 4DV4B 1VQ8V 2EX3A 3ZRVA 2EIMC 4DV0O 1N8RW 1XQ8A 1NVPB 1NH2D 3ZN0A 3P32A 4I4TB 3JALB 3E8HA 5FPOA 1L0NH 4JYBA 2ZE8A 1H2GA 3ZHQA 5LOVB 1OCZC 1FXKC 5F2VO 5CMUA 2LGWA 4RQFA 3P3NA 4DV2B 4R50A 1FKAO 2QWQB 3SYCA 4FM0A 3CEIA 3N27A 3CRQA 3FAVB 1R3JC 4JYAO 4OPAA 3ABMB 1S77D 3ASOB 1GN4A 1RM1B 4JASA 4GZRB 2BCCH 3CCLV 1QU7A 2JGDB 2WLKA 4PJ0Z 3AK2A 4LNUB 4N23A 4GKJO 2KQXA 4WBNB 3DC6A 3E8GA 4FK5C 1TUEB 4K8ZA 3AG7A 4X20B 3QG5A 5B1AC 2OCHA 4I4TA 3CE2A 3EFFK 3WU2Z 5H2FZ 2UUAB 5GTIZ 5J2UB 3ZMSA 4B3MB 2A0LA 1SA0B 2CTQA 5LOVA 2WLJA 1XNRB 2BTQB 3TXQA 5IYCO 4NXMB 1Y66A 4DR2O 3ABTA 3RW0A 2F43G 4PDVA 4D7TA 1NS1A 5L3GA 5JQGA 4LF7B 1FJGB 4X8AA 4RWUA 1RSOB 4NKGB 4GX5A 5BMVB 4I9QA 1WA8B 1K73W 3B77A 2N05A 1L0LH 3LNMB 3S3XA 2JGDA 4MVOA 4R6ZA 5CA0B 1YIJV 3ABKC 4X1KB 2AZ0A 1NR7A 4WBNA 4WFBV 3SPGA 4DV3B 2Y69B 4X20A 1M9NA 3RBZA 1M1KW 3LSQA 2CH7B 4X89A 1Q7YW 1M4UA 2YDEA 2DW4A 3TXSA 3OMNB 5J2UA 5IWAB 2BE3A 1IVSA 3HKEB 4FLXA 1TUBB 3FB8C 1FD9A 4DR1O 1SZTA 5GONA 2A9HA 1P49A 3SJBC 4F6RB 1NTKH 1KB9F 3AG2B 1AP6A 1JFFB 5EBWC 4FLTA 2KG7B 3DTUB 2WLIA 3OEEG 1WA8A 3N2GB 4K8XA 5EYPA 5CN0A 5KUKA 2DWDC 4J42A 4TWKA 5CA0A 3E8BA 4IIJA 4B08A 3LNNA 5LP6C 5LMUB 4X1KA 4CZZA 5LMNO 4LF4B 3CHXA 2DMXA 3UQ8A 4Q20A 3W7UA 4H33A 2ZXWB 3FYEB 4U3JB 2HJFC 1TUBA 4ZHQB 2OIEA 2PI5A 3OTFA 2A79B 2PUSA 4X65O 4PHZA 4LFAB 1AVMA 4JI8B 1HDJA 3OT7A 2LW1A 2RCVA 2GV9A 1GMGA 4X1YA 1IX9A 1FAFA 4JI0O 2F93B 4LCUC 5JJEB 3AG1C 1BCCH 1O9GA 3I56V 1TGOA 1BSMA 1G6UA 2HG5C 3N2GA 4P2ZA 4YXWG 4LC1A 4ZIBA 4JGSA 1IDSA 4CH5A 1JMKC 2BOCC 4OPHA 3W7SA 4NXNO 2GSMB 3T1CA 5JJNB 3THOA 4KHPO 4QE7A 3KCYA 2ARHA 2E74B 1HWYA 3ZHTA 3H01A 1DF4A 2F1MA
chains in the Genus database with same CATH topology
1R6TA 4LF8O 2LW7A 1A32A 1HNWO 1XNRO 4DR7O 1KUQA 2ZM6O 4DV4O 2DJVA 1FKAO 3J7AU 4LF9O 3M8AA 1HR0O 1XNQO 3O65A 4DR1O 2HHHO 1G1XB 3J80N 1I94O 1AILA 4DUZO 4LFCO 1HNZO 4B3TO 4JI6O 4K0KO 4X64O 1FJGO 4DR3O 4X66O 1IBLO 4JYAO 1AB3A 4OPAA 1YZBA 4JI3O 1HNXO 4DV6O 1N36O 5BR8O 4A5UB 5BY1A 4DV2O 5IWAO 2UUCO 1DK1A 4DV7O 4GKKO 1FYJA 4GKJO 4DR6O 5A2QN 2UXBO 1X59A 4DV3O 2JRIA 2F4VO 1XEQA 5BXZA 4YHHO 2E5LO 5LMNO 2UXCO 1F7YA 4JI4O 1N32O 2FKXA 1D2DA 3J81N 1IBKO 4B3SO 1N34O 4B3RO 4X62O 2AGAA 4DR2O 4LFBO 5LMUO 1IBMO 1NS1A 4LF6O 3RT3C 3JAMN 4YY3O 4JI7O 3F5TA 3R66A 4X65O 4AQYO 4LF4O 4B3MO 2Z0AA 4JI0O 2VQEO 2UXDO 4DR4O 4DV1O 2N74A 4DR5O 4DUYO 4JI1O 4NXMO 2ZKOA 3SDLA 3T1YO 4DV5O 1XMQO 4LF5O 1XMOO 4JI5O 2DOSA 4JI2O 3T1HO 4DV0O 1R1BA 2VQFO 2UU9O 4LF7O 5LL6Y 5H5NA 5IT9N 1J5EO 4LFAO 4OPHA 4JI8O 4OX9O 3OTOO 4JV5O 4NXNO 4KHPO 2UUAO 5FLXN 1N33O 2UUBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6T A;  4LF8 O;  2LW7 A;  1A32 A;  1HNW O;  1XNR O;  4DR7 O;  1KUQ A;  2ZM6 O;  4DV4 O;  2DJV A;  1FKA O;  3J7A U;  4LF9 O;  3M8A A;  1HR0 O;  1XNQ O;  3O65 A;  4DR1 O;  2HHH O;  1G1X B;  3J80 N;  1I94 O;  1AIL A;  4DUZ O;  4LFC O;  1HNZ O;  4B3T O;  4JI6 O;  4K0K O;  4X64 O;  1FJG O;  4DR3 O;  4X66 O;  1IBL O;  4JYA O;  1AB3 A;  4OPA A;  1YZB A;  4JI3 O;  1HNX O;  4DV6 O;  1N36 O;  5BR8 O;  4A5U B;  5BY1 A;  4DV2 O;  5IWA O;  2UUC O;  1DK1 A;  4DV7 O;  4GKK O;  1FYJ A;  4GKJ O;  4DR6 O;  5A2Q N;  2UXB O;  1X59 A;  4DV3 O;  2JRI A;  2F4V O;  1XEQ A;  5BXZ A;  4YHH O;  2E5L O;  5LMN O;  2UXC O;  1F7Y A;  4JI4 O;  1N32 O;  2FKX A;  1D2D A;  3J81 N;  1IBK O;  4B3S O;  1N34 O;  4B3R O;  4X62 O;  2AGA A;  4DR2 O;  4LFB O;  5LMU O;  1IBM O;  1NS1 A;  4LF6 O;  3RT3 C;  3JAM N;  4YY3 O;  4JI7 O;  3F5T A;  3R66 A;  4X65 O;  4AQY O;  4LF4 O;  4B3M O;  2Z0A A;  4JI0 O;  2VQE O;  2UXD O;  4DR4 O;  4DV1 O;  2N74 A;  4DR5 O;  4DUY O;  4JI1 O;  4NXM O;  2ZKO A;  3SDL A;  3T1Y O;  4DV5 O;  1XMQ O;  4LF5 O;  1XMO O;  4JI5 O;  2DOS A;  4JI2 O;  3T1H O;  4DV0 O;  1R1B A;  2VQF O;  2UU9 O;  4LF7 O;  5LL6 Y;  5H5N A;  5IT9 N;  1J5E O;  4LFA O;  4OPH A;  4JI8 O;  4OX9 O;  3OTO O;  4JV5 O;  4NXN O;  4KHP O;  2UUA O;  5FLX N;  1N33 O;  2UUB O; 
#chains in the Genus database with same CATH topology
 5D5P A;  1BQZ A;  4Q6G A;  1XRE A;  1HNW O;  2ZD9 A;  3AK3 A;  1Q86 W;  4RQE A;  3M8A A;  4TV8 B;  4J7J A;  1AIL A;  1NQT A;  5KHJ A;  1HNZ O;  1K5Q A;  4HNA A;  4J10 A;  2XTA A;  4X66 O;  3ZHU A;  1S5J A;  1T5E A;  4PDM A;  2A06 H;  3ABL C;  3OM3 B;  5IY5 B;  1N36 O;  3K04 A;  1RPO A;  3JAT A;  1MOF A;  2VQE B;  2OWO A;  1GK9 A;  1RFY A;  2CK3 G;  1FXH A;  3ZRW A;  2NNU A;  3OR6 C;  1RPR A;  1NR1 A;  2DYR C;  3MAQ A;  4J11 A;  4FIP C;  3K57 A;  3A0R A;  4K35 A;  4O2B A;  1O9H A;  5JCO A;  1SRY A;  2WWW A;  4CS4 A;  3VBB A;  4I5S A;  2R9A A;  1N34 O;  2PF4 E;  1P84 F;  2P22 C;  4WFF A;  2W0F C;  4WFH A;  4BWA A;  4AIL C;  2JJ1 G;  4CC5 A;  4JI2 B;  3RT3 C;  4UFZ A;  4TV8 A;  4K0K B;  4EB6 B;  4I50 B;  4AQY O;  4DR3 B;  1IBL B;  2Q68 A;  2Q8V A;  3WFV A;  4JF3 A;  3H1H H;  4U7N A;  1AJP A;  5B3S C;  2UUC B;  5JH7 B;  5DED A;  1H2S B;  3N2K B;  2QM4 A;  4GKK B;  3FFQ A;  1XMQ O;  3CRC A;  2EZO A;  3T1H O;  1R1B A;  2UXB B;  3MDS A;  1J5E O;  3K0D A;  4MVM A;  4X64 B;  5CB4 B;  4J80 A;  4LBE C;  2L6L A;  3BAA A;  1QLN A;  2YC0 A;  2ZNJ A;  4B3R B;  2ZM6 O;  3SJQ C;  4LF9 O;  3X2Q B;  5KA5 A;  4IT5 A;  2D3O W;  3K5M A;  3O65 A;  1WB8 A;  1G1X B;  1KKD A;  2XAF A;  3D36 A;  4ICG A;  1AP5 A;  2Q0O C;  1MMM A;  3SGI A;  4GT1 A;  3BA8 A;  1B3Q A;  1NZ6 A;  4JI3 O;  4O4L B;  4TQF A;  4EB6 A;  1YCI A;  2WAM A;  2YI8 A;  4I50 A;  2GDS A;  1GRJ A;  1MA1 A;  2ZR3 A;  4BW9 A;  4YJ3 B;  3OEH G;  2EIN B;  3HKC A;  4QE9 A;  4UB6 Z;  3G6E V;  2WLL A;  5CBF A;  2ZIM A;  4IHJ A;  1YTF B;  1SQV H;  2QSA A;  3AG4 B;  3AK1 A;  2F4V O;  4ZI7 B;  1EBO A;  3CPW U;  3CX5 F;  2BSK B;  4UCS A;  2OCC C;  5JVD B;  3L70 H;  2FYU H;  4YJ2 B;  3SJC C;  4U7O A;  3D36 C;  1YJ9 V;  2EIJ B;  3CME V;  2Q4P A;  4K3A A;  3ZJZ A;  1WP8 A;  3ZBH A;  4CS2 A;  4N21 A;  5LA6 B;  3MHH C;  4LWS A;  4DW1 A;  1Y74 A;  2XAG A;  1VQM V;  2JDI G;  4DK1 A;  4KUM A;  2RQ6 A;  1PD3 A;  2WPD G;  4JYA B;  4DO2 A;  4I7Z B;  4L8J A;  4NTW A;  3ABU A;  4FM1 A;  2Y4U A;  1ZL8 B;  2YXY A;  2B5U A;  1KQS U;  1MSD A;  1VMG A;  4UV9 A;  4GKJ B;  3L72 H;  4YJ3 A;  2F95 B;  2BOB C;  4X1I A;  1NTM H;  5IDJ A;  1N0N A;  1AI5 A;  3SYO A;  2WA3 A;  3L75 H;  4JI6 B;  1FFX A;  3F7V C;  1M57 C;  3Q4H B;  1AI7 A;  3OTO O;  4JV5 O;  2FTK A;  5JVD A;  3ZRX A;  1M56 B;  2P4V A;  1OCR B;  3BRC A;  4YJ2 A;  4FZ1 A;  4LF8 O;  4Z1M G;  2VRZ A;  5LHH A;  1HR0 O;  3JAK B;  4TT3 G;  4O4J B;  4DR2 B;  2GBO A;  3K58 A;  3CCE V;  5LA6 A;  1YJW V;  3SYQ A;  1QLE B;  4R8C A;  2Y0P A;  4I55 B;  3CXH F;  1HNX O;  4ZOL A;  5K1X A;  4YHH B;  4DV6 O;  1H2K A;  4UB8 Z;  1B04 A;  2UXC B;  4UCT A;  1N32 B;  1KP2 A;  3RYF A;  1URF A;  1EN4 A;  4QIW F;  1ZL8 A;  5LBQ A;  1BHA A;  3K9S A;  4KL1 A;  1V55 B;  3FB7 C;  2JRI A;  2DN9 A;  1YIT V;  4G27 B;  1GN3 A;  4P30 A;  4IYH A;  4H37 A;  2FKX A;  1S5L Z;  4B3S O;  2Y4T A;  2RMK B;  1OCZ B;  1FXK B;  1F4N A;  1Q82 W;  2NN4 A;  1VQ7 V;  2AZ2 A;  5FPR A;  4H13 B;  1YSC A;  4C7U A;  4FZ0 A;  4O4J A;  3F5T A;  3L9D A;  3HKB B;  3RYC A;  4BR6 A;  2CTR A;  1MG1 A;  3TET A;  4HAM A;  4DR4 O;  2ZNI A;  1CP9 A;  4WCE V;  4MS2 A;  2OT5 A;  2H94 A;  1NTZ H;  3UM7 A;  1BE3 H;  5KHK A;  1XMO O;  4JI5 O;  2X7R B;  2MK3 A;  4PA4 A;  2UU9 O;  1SS3 A;  4FLZ A;  4CH4 A;  2ITD C;  3WB1 A;  1FPO A;  3H1L H;  5D5Q A;  4JPR A;  1E1R G;  1IUR A;  5AG2 A;  5B1A B;  1Y6X A;  2YXL A;  3ETD A;  4R7C A;  2UUB O;  3ASN B;  3RYH A;  2LW7 A;  4AHC A;  1KUQ A;  3K59 A;  1P7G A;  3JAW B;  1VQL V;  1B6Q A;  3OGI B;  2JJ2 G;  2EIL C;  1YZB A;  1GM8 A;  3G6B A;  1W0J G;  1JR9 A;  3VQV A;  3DXR B;  1Z5V A;  4JI0 B;  4PA6 A;  3EXA A;  4GUN A;  2LO1 A;  3T4D A;  3SR2 C;  5LGT A;  1S72 V;  3RFR A;  2P06 A;  3CS5 A;  2BTO A;  2E76 B;  3ZX6 A;  4QPJ A;  3RVY A;  2IH3 C;  2RN9 A;  3I55 V;  4NXN B;  3HPL C;  1I5X A;  2LFS A;  2FB5 A;  2QWO B;  2QM8 A;  1IBK O;  2UXD B;  2KB1 A;  2Z5U A;  1HNW B;  3KCX A;  1YVW A;  1ZX3 A;  4UCO A;  3B09 A;  3JSL A;  1NT2 B;  2XT9 A;  3R65 A;  3BHP A;  1HNZ B;  4YY3 O;  1GM7 A;  4JZ2 A;  5H6R A;  3QO5 A;  3S3W A;  3W7T A;  4DXW A;  3JAL A;  1N36 B;  1W59 A;  5B66 Z;  4H44 B;  4DV1 O;  3DSQ A;  2P7T C;  3FKS G;  5BZB A;  2Y0I A;  2YID A;  3O9O A;  4PV1 B;  2Q7G A;  4BAY A;  2ZT9 B;  2FML A;  1K33 A;  5LL6 Y;  4OGQ B;  2CTP A;  2X6B A;  3CCM V;  1L1F A;  1K34 A;  1QNM A;  1H2N A;  1X4T A;  5LP6 B;  1QVG U;  1WNS A;  4JYY A;  3FAV A;  3TGU H;  1N33 O;  2DE0 X;  2RNB A;  4F4L A;  4DR7 O;  1YXB A;  1ZTE A;  5IJ9 B;  1N34 B;  5FL7 G;  3TCU A;  1GN2 A;  4B7K A;  1K9M W;  4EFB A;  4UXN A;  1Q5O A;  4LNU A;  1I94 O;  3G67 A;  1GKF A;  2Q9L A;  3T2M A;  3BY6 A;  3VOU A;  3GB7 C;  4HBN A;  2P4K A;  1Q6U A;  3U11 A;  4HYO A;  1QR9 A;  4JTD B;  1QHT A;  1Z2G A;  4L87 A;  2XAJ A;  2ZDI A;  1SA0 A;  4PA3 A;  1XMQ B;  4LP8 A;  2BTQ A;  2CTW A;  5C8Y B;  3OMI B;  1X59 A;  3ASO C;  1SET A;  1GH6 A;  4LFB B;  2CGO A;  3TJT A;  1RM1 C;  1IBM B;  1DGS A;  2YIB D;  4LH6 A;  3F7Y C;  4HZ3 A;  3JD4 A;  4KXR A;  3I5D A;  4MW3 A;  1D2D A;  1K3E A;  1RSO A;  4MVU A;  4DRX B;  5BMV A;  4X62 O;  1F4M A;  2H3O A;  3BCC H;  2UXN A;  1OCO B;  3JSN A;  2DYS C;  4RO2 A;  1JOY A;  2HVK C;  2EJ7 A;  3CWB H;  5TIS Z;  2ZDI C;  1V9P A;  2KKW A;  2N04 A;  4E2L A;  3G80 A;  1MSW D;  2A3Q A;  1SER A;  3E83 A;  2CH7 A;  5LGU A;  4DR5 O;  3WG7 B;  1US6 A;  4LF5 O;  3HKE A;  3W7W A;  1JX9 A;  1WN7 A;  1GAX A;  3EHB B;  4B3T B;  2F4V B;  1H8E G;  4TQD A;  1N0J A;  2ODM A;  1JQ0 A;  4F6R A;  4UV8 A;  1JFF A;  3JCU Z;  2IJJ A;  3CYO A;  3JAR B;  1A32 A;  2KG7 A;  3OD4 A;  3JD3 A;  5IYZ B;  4DV4 O;  1H2M A;  2IJI A;  1DF5 A;  2Y69 C;  1OHH G;  4BW5 A;  3FB5 C;  2QDO A;  4FLV A;  1NH2 B;  1P7B A;  2YUA A;  5GW7 A;  1UPG A;  1PL4 A;  2WLN A;  4DV2 O;  5L3C A;  1AJN A;  3ZMT A;  2M7W A;  4MSW C;  4FLW A;  1NBM G;  3L71 H;  5CA3 A;  3AG2 C;  5CA1 B;  2XND G;  4ZKI A;  3OUS A;  3CC4 V;  2NR5 A;  4U3J A;  4FFK A;  3IGA C;  4ZHQ A;  2AXT Z;  2HKO A;  3AEI A;  5B5E Z;  1MZE A;  4ZBM A;  1ZSP A;  4FM2 A;  1KBH A;  1F7Y A;  3NR7 A;  4QNH B;  2PYL A;  1L8D A;  4O4I B;  1F51 A;  4W4K A;  2YIC A;  1H38 A;  1ZAU A;  2E3C A;  3JAS B;  4NR1 A;  1BT8 A;  3CRM A;  1JA8 A;  2P6J A;  1HP8 A;  3R66 A;  3BAB A;  3ZED A;  2V7Q G;  1HNX B;  3CRR A;  3FB6 C;  5CBG A;  2ZE7 A;  4B3M O;  2GHY A;  1CPY A;  2ZXW C;  1Q6H A;  3A0B Z;  3C3T A;  4NXM O;  3DC5 A;  2PYJ A;  3CJH B;  3T1Y O;  3AG3 B;  1Y67 A;  2AW9 A;  4FFB B;  3TK1 A;  4J41 A;  4LF7 O;  5CA1 A;  2YIA A;  2R72 A;  1GM9 A;  3A2F A;  2ITC C;  1VQO V;  5FLX N;  1V54 B;  3SPH A;  5BR8 B;  1Q90 D;  1G8M A;  1U96 A;  5JCO C;  4O4I A;  1R3I C;  4BIO A;  4FVM A;  4D7S A;  4DUZ O;  1K7D A;  2ILM A;  2QWR B;  3K5N A;  1VF6 A;  2NLJ C;  1SQB H;  2P90 A;  5IYD O;  4PI2 A;  1AR1 B;  1I08 A;  3CRA A;  3CCU V;  2E5L B;  3KKY A;  4PI0 A;  4AI8 A;  5IWA O;  1BS3 A;  2RJZ A;  4JI4 B;  4DR4 B;  3E35 A;  4BIU A;  1WJZ A;  3GWK C;  2JVD A;  3CCR V;  2UXX A;  1XMO B;  3RYI B;  1I0H A;  3K08 A;  4ABM A;  3OW2 U;  2CUG A;  3CP1 A;  4FFB A;  5IY5 C;  3JD1 A;  2DQ0 A;  4QJF B;  5DEC A;  2QE7 G;  3RWR D;  2YI9 A;  1CEZ A;  1NI8 A;  2P5O A;  1VF6 C;  1QBZ A;  1ZLZ A;  2ZE6 A;  4LH7 A;  1XDC A;  2B1I A;  4DW0 A;  2QKC A;  5JH7 A;  4UCU A;  1KU9 A;  3E8F A;  3N2K A;  5LMU O;  2G38 A;  1S3J A;  1NVP D;  1Y76 B;  4DV0 B;  4I0X B;  4JI7 O;  4MTX A;  4LF4 O;  2V4D A;  4IGG A;  3QTC A;  1NKD A;  1UFI A;  2OTL V;  3K5O A;  5CB4 A;  3APO A;  3CCS V;  1BQ0 A;  1OCC B;  1XL6 A;  2XHB A;  1XBL A;  2ADQ B;  2YEV B;  1OJH A;  3RVZ A;  1VQ6 V;  3K06 A;  2EBO A;  3RYI A;  2Q7E A;  4LFA O;  4JI8 O;  1R73 A;  1K4C C;  4Z2W A;  4JAV A;  1FS0 G;  3IJ4 A;  4O4L A;  1ZWI C;  1R6T A;  3K5L A;  2DJV A;  1B06 A;  3OMA B;  1SES A;  5B1B B;  1LR1 A;  1D5A A;  2HHH O;  2ZIN A;  4F6E A;  3E22 B;  1LNQ A;  3SPC A;  4UVC A;  2GTS A;  4EEQ A;  2X6A A;  4FLY A;  4I0X A;  1XI1 A;  4YIO A;  1AI6 A;  4ZI7 A;  3KZI Z;  2BSK A;  3B8M A;  3X2Q C;  5BY1 A;  3C3S A;  3ZMZ A;  5J9P C;  1KYO F;  4O2A B;  4U3F H;  1VEW A;  1YDX A;  2HLD G;  3LSS A;  1WLE A;  4WFA V;  1Q6I A;  4IYI A;  5BXZ A;  4IL6 Z;  3ZN1 A;  3VQY A;  5KX5 B;  1H2L A;  1VAR A;  1ZUQ A;  1WB7 A;  2EIN C;  2EIK B;  1N33 B;  3M99 B;  4J7Z A;  3MD0 A;  1PL0 A;  2WLH A;  2ATK C;  3AG4 C;  1OZ0 A;  3RGB A;  1NU1 H;  1M5I A;  3SYP A;  5C93 A;  2IU3 A;  1BZK A;  5LXT B;  1I94 B;  2IM9 A;  4D6T H;  5FNV B;  2LGQ A;  5JJJ B;  2MW2 B;  2EIJ C;  2A7W A;  2EIM B;  2R9I A;  1W2B U;  2EIL B;  1KKC A;  1ORQ C;  2QWN B;  3Q4H A;  2EZP A;  4XDJ A;  4DUY O;  3B4S A;  4E4E A;  1P4R A;  3SDL A;  3U10 A;  1HW7 A;  1PM9 A;  2P67 A;  5EC2 C;  1QR8 A;  3UT5 B;  4JI2 O;  3ZHV A;  4FLU A;  4DR1 B;  1YJN V;  3JAK A;  1YI2 V;  3OFN G;  4OX9 O;  1TVK B;  3BPZ A;  3CCQ V;  1E1Q G;  1I5Y A;  4WFG A;  2R9R B;  4I55 A;  5KX5 A;  2CDY A;  3LSU A;  3J7A U;  4X62 B;  3IFX A;  2GUZ B;  3ZRS A;  4X64 O;  4G2K A;  5LXT A;  3ZMV A;  1M56 C;  5L3E A;  3E2E A;  2QTS A;  5EK0 A;  1SC5 B;  3K0G A;  4PEL A;  5LHG A;  5LMN B;  1M93 A;  1SQX H;  3H9V A;  4QGP A;  1EM1 A;  2HEP A;  1MZF A;  4DR6 O;  3CCJ V;  5K1P A;  1FXK A;  3UCS C;  2GTA A;  4TOI A;  2HVJ C;  3JD0 A;  1EN6 A;  3HR0 A;  4MVR A;  2JEX A;  2Q0A A;  2LJ2 A;  4X65 B;  4X9Q A;  1TVK A;  1PPJ H;  4FJC C;  3HKB A;  5A9G A;  1V55 C;  2WA4 A;  3QO7 A;  1H8H G;  3QO8 A;  4WF9 V;  2GUZ A;  2X0L A;  2R70 A;  2JGU A;  4PD4 F;  3ABK B;  1VF5 B;  3FX7 A;  3IC9 A;  2IJK A;  1COW G;  5IE9 A;  1FXV A;  1EZJ A;  4KHP B;  2B1G A;  3JD2 A;  4H0L B;  1BMF G;  1Y4M A;  2QKS A;  1R6K A;  5H9C A;  4TSF G;  3STL C;  2DOS A;  2ETN A;  2JIZ G;  5JQG B;  4JZG A;  3DGE A;  2QJ1 A;  3JAW A;  3ZCC A;  1JCH A;  1YF2 A;  4W4L A;  4X66 B;  1ENV A;  1K4D C;  1EN5 A;  2EUL A;  4YIP A;  1SQF A;  5EIB C;  2OYQ A;  3DXR A;  1R6N A;  1OV9 A;  1DTO A;  1Q81 W;  4PDR A;  4LFC O;  1GO3 F;  4J9Z B;  4JI6 O;  4I9W A;  3F5W C;  1R3K C;  1M90 W;  3B8N A;  1AB3 A;  4J7K A;  3WB0 A;  2XAH A;  2DYS B;  3ASN C;  1R3L C;  1K97 A;  4GX0 A;  5KMG B;  3HKD B;  4A5U B;  1ROP A;  1VF7 A;  1DK1 A;  5GON B;  4DV7 O;  3ZMU A;  1AR4 A;  3CB2 A;  3T1Y B;  5LYJ B;  5ITZ B;  2W6J G;  3EVK A;  3G71 V;  4YHH O;  2WLI B;  1YEW A;  3OR7 C;  3SPI A;  1XIL A;  2HR3 A;  2CE4 A;  4AQY B;  2UXC O;  1N32 O;  2ZR2 A;  2HJD A;  3BVO A;  5EYP B;  1MAB G;  3MHS C;  5KA6 A;  2Q69 A;  2AGA A;  3ETQ A;  3L73 H;  4IIJ B;  4PA9 A;  5HFM A;  1NJI W;  5KHH A;  2D2C B;  3AG1 B;  4DUZ B;  2AHY A;  4LF6 O;  3ABM C;  2YSU B;  3T1H B;  1VQN V;  1J5E B;  1PNK A;  1PKX A;  4XDK A;  2JS5 A;  3SYA A;  1IZ3 A;  4MW8 A;  1LUW A;  2OIG A;  1K92 A;  2XAQ A;  5E79 Z;  5LP6 A;  4RAI A;  4JI1 O;  5KMG A;  3HKD A;  3ICX A;  3BA9 A;  2LFR A;  4DV5 O;  5KUM A;  2ZM6 B;  5IJ9 A;  4LF9 B;  1THZ A;  5L3F A;  4EKW A;  2VQF O;  2XUM A;  4XDL A;  5H5N A;  4X1Y B;  1SKV A;  4TV9 B;  5LYJ A;  5ITZ A;  3VQX A;  5B1N A;  3UKM A;  3K3W A;  4JI3 B;  1F23 A;  4CBC A;  3ABL B;  2AHZ A;  3CC7 V;  2ZIO A;  4QPK A;  1XNQ O;  1AJQ A;  3J80 N;  1YTF D;  1XL4 A;  4MTO A;  3D3I A;  2CGN A;  2CAZ C;  1XHX A;  2DYR B;  1PV0 A;  4JI7 B;  5C8Y A;  3QVN A;  3BFR A;  4UVB A;  5KHI A;  2QTO A;  3IAY A;  2Q6A A;  1SQG A;  4HNA B;  1VQK V;  4DRX A;  1PP9 H;  3FYI B;  3CC2 V;  1BGY H;  4CH6 A;  1S0V A;  1UJW B;  1XEQ A;  1KEC A;  3W7X A;  1IXM A;  1Q3E A;  4JAA A;  2H8P C;  3JAT B;  2O57 A;  1W0K G;  3H1J H;  1LUV A;  4TV9 A;  3ZRW B;  2JK5 C;  2Q73 A;  4FMT A;  1QVF U;  3G4S V;  3A0H Z;  3B2E E;  2OTJ V;  1KC8 W;  5B3S B;  4O2B B;  1TA8 A;  2HHH B;  3H1K H;  3JAM N;  1KMI Z;  2PI4 A;  4PDL A;  3OTO B;  4JV5 B;  4UCV A;  2UXD O;  5KAI Z;  1OCO C;  5J2T B;  4LF8 B;  2VWK A;  4DK0 A;  3LUT B;  3JAR A;  1HR0 B;  5IYZ A;  1BHB A;  4LR3 A;  3VQW A;  4P9P A;  2Q5Z A;  3E86 A;  3OAA G;  2UUA O;  2KSD A;  3WG7 C;  4DV6 B;  1BL8 A;  1XNR O;  4MVZ A;  4KP4 A;  5B1O A;  3A8T A;  1JVM A;  1JPX A;  1Z5W A;  3ZHR A;  2WSS G;  1Q8I A;  5IJ0 B;  1KP3 A;  1FJG O;  3P30 A;  1DLB A;  1AI4 A;  1VP7 A;  4Z1V A;  5EZY B;  5LHI A;  1VQP V;  3QF7 A;  2OCC B;  2QR4 A;  4TUY B;  4GLX A;  4NTY A;  4B3S B;  4DUY B;  4UCR A;  1J95 A;  5J2T A;  5IYB O;  5A2Q N;  1JJ2 U;  4DV3 O;  2Q67 A;  4J9Y B;  5DN6 G;  4PA7 A;  2F23 A;  3JAS A;  4UUJ C;  4OX9 B;  1E79 G;  2K1E A;  4GX2 A;  3HKC B;  1EFR G;  1SQP H;  1PNL A;  3OGC C;  2WLL B;  3WB2 A;  3QNE A;  1VQ4 V;  4IHJ B;  3M7M X;  1VQ9 V;  5EIB D;  4P9O A;  4LFB O;  4JI5 B;  1IBM O;  3CJH A;  2UU9 B;  1Q43 A;  1KD1 W;  5IJ0 A;  1S5H C;  1GN6 A;  3SJA C;  5L3D A;  4GCZ A;  4O4H B;  1M57 B;  1QCE A;  2PTM A;  2L35 A;  1IXB A;  2YS8 A;  5EZY A;  5DM6 V;  3ZHS A;  2UUB B;  4LWS B;  5GTH Z;  4TUY A;  1Y74 B;  1WP7 A;  2C2A A;  4DR6 B;  4EFE A;  2DQ3 A;  2IW5 A;  2IJH A;  5L3B A;  3ZIA G;  5KHG A;  2QWP B;  3AG3 C;  1N4C A;  3HB3 B;  1D5N A;  4X1I B;  4MVS A;  4MTF A;  1FFX B;  4NB5 A;  4B3T O;  1GTO A;  2XAS A;  4UVA A;  4XBF A;  2IU0 A;  1V54 C;  2M6Y A;  4NTX A;  2DWE C;  1K5S A;  2JS3 A;  2YIB A;  4X88 A;  2LP7 A;  2PY5 A;  1QQC A;  4GYC B;  3L74 H;  1ARO P;  1TAE A;  4O4H A;  1IBK B;  3GWO A;  1FYJ A;  3PN1 A;  1WPX A;  1K8A W;  1YHQ V;  4RUF A;  5EBL C;  3PJS K;  2QEX V;  1WAZ A;  2Z3Y A;  2QA4 V;  4ZOL B;  2HP8 A;  4MT8 A;  4YY3 B;  3KG2 A;  1Y76 A;  3RYF B;  3STZ C;  2V1D A;  5E1A C;  2K9P A;  5CBH A;  3J81 N;  4CH3 A;  4NYK A;  4DV1 B;  2LQT A;  3APQ A;  4LFC B;  4JYC A;  3JYC A;  4GX1 A;  2QM7 A;  2FL4 A;  2YEV A;  4MVQ A;  1VQ5 V;  4KFM A;  3D3Q A;  4OXS A;  3D8C A;  1XUQ A;  4G28 B;  3JCZ A;  3CXC U;  2Q7H A;  2RDC A;  2IH1 C;  3ETG A;  4MTG A;  4JTC B;  5LGN A;  3LDD A;  2VQE O;  2N74 A;  3U0Z A;  4DR7 B;  4DV7 B;  2HFE C;  1XOU A;  1WPB A;  4NVP A;  3RYC B;  2Y48 A;  2F66 C;  5IT9 N;  1SZX A;  2VS0 A;  3E22 A;  3LDC A;  2EJR A;  4RUE A;  4WFE A;  3H1I H;  3CD6 V;  1PNM A;  4FPP A;  1RP3 B;  4B7E A;  1OCC C;  5EBM C;  2PGG A;  1AR5 A;  2QGN A;  3B40 A;  3C90 A;  1I7F A;  4JAU A;  1XHZ A;  2ZE5 A;  4JTA B;  2ADP A;  4O2A A;  1G4Y B;  1MNG A;  2B9Z A;  3ZS8 C;  2X6C A;  4K0K O;  4LF6 B;  3GVM A;  4DR3 O;  1IBL O;  2PZS A;  2IBZ H;  5H6Q A;  3FD9 A;  2YXH A;  3RYH B;  3P3P A;  5BR8 O;  2VWJ A;  1CXZ B;  2XOK G;  5B1B C;  2UUC O;  3SPJ A;  2QKA A;  4GKK O;  4JI1 B;  4DV5 B;  4CS3 A;  1U97 A;  2UXB O;  1VIB A;  2VQF B;  1EZV H;  2W0X A;  3CSX A;  5KAF Z;  1OCR C;  3BEH A;  2E5L O;  3K9A A;  5FNV A;  2E75 B;  4BIZ A;  1SF9 A;  4JI4 O;  2JEU A;  3NXS A;  5JWP A;  3K03 A;  5HFL A;  3CCV V;  4B3R O;  3E89 A;  3CMA V;  4DR5 B;  3T4Z A;  1SQQ H;  3UO2 A;  1XNQ B;  3LDE A;  3OUF A;  1QLE C;  4LF5 B;  3UO3 A;  4CC6 A;  3UT5 A;  3K79 A;  1JJO A;  2EIK C;  4ASU G;  5EC1 C;  3ML0 A;  2Z0A A;  2WLM A;  1S76 D;  1FFT B;  2W6I G;  5KLV H;  2ZCE A;  2ZKO A;  2ZQM A;  3ETE A;  4DYL A;  3RN4 A;  3IC7 A;  3OE7 G;  4DV4 B;  1VQ8 V;  2EX3 A;  3ZRV A;  2EIM C;  4DV0 O;  1N8R W;  1XQ8 A;  1NVP B;  1NH2 D;  3ZN0 A;  3P32 A;  4I4T B;  3JAL B;  3E8H A;  5FPO A;  1L0N H;  4JYB A;  2ZE8 A;  1H2G A;  3ZHQ A;  5LOV B;  1OCZ C;  1FXK C;  5F2V O;  5CMU A;  2LGW A;  4RQF A;  3P3N A;  4DV2 B;  4R50 A;  1FKA O;  2QWQ B;  3SYC A;  4FM0 A;  3CEI A;  3N27 A;  3CRQ A;  3FAV B;  1R3J C;  4JYA O;  4OPA A;  3ABM B;  1S77 D;  3ASO B;  1GN4 A;  1RM1 B;  4JAS A;  4GZR B;  2BCC H;  3CCL V;  1QU7 A;  2JGD B;  2WLK A;  4PJ0 Z;  3AK2 A;  4LNU B;  4N23 A;  4GKJ O;  2KQX A;  4WBN B;  3DC6 A;  3E8G A;  4FK5 C;  1TUE B;  4K8Z A;  3AG7 A;  4X20 B;  3QG5 A;  5B1A C;  2OCH A;  4I4T A;  3CE2 A;  3EFF K;  3WU2 Z;  5H2F Z;  2UUA B;  5GTI Z;  5J2U B;  3ZMS A;  4B3M B;  2A0L A;  1SA0 B;  2CTQ A;  5LOV A;  2WLJ A;  1XNR B;  2BTQ B;  3TXQ A;  5IYC O;  4NXM B;  1Y66 A;  4DR2 O;  3ABT A;  3RW0 A;  2F43 G;  4PDV A;  4D7T A;  1NS1 A;  5L3G A;  5JQG A;  4LF7 B;  1FJG B;  4X8A A;  4RWU A;  1RSO B;  4NKG B;  4GX5 A;  5BMV B;  4I9Q A;  1WA8 B;  1K73 W;  3B77 A;  2N05 A;  1L0L H;  3LNM B;  3S3X A;  2JGD A;  4MVO A;  4R6Z A;  5CA0 B;  1YIJ V;  3ABK C;  4X1K B;  2AZ0 A;  1NR7 A;  4WBN A;  4WFB V;  3SPG A;  4DV3 B;  2Y69 B;  4X20 A;  1M9N A;  3RBZ A;  1M1K W;  3LSQ A;  2CH7 B;  4X89 A;  1Q7Y W;  1M4U A;  2YDE A;  2DW4 A;  3TXS A;  3OMN B;  5J2U A;  5IWA B;  2BE3 A;  1IVS A;  3HKE B;  4FLX A;  1TUB B;  3FB8 C;  1FD9 A;  4DR1 O;  1SZT A;  5GON A;  2A9H A;  1P49 A;  3SJB C;  4F6R B;  1NTK H;  1KB9 F;  3AG2 B;  1AP6 A;  1JFF B;  5EBW C;  4FLT A;  2KG7 B;  3DTU B;  2WLI A;  3OEE G;  1WA8 A;  3N2G B;  4K8X A;  5EYP A;  5CN0 A;  5KUK A;  2DWD C;  4J42 A;  4TWK A;  5CA0 A;  3E8B A;  4IIJ A;  4B08 A;  3LNN A;  5LP6 C;  5LMU B;  4X1K A;  4CZZ A;  5LMN O;  4LF4 B;  3CHX A;  2DMX A;  3UQ8 A;  4Q20 A;  3W7U A;  4H33 A;  2ZXW B;  3FYE B;  4U3J B;  2HJF C;  1TUB A;  4ZHQ B;  2OIE A;  2PI5 A;  3OTF A;  2A79 B;  2PUS A;  4X65 O;  4PHZ A;  4LFA B;  1AVM A;  4JI8 B;  1HDJ A;  3OT7 A;  2LW1 A;  2RCV A;  2GV9 A;  1GMG A;  4X1Y A;  1IX9 A;  1FAF A;  4JI0 O;  2F93 B;  4LCU C;  5JJE B;  3AG1 C;  1BCC H;  1O9G A;  3I56 V;  1TGO A;  1BSM A;  1G6U A;  2HG5 C;  3N2G A;  4P2Z A;  4YXW G;  4LC1 A;  4ZIB A;  4JGS A;  1IDS A;  4CH5 A;  1JMK C;  2BOC C;  4OPH A;  3W7S A;  4NXN O;  2GSM B;  3T1C A;  5JJN B;  3THO A;  4KHP O;  4QE7 A;  3KCY A;  2ARH A;  2E74 B;  1HWY A;  3ZHT A;  3H01 A;  1DF4 A;  2F1M A; 
#chains in the Genus database with same CATH homology
 1R6T A;  4LF8 O;  2LW7 A;  1A32 A;  1HNW O;  1XNR O;  4DR7 O;  1KUQ A;  2ZM6 O;  4DV4 O;  2DJV A;  1FKA O;  3J7A U;  4LF9 O;  3M8A A;  1HR0 O;  1XNQ O;  3O65 A;  4DR1 O;  2HHH O;  1G1X B;  3J80 N;  1I94 O;  1AIL A;  4DUZ O;  4LFC O;  1HNZ O;  4B3T O;  4JI6 O;  4K0K O;  4X64 O;  1FJG O;  4DR3 O;  4X66 O;  1IBL O;  4JYA O;  1AB3 A;  4OPA A;  1YZB A;  4JI3 O;  1HNX O;  4DV6 O;  1N36 O;  5BR8 O;  4A5U B;  5BY1 A;  4DV2 O;  5IWA O;  2UUC O;  1DK1 A;  4DV7 O;  4GKK O;  1FYJ A;  4GKJ O;  4DR6 O;  5A2Q N;  2UXB O;  1X59 A;  4DV3 O;  2JRI A;  2F4V O;  1XEQ A;  5BXZ A;  4YHH O;  2E5L O;  5LMN O;  2UXC O;  1F7Y A;  4JI4 O;  1N32 O;  2FKX A;  1D2D A;  3J81 N;  1IBK O;  4B3S O;  1N34 O;  4B3R O;  4X62 O;  2AGA A;  4DR2 O;  4LFB O;  5LMU O;  1IBM O;  1NS1 A;  4LF6 O;  3RT3 C;  3JAM N;  4YY3 O;  4JI7 O;  3F5T A;  3R66 A;  4X65 O;  4AQY O;  4LF4 O;  4B3M O;  2Z0A A;  4JI0 O;  2VQE O;  2UXD O;  4DR4 O;  4DV1 O;  2N74 A;  4DR5 O;  4DUY O;  4JI1 O;  4NXM O;  2ZKO A;  3SDL A;  3T1Y O;  4DV5 O;  1XMQ O;  4LF5 O;  1XMO O;  4JI5 O;  2DOS A;  4JI2 O;  3T1H O;  4DV0 O;  1R1B A;  2VQF O;  2UU9 O;  4LF7 O;  5LL6 Y;  5H5N A;  5IT9 N;  1J5E O;  4LFA O;  4OPH A;  4JI8 O;  4OX9 O;  3OTO O;  4JV5 O;  4NXN O;  4KHP O;  2UUA O;  5FLX N;  1N33 O;  2UUB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...