4GKJQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkjQ00
3GTLH 3S17H 3S2HH 5IYBH 1Q7YC 3CAMA 4NPSA 3D0FA 4DR2Q 3HKSA 3T1YL 1PH6A 3PO3H 1GVPA 1J6QA 4GNXA 1Q12A 2B29A 1SE8A 1XNRL 4DR4Q 1N32L 1H95A 4HJ5A 4KHZA 3HOZH 2R93H 5M3FG 4YWMA 3L0OA 3CF5A 3I4MH 4PG3A 3CCSA 4X6AH 3KJPA 1N36Q 1WYDA 4JBJA 1E1TA 1VQBA 1YIJA 4RMFA 5IWAL 1HNXL 2I5HA 2JA6H 4JI2L 4IFDG 4LF9L 3G48A 2OTJA 1PH8A 1XNQQ 2L15A 2YTVA 3T1HQ 1PH5A 3TQYA 1D7QA 1JT8A 1PFSA 4DV4Q 1K3RA 4A3JG 1HNZQ 1GD7A 4IOCA 1AE3A 1N33Q 1JE5A 1RL2A 4X65L 2LSSA 5FJ8H 3TRZA 2ZTEA 4X64Q 1PH9A 2R7ZH 1GM5A 3S15H 3M3YH 1XTDA 4HIOA 2D62A 2PMZE 2ZTCA 4GNXC 4PZ6A 1XJVA 3K81C 3IRBA 3G6EA 2NVYH 2CKZB 4GLAC 1XMOL 1C7YA 3UDFA 4QGUA 1IBLL 4BA2I 1U0LA 1HNWL 4JI0L 1IZ6A 2K5HA 3FKIH 1UE5A 4UPAA 2RHQB 4JI3L 3FHWA 4L5RC 2HT1A 1B8AA 4AQYL 1K0RA 2D0PA 4QJFA 1EYGA 3KFUA 4GOPB 2UUAQ 2E5LL 3S2DH 2F4VL 1B70B 4XTCS 4BBRG 3TS2A 5C3EH 4JI8Q 3CC2A 3CC7A 3OTOL 1E7ZA 2R7FA 2ZJQA 2N8NA 4JV5Q 3BZKA 2R93G 4A75A 1I6HH 3UDIA 5M5WH 1WOCA 4JG2A 1CSQA 3KOJA 3PGZA 1XPOA 1W2BA 3HFZB 2CCZA 3CQZH 4DUYQ 4OWTB 3TREA 4A3EH 3PO2G 3ER0A 1HH2P 3E9IA 4JI4Q 4HIMA 4JI6L 2JA6G 2K50A 3GD7A 1X65A 4YHHQ 1I94Q 5HGQA 4WJ3M 3NELA 2I5LX 3G4SA 1N34Q 1HZCA 1Z47A 2ID0A 1W3SA 4OX9Q 3S1MH 4IFDJ 3HOWH 1XMQQ 4K0KQ 2WFWA 3HKZE 4DR2L 3VDYA 4DKAC 2KCMA 3STBD 3GO5A 1UE1A 3HOVG 3PUVA 4DV1Q 1A8VA 2UXDQ 2CFMA 3K8AA 4EX5A 4A93H 3RLFA 5C0XG 2HIVA 1HJPA 2JK8A 2F3IA 3MEFA 1C0AA 3GTJH 2ZM6Q 1TWFH 3JAMc 1VQ7A 4DR6Q 3FKIG 3PCOB 1N36L 2JA9A 1GKHA 4P72A 1LYLA 3RZOH 3ZJYC 4KHPQ 4DV5Q 4A3IH 1OXVA 3AFQA 4LF4Q 4GKKQ 1MIUA 3GTPH 3RLOA 2UU9Q 3T1HL 4LUVA 3PUZA 4L5SA 2PI2E 4DV4L 1VQNA 3DM3A 4GN5A 1X55A 4R4TA 1PV4A 3KDFA 4B3MQ 1N33L 4FDBA 4DV3Q 3F2CA 3H3VI 4NXMQ 4LFBQ 2I5MX 4X64L 4DV2Q 1YEZA 1X3GA 3UE0A 1N8RC 5M3FH 4GLXA 1PH7A 4AIMA 1KXLA 4DUZQ 2E2HH 4X66Q 1Q82C 1V9PA 4JI7Q 2MFIA 2UUCQ 2AKWB 2UUBQ 1J5EL 2IY5B 3CPWA 3ULLA 4O0AA 3RNUA 3HOWG 2OQKA 3K0XA 3W1GA 1LTLA 2UUAL 2K52A 1K73C 1CUKA 1CSPA 1OXUA 5C4JH 3PF4A 4JI8L 3I56A 1C9OA 5C44H 2HHHQ 4PZ8A 4A3JH 2QGQA 3KF6B 1QZGA 4B3SQ 4DV7Q 4JV5L 4LF6Q 3U4VA 2OTLA 4A93G 2WP8J 1VQCA 1EQQA 1IBMQ 2R6GA 3NENA 1PH3A 1PVOA 2KHJA 4A3GH 4IJHA 5C0XJ 4DR7Q 4DUYL 3U58A 4AH6A 1RIPA 2DUDA 2K5VA 3JAMi 4JBKA 2ES2A 4A3IG 3K7AH 1L1OB 4JI4L 1KIXA 1I94L 1QVGA 1N34L 4A3KG 2Q2TA 1BBUA 3S1NH 4B3RQ 1XMQL 2K75A 1EIYB 3AEVA 4GN3B 4IPCA 1PH1A 4C3JH 4BBRH 4LFAL 4B3TQ 3M4OH 2E2JH 4P73A 4JI1Q 4NXNQ 3PV0A 2BA1A 4OO1I 2ATWA 4DV1L 2ZJRA 2Z6KA 1Q46A 4DK6C 4YCVA 1Q86C 1JMCA 5IYCH 4A3BG 1UE7A 2VW9A 3KF8B 1KAWA 4DV0Q 3PO2H 1VQIA 3PSIA 3CCQA 4KHPL 4DV5L 2OQ0A 2Y0SG 4BY1H 4LF4L 1SN8A 4GKKL 5GQOA 1YHQA 2WAQG 5C44G 4MZ9A 3UDGA 1KD1C 2B3GA 4JCVE 1GO3E 3J80c 4LWCA 1YJ9A 1QUQB 3BJUA 3J81c 4B3ML 1SR3A 2YV5A 2DGYA 3RR5A 4DV3L 4NXML 3HOVH 3L2PA 2VQFQ 3S1QH 4A3GG 3CCJA 2RCNA 3SGIA 1V43A 1Y14B 2JJQA 3OYYA 2Z6KC 4LW1A 5M3MH 4DUZL 2IT1A 4JYAQ 1U5KA 3S14H 4IJLA 4A3DG 4JI7L 2UUCL 2CQOA 2Q2HA 3AQQA 4OONA 4BY7H 2VQEL 4YY3L 1KHIA 2FXQA 2AWNA 3OW2A 1I3QH 1VS0A 4HJ9A 4UY8C 1XPUA 1WI5A 2PQAB 1CKNB 3PIOA 2YYZA 3Q8DA 4JI5L 1Q81C 1JJCB 1BBWA 4B3SL 2A8VA 3AYHB 3J7ZC 2JA7H 3M7NA 4DV7L 2A1AA 1HR0W 4KI0A 2LXKA 1QVFA 3PUYA 5FLMH 1QUQA 5IYCG 4DR1Q 1IBML 2NVXH 1TWAH 2Q2IA 3J81j 1IBKL 4OWWB 4GKJL 1SFOH 1X3EA 3M4QA 2R7DA 4IPDA 5LMUL 2HIXA 3KYHC 3HOXG 4RG1A 3RLNA 3GTOH 3BU2A 1QZHA 4LF7Q 4BY1G 1R9TH 2ASBA 1X56A 2QEXA 2OCEA 5J3BA 1VCIA 4C3HH 2KENA 4GOPA 1XPRA 1PH2A 4B3RL 2C35B 5IP9H 4B3TL 2PQAA 4JI1L 1CKNA 2YU9H 1SLJA 4DR4L 4X62Q 4JOIA 4IO9A 2ALYB 4HJAA 2YTYA 4DR3Q 5M3MG 1YZ6A 3CCEA 1NTGA 1IL2A 2NN6I 5DLQE 4OXPA 2V1CC 4BY7G 1X6OA 2VNUD 1I50H 3F8TA 2JA5G 4DK3C 2ZTDA 2EXDA 2PI2A 1VQKA 2Q2UA 3GTKH 1XNQL 4J15A 3HOYG 3CD6A 1Y1VH 1S3OA 5GROA 4A3KH 1E24A 1N32Q 1VQ4A 1XNRQ 1HNZL 3GTMH 4PMWA 5M5XH 1HZ9A 2JA7G 5GAGC 3CW2C 1VQ5A 4GOPC 5FLMG 3PF5A 4QL5A 3I55A 2BA0A 3AFPA 1ASZA 1NMGA 5JEAG 2VQFL 4JOIC 1FGUA 2VL6A 4IPHA 3I7FA 1D8LA 4EQ5A 5IWAQ 4HJ8A 3RN2A 4P74A 4GLVB 3CXCA 2B63G 1O7IA 3K7UC 3F2BA 2IHFA 1X9NA 3M9BA 5IT9c 2K4KA 1FL0A 3I2ZA 5GADC 1OTCA 3A0JA 3PUXA 1P16A 1VQOA 3CMAA 2BH2A 4OWXB 1VQ8A 1PA6A 5IP9G 1Y1WH 5C4XH 1YITA 1VQEA 3F2DA 5JJIA 2CWAA 1YJNA 4P75A 2IHEA 4L5QA 3E9HA 1WFQA 1FJGQ 5HY6A 4AYBG 3A5UA 4DR1L 1KC8C 4LF5Q 1HNWQ 1E3PA 3LGJA 5JJLA 1LUZA 5IE8A 1WCMG 5JJKA 1MJCA 1X3FA 2LXJA 2NZOA 4R1JA 3PUWA 5H1SE 3W5OA 4A3DH 2YTXA 2Y0SE 4YHHL 3I4OA 3TEHB 4JBMA 1Q1EA 1Y1VG 2WAQE 1E22A 3A5ZB 5GAHC 4DV6Q 4LF7L 4OX9L 2F4VQ 1M1KC 4A4IA 1TWCH 1E1OA 3OTOQ 3CPFA 4BBSH 2MO0A 3CCVA 2IX1A 2RHSB 4A3CG 1BVSA 4YCWA 5IP7H 4TVAB 1SRUA 3KF6A 4X62L 2UXDL 1NBWA 4DR5Q 4R4IA 4YWLA 2ZJPA 2NVTH 4DR3L 2VUMH 3CC4A 2KCTA 3S1RH 1FVIA 5JEAJ 2ZM6L 4JI6Q 3JC66 3I4NH 4DR6L 1NMFA 2KBNA 3HOXH 4OO1G 3M4PA 2E2IH 1K9MC 3NBHB 4LFCQ 2N78A 5LMNW 4DAYB 1L1OA 3U50C 1NJIC 3GDEA 4KLKA 2AHOB 5ELOA 3W1BA 4A3FH 1Y1WG 1SMXA 1VQMA 1EWIA 5AJ3Q 2UU9L 5C4XG 1UEBA 1YJWA 3S24A 5ELNA 1VQ6A 4L5TA 1JJGA 2OWOA 2XTIA 4LUZA 5LMNQ 4A3MH 2QA4A 4IFDI 1YHAA 3U4ZA 4LFBL 1DGSA 4DV2L 1EFWA 3BZCA 1JJ2A 2VY3A 1S40A 1PH4A 2Z0SA 4X66L 4Y7NH 5E7NA 2VZAA 1MKHA 1VQFA 3H0GG 2UUBL 1KRSA 1YBYA 2JQOA 2K14A 2N3SA 2JA5H 4LF8Q 1VQ9A 1I5FA 2WB1G 4GS3A 4BBSG 3WWVA 3HOYH 1NY4A 4QY7A 1L1OC 2JE6I 1AH9A 5IP7G 5FLXc 2HHHL 1YVCA 4HIDA 1YI2A 1IXRA 1TWHH 4LF6L 3GTGH 1TWGH 1VQAA 2AMCB 1QVCA 1LM0A 2MO1A 2JEAI 2VUMG 1Q1BA 4BXXG 5IYDG 1TXYA 1FJGL 3HOUG 3TS0A 4LF5L 4YWKA 2H5XA 4C3IH 5GAEC 2JA8G 3I4NG 4DPGA 3EIVA 4DR7L 4UP7A 1J5EQ 4QIWE 3K80C 1EUJA 1HR0Q 4MTNA 1IYJB 2B63H 3H3VH 5IYBG 2UXCQ 4A3FG 1VQJA 4R4OA 1L2FA 5BR8Q 1V1QA 4DV6L 1UWVA 2HQLA 1MJEA 3PO3G 3B6YA 1K83H 3EBEA 2KHIA 4JC0A 1EQRA 3HOZG 2RF4A 4A3MG 3J80i 4NXNL 4DAMA 4APVA 1G6PA 1HZAA 3I4MG 3CCRA 3J81i 4PZ7A 4LNQA 4A3LH 1G51A 2EIFA 3ULPA 1WJJA 3CCUA 4DR5L 3ICEA 2UXBQ 1Z9FA 2GVBA 4BA1I 3ERSX 3MXNB 1PYSB 3ULJA 3KJOA 4P71A 1WCMH 2XGTA 3L7ZC 3GTQH 2GVAA 5K36G 4DV0L 2R92H 3CCMA 4LFCL 4UP9A 3S16H 5C0XI 1SROA 3T1YQ 1BKBA 4LFAQ 2PNHA 3KDFB 2NN6G 4C2MH 5IY0A 5FJ8G 5AJ3L 4POGA 4XIGS 2R7ZG 1K8AC 3DLLA 4A76A 1VQLA 3PIPA 3H15A 4A3CH 1G291 4AYBE 5LMNL 1N9WA 3F1ZA 1OXSC 1KRTA 5M5YH 1PYBA 4NB3A 4R4CA 1HNXQ 2JEBI 3RN5A 4JI2Q 3STBC 3RZDH 4LF9Q 4JYAL 3CP0A 2NVQH 2I0QA 1A0IA 4K0KL 1VQHA 1A63A 1M90C 3E0EA 3UE1A 1VQDA 2K5NA 5C3EG 1A62A 4LF8L 3UDXA 1S72A 3KLWA 3FP9A 3J7A5 2VS1A 2D0OA 3A74A 2GN5A 4X65Q 1EOVA 3M85A 3HKZG 1L0WA 4Y52H 3EN2A 2MQHA 4JBWA 4ME3A 3G71A 2N49A 4A3LG 1YNXA 4IOAA 1VQGA 4YCUA 1XMOQ 1PHJA 1CKMA 4IPGA 4A3EG 1IBLQ 1VQPA 4LUOA 4UP8A 1ASYA 4JI0Q 4JI3Q 2R92G 1NE3A 1X54A 2EQSA 4AQYQ 2VQEQ 4R4QA 4YY3Q 1HR0L 1YHBA 1OXTA 3H0GH 4TQUS 4POFA 4O2DA 2E5LQ 2UXCL 4A3BH 2AWOA 1P8LA 4GNXB 4HJ7A 5BR8L 4JI5Q 4HIKA 1T9HA 2A19A 2F52A 4H02A 1OXXK 4WJ4A 1B7YB 2IX0A 1KQSA 4MNOA 4ALPA 3D31A 4GN4B 1EIFA 1K8GA 3CCLA 1HZBA 1KL9A 1IBKQ 4GKJQ 1JB7A 2BH8A 5EAYA 3NEMA 5LMUQ 4BXXH 1AE2A 1CKOA 2NZHA 4QQBX 5IYDH 3HOUH 2CWPA 2UXBL 2MNAA 2JA8H 3CMEA 1Q8KA 4DNIA 2E8GA 1UE6A 2WB1E
chains in the Genus database with same CATH superfamily
3GTLH 2K28A 2G9DA 5KYIA 3CAMA 2F0MA 1FR3A 3T56B 2XRQD 5LL6S 1J6QA 3NWSA 1XNRL 5CGKA 2LS01 2R93H 3BVZA 3I4MH 1IKLA 1EYAA 2RVLA 3KJPA 4JBJA 1E1TA 4LF9L 3ONAB 2OTJA 1K8OA 2JN4A 4ODGA 5EKIA 3LX0A 4C3IB 4IUTA 4A3JG 4UAIA 2B63B 4X65L 2LSSA 2TMPA 1PZKD 2R7ZH 1WTHA 3M3YH 2PMZE 1XJVA 1K83B 3IFTA 2DN8A 2NVYH 4GLAC 4KY7A 4JI0L 5ELCA 2RHQB 3T53B 2HT1A 1ML0D 3MTSA 3KFUA 4QJFA 1EYGA 2E5LL 4A3EB 3VYTA 1D5XC 1TQOA 1HHVA 3D6CA 2R7FA 4JV5Q 1EEFD 2OF1A 5M5WH 3PGZA 1XPOA 1WD0A 1HA6A 1RD9D 3T4AC 1PYWD 3ER0A 5JPMC 2WKDA 3GD7A 1G2TA 1SBBB 3NELA 1C8CA 1Z47A 2ID0A 4DXGA 4IFDJ 1HPCA 3HOWH 3FEWX 4QUFA 4DR2L 2NVQB 1JOOA 4DKAC 3GO5A 4DV1Q 2EYPA 3K8AA 4EX5A 4NMZA 2F3IA 2H1EA 1TWFH 3JAMc 3H3VC 3FKIG 3MXPA 4XQNA 2FJ2A 1N36L 2JA9A 4OIJA 3ZJYC 4KHPQ 5HURA 1OXVA 1T5EA 2UU9Q 3T1HL 1MSHA 1F2ZA 1UAPA 3GV6A 2F0OA 2F4IA 4QMGA 4G7ZC 3F2CA 4NXMQ 4LFBQ 4FXGC 1H9MA 1SE2A 4X64L 4DV2Q 1YEZA 5M3FH 1YNNC 1V9PA 4JI7Q 2MFIA 3PQIA 3CPWA 3K0XA 2UUAL 2PPBC 4DN4M 4CBVA 2K52A 3F2UA 5C4JH 3PF4A 3FPPA 1KAAA 1B1ZA 4JI8L 4B3SQ 4R8NA 1L0YB 2QGQA 3GTLB 2EYLA 4LF6Q 4A93G 1EQQA 5CV8A 2R6GA 1EY8A 4RHRA 1QNUA 4A3GH 1GUWA 5C0XJ 4AH6A 3JAMi 2K5VA 2K5QA 4HEDA 1D5MC 2R93B 3FVQA 1L1OB 3I4MB 1II3A 1EYDA 3DWAA 1UEAB 3SK6A 2NYZD 1N34L 4A3KG 1CFMA 1SJHD 5IT9E 1MBYA 1XMQL 4GN3B 4K0KL 1PH1A 1ZYRD 4BBRH 4B3TQ 4JI1Q 3PV0A 2M00A 2BA1A 1TS4A 4DK6C 3R2IA 1JMCA 4G4KA 4XQQA 4FXKC 2E74C 3A8JE 2R7ZB 4DV0Q 3PO2H 3TN2A 1VQIA 5I2YA 2NVYB 3L3OC 2OQ0A 4LF4L 1SN8A 4GKKL 2QKIC 2DY8A 3EA6A 4JCVE 3BG3A 2DGYA 2EYOA 4K8JA 4DV3L 1PRTF 3L2PA 4Z9CB 1ZEQX 3SGIA 3C3LA 1ENFA 1H9SB 3OYYA 2XIWA 2BCOA 2IT1A 5M5WB 4YIJA 3MHBA 1R4QB 1EZ6A 3OW7A 2SEBD 4EQOA 2Q2HA 5J39A 4K5XA 4OONA 2CH4A 2VQEL 1YNJD 4ZCKA 1VS0A 1XPUA 4QCLA 4E6IA 4IZ8A 2F0SA 4HCEA 3Q8DA 2OEOA 1Q81C 5IOCA 2Z9HA 5EPJA 5KRUA 1E2VA 5DAUA 3M7NA 3BZDB 4DV7L 3HOWB 2MPMA 2LMCB 1ENCA 4OWWB 1TWAH 2Q2IA 3J80E 5C3XA 2B8GA 3M4QA 2FHTA 3RLNA 1Y69U 1IL8A 4CDEC 4BY1G 2ASBA 1X56A 2QEXA 1B9MA 1TWFB 2OCEA 5D3DA 5FK9C 1HTLD 2KENA 1XPRA 1ET6A 2C35B 5TSSA 4X62Q 4JOIA 5K5PA 5AFWA 3E0JA 5M3MG 3CCEA 1NTGA 2AUJD 3AB9A 4BY7G 2JA5G 5M3FB 3TP8A 1VQKA 3GTKH 3HOYG 1S3OA 2G5DA 5GROA 1E24A 1XNRQ 1HNZL 3ERQA 1ZXTA 2F0JA 4MHEA 5FLMG 2BA0A 5C4JB 2WAQB 1NMGA 1D5ZC 4IPHA 3I7FA 4KY5A 4HJ8A 4P74A 3CXCA 4N8FA 3M9BA 4XT3B 2K4KA 1FL0A 4A3GB 4IQZA 2DNEA 3SK5A 1VF5C 2OXPA 3HEJA 3F2DA 4NDXA 4JPBW 4P75A 5I4DA 3OIQA 3E9HA 5HY6A 4BBRB 5EPKA 3FDTA 2P5ZX 1LUZA 1SMYC 1PRTD 1WCMG 1CI3M 1ESFA 2H4OA 3T51B 1X3FA 4R1JA 3OOCA 3PUWA 5H1SE 4CHTB 3W5OA 2WKCA 4YHHL 4JBMA 4LF7L 1E22A 3A5ZB 4DV6Q 3J7YW 1HRJA 1M1KC 3CPFA 1LTBD 3CCVA 2CW0D 1DZ1A 4A3CG 1SRUA 1ICWA 1NBWA 2NVTH 3CC4A 1BXTA 2D5DA 2K1BA 3S1RH 5G3LF 4DR6L 2KCNA 1A2UA 3JC66 4CKBA 2KBNA 4OO1G 3M4PA 2E2IH 4ME5A 4LFCQ 2N78A 1KDAA 4DNRB 4DAYB 3IFDA 1Q86C 1JCKB 5C4XG 1SMXA 4Y7NB 5AJ3Q 1EWHA 1SYDA 1VMCA 1VQ6A 2AUKA 4L5TA 1JJGA 4LUZA 3MFYA 1EFWA 1V1PB 3BZCA 1JJ2A 2VY3A 3KUPA 1X3PA 4KV6A 3NK9A 1GUGA 2EOTA 2VZAA 3H0GG 1VQFA 4C1NI 1KRSA 1YBYA 1TWAB 1VQ9A 4BBSG 1RTNA 1L1OC 5IP7G 2AQ3B 2EYJA 1GUTA 4V190 5IIFA 4RKLA 1TWGH 2AMCB 1LM0A 2F0IA 2JEAI 1GOZA 2Q8TA 3NSWA 5I2XA 1V1PA 4RGOS 4RA8A 4QIWE 5DM73 1IYJB 1Q8IA 4H7BA 3H3VH 5IYBG 5F2DA 1U4LA 1TY0A 4JW0A 4JC0A 3HOZG 4A3MG 5E1FA 3GTKB 1G6PA 3CCRA 1XX8A 4PZ7A 4LNQA 3NTIA 1G51A 1SNCA 2TSSA 4M8AA 5FLXE 1G2SA 3Q24A 2GVBA 2SNSA 3ULJA 3MXNB 3KJOA 2EYHA 4RCNA 3CRKC 3GTQH 3R8BA 1IW7D 1JB3A 4UP9A 1A3TA 1HCZA 1JWMD 1BKBA 3T16A 5IY0A 3KDFB 2NN6G 3T1YQ 5IGCA 2D9UA 2A73B 3CHBD 5KNDA 4X3TA 5LMNL 1G6ZA 5M5YH 5ISRA 4PQXA 2B2UC 1VMPA 3VA7A 3RZDH 3H09A 2I07B 4JI2Q 1A0IA 5G3LD 3E0EA 1GHKA 3ITPA 5LL6X 3KLWA 3NTKA 2K7VA 2VS1A 4HN7A 2MQHA 1AW7A 2WB1B 1PHJA 4IPGA 1VQPA 3I4LA 4LUOA 1ASYA 3J7AV 2R92G 1X54A 4AQYQ 2VQEQ 4R4QA 2NVTB 1YHBA 1OXTA 4TQUS 5BN3A 3I8ZA 4KKUA 3S1RB 5FO8B 3DUZA 5BR8L 2N88A 1KDBA 1T9HA 2F52A 4H02A 2E2IB 4WJ4A 1A2TA 2IX0A 4ALPA 1EIFA 2MGSA 2NZHA 3HOUH 3JAML 4DNIA 1UE6A 3S17H 4NKLA 2PMZB 2F0LA 4NPSA 1PH6A 4H0LC 3PO3H 1GVPA 1N32L 1Q12A 3DMUA 4OIKA 2XN9C 3P75A 2B8FA 5CYUA 1T5XD 4R8IA 4X6AH 3BVMA 5A2QE 1ZYRC 3J7AF 2XRSD 1YIJA 4RMFA 5IWAL 5T1IA 1TWGB 2I5HA 2WACA 5FKAC 5K36H 1PH8A 4B08A 2CQAA 2PZUA 2E76C 2YTVA 1PH5A 3TQYA 2L11A 1HNZQ 1GD7A 4IOCA 1N33Q 5FJ8H 3TRZA 1TR5A 3S15H 1GM5A 1XTDA 2ZTCA 4PZ6A 2IJ0A 2CKZB 3MXUA 1HNWL 1FNUA 1A6XA 3FKIH 3FHWA 1B8AA 2RKSA 4AYBB 4MN3A 2QDLA 4KMUC 4XTCS 4C3JG 1FYCA 1S5FD 2QILA 3CC7A 3GTQB 1I6HH 3I70A 1NR4A 1WOCA 1YNJC 4RFBA 1CSQA 3KOJA 4KD3A 2K03A 3OIPA 4A3EH 2JA6G 4JI4Q 2K50A 4YHHQ 1X65A 4G7OC 5HGQA 4WJ3M 1QWYA 2I5LX 5M5YB 1RF2D 1EZ8A 1SDFA 4B9WA 2O4XA 1PXUA 2IPKD 1A8VA 5IGBA 4A93H 4HMJA 3MEFA 1C0AA 3KLSA 4ZLTF 4DR6Q 1DONA 3E3XA 2M9VA 2R61A 4P72A 2F0DA 1EIHA 2LFNA 3SEBA 4DV5Q 1NUCA 1JWUD 1SYBA 1PTOF 3HP3A 4LUVA 3PUZA 2BE5D 1I4RA 4DV4L 3KLRA 3DM3A 1X55A 1XYIA 2J4XA 3A55A 1X3QA 1X3GA 3UE0A 2L0CA 4DUZQ 2A68D 2UUCQ 3ULLA 4O0AA 3RNUA 3HOUB 3QG1A 3QIAA 1CUKA 1OXUA 3R2TA 1C9OA 2F3WA 4ZKCB 3S17B 5KGUA 1VQCA 2RQXA 2K01A 1PH3A 3GP7A 4IJHA 4DUYL 1RIPA 2DUDA 5CBAE 2Z6BA 2ZXRA 4L6TB 3K7AH 2RCFA 4F87A 2D2CC 4CJ0B 4XQJA 1I94L 1H9KA 4DU9A 1BBUA 4I7AA 3S1NH 1SE3A 2EY5A 3AEVA 4IPCA 1PRTC 4OO1I 1LTID 1W6KA 5EBDA 4EQNA 4J1MA 1IYVA 4A3BG 1HTPA 1UE7A 1XTCD 2B2YC 2VW9A 3S15B 2CW0C 1FD7D 2KA7A 2F0FA 3CCQA 2KCCA 2Y0SG 4BY1H 4N9PA 2F0EA 1TU2B 1GUSA 3W2DA 3FKIB 3K58A 4WJWA 1WTXA 3J80c 1QUQB 4XYOA 4B3ML 3HOVH 2PZWA 3RR5A 2VQFQ 2RCNA 5C0XH 5M3MH 2JJQA 2Z6KC 1I6HB 1U5KA 3S14H 4IJLA 4A3DG 4RKBA 1TS2A 4BY7H 2PQEA 4YY3L 1KHIA 2AWNA 3OW2A 4UY8C 2PQAB 2PCFB 3K5NA 1BBWA 3L9AX 1PTOD 5JJZA 2A8VA 3J7ZC 2EY6A 1HR0W 3PMFA 4KTAA 2ZT9C 5FLMH 1QUQA 1EOTA 1IBML 1SFOH 2R7DA 4IPDA 3J81E 2HIXA 3CU7A 3KYHC 3HOXG 1CZGA 4A93B 2RA4A 1C4QA 1EY9A 4RGTA 5J3BA 3D6WA 2CHBD 2EVBA 4RGNA 4B3RL 1I50B 1TS5A 2PQAA 1GHJA 4ZRZA 2YU9H 1SLJA 4DR4L 1KLUD 2ALYB 3E6ZX 4A3KB 1YZ6A 2NN6I 1G91A 2FMCA 3F8TA 1DXMA 2EXDA 2PI2A 2Q2UA 1XNQL 4J15A 1EWCA 4ABNA 2NWGA 1N32Q 3R3OA 2K04A 3I72A 4KJOA 3GTMH 4PMWA 1HZ9A 1IW7C 1K0SA 3PF5A 2V4DA 5EBCA 4C3IG 2B2TC 2WIIB 4EQ5A 5IWAQ 4FNFA 3DEPA 2B63G 3K7UC 3F2BA 1X9NA 5CV4A 4OO1H 1CHPD 2DJFC 1OTCA 4C3HG 3A0JA 3PUXA 1P16A 1STBA 3K7AB 5IP9G 4RHSA 5C4XH 5C3WA 1YITA 4FO2A 1EL0A 4K5VA 2CWAA 3C1FA 1YJNA 3S1NB 3SXHA 2AQ1B 4DR1L 4L63B 1QNKA 3GQBA 1HNWQ 2ZXOA 3D4DA 1MJCA 2LXJA 3U9OA 4DGZA 2Y0SE 1Q1EA 3QWNA 4OX9L 4A4IA 1TWCH 1E1OA 3TP6A 1IHZA 4BBSH 2RDFA 4ZAIA 2RHSB 4UHVA 4QUCA 5A35A 2EPBA 1LT4D 5IP7H 4BY1B 2F0NA 4DAVA 1KTKA 3OSOA 3T13A 2UXDL 1J9OA 4DR5Q 4R4IA 4YWLA 4PNYA 2ZJPA 4DR3L 2KCTA 2KJXA 2ZM6L 3EROA 2EJMA 3MZ5A 1NMFA 5DEHA 3HOVB 2BOSA 3AMUA 1PDQA 1L1OA 4KKTA 5M3MB 4KLKA 1Y1WG 3S14B 4FF4A 2XWJB 1YJWA 4BY7B 2WV6D 2JA5B 2L5TA 3QO2A 2XTIA 5FO7B 3MA2B 2QA4A 4A3MH 1PTOB 1YHAA 1WTVA 1I4XA 3HOYB 1DGSA 4L8JA 3Q22A 1LO5D 2SDFA 1PH4A 4X66L 4Y7NH 3OWEB 1ILQA 1UNSA 2N3SA 1K8MA 1NCVA 1SFOB 4LF8Q 1RTOA 1I5FA 4KKSA 1MGSA 1Y8OB 2NN6H 5FLXc 2HHHL 1QB5D 1GXDC 3SR1A 4HIDA 1TWHH 2EE1A 3FPUB 1VQAA 1OO9B 1QVCA 2QEJC 5CR3A 2VUMG 1Q1BA 3SHLA 5IYDG 2GA4B 1FJGL 4KN4C 4LF5L 3I4NG 2H5XA 4DPGA 3M7GA 2YU9B 3I3CA 4DR7L 1H9SA 1EUJA 1HR0Q 1EQTA 3HS0C 1SYCA 1MJEA 2O5JC 3B6YA 1JQYD 2KHIA 4FXDA 5BN5A 4NXNL 1SXTA 2L12A 1HZAA 2OT2A 3I4MG 2X69A 3K0YA 4WRDA 2B2UA 4JK1C 3ULPA 5JPNC 1EQVA 2WINB 3GTMB 5E4WC 2UXBQ 2Q8IB 4OEMB 2XGTA 2F3VA 1H9RA 2R92H 1IYUA 5DM63 3D8GA 3S16H 4DAPA 4OHJA 1JOKA 1DCZA 2PNHA 4C2MH 1AZQA 2KOLA 3OMCA 2R7ZG 3DLLA 3FMCA 3PIPA 3H94A 3H15A 2K6AA 3HRZC 4DK1A 5C4XB 5KEEA 3SK4A 4R4CA 2NTSA 5IGDA 2JEBI 2MJ8A 3H6MA 3RN5A 1O7LA 1RHPA 4LF9Q 1CZWA 1A63A 3K57A 2K5NA 3DXJC 4M1UB 3UDXA 1S72A 4X65Q 1EOVA 3HKZG 3EN2A 1Z6HA 1B3QA 1TWCB 3RMHA 4BBSB 2ICIA 4IOAA 2BE5C 4N8X1 3K5LA 4IUVA 4JI0Q 4YY3Q 3JAME 2E5LQ 1LT6D 1U4MA 2UXCL 2AWOA 4HJ7A 1BR9A 4WFN3 2A19A 1CHQD 1B7YB 3OHXC 2A6ED 3NHHA 4MNOA 1B2TA 1CT1D 1K8GA 2JYOA 1KL9A 3TBIB 1JB7A 2BH8A 2HCCA 1RDPD 4BXXH 1S5BD 1AE2A 4QQBX 1UUPA 3WOEA 3VYUA 1I6VC 4A3MB 2MNAA 2JA8H 1U9RA 1ONLA 1Q8KA 2E8GA 1TS3A 3S2HH 3TP5A 3MVVA 5CBEE 5JVG3 2Z8LA 3D0FA 4DR2Q 2IWHA 2HCIA 4CDFC 2B29A 1SE8A 1H95A 4DR4Q 4U68A 5M3FG 3L0OA 3P1HA 4PG3A 3CCSA 1N36Q 3NP8A 2NUCA 1JORA 1TWHB 1VQBA 3NTHA 1HNXL 2JA6H 3C1EA 2L9HA 1XNQQ 1WD1A 2L15A 3T1HQ 1PFSA 1K3RA 4DAYA 5D3IB 2ZTEA 4X64Q 3EJIA 1D6EC 4HIOA 2D62A 4GNXC 4G57A 1XMOL 1C7YA 4BA2I 3DM1A 5E4XA 1IBLL 1U0LA 1SEBD 4IUQA 1IZ6A 2K5HA 1PFBA 4JI3L 3VYRA 1TIID 2NB0A 1K0RA 4GOPB 2UUAQ 4BBRG 3TS2A 5C3EH 4JI8Q 1D1KA 3CC2A 2R92B 1DOMA 3K59A 3AU7A 2X6GA 3NUCA 3UDIA 4A75A 3S16B 1CQFA 4JG2A 4MIUA 4C2MB 1W2BA 3HFZB 3CQZH 3PO2G 1PTOC 3MEHA 1O78A 3G7LA 1N34Q 1F9PA 4OX9Q 3S1MH 1XMQQ 4K0KQ 1WTPA 1JOQA 3HKZE 1A3VA 3K6OA 5C4HA 2M2LA 3M4YA 3STBD 4FF3A 3PUVA 3J80L 2UXDQ 4UDUC 4FVMA 2DJGC 2ZM6Q 3PCOB 1PRTB 3RZOH 2AQ2B 3AFQA 3MXNA 4LF4Q 4GKKQ 1U4RA 5JOBA 3RLOA 1WTQA 1BBXC 1B3AA 1BNZA 1YNND 4GN5A 4R4TA 3KDFA 1GUOA 4DV3Q 2I5MX 1O80A 3C2PA 4GLXA 1PH7A 4AIMA 1WVLA 1PLFA 5KNBA 1KXLA 2E2HH 4X66Q 5J1ZA 3PIP3 2AKWB 5NUCA 4X3SA 1CQVA 2OQKA 5FOBB 1LTLA 4ILWA 1M4VA 2B39A 2JA8B 1S5DD 3I56A 2HHHQ 1EY5A 4A3JH 1QZGA 3KF6B 4JV5L 4DV7Q 1PFNA 5L37A 2OTLA 3S2HB 4ZQ3A 2L55A 2B2YA 4DK0A 1PVOA 1HQRD 4DR7Q 4CJ1B 3S9WA 1ZKOA 2ZXPA 2ES2A 4A3IG 1BDOA 1TT2A 2Q2TA 1EIYB 2K75A 3WOFA 2JA6B 3M4OH 2E2JH 4P73A 1SYEA 1STEA 4NXNQ 1SAPA 1LT3D 1BCPF 5I9PA 4DV1L 5CMDA 2Z6KA 1Q46A 1Y8NB 4YCVA 1S5ED 1MSGA 3K5MA 1KAWA 4B9XA 5C4ZA 2B2WC 1W6JA 4KHPL 2ENBA 1YHQA 3URYA 5FO9B 4MZ9A 5C44G 3Q0AA 3UDGA 1KD1C 1LTRD 1GO3E 1YJ9A 3J81c 2YV5A 4DNTB 4NXML 4HTHA 5CC4A 5C3EB 3CCJA 1E2WA 1HFGA 1Y14B 4JI7L 1CM9A 1S4ZA 2BDNA 2JSOA 3CQZB 1F9QA 3RUZA 2FXQA 2NTTA 4HJ9A 4WORA 2K33A 4U673 1CKNB 1CA5A 4JI5L 2NBFA 2F0QA 1JJCB 4LK1C 4B3SL 3AYHB 4XYQA 5BN4A 3S1MB 3SDZA 3LWEA 4KI0A 3O13A 1QVFA 1L0XB 2F0KA 5IYCG 2EYMA 1HFNA 2NVXH 1IBKL 5JAVA 3GTOH 3IAYA 3BU2A 1QZHA 2RDHA 4LF7Q 2EJGC 4ZK9B 1STNA 2I46A 4RAUC 3VYSA 4C3HH 3RZOB 4CKCA 5IP9H 4B3TL 4JI1L 1CKNA 2B2TA 4IO9A 3QJYA 2YTYA 3MFGA 1I4GA 1IL2A 5DLQE 4OXPA 1X6OA 1I50H 2FFKB 3X3NA 2E2HB 1JWSD 1I4QA 3CD6A 1LTGD 4A3KH 1XXGA 4HSVA 1SE4A 2JA7G 3CW2C 4P2CB 4GOPC 5FLXL 4IURA 1EY0A 3TDQA 2MP1A 4EQPA 1ASZA 5JEAG 1BCPD 2RSOA 4K8IA 4A3JB 1FGUA 1HUNA 3D3RA 1VF7A 1D8LA 3RN2A 1LTSD 5IT9c 3I2ZA 2C5CA 1Q90A 5GADC 4O1NA 1VQOA 3CMAA 2SOBA 5C5LA 3NXWA 4OWXB 1VQ8A 1Y1WH 2FINB 1IKMA 3WDNA 3MXGA 5JJIA 2IHEA 1WFQA 4AYBG 3A5UA 1KC8C 3M4OB 2E2JB 1E3PA 2A74C 5IE8A 1X32A 4ZUIA 5KNCA 2YTXA 1F9RA 3I4OA 1Y1VG 2MHVA 4PV1C 5GAHC 1MI2A 1D1IA 3MWYW 1EU4A 1V1OA 3W3AA 2B2VC 4BWGB 3MAQA 2A69D 4X62L 2CH4W 2BDOA 3Q23A 2VUMH 2QDBA 5IGFA 1FVIA 3VA5A 3I4NH 2A6EC 1K9MC 3EVQA 3NBHB 1EYCA 3E5SA 3U50C 2AHOB 5EKKA 4ZKBB 2OWOA 5LMNQ 2EY1A 3BVGA 1EFID 3U4ZA 1MD2D 4NW2A 2Z0SA 4LJZC 2F0GA 5CORA 1NNXA 4C1NK 1MKHA 2UUBL 2NVXB 3HG9A 2JQOA 2JA5H 4LMQD 3BDLA 3NBHA 1PTOH 4GZYC 2KVMA 1NY4A 3HOYH 3GTOB 3SE0A 1EY6A 2L4NA 1Q3LA 1AH9A 1SYFA 4K6LA 1YI2A 1IXRA 4KK7A 3GTGH 4C3HB 2MO1A 1HXYD 5A2QL 3DHQA 2LKVA 1PZJD 1F2YA 4Q0FA 3HOUG 4YWKA 5GAEC 5CV9A 1AP0A 1AEXA 1SNDA 1TVXA 5IODA 1M8AA 1LTTD 4A3FG 1VQJA 5BR8Q 4IUNA 4DV6L 1DD2A 3PO3G 3EBEA 1EQRA 1F9SA 3J80i 3P7JA 1QOHA 2Z4IA 3BYTB 1STGA 1WJJA 3CRLC 3CCUA 1Z9FA 1BCPB 4BA1I 1K3BC 1WCMH 1QG7A 3L7ZC 5K36G 3C46A 3CCMA 4LFCL 1SROA 1QJOA 1SNQA 5FJ8G 3VR5A 5AJ3L 1EY7A 3TSSA 4POGA 4A76A 3DWQA 4A3CH 1G291 2J7ZA 4AYBE 2IL8A 2KEDA 1Y1WB 1KRTA 3A8KE 1LV9A 4PMCA 1PYBA 4C56C 3V2TA 3STBC 1NR2A 2IX3A 3CP0A 1SYGA 4JYAL 1VQHA 1M90C 1ENAA 3SVMA 1A62A 2C9OA 2JP1A 1HQMC 2HD3A 3FP9A 3J7A5 2D0OA 2GN5A 3M85A 4KD4A 2EYFA 1L0WA 4Y52H 4JBWA 3BDOA 3G71A 4A3LG 4K2KA 2VB3X 1VQGA 4YCUA 1CKMA 4A3EG 3MC0B 1LT5D 4OL7A 1NE3A 2EQSA 3H0GH 5D65A 4O2DA 2VUMB 4GNXB 3I4NB 3CKIB 1VDZA 4RCOA 4JI5Q 4HIKA 4S3SA 3N6RA 4H13C 3QB3A 4GN4B 2A6HD 4KN7C 1HZBA 1IBKQ 3KK7A 1CKOA 2F1MA 5E3FA 1STHA 2CWPA 1KLGD 4K5WA 3KLSX 1F2LA 4DFAA 1RKNA 4JVZA 5IYBH 1Q7YC 4RH6A 3HKSA 3T1YL 3N52A 4GNXA 3NQIA 2K5WA 4K14A 2KUMA 4KHZA 4HJ5A 2HDLA 4QIWB 3HOZH 1J8IA 4YWMA 3CF5A 2F03A 1PMRA 2L1BA 4F8MA 3U9SA 1WYDA 1NAPA 3M3YB 3GTGB 4IFDG 4JI2L 5HGTA 3G48A 1TY2A 4KY6A 3VR2A 1D7QA 4I65A 1JT8A 4DV4Q 1EIGA 1AE3A 2F0TA 1JE5A 2N55A 1RL2A 1B4OA 4BS9A 1PH9A 1QILA 4CKEA 2PNRC 1BOSA 4F7XA 3K81C 3IRBA 4PMBA 3G6EA 3GV3A 3UDFA 4QGUA 4KHVA 3HKZB 1UE5A 4UPAA 3TZUA 4L5RC 1B50A 1K28A 1PZID 2D0PA 4AQYL 2PW7A 3S2DH 2F4VL 1B70B 1I4HA 1WCMB 3OTOL 1E7ZA 4CDDC 1WTWA 2ZJQA 2N8NA 3BZKA 4ULLA 2R93G 5C6AA 3R93A 2CCZA 1B9NA 4DUYQ 4OWTB 3TREA 2E2DC 1HH2P 3E9IA 4JI6L 1B53A 4HIMA 5IGEA 1I94Q 3I90A 3G4SA 1HZCA 1W3SA 2XWBB 5CV6A 5EJWA 2WFWA 2O2LD 3VDYA 2KCMA 1UE1A 3HOVG 2KHSA 1KNEA 2CFMA 3RLFA 5C0XG 2HIVA 3J81L 1HJPA 2JK8A 3GTJH 4O42A 1VQ7A 1V8QA 1GKHA 1LYLA 2K32A 4A3IH 1LTAD 3A56A 1MIUA 3GTPH 3QR8A 3EFXD 4L5SA 2PI2E 2RDGA 1VQNA 1PV4A 1N33L 3H0GB 4B3MQ 4FDBA 3K5OA 3H3VI 3UI2A 1N8RC 3G6JB 1Q82C 2UUBQ 3HGBA 1AFPA 1J5EL 2IY5B 3HOWG 4KJNA 3SK8A 3W1GA 1BCPC 1K73C 1CSPA 1F77A 1JR0D 2A68C 5C44H 4PZ8A 2LY7A 2HUGA 4OGQC 4IUUA 3U4VA 1NSNS 1G8ZD 2WP8J 1SNMA 1IBMQ 3NENA 4Q5VA 3X3MA 2KHJA 2B2WA 3U58A 1BF4A 2SNMA 3HOZB 4JBKA 5I6WA 2EY2A 3ND9A 4JI4L 1KIXA 1QVGA 5EGTA 4B3RQ 3EQLC 1AN8A 4LFAL 4C3JH 3PO2B 3NWTA 4TKOB 3VR4A 1GUNA 2J0TD 1LACA 2ATWA 2ZJRA 2EDGA 5IGGA 4N9TA 1WTRA 5IYCH 4DF7A 3H91A 3KF8B 3VR3A 4EGVA 3QOJA 3PSIA 2NZ1D 5KYLA 2A69C 4DV5L 4ZUJA 5IT9L 2RSNA 5GQOA 2WAQG 4MTKA 1O7ZA 5COYA 1E0BA 3Q6SA 5EPLA 2B3GA 4LWCA 3BJUA 1DM0B 3S2DB 1SR3A 3BS1A 1O7YA 3S1QH 4A3GG 2XNAC 1V43A 2FMMA 2VXWA 4LW1A 4DUZL 2IW3A 4JYAQ 1SJED 4DXFA 3V05A 2UUCL 3KF8A 2CQOA 3AQQA 2KQ3A 1I3QH 1WI5A 4R9WA 3PIOA 2YYZA 1PFMA 2F0VA 2XSCA 1GJXA 2JA7H 1Z7TA 2A1AA 2LXKA 3QOLA 3PUYA 4DR1Q 2PO4A 3J81j 1QE6A 4GKJL 1X3EA 5JEAH 5LMUL 4XT1B 4RG1A 4G7HC 1MHWC 3NE5B 4J8QA 1FNWA 1SNOA 1STAA 1R9TH 3GTJB 3D4RA 1VCIA 1CTMA 1XWEA 3A7AB 4GOPA 2PZTA 1PH2A 4A3IB 1B44D 5C5MA 1F2MA 3NQTA 3GTPB 2F0PA 2G9HD 5M9OA 4HJAA 4DR3Q 4CGYB 1TKWB 1KNAA 1WTOA 3P20A 3LNNA 5LHY1 2V1CC 1AZPA 2VNUD 1I4PA 2MUYA 4DK3C 2ZTDA 3V96A 1HA5A 3OPOA 1Y1VH 4IN3A 1VQ4A 2QCPX 5DNFA 5M5XH 5GAGC 1VQ5A 1DYQA 4EVOA 4QL5A 1ILPA 4DA2A 3I55A 3AFPA 1ESRA 2VQFL 5C44B 1BQQT 4JOIC 2VL6A 4QF4A 4A3BH 3BDCA 4GLVB 1O7IA 2IHFA 3BYYB 4FP5D 2XVSA 3ND8A 2BH2A 4F88A 2B2VA 1PA6A 3TP7A 2EXZA 1VQEA 1CA6A 3KBGA 4L5QA 4HMIA 1FJGQ 4C3JB 4LF5Q 1SNPA 4FF1A 5ELEA 3LGJA 3I73A 5JJLA 5JJKA 3NPPA 2NZOA 3D4WA 5J22A 2CVRA 1DJRD 4A3DH 3TEHB 2WAQE 2F4VQ 2PYKA 2K5DA 1C48A 3LWUA 3OTOQ 1HUMA 2MO0A 2IX1A 4FYDA 1BVSA 4YCWA 1RCVD 4RGMA 3A54A 4CJ2C 4TVAB 2VB2X 3KF6A 1D2BA 5I6YA 3TZDA 2QW7A 4JI6Q 5JEAJ 3HOXH 2R3ZA 4TRDA 3S1QB 2A6HC 2Z4HA 5LMNW 2KEEA 1STYA 1NJIC 1JC7A 4J6HA 3GDEA 3W1BA 5ELOA 4A3FH 1VQMA 1EWIA 2UU9L 1UEBA 2F0WA 5KIXA 1ET9A 3S24A 5ELNA 1I3QB 4IFDI 3VR6A 2RBMA 4LAAA 5JVH3 4LFBL 5EKLA 1Y8PB 4DV2L 1S40A 4OELB 2JA7B 5E7NA 1RJTA 4HR7B 2K14A 2O5IC 3IL8A 2WB1G 4GS3A 3WWVA 4I7ZC 4QY7A 3FRPB 2JE6I 1R9TB 2PW5A 3TMEA 1YVCA 5I9OA 4LF6L 4HCSA 4BXXG 2KECA 1TXYA 4RWSC 3TS0A 4X3KA 1EU3A 4C3IH 2JA8G 3EIVA 5ELBA 4UP7A 1QCBD 1J5EQ 1RODA 3K80C 3ZYYX 4MTNA 4IUPA 2B63H 2UXCQ 1LLRD 1SSOA 4R4OA 5EQ0A 1L2FA 1V1QA 1UWVA 2HQLA 3KBXA 5CV5A 1K83H 1R4PB 2Z1CA 2RF4A 4DAMA 4X3UA 4APVA 4FF2A 2F0HA 3J81i 1Y1VB 1JE4A 4A3LH 2EIFA 3PIO3 3NBIA 1U4PA 4DR5L 5M5XB 3ICEA 4XDXA 3ERSX 1PYSB 4P71A 4CDCC 2EJFC 2GVAA 1DOLA 3RD4A 4DV0L 3DWPA 1LABA 1A15A 5C0XI 5ELFA 4A3BB 4LFAQ 3RZDB 1BUVT 1E2ZA 4TSSA 4XIGS 1K8AC 1VQLA 2X6LA 1CK1A 2Y0SB 4QB4A 1N9WA 3F1ZA 1OXSC 2E75C 1DOKA 4HSPA 3OWFA 4NB3A 1EY4A 2HDMA 1ICFB 1HNXQ 3A7LA 1BO0A 3DEOA 2I0QA 2NVQH 1KABA 3UE1A 1VQDA 5C3EG 4LF8L 2HQEA 2ICEC 1SMYD 3A74A 4HAEA 4A3DB 5ELDA 4V0BA 4ME3A 2N49A 1YNXA 1H9JA 1JICA 1XMOQ 1KDCA 1FGBD 1IBLQ 4UP8A 2Q8RE 1A3UA 4JI3Q 4K2LA 1HR0L 4IFDH 5D14A 4POFA 1P8LA 3A8IE 5CV7A 5T1GA 4XXEA 3HOXB 1FNVA 1OXXK 3I91A 4ZYSA 2QF7A 1KQSA 2F0UA 4NP5A 2K05A 3D31A 2DY7A 1EEID 4A3FB 4ID6A 4H44C 3CCLA 4GKJQ 1S5CD 3PO3B 5EAYA 3NEMA 3HZXA 5LMUQ 3IKJA 2EZVA 2A5HA 4K6DA 5IYDH 2JXMB 4IALA 2UXBL 2DNCA 3CMEA 3OMGA 2WB1E
chains in the Genus database with same CATH topology
3GTLH 3S17H 3S2HH 5IYBH 1Q7YC 3CAMA 4NPSA 3D0FA 4DR2Q 3HKSA 3T1YL 1PH6A 3PO3H 1GVPA 1J6QA 4GNXA 1Q12A 2B29A 1SE8A 1XNRL 4DR4Q 1N32L 1H95A 4HJ5A 4KHZA 3HOZH 2R93H 5M3FG 4YWMA 3L0OA 3CF5A 3I4MH 4PG3A 3CCSA 4X6AH 3KJPA 1N36Q 1WYDA 4JBJA 1E1TA 1VQBA 1YIJA 4RMFA 5IWAL 1HNXL 2I5HA 2JA6H 4JI2L 4IFDG 4LF9L 3G48A 2OTJA 1PH8A 1XNQQ 2L15A 2YTVA 3T1HQ 1PH5A 3TQYA 1D7QA 1JT8A 1PFSA 4DV4Q 1K3RA 4A3JG 1HNZQ 1GD7A 4IOCA 1AE3A 1N33Q 1JE5A 1RL2A 4X65L 2LSSA 5FJ8H 3TRZA 2ZTEA 4X64Q 1PH9A 2R7ZH 1GM5A 3S15H 3M3YH 1XTDA 4HIOA 2D62A 2PMZE 2ZTCA 4GNXC 4PZ6A 1XJVA 3K81C 3IRBA 3G6EA 2NVYH 2CKZB 4GLAC 1XMOL 1C7YA 3UDFA 4QGUA 1IBLL 4BA2I 1U0LA 1HNWL 4JI0L 1IZ6A 2K5HA 3FKIH 1UE5A 4UPAA 2RHQB 4JI3L 3FHWA 4L5RC 2HT1A 1B8AA 4AQYL 1K0RA 2D0PA 4QJFA 1EYGA 3KFUA 4GOPB 2UUAQ 2E5LL 3S2DH 2F4VL 1B70B 4XTCS 4BBRG 3TS2A 5C3EH 4JI8Q 3CC2A 3CC7A 3OTOL 1E7ZA 2R7FA 2ZJQA 2N8NA 4JV5Q 3BZKA 2R93G 4A75A 1I6HH 3UDIA 5M5WH 1WOCA 4JG2A 1CSQA 3KOJA 3PGZA 1XPOA 1W2BA 3HFZB 2CCZA 3CQZH 4DUYQ 4OWTB 3TREA 4A3EH 3PO2G 3ER0A 1HH2P 3E9IA 4JI4Q 4HIMA 4JI6L 2JA6G 2K50A 3GD7A 1X65A 4YHHQ 1I94Q 5HGQA 4WJ3M 3NELA 2I5LX 3G4SA 1N34Q 1HZCA 1Z47A 2ID0A 1W3SA 4OX9Q 3S1MH 4IFDJ 3HOWH 1XMQQ 4K0KQ 2WFWA 3HKZE 4DR2L 3VDYA 4DKAC 2KCMA 3STBD 3GO5A 1UE1A 3HOVG 3PUVA 4DV1Q 1A8VA 2UXDQ 2CFMA 3K8AA 4EX5A 4A93H 3RLFA 5C0XG 2HIVA 1HJPA 2JK8A 2F3IA 3MEFA 1C0AA 3GTJH 2ZM6Q 1TWFH 3JAMc 1VQ7A 4DR6Q 3FKIG 3PCOB 1N36L 2JA9A 1GKHA 4P72A 1LYLA 3RZOH 3ZJYC 4KHPQ 4DV5Q 4A3IH 1OXVA 3AFQA 4LF4Q 4GKKQ 1MIUA 3GTPH 3RLOA 2UU9Q 3T1HL 4LUVA 3PUZA 4L5SA 2PI2E 4DV4L 1VQNA 3DM3A 4GN5A 1X55A 4R4TA 1PV4A 3KDFA 4B3MQ 1N33L 4FDBA 4DV3Q 3F2CA 3H3VI 4NXMQ 4LFBQ 2I5MX 4X64L 4DV2Q 1YEZA 1X3GA 3UE0A 1N8RC 5M3FH 4GLXA 1PH7A 4AIMA 1KXLA 4DUZQ 2E2HH 4X66Q 1Q82C 1V9PA 4JI7Q 2MFIA 2UUCQ 2AKWB 2UUBQ 1J5EL 2IY5B 3CPWA 3ULLA 4O0AA 3RNUA 3HOWG 2OQKA 3K0XA 3W1GA 1LTLA 2UUAL 2K52A 1K73C 1CUKA 1CSPA 1OXUA 5C4JH 3PF4A 4JI8L 3I56A 1C9OA 5C44H 2HHHQ 4PZ8A 4A3JH 2QGQA 3KF6B 1QZGA 4B3SQ 4DV7Q 4JV5L 4LF6Q 3U4VA 2OTLA 4A93G 2WP8J 1VQCA 1EQQA 1IBMQ 2R6GA 3NENA 1PH3A 1PVOA 2KHJA 4A3GH 4IJHA 5C0XJ 4DR7Q 4DUYL 3U58A 4AH6A 1RIPA 2DUDA 2K5VA 3JAMi 4JBKA 2ES2A 4A3IG 3K7AH 1L1OB 4JI4L 1KIXA 1I94L 1QVGA 1N34L 4A3KG 2Q2TA 1BBUA 3S1NH 4B3RQ 1XMQL 2K75A 1EIYB 3AEVA 4GN3B 4IPCA 1PH1A 4C3JH 4BBRH 4LFAL 4B3TQ 3M4OH 2E2JH 4P73A 4JI1Q 4NXNQ 3PV0A 2BA1A 4OO1I 2ATWA 4DV1L 2ZJRA 2Z6KA 1Q46A 4DK6C 4YCVA 1Q86C 1JMCA 5IYCH 4A3BG 1UE7A 2VW9A 3KF8B 1KAWA 4DV0Q 3PO2H 1VQIA 3PSIA 3CCQA 4KHPL 4DV5L 2OQ0A 2Y0SG 4BY1H 4LF4L 1SN8A 4GKKL 5GQOA 1YHQA 2WAQG 5C44G 4MZ9A 3UDGA 1KD1C 2B3GA 4JCVE 1GO3E 3J80c 4LWCA 1YJ9A 1QUQB 3BJUA 3J81c 4B3ML 1SR3A 2YV5A 2DGYA 3RR5A 4DV3L 4NXML 3HOVH 3L2PA 2VQFQ 3S1QH 4A3GG 3CCJA 2RCNA 3SGIA 1V43A 1Y14B 2JJQA 3OYYA 2Z6KC 4LW1A 5M3MH 4DUZL 2IT1A 4JYAQ 1U5KA 3S14H 4IJLA 4A3DG 4JI7L 2UUCL 2CQOA 2Q2HA 3AQQA 4OONA 4BY7H 2VQEL 4YY3L 1KHIA 2FXQA 2AWNA 3OW2A 1I3QH 1VS0A 4HJ9A 4UY8C 1XPUA 1WI5A 2PQAB 1CKNB 3PIOA 2YYZA 3Q8DA 4JI5L 1Q81C 1JJCB 1BBWA 4B3SL 2A8VA 3AYHB 3J7ZC 2JA7H 3M7NA 4DV7L 2A1AA 1HR0W 4KI0A 2LXKA 1QVFA 3PUYA 5FLMH 1QUQA 5IYCG 4DR1Q 1IBML 2NVXH 1TWAH 2Q2IA 3J81j 1IBKL 4OWWB 4GKJL 1SFOH 1X3EA 3M4QA 2R7DA 4IPDA 5LMUL 2HIXA 3KYHC 3HOXG 4RG1A 3RLNA 3GTOH 3BU2A 1QZHA 4LF7Q 4BY1G 1R9TH 2ASBA 1X56A 2QEXA 2OCEA 5J3BA 1VCIA 4C3HH 2KENA 4GOPA 1XPRA 1PH2A 4B3RL 2C35B 5IP9H 4B3TL 2PQAA 4JI1L 1CKNA 2YU9H 1SLJA 4DR4L 4X62Q 4JOIA 4IO9A 2ALYB 4HJAA 2YTYA 4DR3Q 5M3MG 1YZ6A 3CCEA 1NTGA 1IL2A 2NN6I 5DLQE 4OXPA 2V1CC 4BY7G 1X6OA 2VNUD 1I50H 3F8TA 2JA5G 4DK3C 2ZTDA 2EXDA 2PI2A 1VQKA 2Q2UA 3GTKH 1XNQL 4J15A 3HOYG 3CD6A 1Y1VH 1S3OA 5GROA 4A3KH 1E24A 1N32Q 1VQ4A 1XNRQ 1HNZL 3GTMH 4PMWA 5M5XH 1HZ9A 2JA7G 5GAGC 3CW2C 1VQ5A 4GOPC 5FLMG 3PF5A 4QL5A 3I55A 2BA0A 3AFPA 1ASZA 1NMGA 5JEAG 2VQFL 4JOIC 1FGUA 2VL6A 4IPHA 3I7FA 1D8LA 4EQ5A 5IWAQ 4HJ8A 3RN2A 4P74A 4GLVB 3CXCA 2B63G 1O7IA 3K7UC 3F2BA 2IHFA 1X9NA 3M9BA 5IT9c 2K4KA 1FL0A 3I2ZA 5GADC 1OTCA 3A0JA 3PUXA 1P16A 1VQOA 3CMAA 2BH2A 4OWXB 1VQ8A 1PA6A 5IP9G 1Y1WH 5C4XH 1YITA 1VQEA 3F2DA 5JJIA 2CWAA 1YJNA 4P75A 2IHEA 4L5QA 3E9HA 1WFQA 1FJGQ 5HY6A 4AYBG 3A5UA 4DR1L 1KC8C 4LF5Q 1HNWQ 1E3PA 3LGJA 5JJLA 1LUZA 5IE8A 1WCMG 5JJKA 1MJCA 1X3FA 2LXJA 2NZOA 4R1JA 3PUWA 5H1SE 3W5OA 4A3DH 2YTXA 2Y0SE 4YHHL 3I4OA 3TEHB 4JBMA 1Q1EA 1Y1VG 2WAQE 1E22A 3A5ZB 5GAHC 4DV6Q 4LF7L 4OX9L 2F4VQ 1M1KC 4A4IA 1TWCH 1E1OA 3OTOQ 3CPFA 4BBSH 2MO0A 3CCVA 2IX1A 2RHSB 4A3CG 1BVSA 4YCWA 5IP7H 4TVAB 1SRUA 3KF6A 4X62L 2UXDL 1NBWA 4DR5Q 4R4IA 4YWLA 2ZJPA 2NVTH 4DR3L 2VUMH 3CC4A 2KCTA 3S1RH 1FVIA 5JEAJ 2ZM6L 4JI6Q 3JC66 3I4NH 4DR6L 1NMFA 2KBNA 3HOXH 4OO1G 3M4PA 2E2IH 1K9MC 3NBHB 4LFCQ 2N78A 5LMNW 4DAYB 1L1OA 3U50C 1NJIC 3GDEA 4KLKA 2AHOB 5ELOA 3W1BA 4A3FH 1Y1WG 1SMXA 1VQMA 1EWIA 5AJ3Q 2UU9L 5C4XG 1UEBA 1YJWA 3S24A 5ELNA 1VQ6A 4L5TA 1JJGA 2OWOA 2XTIA 4LUZA 5LMNQ 4A3MH 2QA4A 4IFDI 1YHAA 3U4ZA 4LFBL 1DGSA 4DV2L 1EFWA 3BZCA 1JJ2A 2VY3A 1S40A 1PH4A 2Z0SA 4X66L 4Y7NH 5E7NA 2VZAA 1MKHA 1VQFA 3H0GG 2UUBL 1KRSA 1YBYA 2JQOA 2K14A 2N3SA 2JA5H 4LF8Q 1VQ9A 1I5FA 2WB1G 4GS3A 4BBSG 3WWVA 3HOYH 1NY4A 4QY7A 1L1OC 2JE6I 1AH9A 5IP7G 5FLXc 2HHHL 1YVCA 4HIDA 1YI2A 1IXRA 1TWHH 4LF6L 3GTGH 1TWGH 1VQAA 2AMCB 1QVCA 1LM0A 2MO1A 2JEAI 2VUMG 1Q1BA 4BXXG 5IYDG 1TXYA 1FJGL 3HOUG 3TS0A 4LF5L 4YWKA 2H5XA 4C3IH 5GAEC 2JA8G 3I4NG 4DPGA 3EIVA 4DR7L 4UP7A 1J5EQ 4QIWE 3K80C 1EUJA 1HR0Q 4MTNA 1IYJB 2B63H 3H3VH 5IYBG 2UXCQ 4A3FG 1VQJA 4R4OA 1L2FA 5BR8Q 1V1QA 4DV6L 1UWVA 2HQLA 1MJEA 3PO3G 3B6YA 1K83H 3EBEA 2KHIA 4JC0A 1EQRA 3HOZG 2RF4A 4A3MG 3J80i 4NXNL 4DAMA 4APVA 1G6PA 1HZAA 3I4MG 3CCRA 3J81i 4PZ7A 4LNQA 4A3LH 1G51A 2EIFA 3ULPA 1WJJA 3CCUA 4DR5L 3ICEA 2UXBQ 1Z9FA 2GVBA 4BA1I 3ERSX 3MXNB 1PYSB 3ULJA 3KJOA 4P71A 1WCMH 2XGTA 3L7ZC 3GTQH 2GVAA 5K36G 4DV0L 2R92H 3CCMA 4LFCL 4UP9A 3S16H 5C0XI 1SROA 3T1YQ 1BKBA 4LFAQ 2PNHA 3KDFB 2NN6G 4C2MH 5IY0A 5FJ8G 5AJ3L 4POGA 4XIGS 2R7ZG 1K8AC 3DLLA 4A76A 1VQLA 3PIPA 3H15A 4A3CH 1G291 4AYBE 5LMNL 1N9WA 3F1ZA 1OXSC 1KRTA 5M5YH 1PYBA 4NB3A 4R4CA 1HNXQ 2JEBI 3RN5A 4JI2Q 3STBC 3RZDH 4LF9Q 4JYAL 3CP0A 2NVQH 2I0QA 1A0IA 4K0KL 1VQHA 1A63A 1M90C 3E0EA 3UE1A 1VQDA 2K5NA 5C3EG 1A62A 4LF8L 3UDXA 1S72A 3KLWA 3FP9A 3J7A5 2VS1A 2D0OA 3A74A 2GN5A 4X65Q 1EOVA 3M85A 3HKZG 1L0WA 4Y52H 3EN2A 2MQHA 4JBWA 4ME3A 3G71A 2N49A 4A3LG 1YNXA 4IOAA 1VQGA 4YCUA 1XMOQ 1PHJA 1CKMA 4IPGA 4A3EG 1IBLQ 1VQPA 4LUOA 4UP8A 1ASYA 4JI0Q 4JI3Q 2R92G 1NE3A 1X54A 2EQSA 4AQYQ 2VQEQ 4R4QA 4YY3Q 1HR0L 1YHBA 1OXTA 3H0GH 4TQUS 4POFA 4O2DA 2E5LQ 2UXCL 4A3BH 2AWOA 1P8LA 4GNXB 4HJ7A 5BR8L 4JI5Q 4HIKA 1T9HA 2A19A 2F52A 4H02A 1OXXK 4WJ4A 1B7YB 2IX0A 1KQSA 4MNOA 4ALPA 3D31A 4GN4B 1EIFA 1K8GA 3CCLA 1HZBA 1KL9A 1IBKQ 4GKJQ 1JB7A 2BH8A 5EAYA 3NEMA 5LMUQ 4BXXH 1AE2A 1CKOA 2NZHA 4QQBX 5IYDH 3HOUH 2CWPA 2UXBL 2MNAA 2JA8H 3CMEA 1Q8KA 4DNIA 2E8GA 1UE6A 2WB1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL H;  3S17 H;  3S2H H;  5IYB H;  1Q7Y C;  3CAM A;  4NPS A;  3D0F A;  4DR2 Q;  3HKS A;  3T1Y L;  1PH6 A;  3PO3 H;  1GVP A;  1J6Q A;  4GNX A;  1Q12 A;  2B29 A;  1SE8 A;  1XNR L;  4DR4 Q;  1N32 L;  1H95 A;  4HJ5 A;  4KHZ A;  3HOZ H;  2R93 H;  5M3F G;  4YWM A;  3L0O A;  3CF5 A;  3I4M H;  4PG3 A;  3CCS A;  4X6A H;  3KJP A;  1N36 Q;  1WYD A;  4JBJ A;  1E1T A;  1VQB A;  1YIJ A;  4RMF A;  5IWA L;  1HNX L;  2I5H A;  2JA6 H;  4JI2 L;  4IFD G;  4LF9 L;  3G48 A;  2OTJ A;  1PH8 A;  1XNQ Q;  2L15 A;  2YTV A;  3T1H Q;  1PH5 A;  3TQY A;  1D7Q A;  1JT8 A;  1PFS A;  4DV4 Q;  1K3R A;  4A3J G;  1HNZ Q;  1GD7 A;  4IOC A;  1AE3 A;  1N33 Q;  1JE5 A;  1RL2 A;  4X65 L;  2LSS A;  5FJ8 H;  3TRZ A;  2ZTE A;  4X64 Q;  1PH9 A;  2R7Z H;  1GM5 A;  3S15 H;  3M3Y H;  1XTD A;  4HIO A;  2D62 A;  2PMZ E;  2ZTC A;  4GNX C;  4PZ6 A;  1XJV A;  3K81 C;  3IRB A;  3G6E A;  2NVY H;  2CKZ B;  4GLA C;  1XMO L;  1C7Y A;  3UDF A;  4QGU A;  1IBL L;  4BA2 I;  1U0L A;  1HNW L;  4JI0 L;  1IZ6 A;  2K5H A;  3FKI H;  1UE5 A;  4UPA A;  2RHQ B;  4JI3 L;  3FHW A;  4L5R C;  2HT1 A;  1B8A A;  4AQY L;  1K0R A;  2D0P A;  4QJF A;  1EYG A;  3KFU A;  4GOP B;  2UUA Q;  2E5L L;  3S2D H;  2F4V L;  1B70 B;  4XTC S;  4BBR G;  3TS2 A;  5C3E H;  4JI8 Q;  3CC2 A;  3CC7 A;  3OTO L;  1E7Z A;  2R7F A;  2ZJQ A;  2N8N A;  4JV5 Q;  3BZK A;  2R93 G;  4A75 A;  1I6H H;  3UDI A;  5M5W H;  1WOC A;  4JG2 A;  1CSQ A;  3KOJ A;  3PGZ A;  1XPO A;  1W2B A;  3HFZ B;  2CCZ A;  3CQZ H;  4DUY Q;  4OWT B;  3TRE A;  4A3E H;  3PO2 G;  3ER0 A;  1HH2 P;  3E9I A;  4JI4 Q;  4HIM A;  4JI6 L;  2JA6 G;  2K50 A;  3GD7 A;  1X65 A;  4YHH Q;  1I94 Q;  5HGQ A;  4WJ3 M;  3NEL A;  2I5L X;  3G4S A;  1N34 Q;  1HZC A;  1Z47 A;  2ID0 A;  1W3S A;  4OX9 Q;  3S1M H;  4IFD J;  3HOW H;  1XMQ Q;  4K0K Q;  2WFW A;  3HKZ E;  4DR2 L;  3VDY A;  4DKA C;  2KCM A;  3STB D;  3GO5 A;  1UE1 A;  3HOV G;  3PUV A;  4DV1 Q;  1A8V A;  2UXD Q;  2CFM A;  3K8A A;  4EX5 A;  4A93 H;  3RLF A;  5C0X G;  2HIV A;  1HJP A;  2JK8 A;  2F3I A;  3MEF A;  1C0A A;  3GTJ H;  2ZM6 Q;  1TWF H;  3JAM c;  1VQ7 A;  4DR6 Q;  3FKI G;  3PCO B;  1N36 L;  2JA9 A;  1GKH A;  4P72 A;  1LYL A;  3RZO H;  3ZJY C;  4KHP Q;  4DV5 Q;  4A3I H;  1OXV A;  3AFQ A;  4LF4 Q;  4GKK Q;  1MIU A;  3GTP H;  3RLO A;  2UU9 Q;  3T1H L;  4LUV A;  3PUZ A;  4L5S A;  2PI2 E;  4DV4 L;  1VQN A;  3DM3 A;  4GN5 A;  1X55 A;  4R4T A;  1PV4 A;  3KDF A;  4B3M Q;  1N33 L;  4FDB A;  4DV3 Q;  3F2C A;  3H3V I;  4NXM Q;  4LFB Q;  2I5M X;  4X64 L;  4DV2 Q;  1YEZ A;  1X3G A;  3UE0 A;  1N8R C;  5M3F H;  4GLX A;  1PH7 A;  4AIM A;  1KXL A;  4DUZ Q;  2E2H H;  4X66 Q;  1Q82 C;  1V9P A;  4JI7 Q;  2MFI A;  2UUC Q;  2AKW B;  2UUB Q;  1J5E L;  2IY5 B;  3CPW A;  3ULL A;  4O0A A;  3RNU A;  3HOW G;  2OQK A;  3K0X A;  3W1G A;  1LTL A;  2UUA L;  2K52 A;  1K73 C;  1CUK A;  1CSP A;  1OXU A;  5C4J H;  3PF4 A;  4JI8 L;  3I56 A;  1C9O A;  5C44 H;  2HHH Q;  4PZ8 A;  4A3J H;  2QGQ A;  3KF6 B;  1QZG A;  4B3S Q;  4DV7 Q;  4JV5 L;  4LF6 Q;  3U4V A;  2OTL A;  4A93 G;  2WP8 J;  1VQC A;  1EQQ A;  1IBM Q;  2R6G A;  3NEN A;  1PH3 A;  1PVO A;  2KHJ A;  4A3G H;  4IJH A;  5C0X J;  4DR7 Q;  4DUY L;  3U58 A;  4AH6 A;  1RIP A;  2DUD A;  2K5V A;  3JAM i;  4JBK A;  2ES2 A;  4A3I G;  3K7A H;  1L1O B;  4JI4 L;  1KIX A;  1I94 L;  1QVG A;  1N34 L;  4A3K G;  2Q2T A;  1BBU A;  3S1N H;  4B3R Q;  1XMQ L;  2K75 A;  1EIY B;  3AEV A;  4GN3 B;  4IPC A;  1PH1 A;  4C3J H;  4BBR H;  4LFA L;  4B3T Q;  3M4O H;  2E2J H;  4P73 A;  4JI1 Q;  4NXN Q;  3PV0 A;  2BA1 A;  4OO1 I;  2ATW A;  4DV1 L;  2ZJR A;  2Z6K A;  1Q46 A;  4DK6 C;  4YCV A;  1Q86 C;  1JMC A;  5IYC H;  4A3B G;  1UE7 A;  2VW9 A;  3KF8 B;  1KAW A;  4DV0 Q;  3PO2 H;  1VQI A;  3PSI A;  3CCQ A;  4KHP L;  4DV5 L;  2OQ0 A;  2Y0S G;  4BY1 H;  4LF4 L;  1SN8 A;  4GKK L;  5GQO A;  1YHQ A;  2WAQ G;  5C44 G;  4MZ9 A;  3UDG A;  1KD1 C;  2B3G A;  4JCV E;  1GO3 E;  3J80 c;  4LWC A;  1YJ9 A;  1QUQ B;  3BJU A;  3J81 c;  4B3M L;  1SR3 A;  2YV5 A;  2DGY A;  3RR5 A;  4DV3 L;  4NXM L;  3HOV H;  3L2P A;  2VQF Q;  3S1Q H;  4A3G G;  3CCJ A;  2RCN A;  3SGI A;  1V43 A;  1Y14 B;  2JJQ A;  3OYY A;  2Z6K C;  4LW1 A;  5M3M H;  4DUZ L;  2IT1 A;  4JYA Q;  1U5K A;  3S14 H;  4IJL A;  4A3D G;  4JI7 L;  2UUC L;  2CQO A;  2Q2H A;  3AQQ A;  4OON A;  4BY7 H;  2VQE L;  4YY3 L;  1KHI A;  2FXQ A;  2AWN A;  3OW2 A;  1I3Q H;  1VS0 A;  4HJ9 A;  4UY8 C;  1XPU A;  1WI5 A;  2PQA B;  1CKN B;  3PIO A;  2YYZ A;  3Q8D A;  4JI5 L;  1Q81 C;  1JJC B;  1BBW A;  4B3S L;  2A8V A;  3AYH B;  3J7Z C;  2JA7 H;  3M7N A;  4DV7 L;  2A1A A;  1HR0 W;  4KI0 A;  2LXK A;  1QVF A;  3PUY A;  5FLM H;  1QUQ A;  5IYC G;  4DR1 Q;  1IBM L;  2NVX H;  1TWA H;  2Q2I A;  3J81 j;  1IBK L;  4OWW B;  4GKJ L;  1SFO H;  1X3E A;  3M4Q A;  2R7D A;  4IPD A;  5LMU L;  2HIX A;  3KYH C;  3HOX G;  4RG1 A;  3RLN A;  3GTO H;  3BU2 A;  1QZH A;  4LF7 Q;  4BY1 G;  1R9T H;  2ASB A;  1X56 A;  2QEX A;  2OCE A;  5J3B A;  1VCI A;  4C3H H;  2KEN A;  4GOP A;  1XPR A;  1PH2 A;  4B3R L;  2C35 B;  5IP9 H;  4B3T L;  2PQA A;  4JI1 L;  1CKN A;  2YU9 H;  1SLJ A;  4DR4 L;  4X62 Q;  4JOI A;  4IO9 A;  2ALY B;  4HJA A;  2YTY A;  4DR3 Q;  5M3M G;  1YZ6 A;  3CCE A;  1NTG A;  1IL2 A;  2NN6 I;  5DLQ E;  4OXP A;  2V1C C;  4BY7 G;  1X6O A;  2VNU D;  1I50 H;  3F8T A;  2JA5 G;  4DK3 C;  2ZTD A;  2EXD A;  2PI2 A;  1VQK A;  2Q2U A;  3GTK H;  1XNQ L;  4J15 A;  3HOY G;  3CD6 A;  1Y1V H;  1S3O A;  5GRO A;  4A3K H;  1E24 A;  1N32 Q;  1VQ4 A;  1XNR Q;  1HNZ L;  3GTM H;  4PMW A;  5M5X H;  1HZ9 A;  2JA7 G;  5GAG C;  3CW2 C;  1VQ5 A;  4GOP C;  5FLM G;  3PF5 A;  4QL5 A;  3I55 A;  2BA0 A;  3AFP A;  1ASZ A;  1NMG A;  5JEA G;  2VQF L;  4JOI C;  1FGU A;  2VL6 A;  4IPH A;  3I7F A;  1D8L A;  4EQ5 A;  5IWA Q;  4HJ8 A;  3RN2 A;  4P74 A;  4GLV B;  3CXC A;  2B63 G;  1O7I A;  3K7U C;  3F2B A;  2IHF A;  1X9N A;  3M9B A;  5IT9 c;  2K4K A;  1FL0 A;  3I2Z A;  5GAD C;  1OTC A;  3A0J A;  3PUX A;  1P16 A;  1VQO A;  3CMA A;  2BH2 A;  4OWX B;  1VQ8 A;  1PA6 A;  5IP9 G;  1Y1W H;  5C4X H;  1YIT A;  1VQE A;  3F2D A;  5JJI A;  2CWA A;  1YJN A;  4P75 A;  2IHE A;  4L5Q A;  3E9H A;  1WFQ A;  1FJG Q;  5HY6 A;  4AYB G;  3A5U A;  4DR1 L;  1KC8 C;  4LF5 Q;  1HNW Q;  1E3P A;  3LGJ A;  5JJL A;  1LUZ A;  5IE8 A;  1WCM G;  5JJK A;  1MJC A;  1X3F A;  2LXJ A;  2NZO A;  4R1J A;  3PUW A;  5H1S E;  3W5O A;  4A3D H;  2YTX A;  2Y0S E;  4YHH L;  3I4O A;  3TEH B;  4JBM A;  1Q1E A;  1Y1V G;  2WAQ E;  1E22 A;  3A5Z B;  5GAH C;  4DV6 Q;  4LF7 L;  4OX9 L;  2F4V Q;  1M1K C;  4A4I A;  1TWC H;  1E1O A;  3OTO Q;  3CPF A;  4BBS H;  2MO0 A;  3CCV A;  2IX1 A;  2RHS B;  4A3C G;  1BVS A;  4YCW A;  5IP7 H;  4TVA B;  1SRU A;  3KF6 A;  4X62 L;  2UXD L;  1NBW A;  4DR5 Q;  4R4I A;  4YWL A;  2ZJP A;  2NVT H;  4DR3 L;  2VUM H;  3CC4 A;  2KCT A;  3S1R H;  1FVI A;  5JEA J;  2ZM6 L;  4JI6 Q;  3JC6 6;  3I4N H;  4DR6 L;  1NMF A;  2KBN A;  3HOX H;  4OO1 G;  3M4P A;  2E2I H;  1K9M C;  3NBH B;  4LFC Q;  2N78 A;  5LMN W;  4DAY B;  1L1O A;  3U50 C;  1NJI C;  3GDE A;  4KLK A;  2AHO B;  5ELO A;  3W1B A;  4A3F H;  1Y1W G;  1SMX A;  1VQM A;  1EWI A;  5AJ3 Q;  2UU9 L;  5C4X G;  1UEB A;  1YJW A;  3S24 A;  5ELN A;  1VQ6 A;  4L5T A;  1JJG A;  2OWO A;  2XTI A;  4LUZ A;  5LMN Q;  4A3M H;  2QA4 A;  4IFD I;  1YHA A;  3U4Z A;  4LFB L;  1DGS A;  4DV2 L;  1EFW A;  3BZC A;  1JJ2 A;  2VY3 A;  1S40 A;  1PH4 A;  2Z0S A;  4X66 L;  4Y7N H;  5E7N A;  2VZA A;  1MKH A;  1VQF A;  3H0G G;  2UUB L;  1KRS A;  1YBY A;  2JQO A;  2K14 A;  2N3S A;  2JA5 H;  4LF8 Q;  1VQ9 A;  1I5F A;  2WB1 G;  4GS3 A;  4BBS G;  3WWV A;  3HOY H;  1NY4 A;  4QY7 A;  1L1O C;  2JE6 I;  1AH9 A;  5IP7 G;  5FLX c;  2HHH L;  1YVC A;  4HID A;  1YI2 A;  1IXR A;  1TWH H;  4LF6 L;  3GTG H;  1TWG H;  1VQA A;  2AMC B;  1QVC A;  1LM0 A;  2MO1 A;  2JEA I;  2VUM G;  1Q1B A;  4BXX G;  5IYD G;  1TXY A;  1FJG L;  3HOU G;  3TS0 A;  4LF5 L;  4YWK A;  2H5X A;  4C3I H;  5GAE C;  2JA8 G;  3I4N G;  4DPG A;  3EIV A;  4DR7 L;  4UP7 A;  1J5E Q;  4QIW E;  3K80 C;  1EUJ A;  1HR0 Q;  4MTN A;  1IYJ B;  2B63 H;  3H3V H;  5IYB G;  2UXC Q;  4A3F G;  1VQJ A;  4R4O A;  1L2F A;  5BR8 Q;  1V1Q A;  4DV6 L;  1UWV A;  2HQL A;  1MJE A;  3PO3 G;  3B6Y A;  1K83 H;  3EBE A;  2KHI A;  4JC0 A;  1EQR A;  3HOZ G;  2RF4 A;  4A3M G;  3J80 i;  4NXN L;  4DAM A;  4APV A;  1G6P A;  1HZA A;  3I4M G;  3CCR A;  3J81 i;  4PZ7 A;  4LNQ A;  4A3L H;  1G51 A;  2EIF A;  3ULP A;  1WJJ A;  3CCU A;  4DR5 L;  3ICE A;  2UXB Q;  1Z9F A;  2GVB A;  4BA1 I;  3ERS X;  3MXN B;  1PYS B;  3ULJ A;  3KJO A;  4P71 A;  1WCM H;  2XGT A;  3L7Z C;  3GTQ H;  2GVA A;  5K36 G;  4DV0 L;  2R92 H;  3CCM A;  4LFC L;  4UP9 A;  3S16 H;  5C0X I;  1SRO A;  3T1Y Q;  1BKB A;  4LFA Q;  2PNH A;  3KDF B;  2NN6 G;  4C2M H;  5IY0 A;  5FJ8 G;  5AJ3 L;  4POG A;  4XIG S;  2R7Z G;  1K8A C;  3DLL A;  4A76 A;  1VQL A;  3PIP A;  3H15 A;  4A3C H;  1G29 1;  4AYB E;  5LMN L;  1N9W A;  3F1Z A;  1OXS C;  1KRT A;  5M5Y H;  1PYB A;  4NB3 A;  4R4C A;  1HNX Q;  2JEB I;  3RN5 A;  4JI2 Q;  3STB C;  3RZD H;  4LF9 Q;  4JYA L;  3CP0 A;  2NVQ H;  2I0Q A;  1A0I A;  4K0K L;  1VQH A;  1A63 A;  1M90 C;  3E0E A;  3UE1 A;  1VQD A;  2K5N A;  5C3E G;  1A62 A;  4LF8 L;  3UDX A;  1S72 A;  3KLW A;  3FP9 A;  3J7A 5;  2VS1 A;  2D0O A;  3A74 A;  2GN5 A;  4X65 Q;  1EOV A;  3M85 A;  3HKZ G;  1L0W A;  4Y52 H;  3EN2 A;  2MQH A;  4JBW A;  4ME3 A;  3G71 A;  2N49 A;  4A3L G;  1YNX A;  4IOA A;  1VQG A;  4YCU A;  1XMO Q;  1PHJ A;  1CKM A;  4IPG A;  4A3E G;  1IBL Q;  1VQP A;  4LUO A;  4UP8 A;  1ASY A;  4JI0 Q;  4JI3 Q;  2R92 G;  1NE3 A;  1X54 A;  2EQS A;  4AQY Q;  2VQE Q;  4R4Q A;  4YY3 Q;  1HR0 L;  1YHB A;  1OXT A;  3H0G H;  4TQU S;  4POF A;  4O2D A;  2E5L Q;  2UXC L;  4A3B H;  2AWO A;  1P8L A;  4GNX B;  4HJ7 A;  5BR8 L;  4JI5 Q;  4HIK A;  1T9H A;  2A19 A;  2F52 A;  4H02 A;  1OXX K;  4WJ4 A;  1B7Y B;  2IX0 A;  1KQS A;  4MNO A;  4ALP A;  3D31 A;  4GN4 B;  1EIF A;  1K8G A;  3CCL A;  1HZB A;  1KL9 A;  1IBK Q;  4GKJ Q;  1JB7 A;  2BH8 A;  5EAY A;  3NEM A;  5LMU Q;  4BXX H;  1AE2 A;  1CKO A;  2NZH A;  4QQB X;  5IYD H;  3HOU H;  2CWP A;  2UXB L;  2MNA A;  2JA8 H;  3CME A;  1Q8K A;  4DNI A;  2E8G A;  1UE6 A;  2WB1 E; 
#chains in the Genus database with same CATH topology
 3GTL H;  2K28 A;  2G9D A;  5KYI A;  3CAM A;  2F0M A;  1FR3 A;  3T56 B;  2XRQ D;  5LL6 S;  1J6Q A;  3NWS A;  1XNR L;  5CGK A;  2LS0 1;  2R93 H;  3BVZ A;  3I4M H;  1IKL A;  1EYA A;  2RVL A;  3KJP A;  4JBJ A;  1E1T A;  4LF9 L;  3ONA B;  2OTJ A;  1K8O A;  2JN4 A;  4ODG A;  5EKI A;  3LX0 A;  4C3I B;  4IUT A;  4A3J G;  4UAI A;  2B63 B;  4X65 L;  2LSS A;  2TMP A;  1PZK D;  2R7Z H;  1WTH A;  3M3Y H;  2PMZ E;  1XJV A;  1K83 B;  3IFT A;  2DN8 A;  2NVY H;  4GLA C;  4KY7 A;  4JI0 L;  5ELC A;  2RHQ B;  3T53 B;  2HT1 A;  1ML0 D;  3MTS A;  3KFU A;  4QJF A;  1EYG A;  2E5L L;  4A3E B;  3VYT A;  1D5X C;  1TQO A;  1HHV A;  3D6C A;  2R7F A;  4JV5 Q;  1EEF D;  2OF1 A;  5M5W H;  3PGZ A;  1XPO A;  1WD0 A;  1HA6 A;  1RD9 D;  3T4A C;  1PYW D;  3ER0 A;  5JPM C;  2WKD A;  3GD7 A;  1G2T A;  1SBB B;  3NEL A;  1C8C A;  1Z47 A;  2ID0 A;  4DXG A;  4IFD J;  1HPC A;  3HOW H;  3FEW X;  4QUF A;  4DR2 L;  2NVQ B;  1JOO A;  4DKA C;  3GO5 A;  4DV1 Q;  2EYP A;  3K8A A;  4EX5 A;  4NMZ A;  2F3I A;  2H1E A;  1TWF H;  3JAM c;  3H3V C;  3FKI G;  3MXP A;  4XQN A;  2FJ2 A;  1N36 L;  2JA9 A;  4OIJ A;  3ZJY C;  4KHP Q;  5HUR A;  1OXV A;  1T5E A;  2UU9 Q;  3T1H L;  1MSH A;  1F2Z A;  1UAP A;  3GV6 A;  2F0O A;  2F4I A;  4QMG A;  4G7Z C;  3F2C A;  4NXM Q;  4LFB Q;  4FXG C;  1H9M A;  1SE2 A;  4X64 L;  4DV2 Q;  1YEZ A;  5M3F H;  1YNN C;  1V9P A;  4JI7 Q;  2MFI A;  3PQI A;  3CPW A;  3K0X A;  2UUA L;  2PPB C;  4DN4 M;  4CBV A;  2K52 A;  3F2U A;  5C4J H;  3PF4 A;  3FPP A;  1KAA A;  1B1Z A;  4JI8 L;  4B3S Q;  4R8N A;  1L0Y B;  2QGQ A;  3GTL B;  2EYL A;  4LF6 Q;  4A93 G;  1EQQ A;  5CV8 A;  2R6G A;  1EY8 A;  4RHR A;  1QNU A;  4A3G H;  1GUW A;  5C0X J;  4AH6 A;  3JAM i;  2K5V A;  2K5Q A;  4HED A;  1D5M C;  2R93 B;  3FVQ A;  1L1O B;  3I4M B;  1II3 A;  1EYD A;  3DWA A;  1UEA B;  3SK6 A;  2NYZ D;  1N34 L;  4A3K G;  1CFM A;  1SJH D;  5IT9 E;  1MBY A;  1XMQ L;  4GN3 B;  4K0K L;  1PH1 A;  1ZYR D;  4BBR H;  4B3T Q;  4JI1 Q;  3PV0 A;  2M00 A;  2BA1 A;  1TS4 A;  4DK6 C;  3R2I A;  1JMC A;  4G4K A;  4XQQ A;  4FXK C;  2E74 C;  3A8J E;  2R7Z B;  4DV0 Q;  3PO2 H;  3TN2 A;  1VQI A;  5I2Y A;  2NVY B;  3L3O C;  2OQ0 A;  4LF4 L;  1SN8 A;  4GKK L;  2QKI C;  2DY8 A;  3EA6 A;  4JCV E;  3BG3 A;  2DGY A;  2EYO A;  4K8J A;  4DV3 L;  1PRT F;  3L2P A;  4Z9C B;  1ZEQ X;  3SGI A;  3C3L A;  1ENF A;  1H9S B;  3OYY A;  2XIW A;  2BCO A;  2IT1 A;  5M5W B;  4YIJ A;  3MHB A;  1R4Q B;  1EZ6 A;  3OW7 A;  2SEB D;  4EQO A;  2Q2H A;  5J39 A;  4K5X A;  4OON A;  2CH4 A;  2VQE L;  1YNJ D;  4ZCK A;  1VS0 A;  1XPU A;  4QCL A;  4E6I A;  4IZ8 A;  2F0S A;  4HCE A;  3Q8D A;  2OEO A;  1Q81 C;  5IOC A;  2Z9H A;  5EPJ A;  5KRU A;  1E2V A;  5DAU A;  3M7N A;  3BZD B;  4DV7 L;  3HOW B;  2MPM A;  2LMC B;  1ENC A;  4OWW B;  1TWA H;  2Q2I A;  3J80 E;  5C3X A;  2B8G A;  3M4Q A;  2FHT A;  3RLN A;  1Y69 U;  1IL8 A;  4CDE C;  4BY1 G;  2ASB A;  1X56 A;  2QEX A;  1B9M A;  1TWF B;  2OCE A;  5D3D A;  5FK9 C;  1HTL D;  2KEN A;  1XPR A;  1ET6 A;  2C35 B;  5TSS A;  4X62 Q;  4JOI A;  5K5P A;  5AFW A;  3E0J A;  5M3M G;  3CCE A;  1NTG A;  2AUJ D;  3AB9 A;  4BY7 G;  2JA5 G;  5M3F B;  3TP8 A;  1VQK A;  3GTK H;  3HOY G;  1S3O A;  2G5D A;  5GRO A;  1E24 A;  1XNR Q;  1HNZ L;  3ERQ A;  1ZXT A;  2F0J A;  4MHE A;  5FLM G;  2BA0 A;  5C4J B;  2WAQ B;  1NMG A;  1D5Z C;  4IPH A;  3I7F A;  4KY5 A;  4HJ8 A;  4P74 A;  3CXC A;  4N8F A;  3M9B A;  4XT3 B;  2K4K A;  1FL0 A;  4A3G B;  4IQZ A;  2DNE A;  3SK5 A;  1VF5 C;  2OXP A;  3HEJ A;  3F2D A;  4NDX A;  4JPB W;  4P75 A;  5I4D A;  3OIQ A;  3E9H A;  5HY6 A;  4BBR B;  5EPK A;  3FDT A;  2P5Z X;  1LUZ A;  1SMY C;  1PRT D;  1WCM G;  1CI3 M;  1ESF A;  2H4O A;  3T51 B;  1X3F A;  4R1J A;  3OOC A;  3PUW A;  5H1S E;  4CHT B;  3W5O A;  2WKC A;  4YHH L;  4JBM A;  4LF7 L;  1E22 A;  3A5Z B;  4DV6 Q;  3J7Y W;  1HRJ A;  1M1K C;  3CPF A;  1LTB D;  3CCV A;  2CW0 D;  1DZ1 A;  4A3C G;  1SRU A;  1ICW A;  1NBW A;  2NVT H;  3CC4 A;  1BXT A;  2D5D A;  2K1B A;  3S1R H;  5G3L F;  4DR6 L;  2KCN A;  1A2U A;  3JC6 6;  4CKB A;  2KBN A;  4OO1 G;  3M4P A;  2E2I H;  4ME5 A;  4LFC Q;  2N78 A;  1KDA A;  4DNR B;  4DAY B;  3IFD A;  1Q86 C;  1JCK B;  5C4X G;  1SMX A;  4Y7N B;  5AJ3 Q;  1EWH A;  1SYD A;  1VMC A;  1VQ6 A;  2AUK A;  4L5T A;  1JJG A;  4LUZ A;  3MFY A;  1EFW A;  1V1P B;  3BZC A;  1JJ2 A;  2VY3 A;  3KUP A;  1X3P A;  4KV6 A;  3NK9 A;  1GUG A;  2EOT A;  2VZA A;  3H0G G;  1VQF A;  4C1N I;  1KRS A;  1YBY A;  1TWA B;  1VQ9 A;  4BBS G;  1RTN A;  1L1O C;  5IP7 G;  2AQ3 B;  2EYJ A;  1GUT A;  4V19 0;  5IIF A;  4RKL A;  1TWG H;  2AMC B;  1LM0 A;  2F0I A;  2JEA I;  1GOZ A;  2Q8T A;  3NSW A;  5I2X A;  1V1P A;  4RGO S;  4RA8 A;  4QIW E;  5DM7 3;  1IYJ B;  1Q8I A;  4H7B A;  3H3V H;  5IYB G;  5F2D A;  1U4L A;  1TY0 A;  4JW0 A;  4JC0 A;  3HOZ G;  4A3M G;  5E1F A;  3GTK B;  1G6P A;  3CCR A;  1XX8 A;  4PZ7 A;  4LNQ A;  3NTI A;  1G51 A;  1SNC A;  2TSS A;  4M8A A;  5FLX E;  1G2S A;  3Q24 A;  2GVB A;  2SNS A;  3ULJ A;  3MXN B;  3KJO A;  2EYH A;  4RCN A;  3CRK C;  3GTQ H;  3R8B A;  1IW7 D;  1JB3 A;  4UP9 A;  1A3T A;  1HCZ A;  1JWM D;  1BKB A;  3T16 A;  5IY0 A;  3KDF B;  2NN6 G;  3T1Y Q;  5IGC A;  2D9U A;  2A73 B;  3CHB D;  5KND A;  4X3T A;  5LMN L;  1G6Z A;  5M5Y H;  5ISR A;  4PQX A;  2B2U C;  1VMP A;  3VA7 A;  3RZD H;  3H09 A;  2I07 B;  4JI2 Q;  1A0I A;  5G3L D;  3E0E A;  1GHK A;  3ITP A;  5LL6 X;  3KLW A;  3NTK A;  2K7V A;  2VS1 A;  4HN7 A;  2MQH A;  1AW7 A;  2WB1 B;  1PHJ A;  4IPG A;  1VQP A;  3I4L A;  4LUO A;  1ASY A;  3J7A V;  2R92 G;  1X54 A;  4AQY Q;  2VQE Q;  4R4Q A;  2NVT B;  1YHB A;  1OXT A;  4TQU S;  5BN3 A;  3I8Z A;  4KKU A;  3S1R B;  5FO8 B;  3DUZ A;  5BR8 L;  2N88 A;  1KDB A;  1T9H A;  2F52 A;  4H02 A;  2E2I B;  4WJ4 A;  1A2T A;  2IX0 A;  4ALP A;  1EIF A;  2MGS A;  2NZH A;  3HOU H;  3JAM L;  4DNI A;  1UE6 A;  3S17 H;  4NKL A;  2PMZ B;  2F0L A;  4NPS A;  1PH6 A;  4H0L C;  3PO3 H;  1GVP A;  1N32 L;  1Q12 A;  3DMU A;  4OIK A;  2XN9 C;  3P75 A;  2B8F A;  5CYU A;  1T5X D;  4R8I A;  4X6A H;  3BVM A;  5A2Q E;  1ZYR C;  3J7A F;  2XRS D;  1YIJ A;  4RMF A;  5IWA L;  5T1I A;  1TWG B;  2I5H A;  2WAC A;  5FKA C;  5K36 H;  1PH8 A;  4B08 A;  2CQA A;  2PZU A;  2E76 C;  2YTV A;  1PH5 A;  3TQY A;  2L11 A;  1HNZ Q;  1GD7 A;  4IOC A;  1N33 Q;  5FJ8 H;  3TRZ A;  1TR5 A;  3S15 H;  1GM5 A;  1XTD A;  2ZTC A;  4PZ6 A;  2IJ0 A;  2CKZ B;  3MXU A;  1HNW L;  1FNU A;  1A6X A;  3FKI H;  3FHW A;  1B8A A;  2RKS A;  4AYB B;  4MN3 A;  2QDL A;  4KMU C;  4XTC S;  4C3J G;  1FYC A;  1S5F D;  2QIL A;  3CC7 A;  3GTQ B;  1I6H H;  3I70 A;  1NR4 A;  1WOC A;  1YNJ C;  4RFB A;  1CSQ A;  3KOJ A;  4KD3 A;  2K03 A;  3OIP A;  4A3E H;  2JA6 G;  4JI4 Q;  2K50 A;  4YHH Q;  1X65 A;  4G7O C;  5HGQ A;  4WJ3 M;  1QWY A;  2I5L X;  5M5Y B;  1RF2 D;  1EZ8 A;  1SDF A;  4B9W A;  2O4X A;  1PXU A;  2IPK D;  1A8V A;  5IGB A;  4A93 H;  4HMJ A;  3MEF A;  1C0A A;  3KLS A;  4ZLT F;  4DR6 Q;  1DON A;  3E3X A;  2M9V A;  2R61 A;  4P72 A;  2F0D A;  1EIH A;  2LFN A;  3SEB A;  4DV5 Q;  1NUC A;  1JWU D;  1SYB A;  1PTO F;  3HP3 A;  4LUV A;  3PUZ A;  2BE5 D;  1I4R A;  4DV4 L;  3KLR A;  3DM3 A;  1X55 A;  1XYI A;  2J4X A;  3A55 A;  1X3Q A;  1X3G A;  3UE0 A;  2L0C A;  4DUZ Q;  2A68 D;  2UUC Q;  3ULL A;  4O0A A;  3RNU A;  3HOU B;  3QG1 A;  3QIA A;  1CUK A;  1OXU A;  3R2T A;  1C9O A;  2F3W A;  4ZKC B;  3S17 B;  5KGU A;  1VQC A;  2RQX A;  2K01 A;  1PH3 A;  3GP7 A;  4IJH A;  4DUY L;  1RIP A;  2DUD A;  5CBA E;  2Z6B A;  2ZXR A;  4L6T B;  3K7A H;  2RCF A;  4F87 A;  2D2C C;  4CJ0 B;  4XQJ A;  1I94 L;  1H9K A;  4DU9 A;  1BBU A;  4I7A A;  3S1N H;  1SE3 A;  2EY5 A;  3AEV A;  4IPC A;  1PRT C;  4OO1 I;  1LTI D;  1W6K A;  5EBD A;  4EQN A;  4J1M A;  1IYV A;  4A3B G;  1HTP A;  1UE7 A;  1XTC D;  2B2Y C;  2VW9 A;  3S15 B;  2CW0 C;  1FD7 D;  2KA7 A;  2F0F A;  3CCQ A;  2KCC A;  2Y0S G;  4BY1 H;  4N9P A;  2F0E A;  1TU2 B;  1GUS A;  3W2D A;  3FKI B;  3K58 A;  4WJW A;  1WTX A;  3J80 c;  1QUQ B;  4XYO A;  4B3M L;  3HOV H;  2PZW A;  3RR5 A;  2VQF Q;  2RCN A;  5C0X H;  5M3M H;  2JJQ A;  2Z6K C;  1I6H B;  1U5K A;  3S14 H;  4IJL A;  4A3D G;  4RKB A;  1TS2 A;  4BY7 H;  2PQE A;  4YY3 L;  1KHI A;  2AWN A;  3OW2 A;  4UY8 C;  2PQA B;  2PCF B;  3K5N A;  1BBW A;  3L9A X;  1PTO D;  5JJZ A;  2A8V A;  3J7Z C;  2EY6 A;  1HR0 W;  3PMF A;  4KTA A;  2ZT9 C;  5FLM H;  1QUQ A;  1EOT A;  1IBM L;  1SFO H;  2R7D A;  4IPD A;  3J81 E;  2HIX A;  3CU7 A;  3KYH C;  3HOX G;  1CZG A;  4A93 B;  2RA4 A;  1C4Q A;  1EY9 A;  4RGT A;  5J3B A;  3D6W A;  2CHB D;  2EVB A;  4RGN A;  4B3R L;  1I50 B;  1TS5 A;  2PQA A;  1GHJ A;  4ZRZ A;  2YU9 H;  1SLJ A;  4DR4 L;  1KLU D;  2ALY B;  3E6Z X;  4A3K B;  1YZ6 A;  2NN6 I;  1G91 A;  2FMC A;  3F8T A;  1DXM A;  2EXD A;  2PI2 A;  2Q2U A;  1XNQ L;  4J15 A;  1EWC A;  4ABN A;  2NWG A;  1N32 Q;  3R3O A;  2K04 A;  3I72 A;  4KJO A;  3GTM H;  4PMW A;  1HZ9 A;  1IW7 C;  1K0S A;  3PF5 A;  2V4D A;  5EBC A;  4C3I G;  2B2T C;  2WII B;  4EQ5 A;  5IWA Q;  4FNF A;  3DEP A;  2B63 G;  3K7U C;  3F2B A;  1X9N A;  5CV4 A;  4OO1 H;  1CHP D;  2DJF C;  1OTC A;  4C3H G;  3A0J A;  3PUX A;  1P16 A;  1STB A;  3K7A B;  5IP9 G;  4RHS A;  5C4X H;  5C3W A;  1YIT A;  4FO2 A;  1EL0 A;  4K5V A;  2CWA A;  3C1F A;  1YJN A;  3S1N B;  3SXH A;  2AQ1 B;  4DR1 L;  4L63 B;  1QNK A;  3GQB A;  1HNW Q;  2ZXO A;  3D4D A;  1MJC A;  2LXJ A;  3U9O A;  4DGZ A;  2Y0S E;  1Q1E A;  3QWN A;  4OX9 L;  4A4I A;  1TWC H;  1E1O A;  3TP6 A;  1IHZ A;  4BBS H;  2RDF A;  4ZAI A;  2RHS B;  4UHV A;  4QUC A;  5A35 A;  2EPB A;  1LT4 D;  5IP7 H;  4BY1 B;  2F0N A;  4DAV A;  1KTK A;  3OSO A;  3T13 A;  2UXD L;  1J9O A;  4DR5 Q;  4R4I A;  4YWL A;  4PNY A;  2ZJP A;  4DR3 L;  2KCT A;  2KJX A;  2ZM6 L;  3ERO A;  2EJM A;  3MZ5 A;  1NMF A;  5DEH A;  3HOV B;  2BOS A;  3AMU A;  1PDQ A;  1L1O A;  4KKT A;  5M3M B;  4KLK A;  1Y1W G;  3S14 B;  4FF4 A;  2XWJ B;  1YJW A;  4BY7 B;  2WV6 D;  2JA5 B;  2L5T A;  3QO2 A;  2XTI A;  5FO7 B;  3MA2 B;  2QA4 A;  4A3M H;  1PTO B;  1YHA A;  1WTV A;  1I4X A;  3HOY B;  1DGS A;  4L8J A;  3Q22 A;  1LO5 D;  2SDF A;  1PH4 A;  4X66 L;  4Y7N H;  3OWE B;  1ILQ A;  1UNS A;  2N3S A;  1K8M A;  1NCV A;  1SFO B;  4LF8 Q;  1RTO A;  1I5F A;  4KKS A;  1MGS A;  1Y8O B;  2NN6 H;  5FLX c;  2HHH L;  1QB5 D;  1GXD C;  3SR1 A;  4HID A;  1TWH H;  2EE1 A;  3FPU B;  1VQA A;  1OO9 B;  1QVC A;  2QEJ C;  5CR3 A;  2VUM G;  1Q1B A;  3SHL A;  5IYD G;  2GA4 B;  1FJG L;  4KN4 C;  4LF5 L;  3I4N G;  2H5X A;  4DPG A;  3M7G A;  2YU9 B;  3I3C A;  4DR7 L;  1H9S A;  1EUJ A;  1HR0 Q;  1EQT A;  3HS0 C;  1SYC A;  1MJE A;  2O5J C;  3B6Y A;  1JQY D;  2KHI A;  4FXD A;  5BN5 A;  4NXN L;  1SXT A;  2L12 A;  1HZA A;  2OT2 A;  3I4M G;  2X69 A;  3K0Y A;  4WRD A;  2B2U A;  4JK1 C;  3ULP A;  5JPN C;  1EQV A;  2WIN B;  3GTM B;  5E4W C;  2UXB Q;  2Q8I B;  4OEM B;  2XGT A;  2F3V A;  1H9R A;  2R92 H;  1IYU A;  5DM6 3;  3D8G A;  3S16 H;  4DAP A;  4OHJ A;  1JOK A;  1DCZ A;  2PNH A;  4C2M H;  1AZQ A;  2KOL A;  3OMC A;  2R7Z G;  3DLL A;  3FMC A;  3PIP A;  3H94 A;  3H15 A;  2K6A A;  3HRZ C;  4DK1 A;  5C4X B;  5KEE A;  3SK4 A;  4R4C A;  2NTS A;  5IGD A;  2JEB I;  2MJ8 A;  3H6M A;  3RN5 A;  1O7L A;  1RHP A;  4LF9 Q;  1CZW A;  1A63 A;  3K57 A;  2K5N A;  3DXJ C;  4M1U B;  3UDX A;  1S72 A;  4X65 Q;  1EOV A;  3HKZ G;  3EN2 A;  1Z6H A;  1B3Q A;  1TWC B;  3RMH A;  4BBS B;  2ICI A;  4IOA A;  2BE5 C;  4N8X 1;  3K5L A;  4IUV A;  4JI0 Q;  4YY3 Q;  3JAM E;  2E5L Q;  1LT6 D;  1U4M A;  2UXC L;  2AWO A;  4HJ7 A;  1BR9 A;  4WFN 3;  2A19 A;  1CHQ D;  1B7Y B;  3OHX C;  2A6E D;  3NHH A;  4MNO A;  1B2T A;  1CT1 D;  1K8G A;  2JYO A;  1KL9 A;  3TBI B;  1JB7 A;  2BH8 A;  2HCC A;  1RDP D;  4BXX H;  1S5B D;  1AE2 A;  4QQB X;  1UUP A;  3WOE A;  3VYU A;  1I6V C;  4A3M B;  2MNA A;  2JA8 H;  1U9R A;  1ONL A;  1Q8K A;  2E8G A;  1TS3 A;  3S2H H;  3TP5 A;  3MVV A;  5CBE E;  5JVG 3;  2Z8L A;  3D0F A;  4DR2 Q;  2IWH A;  2HCI A;  4CDF C;  2B29 A;  1SE8 A;  1H95 A;  4DR4 Q;  4U68 A;  5M3F G;  3L0O A;  3P1H A;  4PG3 A;  3CCS A;  1N36 Q;  3NP8 A;  2NUC A;  1JOR A;  1TWH B;  1VQB A;  3NTH A;  1HNX L;  2JA6 H;  3C1E A;  2L9H A;  1XNQ Q;  1WD1 A;  2L15 A;  3T1H Q;  1PFS A;  1K3R A;  4DAY A;  5D3I B;  2ZTE A;  4X64 Q;  3EJI A;  1D6E C;  4HIO A;  2D62 A;  4GNX C;  4G57 A;  1XMO L;  1C7Y A;  4BA2 I;  3DM1 A;  5E4X A;  1IBL L;  1U0L A;  1SEB D;  4IUQ A;  1IZ6 A;  2K5H A;  1PFB A;  4JI3 L;  3VYR A;  1TII D;  2NB0 A;  1K0R A;  4GOP B;  2UUA Q;  4BBR G;  3TS2 A;  5C3E H;  4JI8 Q;  1D1K A;  3CC2 A;  2R92 B;  1DOM A;  3K59 A;  3AU7 A;  2X6G A;  3NUC A;  3UDI A;  4A75 A;  3S16 B;  1CQF A;  4JG2 A;  4MIU A;  4C2M B;  1W2B A;  3HFZ B;  3CQZ H;  3PO2 G;  1PTO C;  3MEH A;  1O78 A;  3G7L A;  1N34 Q;  1F9P A;  4OX9 Q;  3S1M H;  1XMQ Q;  4K0K Q;  1WTP A;  1JOQ A;  3HKZ E;  1A3V A;  3K6O A;  5C4H A;  2M2L A;  3M4Y A;  3STB D;  4FF3 A;  3PUV A;  3J80 L;  2UXD Q;  4UDU C;  4FVM A;  2DJG C;  2ZM6 Q;  3PCO B;  1PRT B;  3RZO H;  2AQ2 B;  3AFQ A;  3MXN A;  4LF4 Q;  4GKK Q;  1U4R A;  5JOB A;  3RLO A;  1WTQ A;  1BBX C;  1B3A A;  1BNZ A;  1YNN D;  4GN5 A;  4R4T A;  3KDF A;  1GUO A;  4DV3 Q;  2I5M X;  1O80 A;  3C2P A;  4GLX A;  1PH7 A;  4AIM A;  1WVL A;  1PLF A;  5KNB A;  1KXL A;  2E2H H;  4X66 Q;  5J1Z A;  3PIP 3;  2AKW B;  5NUC A;  4X3S A;  1CQV A;  2OQK A;  5FOB B;  1LTL A;  4ILW A;  1M4V A;  2B39 A;  2JA8 B;  1S5D D;  3I56 A;  2HHH Q;  1EY5 A;  4A3J H;  1QZG A;  3KF6 B;  4JV5 L;  4DV7 Q;  1PFN A;  5L37 A;  2OTL A;  3S2H B;  4ZQ3 A;  2L55 A;  2B2Y A;  4DK0 A;  1PVO A;  1HQR D;  4DR7 Q;  4CJ1 B;  3S9W A;  1ZKO A;  2ZXP A;  2ES2 A;  4A3I G;  1BDO A;  1TT2 A;  2Q2T A;  1EIY B;  2K75 A;  3WOF A;  2JA6 B;  3M4O H;  2E2J H;  4P73 A;  1SYE A;  1STE A;  4NXN Q;  1SAP A;  1LT3 D;  1BCP F;  5I9P A;  4DV1 L;  5CMD A;  2Z6K A;  1Q46 A;  1Y8N B;  4YCV A;  1S5E D;  1MSG A;  3K5M A;  1KAW A;  4B9X A;  5C4Z A;  2B2W C;  1W6J A;  4KHP L;  2ENB A;  1YHQ A;  3URY A;  5FO9 B;  4MZ9 A;  5C44 G;  3Q0A A;  3UDG A;  1KD1 C;  1LTR D;  1GO3 E;  1YJ9 A;  3J81 c;  2YV5 A;  4DNT B;  4NXM L;  4HTH A;  5CC4 A;  5C3E B;  3CCJ A;  1E2W A;  1HFG A;  1Y14 B;  4JI7 L;  1CM9 A;  1S4Z A;  2BDN A;  2JSO A;  3CQZ B;  1F9Q A;  3RUZ A;  2FXQ A;  2NTT A;  4HJ9 A;  4WOR A;  2K33 A;  4U67 3;  1CKN B;  1CA5 A;  4JI5 L;  2NBF A;  2F0Q A;  1JJC B;  4LK1 C;  4B3S L;  3AYH B;  4XYQ A;  5BN4 A;  3S1M B;  3SDZ A;  3LWE A;  4KI0 A;  3O13 A;  1QVF A;  1L0X B;  2F0K A;  5IYC G;  2EYM A;  1HFN A;  2NVX H;  1IBK L;  5JAV A;  3GTO H;  3IAY A;  3BU2 A;  1QZH A;  2RDH A;  4LF7 Q;  2EJG C;  4ZK9 B;  1STN A;  2I46 A;  4RAU C;  3VYS A;  4C3H H;  3RZO B;  4CKC A;  5IP9 H;  4B3T L;  4JI1 L;  1CKN A;  2B2T A;  4IO9 A;  3QJY A;  2YTY A;  3MFG A;  1I4G A;  1IL2 A;  5DLQ E;  4OXP A;  1X6O A;  1I50 H;  2FFK B;  3X3N A;  2E2H B;  1JWS D;  1I4Q A;  3CD6 A;  1LTG D;  4A3K H;  1XXG A;  4HSV A;  1SE4 A;  2JA7 G;  3CW2 C;  4P2C B;  4GOP C;  5FLX L;  4IUR A;  1EY0 A;  3TDQ A;  2MP1 A;  4EQP A;  1ASZ A;  5JEA G;  1BCP D;  2RSO A;  4K8I A;  4A3J B;  1FGU A;  1HUN A;  3D3R A;  1VF7 A;  1D8L A;  3RN2 A;  1LTS D;  5IT9 c;  3I2Z A;  2C5C A;  1Q90 A;  5GAD C;  4O1N A;  1VQO A;  3CMA A;  2SOB A;  5C5L A;  3NXW A;  4OWX B;  1VQ8 A;  1Y1W H;  2FIN B;  1IKM A;  3WDN A;  3MXG A;  5JJI A;  2IHE A;  1WFQ A;  4AYB G;  3A5U A;  1KC8 C;  3M4O B;  2E2J B;  1E3P A;  2A74 C;  5IE8 A;  1X32 A;  4ZUI A;  5KNC A;  2YTX A;  1F9R A;  3I4O A;  1Y1V G;  2MHV A;  4PV1 C;  5GAH C;  1MI2 A;  1D1I A;  3MWY W;  1EU4 A;  1V1O A;  3W3A A;  2B2V C;  4BWG B;  3MAQ A;  2A69 D;  4X62 L;  2CH4 W;  2BDO A;  3Q23 A;  2VUM H;  2QDB A;  5IGF A;  1FVI A;  3VA5 A;  3I4N H;  2A6E C;  1K9M C;  3EVQ A;  3NBH B;  1EYC A;  3E5S A;  3U50 C;  2AHO B;  5EKK A;  4ZKB B;  2OWO A;  5LMN Q;  2EY1 A;  3BVG A;  1EFI D;  3U4Z A;  1MD2 D;  4NW2 A;  2Z0S A;  4LJZ C;  2F0G A;  5COR A;  1NNX A;  4C1N K;  1MKH A;  2UUB L;  2NVX B;  3HG9 A;  2JQO A;  2JA5 H;  4LMQ D;  3BDL A;  3NBH A;  1PTO H;  4GZY C;  2KVM A;  1NY4 A;  3HOY H;  3GTO B;  3SE0 A;  1EY6 A;  2L4N A;  1Q3L A;  1AH9 A;  1SYF A;  4K6L A;  1YI2 A;  1IXR A;  4KK7 A;  3GTG H;  4C3H B;  2MO1 A;  1HXY D;  5A2Q L;  3DHQ A;  2LKV A;  1PZJ D;  1F2Y A;  4Q0F A;  3HOU G;  4YWK A;  5GAE C;  5CV9 A;  1AP0 A;  1AEX A;  1SND A;  1TVX A;  5IOD A;  1M8A A;  1LTT D;  4A3F G;  1VQJ A;  5BR8 Q;  4IUN A;  4DV6 L;  1DD2 A;  3PO3 G;  3EBE A;  1EQR A;  1F9S A;  3J80 i;  3P7J A;  1QOH A;  2Z4I A;  3BYT B;  1STG A;  1WJJ A;  3CRL C;  3CCU A;  1Z9F A;  1BCP B;  4BA1 I;  1K3B C;  1WCM H;  1QG7 A;  3L7Z C;  5K36 G;  3C46 A;  3CCM A;  4LFC L;  1SRO A;  1QJO A;  1SNQ A;  5FJ8 G;  3VR5 A;  5AJ3 L;  1EY7 A;  3TSS A;  4POG A;  4A76 A;  3DWQ A;  4A3C H;  1G29 1;  2J7Z A;  4AYB E;  2IL8 A;  2KED A;  1Y1W B;  1KRT A;  3A8K E;  1LV9 A;  4PMC A;  1PYB A;  4C56 C;  3V2T A;  3STB C;  1NR2 A;  2IX3 A;  3CP0 A;  1SYG A;  4JYA L;  1VQH A;  1M90 C;  1ENA A;  3SVM A;  1A62 A;  2C9O A;  2JP1 A;  1HQM C;  2HD3 A;  3FP9 A;  3J7A 5;  2D0O A;  2GN5 A;  3M85 A;  4KD4 A;  2EYF A;  1L0W A;  4Y52 H;  4JBW A;  3BDO A;  3G71 A;  4A3L G;  4K2K A;  2VB3 X;  1VQG A;  4YCU A;  1CKM A;  4A3E G;  3MC0 B;  1LT5 D;  4OL7 A;  1NE3 A;  2EQS A;  3H0G H;  5D65 A;  4O2D A;  2VUM B;  4GNX B;  3I4N B;  3CKI B;  1VDZ A;  4RCO A;  4JI5 Q;  4HIK A;  4S3S A;  3N6R A;  4H13 C;  3QB3 A;  4GN4 B;  2A6H D;  4KN7 C;  1HZB A;  1IBK Q;  3KK7 A;  1CKO A;  2F1M A;  5E3F A;  1STH A;  2CWP A;  1KLG D;  4K5W A;  3KLS X;  1F2L A;  4DFA A;  1RKN A;  4JVZ A;  5IYB H;  1Q7Y C;  4RH6 A;  3HKS A;  3T1Y L;  3N52 A;  4GNX A;  3NQI A;  2K5W A;  4K14 A;  2KUM A;  4KHZ A;  4HJ5 A;  2HDL A;  4QIW B;  3HOZ H;  1J8I A;  4YWM A;  3CF5 A;  2F03 A;  1PMR A;  2L1B A;  4F8M A;  3U9S A;  1WYD A;  1NAP A;  3M3Y B;  3GTG B;  4IFD G;  4JI2 L;  5HGT A;  3G48 A;  1TY2 A;  4KY6 A;  3VR2 A;  1D7Q A;  4I65 A;  1JT8 A;  4DV4 Q;  1EIG A;  1AE3 A;  2F0T A;  1JE5 A;  2N55 A;  1RL2 A;  1B4O A;  4BS9 A;  1PH9 A;  1QIL A;  4CKE A;  2PNR C;  1BOS A;  4F7X A;  3K81 C;  3IRB A;  4PMB A;  3G6E A;  3GV3 A;  3UDF A;  4QGU A;  4KHV A;  3HKZ B;  1UE5 A;  4UPA A;  3TZU A;  4L5R C;  1B50 A;  1K28 A;  1PZI D;  2D0P A;  4AQY L;  2PW7 A;  3S2D H;  2F4V L;  1B70 B;  1I4H A;  1WCM B;  3OTO L;  1E7Z A;  4CDD C;  1WTW A;  2ZJQ A;  2N8N A;  3BZK A;  4ULL A;  2R93 G;  5C6A A;  3R93 A;  2CCZ A;  1B9N A;  4DUY Q;  4OWT B;  3TRE A;  2E2D C;  1HH2 P;  3E9I A;  4JI6 L;  1B53 A;  4HIM A;  5IGE A;  1I94 Q;  3I90 A;  3G4S A;  1HZC A;  1W3S A;  2XWB B;  5CV6 A;  5EJW A;  2WFW A;  2O2L D;  3VDY A;  2KCM A;  1UE1 A;  3HOV G;  2KHS A;  1KNE A;  2CFM A;  3RLF A;  5C0X G;  2HIV A;  3J81 L;  1HJP A;  2JK8 A;  3GTJ H;  4O42 A;  1VQ7 A;  1V8Q A;  1GKH A;  1LYL A;  2K32 A;  4A3I H;  1LTA D;  3A56 A;  1MIU A;  3GTP H;  3QR8 A;  3EFX D;  4L5S A;  2PI2 E;  2RDG A;  1VQN A;  1PV4 A;  1N33 L;  3H0G B;  4B3M Q;  4FDB A;  3K5O A;  3H3V I;  3UI2 A;  1N8R C;  3G6J B;  1Q82 C;  2UUB Q;  3HGB A;  1AFP A;  1J5E L;  2IY5 B;  3HOW G;  4KJN A;  3SK8 A;  3W1G A;  1BCP C;  1K73 C;  1CSP A;  1F77 A;  1JR0 D;  2A68 C;  5C44 H;  4PZ8 A;  2LY7 A;  2HUG A;  4OGQ C;  4IUU A;  3U4V A;  1NSN S;  1G8Z D;  2WP8 J;  1SNM A;  1IBM Q;  3NEN A;  4Q5V A;  3X3M A;  2KHJ A;  2B2W A;  3U58 A;  1BF4 A;  2SNM A;  3HOZ B;  4JBK A;  5I6W A;  2EY2 A;  3ND9 A;  4JI4 L;  1KIX A;  1QVG A;  5EGT A;  4B3R Q;  3EQL C;  1AN8 A;  4LFA L;  4C3J H;  3PO2 B;  3NWT A;  4TKO B;  3VR4 A;  1GUN A;  2J0T D;  1LAC A;  2ATW A;  2ZJR A;  2EDG A;  5IGG A;  4N9T A;  1WTR A;  5IYC H;  4DF7 A;  3H91 A;  3KF8 B;  3VR3 A;  4EGV A;  3QOJ A;  3PSI A;  2NZ1 D;  5KYL A;  2A69 C;  4DV5 L;  4ZUJ A;  5IT9 L;  2RSN A;  5GQO A;  2WAQ G;  4MTK A;  1O7Z A;  5COY A;  1E0B A;  3Q6S A;  5EPL A;  2B3G A;  4LWC A;  3BJU A;  1DM0 B;  3S2D B;  1SR3 A;  3BS1 A;  1O7Y A;  3S1Q H;  4A3G G;  2XNA C;  1V43 A;  2FMM A;  2VXW A;  4LW1 A;  4DUZ L;  2IW3 A;  4JYA Q;  1SJE D;  4DXF A;  3V05 A;  2UUC L;  3KF8 A;  2CQO A;  3AQQ A;  2KQ3 A;  1I3Q H;  1WI5 A;  4R9W A;  3PIO A;  2YYZ A;  1PFM A;  2F0V A;  2XSC A;  1GJX A;  2JA7 H;  1Z7T A;  2A1A A;  2LXK A;  3QOL A;  3PUY A;  4DR1 Q;  2PO4 A;  3J81 j;  1QE6 A;  4GKJ L;  1X3E A;  5JEA H;  5LMU L;  4XT1 B;  4RG1 A;  4G7H C;  1MHW C;  3NE5 B;  4J8Q A;  1FNW A;  1SNO A;  1STA A;  1R9T H;  3GTJ B;  3D4R A;  1VCI A;  1CTM A;  1XWE A;  3A7A B;  4GOP A;  2PZT A;  1PH2 A;  4A3I B;  1B44 D;  5C5M A;  1F2M A;  3NQT A;  3GTP B;  2F0P A;  2G9H D;  5M9O A;  4HJA A;  4DR3 Q;  4CGY B;  1TKW B;  1KNA A;  1WTO A;  3P20 A;  3LNN A;  5LHY 1;  2V1C C;  1AZP A;  2VNU D;  1I4P A;  2MUY A;  4DK3 C;  2ZTD A;  3V96 A;  1HA5 A;  3OPO A;  1Y1V H;  4IN3 A;  1VQ4 A;  2QCP X;  5DNF A;  5M5X H;  5GAG C;  1VQ5 A;  1DYQ A;  4EVO A;  4QL5 A;  1ILP A;  4DA2 A;  3I55 A;  3AFP A;  1ESR A;  2VQF L;  5C44 B;  1BQQ T;  4JOI C;  2VL6 A;  4QF4 A;  4A3B H;  3BDC A;  4GLV B;  1O7I A;  2IHF A;  3BYY B;  4FP5 D;  2XVS A;  3ND8 A;  2BH2 A;  4F88 A;  2B2V A;  1PA6 A;  3TP7 A;  2EXZ A;  1VQE A;  1CA6 A;  3KBG A;  4L5Q A;  4HMI A;  1FJG Q;  4C3J B;  4LF5 Q;  1SNP A;  4FF1 A;  5ELE A;  3LGJ A;  3I73 A;  5JJL A;  5JJK A;  3NPP A;  2NZO A;  3D4W A;  5J22 A;  2CVR A;  1DJR D;  4A3D H;  3TEH B;  2WAQ E;  2F4V Q;  2PYK A;  2K5D A;  1C48 A;  3LWU A;  3OTO Q;  1HUM A;  2MO0 A;  2IX1 A;  4FYD A;  1BVS A;  4YCW A;  1RCV D;  4RGM A;  3A54 A;  4CJ2 C;  4TVA B;  2VB2 X;  3KF6 A;  1D2B A;  5I6Y A;  3TZD A;  2QW7 A;  4JI6 Q;  5JEA J;  3HOX H;  2R3Z A;  4TRD A;  3S1Q B;  2A6H C;  2Z4H A;  5LMN W;  2KEE A;  1STY A;  1NJI C;  1JC7 A;  4J6H A;  3GDE A;  3W1B A;  5ELO A;  4A3F H;  1VQM A;  1EWI A;  2UU9 L;  1UEB A;  2F0W A;  5KIX A;  1ET9 A;  3S24 A;  5ELN A;  1I3Q B;  4IFD I;  3VR6 A;  2RBM A;  4LAA A;  5JVH 3;  4LFB L;  5EKL A;  1Y8P B;  4DV2 L;  1S40 A;  4OEL B;  2JA7 B;  5E7N A;  1RJT A;  4HR7 B;  2K14 A;  2O5I C;  3IL8 A;  2WB1 G;  4GS3 A;  3WWV A;  4I7Z C;  4QY7 A;  3FRP B;  2JE6 I;  1R9T B;  2PW5 A;  3TME A;  1YVC A;  5I9O A;  4LF6 L;  4HCS A;  4BXX G;  2KEC A;  1TXY A;  4RWS C;  3TS0 A;  4X3K A;  1EU3 A;  4C3I H;  2JA8 G;  3EIV A;  5ELB A;  4UP7 A;  1QCB D;  1J5E Q;  1ROD A;  3K80 C;  3ZYY X;  4MTN A;  4IUP A;  2B63 H;  2UXC Q;  1LLR D;  1SSO A;  4R4O A;  5EQ0 A;  1L2F A;  1V1Q A;  1UWV A;  2HQL A;  3KBX A;  5CV5 A;  1K83 H;  1R4P B;  2Z1C A;  2RF4 A;  4DAM A;  4X3U A;  4APV A;  4FF2 A;  2F0H A;  3J81 i;  1Y1V B;  1JE4 A;  4A3L H;  2EIF A;  3PIO 3;  3NBI A;  1U4P A;  4DR5 L;  5M5X B;  3ICE A;  4XDX A;  3ERS X;  1PYS B;  4P71 A;  4CDC C;  2EJF C;  2GVA A;  1DOL A;  3RD4 A;  4DV0 L;  3DWP A;  1LAB A;  1A15 A;  5C0X I;  5ELF A;  4A3B B;  4LFA Q;  3RZD B;  1BUV T;  1E2Z A;  4TSS A;  4XIG S;  1K8A C;  1VQL A;  2X6L A;  1CK1 A;  2Y0S B;  4QB4 A;  1N9W A;  3F1Z A;  1OXS C;  2E75 C;  1DOK A;  4HSP A;  3OWF A;  4NB3 A;  1EY4 A;  2HDM A;  1ICF B;  1HNX Q;  3A7L A;  1BO0 A;  3DEO A;  2I0Q A;  2NVQ H;  1KAB A;  3UE1 A;  1VQD A;  5C3E G;  4LF8 L;  2HQE A;  2ICE C;  1SMY D;  3A74 A;  4HAE A;  4A3D B;  5ELD A;  4V0B A;  4ME3 A;  2N49 A;  1YNX A;  1H9J A;  1JIC A;  1XMO Q;  1KDC A;  1FGB D;  1IBL Q;  4UP8 A;  2Q8R E;  1A3U A;  4JI3 Q;  4K2L A;  1HR0 L;  4IFD H;  5D14 A;  4POF A;  1P8L A;  3A8I E;  5CV7 A;  5T1G A;  4XXE A;  3HOX B;  1FNV A;  1OXX K;  3I91 A;  4ZYS A;  2QF7 A;  1KQS A;  2F0U A;  4NP5 A;  2K05 A;  3D31 A;  2DY7 A;  1EEI D;  4A3F B;  4ID6 A;  4H44 C;  3CCL A;  4GKJ Q;  1S5C D;  3PO3 B;  5EAY A;  3NEM A;  3HZX A;  5LMU Q;  3IKJ A;  2EZV A;  2A5H A;  4K6D A;  5IYD H;  2JXM B;  4IAL A;  2UXB L;  2DNC A;  3CME A;  3OMG A;  2WB1 E; 
#chains in the Genus database with same CATH homology
 3GTL H;  3S17 H;  3S2H H;  5IYB H;  1Q7Y C;  3CAM A;  4NPS A;  3D0F A;  4DR2 Q;  3HKS A;  3T1Y L;  1PH6 A;  3PO3 H;  1GVP A;  1J6Q A;  4GNX A;  1Q12 A;  2B29 A;  1SE8 A;  1XNR L;  4DR4 Q;  1N32 L;  1H95 A;  4HJ5 A;  4KHZ A;  3HOZ H;  2R93 H;  5M3F G;  4YWM A;  3L0O A;  3CF5 A;  3I4M H;  4PG3 A;  3CCS A;  4X6A H;  3KJP A;  1N36 Q;  1WYD A;  4JBJ A;  1E1T A;  1VQB A;  1YIJ A;  4RMF A;  5IWA L;  1HNX L;  2I5H A;  2JA6 H;  4JI2 L;  4IFD G;  4LF9 L;  3G48 A;  2OTJ A;  1PH8 A;  1XNQ Q;  2L15 A;  2YTV A;  3T1H Q;  1PH5 A;  3TQY A;  1D7Q A;  1JT8 A;  1PFS A;  4DV4 Q;  1K3R A;  4A3J G;  1HNZ Q;  1GD7 A;  4IOC A;  1AE3 A;  1N33 Q;  1JE5 A;  1RL2 A;  4X65 L;  2LSS A;  5FJ8 H;  3TRZ A;  2ZTE A;  4X64 Q;  1PH9 A;  2R7Z H;  1GM5 A;  3S15 H;  3M3Y H;  1XTD A;  4HIO A;  2D62 A;  2PMZ E;  2ZTC A;  4GNX C;  4PZ6 A;  1XJV A;  3K81 C;  3IRB A;  3G6E A;  2NVY H;  2CKZ B;  4GLA C;  1XMO L;  1C7Y A;  3UDF A;  4QGU A;  1IBL L;  4BA2 I;  1U0L A;  1HNW L;  4JI0 L;  1IZ6 A;  2K5H A;  3FKI H;  1UE5 A;  4UPA A;  2RHQ B;  4JI3 L;  3FHW A;  4L5R C;  2HT1 A;  1B8A A;  4AQY L;  1K0R A;  2D0P A;  4QJF A;  1EYG A;  3KFU A;  4GOP B;  2UUA Q;  2E5L L;  3S2D H;  2F4V L;  1B70 B;  4XTC S;  4BBR G;  3TS2 A;  5C3E H;  4JI8 Q;  3CC2 A;  3CC7 A;  3OTO L;  1E7Z A;  2R7F A;  2ZJQ A;  2N8N A;  4JV5 Q;  3BZK A;  2R93 G;  4A75 A;  1I6H H;  3UDI A;  5M5W H;  1WOC A;  4JG2 A;  1CSQ A;  3KOJ A;  3PGZ A;  1XPO A;  1W2B A;  3HFZ B;  2CCZ A;  3CQZ H;  4DUY Q;  4OWT B;  3TRE A;  4A3E H;  3PO2 G;  3ER0 A;  1HH2 P;  3E9I A;  4JI4 Q;  4HIM A;  4JI6 L;  2JA6 G;  2K50 A;  3GD7 A;  1X65 A;  4YHH Q;  1I94 Q;  5HGQ A;  4WJ3 M;  3NEL A;  2I5L X;  3G4S A;  1N34 Q;  1HZC A;  1Z47 A;  2ID0 A;  1W3S A;  4OX9 Q;  3S1M H;  4IFD J;  3HOW H;  1XMQ Q;  4K0K Q;  2WFW A;  3HKZ E;  4DR2 L;  3VDY A;  4DKA C;  2KCM A;  3STB D;  3GO5 A;  1UE1 A;  3HOV G;  3PUV A;  4DV1 Q;  1A8V A;  2UXD Q;  2CFM A;  3K8A A;  4EX5 A;  4A93 H;  3RLF A;  5C0X G;  2HIV A;  1HJP A;  2JK8 A;  2F3I A;  3MEF A;  1C0A A;  3GTJ H;  2ZM6 Q;  1TWF H;  3JAM c;  1VQ7 A;  4DR6 Q;  3FKI G;  3PCO B;  1N36 L;  2JA9 A;  1GKH A;  4P72 A;  1LYL A;  3RZO H;  3ZJY C;  4KHP Q;  4DV5 Q;  4A3I H;  1OXV A;  3AFQ A;  4LF4 Q;  4GKK Q;  1MIU A;  3GTP H;  3RLO A;  2UU9 Q;  3T1H L;  4LUV A;  3PUZ A;  4L5S A;  2PI2 E;  4DV4 L;  1VQN A;  3DM3 A;  4GN5 A;  1X55 A;  4R4T A;  1PV4 A;  3KDF A;  4B3M Q;  1N33 L;  4FDB A;  4DV3 Q;  3F2C A;  3H3V I;  4NXM Q;  4LFB Q;  2I5M X;  4X64 L;  4DV2 Q;  1YEZ A;  1X3G A;  3UE0 A;  1N8R C;  5M3F H;  4GLX A;  1PH7 A;  4AIM A;  1KXL A;  4DUZ Q;  2E2H H;  4X66 Q;  1Q82 C;  1V9P A;  4JI7 Q;  2MFI A;  2UUC Q;  2AKW B;  2UUB Q;  1J5E L;  2IY5 B;  3CPW A;  3ULL A;  4O0A A;  3RNU A;  3HOW G;  2OQK A;  3K0X A;  3W1G A;  1LTL A;  2UUA L;  2K52 A;  1K73 C;  1CUK A;  1CSP A;  1OXU A;  5C4J H;  3PF4 A;  4JI8 L;  3I56 A;  1C9O A;  5C44 H;  2HHH Q;  4PZ8 A;  4A3J H;  2QGQ A;  3KF6 B;  1QZG A;  4B3S Q;  4DV7 Q;  4JV5 L;  4LF6 Q;  3U4V A;  2OTL A;  4A93 G;  2WP8 J;  1VQC A;  1EQQ A;  1IBM Q;  2R6G A;  3NEN A;  1PH3 A;  1PVO A;  2KHJ A;  4A3G H;  4IJH A;  5C0X J;  4DR7 Q;  4DUY L;  3U58 A;  4AH6 A;  1RIP A;  2DUD A;  2K5V A;  3JAM i;  4JBK A;  2ES2 A;  4A3I G;  3K7A H;  1L1O B;  4JI4 L;  1KIX A;  1I94 L;  1QVG A;  1N34 L;  4A3K G;  2Q2T A;  1BBU A;  3S1N H;  4B3R Q;  1XMQ L;  2K75 A;  1EIY B;  3AEV A;  4GN3 B;  4IPC A;  1PH1 A;  4C3J H;  4BBR H;  4LFA L;  4B3T Q;  3M4O H;  2E2J H;  4P73 A;  4JI1 Q;  4NXN Q;  3PV0 A;  2BA1 A;  4OO1 I;  2ATW A;  4DV1 L;  2ZJR A;  2Z6K A;  1Q46 A;  4DK6 C;  4YCV A;  1Q86 C;  1JMC A;  5IYC H;  4A3B G;  1UE7 A;  2VW9 A;  3KF8 B;  1KAW A;  4DV0 Q;  3PO2 H;  1VQI A;  3PSI A;  3CCQ A;  4KHP L;  4DV5 L;  2OQ0 A;  2Y0S G;  4BY1 H;  4LF4 L;  1SN8 A;  4GKK L;  5GQO A;  1YHQ A;  2WAQ G;  5C44 G;  4MZ9 A;  3UDG A;  1KD1 C;  2B3G A;  4JCV E;  1GO3 E;  3J80 c;  4LWC A;  1YJ9 A;  1QUQ B;  3BJU A;  3J81 c;  4B3M L;  1SR3 A;  2YV5 A;  2DGY A;  3RR5 A;  4DV3 L;  4NXM L;  3HOV H;  3L2P A;  2VQF Q;  3S1Q H;  4A3G G;  3CCJ A;  2RCN A;  3SGI A;  1V43 A;  1Y14 B;  2JJQ A;  3OYY A;  2Z6K C;  4LW1 A;  5M3M H;  4DUZ L;  2IT1 A;  4JYA Q;  1U5K A;  3S14 H;  4IJL A;  4A3D G;  4JI7 L;  2UUC L;  2CQO A;  2Q2H A;  3AQQ A;  4OON A;  4BY7 H;  2VQE L;  4YY3 L;  1KHI A;  2FXQ A;  2AWN A;  3OW2 A;  1I3Q H;  1VS0 A;  4HJ9 A;  4UY8 C;  1XPU A;  1WI5 A;  2PQA B;  1CKN B;  3PIO A;  2YYZ A;  3Q8D A;  4JI5 L;  1Q81 C;  1JJC B;  1BBW A;  4B3S L;  2A8V A;  3AYH B;  3J7Z C;  2JA7 H;  3M7N A;  4DV7 L;  2A1A A;  1HR0 W;  4KI0 A;  2LXK A;  1QVF A;  3PUY A;  5FLM H;  1QUQ A;  5IYC G;  4DR1 Q;  1IBM L;  2NVX H;  1TWA H;  2Q2I A;  3J81 j;  1IBK L;  4OWW B;  4GKJ L;  1SFO H;  1X3E A;  3M4Q A;  2R7D A;  4IPD A;  5LMU L;  2HIX A;  3KYH C;  3HOX G;  4RG1 A;  3RLN A;  3GTO H;  3BU2 A;  1QZH A;  4LF7 Q;  4BY1 G;  1R9T H;  2ASB A;  1X56 A;  2QEX A;  2OCE A;  5J3B A;  1VCI A;  4C3H H;  2KEN A;  4GOP A;  1XPR A;  1PH2 A;  4B3R L;  2C35 B;  5IP9 H;  4B3T L;  2PQA A;  4JI1 L;  1CKN A;  2YU9 H;  1SLJ A;  4DR4 L;  4X62 Q;  4JOI A;  4IO9 A;  2ALY B;  4HJA A;  2YTY A;  4DR3 Q;  5M3M G;  1YZ6 A;  3CCE A;  1NTG A;  1IL2 A;  2NN6 I;  5DLQ E;  4OXP A;  2V1C C;  4BY7 G;  1X6O A;  2VNU D;  1I50 H;  3F8T A;  2JA5 G;  4DK3 C;  2ZTD A;  2EXD A;  2PI2 A;  1VQK A;  2Q2U A;  3GTK H;  1XNQ L;  4J15 A;  3HOY G;  3CD6 A;  1Y1V H;  1S3O A;  5GRO A;  4A3K H;  1E24 A;  1N32 Q;  1VQ4 A;  1XNR Q;  1HNZ L;  3GTM H;  4PMW A;  5M5X H;  1HZ9 A;  2JA7 G;  5GAG C;  3CW2 C;  1VQ5 A;  4GOP C;  5FLM G;  3PF5 A;  4QL5 A;  3I55 A;  2BA0 A;  3AFP A;  1ASZ A;  1NMG A;  5JEA G;  2VQF L;  4JOI C;  1FGU A;  2VL6 A;  4IPH A;  3I7F A;  1D8L A;  4EQ5 A;  5IWA Q;  4HJ8 A;  3RN2 A;  4P74 A;  4GLV B;  3CXC A;  2B63 G;  1O7I A;  3K7U C;  3F2B A;  2IHF A;  1X9N A;  3M9B A;  5IT9 c;  2K4K A;  1FL0 A;  3I2Z A;  5GAD C;  1OTC A;  3A0J A;  3PUX A;  1P16 A;  1VQO A;  3CMA A;  2BH2 A;  4OWX B;  1VQ8 A;  1PA6 A;  5IP9 G;  1Y1W H;  5C4X H;  1YIT A;  1VQE A;  3F2D A;  5JJI A;  2CWA A;  1YJN A;  4P75 A;  2IHE A;  4L5Q A;  3E9H A;  1WFQ A;  1FJG Q;  5HY6 A;  4AYB G;  3A5U A;  4DR1 L;  1KC8 C;  4LF5 Q;  1HNW Q;  1E3P A;  3LGJ A;  5JJL A;  1LUZ A;  5IE8 A;  1WCM G;  5JJK A;  1MJC A;  1X3F A;  2LXJ A;  2NZO A;  4R1J A;  3PUW A;  5H1S E;  3W5O A;  4A3D H;  2YTX A;  2Y0S E;  4YHH L;  3I4O A;  3TEH B;  4JBM A;  1Q1E A;  1Y1V G;  2WAQ E;  1E22 A;  3A5Z B;  5GAH C;  4DV6 Q;  4LF7 L;  4OX9 L;  2F4V Q;  1M1K C;  4A4I A;  1TWC H;  1E1O A;  3OTO Q;  3CPF A;  4BBS H;  2MO0 A;  3CCV A;  2IX1 A;  2RHS B;  4A3C G;  1BVS A;  4YCW A;  5IP7 H;  4TVA B;  1SRU A;  3KF6 A;  4X62 L;  2UXD L;  1NBW A;  4DR5 Q;  4R4I A;  4YWL A;  2ZJP A;  2NVT H;  4DR3 L;  2VUM H;  3CC4 A;  2KCT A;  3S1R H;  1FVI A;  5JEA J;  2ZM6 L;  4JI6 Q;  3JC6 6;  3I4N H;  4DR6 L;  1NMF A;  2KBN A;  3HOX H;  4OO1 G;  3M4P A;  2E2I H;  1K9M C;  3NBH B;  4LFC Q;  2N78 A;  5LMN W;  4DAY B;  1L1O A;  3U50 C;  1NJI C;  3GDE A;  4KLK A;  2AHO B;  5ELO A;  3W1B A;  4A3F H;  1Y1W G;  1SMX A;  1VQM A;  1EWI A;  5AJ3 Q;  2UU9 L;  5C4X G;  1UEB A;  1YJW A;  3S24 A;  5ELN A;  1VQ6 A;  4L5T A;  1JJG A;  2OWO A;  2XTI A;  4LUZ A;  5LMN Q;  4A3M H;  2QA4 A;  4IFD I;  1YHA A;  3U4Z A;  4LFB L;  1DGS A;  4DV2 L;  1EFW A;  3BZC A;  1JJ2 A;  2VY3 A;  1S40 A;  1PH4 A;  2Z0S A;  4X66 L;  4Y7N H;  5E7N A;  2VZA A;  1MKH A;  1VQF A;  3H0G G;  2UUB L;  1KRS A;  1YBY A;  2JQO A;  2K14 A;  2N3S A;  2JA5 H;  4LF8 Q;  1VQ9 A;  1I5F A;  2WB1 G;  4GS3 A;  4BBS G;  3WWV A;  3HOY H;  1NY4 A;  4QY7 A;  1L1O C;  2JE6 I;  1AH9 A;  5IP7 G;  5FLX c;  2HHH L;  1YVC A;  4HID A;  1YI2 A;  1IXR A;  1TWH H;  4LF6 L;  3GTG H;  1TWG H;  1VQA A;  2AMC B;  1QVC A;  1LM0 A;  2MO1 A;  2JEA I;  2VUM G;  1Q1B A;  4BXX G;  5IYD G;  1TXY A;  1FJG L;  3HOU G;  3TS0 A;  4LF5 L;  4YWK A;  2H5X A;  4C3I H;  5GAE C;  2JA8 G;  3I4N G;  4DPG A;  3EIV A;  4DR7 L;  4UP7 A;  1J5E Q;  4QIW E;  3K80 C;  1EUJ A;  1HR0 Q;  4MTN A;  1IYJ B;  2B63 H;  3H3V H;  5IYB G;  2UXC Q;  4A3F G;  1VQJ A;  4R4O A;  1L2F A;  5BR8 Q;  1V1Q A;  4DV6 L;  1UWV A;  2HQL A;  1MJE A;  3PO3 G;  3B6Y A;  1K83 H;  3EBE A;  2KHI A;  4JC0 A;  1EQR A;  3HOZ G;  2RF4 A;  4A3M G;  3J80 i;  4NXN L;  4DAM A;  4APV A;  1G6P A;  1HZA A;  3I4M G;  3CCR A;  3J81 i;  4PZ7 A;  4LNQ A;  4A3L H;  1G51 A;  2EIF A;  3ULP A;  1WJJ A;  3CCU A;  4DR5 L;  3ICE A;  2UXB Q;  1Z9F A;  2GVB A;  4BA1 I;  3ERS X;  3MXN B;  1PYS B;  3ULJ A;  3KJO A;  4P71 A;  1WCM H;  2XGT A;  3L7Z C;  3GTQ H;  2GVA A;  5K36 G;  4DV0 L;  2R92 H;  3CCM A;  4LFC L;  4UP9 A;  3S16 H;  5C0X I;  1SRO A;  3T1Y Q;  1BKB A;  4LFA Q;  2PNH A;  3KDF B;  2NN6 G;  4C2M H;  5IY0 A;  5FJ8 G;  5AJ3 L;  4POG A;  4XIG S;  2R7Z G;  1K8A C;  3DLL A;  4A76 A;  1VQL A;  3PIP A;  3H15 A;  4A3C H;  1G29 1;  4AYB E;  5LMN L;  1N9W A;  3F1Z A;  1OXS C;  1KRT A;  5M5Y H;  1PYB A;  4NB3 A;  4R4C A;  1HNX Q;  2JEB I;  3RN5 A;  4JI2 Q;  3STB C;  3RZD H;  4LF9 Q;  4JYA L;  3CP0 A;  2NVQ H;  2I0Q A;  1A0I A;  4K0K L;  1VQH A;  1A63 A;  1M90 C;  3E0E A;  3UE1 A;  1VQD A;  2K5N A;  5C3E G;  1A62 A;  4LF8 L;  3UDX A;  1S72 A;  3KLW A;  3FP9 A;  3J7A 5;  2VS1 A;  2D0O A;  3A74 A;  2GN5 A;  4X65 Q;  1EOV A;  3M85 A;  3HKZ G;  1L0W A;  4Y52 H;  3EN2 A;  2MQH A;  4JBW A;  4ME3 A;  3G71 A;  2N49 A;  4A3L G;  1YNX A;  4IOA A;  1VQG A;  4YCU A;  1XMO Q;  1PHJ A;  1CKM A;  4IPG A;  4A3E G;  1IBL Q;  1VQP A;  4LUO A;  4UP8 A;  1ASY A;  4JI0 Q;  4JI3 Q;  2R92 G;  1NE3 A;  1X54 A;  2EQS A;  4AQY Q;  2VQE Q;  4R4Q A;  4YY3 Q;  1HR0 L;  1YHB A;  1OXT A;  3H0G H;  4TQU S;  4POF A;  4O2D A;  2E5L Q;  2UXC L;  4A3B H;  2AWO A;  1P8L A;  4GNX B;  4HJ7 A;  5BR8 L;  4JI5 Q;  4HIK A;  1T9H A;  2A19 A;  2F52 A;  4H02 A;  1OXX K;  4WJ4 A;  1B7Y B;  2IX0 A;  1KQS A;  4MNO A;  4ALP A;  3D31 A;  4GN4 B;  1EIF A;  1K8G A;  3CCL A;  1HZB A;  1KL9 A;  1IBK Q;  4GKJ Q;  1JB7 A;  2BH8 A;  5EAY A;  3NEM A;  5LMU Q;  4BXX H;  1AE2 A;  1CKO A;  2NZH A;  4QQB X;  5IYD H;  3HOU H;  2CWP A;  2UXB L;  2MNA A;  2JA8 H;  3CME A;  1Q8K A;  4DNI A;  2E8G A;  1UE6 A;  2WB1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...