4GKJQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gkjQ00
1PH3A 2MNAA 3HOVG 3PCOB 4DK3C 3T1HQ 3MEFA 5M3MG 4LF4L 4DV7Q 4LF7L 5IP9H 4IOAA 1Y14B 1A0IA 4L5TA 1I94Q 1PH8A 1A63A 3K7UC 4JOIC 4A3EH 4A3BG 3MXNB 1YJWA 4DR6Q 1YNXA 5IWAQ 1HNWQ 3RZDH 2B3GA 5HY6A 2WAQE 3KYHC 1IBKQ 3U4ZA 3ULJA 2YV5A 1YHAA 4QQBX 2CWAA 2AWOA 1ASYA 3S16H 4DR3L 1TWAH 4OWTB 2N3SA 5LMUQ 4GN4B 4DUYQ 3T1HL 1YIJA 1K8AC 3I4MG 2PQAB 2KCTA 1N34L 4QL5A 1YBYA 3HOWG 1VQ8A 1GM5A 4DR7Q 3HKSA 3CF5A 1WYDA 1VQNA 3PSIA 4IJLA 1PH5A 1EQQA 4A3DG 3K8AA 4GOPB 1NMFA 5IWAL 5FLXc 1E3PA 3I55A 1PA6A 1HNWL 4DAYB 4HJ7A 1HR0L 1AH9A 3CXCA 4DR2Q 5C0XJ 4JI0Q 2HHHQ 5LMUL 4DUYL 1R9TH 3H3VI 1HJPA 1Q1BA 5BR8Q 1D7QA 1VQPA 1YI2A 2HIXA 3UDIA 1L1OB 3GTGH 5C4JH 1P8LA 1Q1EA 4AH6A 3CP0A 2UUCQ 1MJCA 1E24A 2VQFQ 1NTGA 1QZGA 4DUZQ 4PZ6A 4HIOA 1WI5A 3OTOQ 1C7YA 4NXNQ 4XTCS 4A93G 1YZ6A 3H0GH 5IYBH 4X62L 3HOZG 4B3ML 2K52A 1Z9FA 5K36G 1NBWA 1EIFA 3KFUA 1IXRA 4JG2A 3W1BA 3CCMA 3AFPA 1KD1C 4LF5Q 5FLMG 1VQLA 5IE8A 2YTVA 1I94L 1QZHA 4BBRH 2HQLA 1EWIA 4APVA 2K75A 4A75A 3GO5A 4A3MH 2OTLA 3K0XA 4A3LH 3TS2A 4GLXA 2AMCB 3HOXG 4B3MQ 4X64Q 1IBKL 4DV3L 3PUWA 2R93G 5IYDG 2XGTA 4JI5Q 2RF4A 2Z6KC 2E5LL 3TREA 1S3OA 3M4OH 1L0WA 1YVCA 5JEAG 2ZTEA 5ELNA 2ATWA 2IHEA 3PV0A 2E2JH 2R7FA 1M1KC 3PO3G 3S15H 4DR7L 1X3EA 1JMCA 1PFSA 3RR5A 4YWKA 3UDXA 3J81i 1PV4A 2PI2E 1FJGL 3UDFA 5IP9G 2JA8H 4DV2L 3H3VH 4JI7Q 4JI8Q 2JA6G 4A76A 4LF9L 4X64L 2GVAA 1HR0Q 3J7A5 4DV3Q 3TQYA 5M5XH 3RN5A 4A3JH 4EX5A 1VQBA 1YJNA 1Q7YC 2UXCL 1SE8A 2YTYA 3S17H 1PHJA 4LF7Q 3W1GA 1UWVA 2UUAQ 1V43A 1TWHH 1AE3A 4AYBE 2VQEQ 1SLJA 4POFA 4DUZL 2I5LX 4DV1Q 1CSPA 2N49A 2ZTDA 4A3EG 1EFWA 4JI7L 4JI8L 1UE5A 1LUZA 4WJ3M 1HZCA 4YCVA 3HOUG 2KHIA 4IFDJ 1L1OC 1XMOQ 1WCMG 4JI6Q 1FGUA 4LW1A 4R4OA 4JI3Q 4JI1L 1X6OA 2GVBA 4X66Q 1K73C 4JBMA 2UUAL 1SMXA 3F8TA 3GTJH 4DV0Q 4LF5L 4BBSH 3KOJA 4BY7G 1Q81C 1Y1VG 4DV1L 3NBHB 5AJ3L 3PUVA 4H02A 4A3KG 1IBLQ 4A3DH 1U0LA 2HT1A 4R1JA 2NN6I 4BXXG 2F4VQ 3KJOA 1N32L 1BVSA 3CCLA 1XMOL 2R7DA 3CCQA 2R6GA 4BY1H 3PF5A 2E5LQ 4JI3L 1K83H 5IYCG 1K8GA 2RHQB 2A1AA 1TWCH 1TXYA 1KQSA 4UP8A 1HNXQ 2I0QA 3CAMA 3S1RH 4OX9Q 5LMNL 2D0PA 4DV6Q 3JAMc 3RNUA 4LFBQ 4TQUS 1VQ4A 3RLOA 5C3EH 4ALPA 3CCUA 1NMGA 4B3SQ 2EIFA 4EQ5A 2PNHA 4OWWB 2JA9A 3GTLH 3HOZH 1VQGA 4AYBG 4OO1G 3A5UA 2K5VA 2K4KA 4JCVE 2EQSA 5C0XI 2N78A 1E1OA 1UE6A 1W2BA 4A3FH 4IJHA 2DGYA 2D62A 4A3FG 1KRTA 4A3IG 1S40A 5FJ8H 3WWVA 1KXLA 1L2FA 1KAWA 2JA8G 3PIPA 4O0AA 4PMWA 2CFMA 3D31A 3Q8DA 1Y1WG 1A8VA 3NENA 4C3IH 3RLNA 3G71A 3E0EA 2K5HA 4GLVB 5C4XG 2WB1E 5JJLA 2Y0SE 3PO2H 3F2DA 4K0KL 3ICEA 5IY0A 3STBD 1FJGQ 1P16A 2L15A 3ULPA 4L5QA 3RLFA 4GNXB 4IPDA 1B7YB 2KBNA 1Z47A 2QGQA 4WJ4A 3CCJA 1VQKA 2UUBL 4DNIA 4AQYL 3M4QA 1SN8A 2KHJA 1GD7A 1YHQA 3LGJA 5FLMH 1GVPA 2CKZB 1HZBA 1BBUA 1EYGA 1HNXL 3GTMH 4R4CA 2YU9H 4LFAQ 4YWLA 1OXTA 4DV6L 1VQDA 4LWCA 3CPWA 3S2HH 1HNZQ 2AHOB 3HOVH 5GQOA 3CD6A 1KRSA 3F2BA 4MTNA 4B3SL 4JI6L 4JBKA 4GKKQ 1JJGA 1YEZA 2KENA 3L7ZC 1OXUA 5BR8L 5M5WH 1UE1A 3W5OA 4X66L 4IPCA 2QEXA 4R4QA 4A3CH 3I7FA 4DV0L 4PZ7A 4QY7A 1HH2P 4LF8Q 2K5NA 2KCMA 2BH2A 3OTOL 3CC4A 3GTQH 1SR3A 2BA0A 3HOWH 1XMQL 1M90C 4GLAC 2Q2UA 1QUQA 1MJEA 2IT1A 3IRBA 4JBWA 3KDFB 4A3JG 1IBMQ 4OXPA 2D0OA 1XNRL 5M3MH 2JA7H 2WB1G 4OWXB 1QVCA 1TWFH 2R92H 4JV5L 4IPHA 1IL2A 5C3EG 2UXBQ 1FL0A 4P71A 1JJCB 4P74A 4NXML 3TS0A 4LF8L 4OX9L 4JOIA 1I5FA 1TWGH 1IYJB 3ERSX 2E8GA 4DR1L 4HIKA 4DV5Q 3K80C 3U50C 3NEMA 4GN5A 4LUZA 3CCEA 4IO9A 3RN2A 2UUBQ 1XNQQ 4A3GH 3FHWA 3S14H 1PH7A 4JI5L 3S1QH 5C0XG 4GN3B 5M3FG 5FJ8G 1NY4A 2BH8A 2AKWB 4MNOA 2OQ0A 5GROA 3M85A 4KLKA 4UP9A 4GKJL 1PH9A 3A74A 4JI2Q 1JE5A 2OWOA 2B63G 4OO1I 4A3KH 3E9IA 2Y0SG 2F3IA 1PH6A 4YWMA 4DV2Q 3PO3H 4DR1Q 1CKNA 2JE6I 1D8LA 1Q12A 1I6HH 2ES2A 4LF6L 2UXCQ 3I4OA 1J6QA 4DR5Q 1JB7A 4GKKL 3AFQA 1X3GA 2IX1A 3M7NA 2CQOA 4YHHL 1EUJA 5GADC 2R7ZG 3K7AH 5H1SE 1HR0W 2VQEL 2GN5A 3CMEA 1X56A 4K0KQ 1KHIA 1K0RA 2MQHA 3SGIA 5C4XH 3PO2G 1VQJA 1PH4A 2NN6G 4PG3A 1Q82C 1VQ9A 1QUQB 4L5RC 3I4NH 1XMQQ 2VZAA 3F2CA 4AQYQ 5HGQA 2K14A 2ZM6Q 2OTJA 1W3SA 3UDGA 2N8NA 1OXSC 4JBJA 3UE1A 2WFWA 1NE3A 2YYZA 4BA1I 5JJIA 1XPUA 3F1ZA 5DLQE 1QVGA 3EBEA 4LFAL 4R4TA 2E2IH 3STBC 4C2MH 4DKAC 3OW2A 1IBLL 3M9BA 1HNZL 3JAMi 3PUXA 1N32Q 3J7ZC 5IP7H 1BKBA 3PIOA 1XNQL 4BXXH 1UE7A 2YTXA 4HIMA 1J5EL 2OQKA 1VQ6A 2PMZE 1N33L 3BU2A 2UXDL 3G4SA 5E7NA 1CKOA 2R92G 4GKJQ 2ID0A 1VQOA 2VY3A 2RHSB 2JA6H 2AWNA 3KF6A 2Z0SA 3KLWA 4HJ9A 3JC66 1VQ5A 1QVFA 1VQIA 3BZKA 1GO3E 1IBML 4LFBL 1V9PA 2DUDA 1BBWA 2JEBI 2LXJA 3FP9A 4GNXC 1XNRQ 3RZOH 4UPAA 2JK8A 3DLLA 2WP8J 3VDYA 1B8AA 2IHFA 1LM0A 4DR5L 3KF8B 3ER0A 3B6YA 1VS0A 4YHHQ 1Y1VH 4QIWE 2QA4A 4A3BH 2NVYH 1K9MC 2JJQA 3DM3A 1HZ9A 3S1NH 1RL2A 4RG1A 5LMNW 4BA2I 2B63H 4UP7A 4NPSA 1YHBA 4DV5L 1S72A 1RIPA 1O7IA 1A62A 1WJJA 2LSSA 3KJPA 1L1OA 2ZM6L 5IYCH 1YITA 2WAQG 1LYLA 1EQRA 1SROA 5J3BA 3CC7A 3EIVA 4A3LG 2RCNA 4NB3A 5ELOA 4KHPL 2Z6KA 2VUMH 1X65A 1VQCA 3ULLA 4JI2L 3BJUA 4HJAA 3CC2A 3H0GG 2H5XA 4XIGS 1SRUA 1Q46A 4DR4Q 2NVXH 3S2DH 1IZ6A 1XPRA 1XTDA 1DGSA 2C35B 4QJFA 3GD7A 4LF6Q 2Q2IA 4Y52H 4JI0L 3HKZE 1Q86C 4BBRG 2BA1A 3CQZH 3J80i 2JA5H 3AQQA 1PYSB 2LXKA 4HIDA 5GAEC 2Q2TA 5C44G 3S1MH 1E1TA 4RMFA 4P73A 4AIMA 3M4PA 4A4IA 4C3HH 1H95A 4LFCL 2CWPA 2FXQA 2HIVA 3BZCA 5EAYA 1N9WA 4YCUA 3G48A 1U5KA 2ZJPA 1CUKA 1MIUA 1WFQA 2XTIA 1YJ9A 1JJ2A 2VS1A 1K3RA 3PUZA 3U4VA 4TVAB 4DV4L 2MFIA 3CCRA 4IPGA 1N8RC 1PH2A 5JJKA 4JC0A 4YY3L 1B70B 2UU9Q 1X9NA 4YCWA 1LTLA 3I56A 1CKNB 4R4IA 1VCIA 2MO1A 1Y1WH 1N36Q 4LFCQ 3GTKH 4BBSG 4Y7NH 3K81C 2E2HH 2PI2A 3CPFA 4GOPC 1EOVA 5IP7G 2I5MX 3T1YQ 2V1CC 4JV5Q 1N33Q 2JA7G 2UXBL 2UXDQ 2Q2HA 3HOUH 4LUVA 4NXMQ 1Q8KA 1PVOA 4DV4Q 1E22A 5GAHC 3FKIG 4LF9Q 3A0JA 3GDEA 2ASBA 4P75A 4LNQA 3L2PA 2ZTCA 1VQHA 1WCMH 3A5ZB 4HJ8A 3FKIH 1KC8C 3T1YL 2JEAI 4DR6L 4IFDG 4B3RQ 1XPOA 3H15A 2NVTH 4A93H 4A3GG 1G51A 2VW9A 2I5HA 1V1QA 1PH1A 1KIXA 2CCZA 4BY7H 4A3CG 3S24A 1NJIC 1JT8A 1I50H 1VQAA 5GAGC 2ZJQA 1UEBA 2VL6A 2IY5B 4J15A 4X65Q 2K50A 4BY1G 1CSQA 4KI0A 2F52A 4B3TL 3I4MH 4JI4L 5JEAJ 4A3MG 3HKZG 3PUYA 1X3FA 3I2ZA 3CCVA 1OTCA 3CW2C 4X6AH 4DPGA 2ZJRA 3TRZA 4GOPA 2HHHL 4A3IH 4KHPQ 3TEHB 3UE0A 4LF4Q 4DK6C 4JI1Q 2B29A 1PYBA 2A8VA 1G291 2VUMG 2VNUD 4LUOA 4JYAQ 1ASZA 2VQFL 4X65L 1KL9A 4QGUA 4L5SA 4DR4L 3NELA 4YY3Q 4IOCA 1MKHA 4ME3A 5AJ3Q 1E7ZA 5C44H 4HJ5A 1C0AA 4MZ9A 2NZHA 3G6EA 1C9OA 2EXDA 1N36L 1EIYB 1FVIA 4B3TQ 4UY8C 1VQFA 4X62Q 2F4VL 1AE2A 4PZ8A 4DR3Q 4FDBA 4KHZA 3KF6B 1VQMA 3J80c 1N34Q 3M3YH 3HFZB 3KDFA 2ALYB 2JA5G 1OXXK 4JYAL 3CMAA 4OONA 1VQEA 5IYBG 3AEVA 5LMNQ 2NVQH 5M3FH 1HZAA 3HOXH 1X55A 2IX0A 4GNXA 3E9HA 1CKMA 1WOCA 1G6PA 2NZOA 2MO0A 4DR2L 1T9HA 4B3RL 1J5EQ 5IYDH 3J81c 3U58A 3GTPH 4POGA 2R7ZH 4O2DA 4P72A 1OXVA 4GS3A 3OYYA 2PQAA 3J81j 3D0FA 5IT9c 3AYHB 1VQ7A 2UUCL 4DV7L 2OCEA 3CCSA 3HOYH 3I4NG 1GKHA 3GTOH 5M5YH 2UU9L 4IFDI 3PGZA 3EN2A 4DAMA 3L0OA 4NXNL 1XJVA 3HOYG 2R93H 2JQOA 4C3JH 1SFOH 4JI4Q 1I3QH 3ZJYC 2A19A 3PF4A 1X54A
chains in the Genus database with same CATH superfamily
3HOVG 3PO2B 3T1HQ 1S5FD 1Y14B 4DA2A 5E4WC 4JOIC 1LTGD 2F0OA 2BDNA 3HS0C 1HNWQ 3P1HA 1GHKA 4J6HA 5ISRA 3DMUA 3ULJA 2AWOA 1K8AC 2N3SA 4DUYQ 3NSWA 2MHVA 2PW5A 1YBYA 4DR7Q 2BOSA 1VQNA 2AQ3B 3A7AB 1E2ZA 4H7BA 4DK0A 3K8AA 4TSSA 5IWAL 1F2MA 3QO2A 4H44C 1BQQT 1HR0L 4DR2Q 5IGBA 1R9TH 1WTHA 2HIXA 3TZDA 3UDIA 1STGA 2EPBA 1H9SA 1SYGA 2FHTA 3HOXB 1MJCA 3NTKA 1E24A 1EFID 4ZAIA 4PZ6A 2KUMA 1ET6A 1RJTA 1C7YA 4PNYA 1EY4A 3H0GH 2KECA 1EWCA 1NBWA 4A3DB 1HHVA 1EIFA 3W1BA 1L0YB 5FLMG 4QB4A 1MI2A 3VR5A 5IE8A 1I94L 4MHEA 1EWIA 3IFDA 5C3WA 4A75A 2OTLA 1I4GA 4A3LH 3K5LA 4CJ2C 5DM63 4B3MQ 5CGKA 4DV3L 3PUWA 5IYDG 3NHHA 3TREA 4RHRA 3M4OH 1YVCA 2V4DA 3KUPA 2ATWA 3PV0A 3S15H 2R7FA 3PO3G 1ESRA 1B3AA 1TT2A 1PV4A 5IP9G 1EYCA 1U4PA 4JI8Q 4QF4A 3J7A5 5A2QE 2WKDA 1SAPA 2UXCL 1KNEA 1Q7YC 1JOQA 2RQXA 3S17H 3LWUA 1ILQA 2CW0C 3W1GA 1UWVA 5EPJA 1CT1D 1V43A 1SLJA 1HUMA 5EKIA 1JWMD 2I5LX 4DV1Q 4A3EG 4JI7L 1UE5A 2N55A 2DJGC 2BE5C 2KHIA 2WV6D 1WCMG 4X3TA 4JI6Q 1FGUA 4LK1C 4R4OA 4JI1L 1K73C 4X66Q 3F8TA 4LF5L 4BBSH 2NZ1D 1Q81C 1Y1VG 3PUVA 5L37A 3KJOA 1CA5A 3PF5A 1K8GA 1CHPD 1VF5C 1TWCH 1RKNA 1TXYA 1R9TB 2I0QA 3E0JA 4OL7A 4OX9Q 2D0PA 3JAMc 2EE1A 2K5QA 2K04A 3RLOA 2ZXRA 4EVOA 4ALPA 1M8AA 2JYOA 4C3IB 1F9SA 4FP5D 2JA9A 1QCBD 2HCCA 4YIJA 1QG7A 3BVGA 4A3KB 1GUOA 1U4RA 3LNNA 1CM9A 1W2BA 1UE6A 4IJHA 1T5XD 2D62A 4HCSA 4A3FG 3EVQA 1B53A 3KLSX 3BZDB 2EY5A 3K7AB 2O2LD 3NENA 5NUCA 3RLNA 5C4XB 4BBSB 3FPUB 2NBFA 2SDFA 4JVZA 4F88A 1Z47A 4RWSC 3FKIB 3M4QA 1TIID 3LWEA 2JA5B 3SR1A 4G57A 1DOLA 2A74C 3RUZA 4KK7A 1BBUA 3TP8A 2YU9H 1EWHA 1Y1WB 4LWCA 1PZKD 1HNZQ 2AHOB 2A69C 1YNJC 5GQOA 3HOVH 5BN3A 2Z9HA 5BN5A 2ZXPA 3F2BA 4JBKA 2J4XA 2KENA 1WD0A 5M5WH 2QEXA 1XTCD 3J81E 3I7FA 4LF8Q 4KD4A 3CC4A 1XMQL 2Q2UA 3KK7A 1IBMQ 3IRBA 3S1MB 4CHTB 4A3JG 2D0OA 1LLRD 1O80A 1K28A 1UNSA 5M3MH 1XNRL 1HUNA 1A3VA 4OWXB 1QVCA 1EY9A 4A3BB 1IL2A 2UXBQ 2A6EC 3FDTA 1H9RA 1JJCB 1Z6HA 1SYCA 1I5FA 1TWGH 3P20A 2H1EA 2M2LA 1LTBD 3RN2A 4A3GH 4IO9A 4IUNA 4X3UA 5FJ8G 3HZXA 5A35A 1V1PA 5ELEA 4UP9A 1DOKA 3A74A 2B63G 4A3KH 3OPOA 1PH6A 3K57A 4DR1Q 1CKNA 4HEDA 2ES2A 4ZKBB 3DHQA 2UXCQ 1BR9A 3I4OA 3OHXC 4IUUA 3AFQA 3M7NA 2B2YC 1BOSA 1HR0W 3S2HB 4K0KQ 5EJWA 1A2UA 2MQHA 5C4XH 5M3FB 1PTOB 1FD7D 1F77A 1VQJA 4N8X1 2F0MA 2NN6G 4L5RC 3MXUA 4P2CB 1SE3A 5DNFA 3I4NH 3OWFA 2VZAA 3CKIB 3F2CA 4AQYQ 2ZM6Q 2OTJA 2HDLA 1ICWA 2K5DA 2F0EA 4JBJA 2WFWA 3UE1A 3D4WA 1YNJD 1TWGB 2NVQB 2ENBA 2EYOA 1QVGA 2QDLA 3EBEA 4LFAL 3STBC 4DKAC 3I72A 5I6YA 3JAMi 1I3QB 3PUXA 1KTKA 4MTKA 5IP7H 1NSNS 4HIMA 1J5EL 2OQKA 5KNBA 2PMZE 2UXDL 1A15A 2JA6H 1K83B 2AWNA 3KF6A 3JC66 4QMGA 1GO3E 1V9PA 1BBWA 2WIIB 2JK8A 1DOMA 4IUVA 1GXDC 1ILPA 1YNND 1LM0A 2FINB 3M7GA 4YHHQ 3PIO3 3HOZB 4QIWE 2G9DA 2PPBC 3DM3A 2RCFA 1GHJA 4RG1A 4BA2I 4UP7A 4BBRB 1A62A 1B9NA 1WJJA 5M5YB 1TS4A 1LYLA 2KA7A 3EIVA 4A3LG 2RCNA 2VUMH 3H0GG 1JR0D 2DN8A 4OEMB 1ONLA 3S2DH 1ZYRD 1XPRA 3MVVA 1XTDA 1FNWA 2C35B 4QJFA 3SK4A 1D1KA 1UEAB 2BA1A 3CQZH 4IQZA 2Q2TA 3M4PA 4C3HH 2CWPA 3BZCA 4ZRZA 2O5IC 1CUKA 1MIUA 1JJ2A 2VS1A 5CV5A 1K3RA 3QB3A 3S1NB 1C8CA 2JA8B 2IL8A 4IPGA 1PH2A 1Y8OB 4JC0A 1CQVA 5C4JB 2RSNA 1X9NA 4YCWA 1ZXTA 1Y1WH 1VCIA 1N36Q 2O5JC 3D4RA 3S15B 2UXBL 2PYKA 4KJNA 2EJGC 1SYEA 4LUVA 3SK8A 2TSSA 5TSSA 1E22A 1E2VA 5GAHC 4L8JA 2EYFA 4JPBW 1F2LA 3A5ZB 1VQHA 1WCMH 1AZQA 2JEAI 3UI2A 5T1IA 2NVTH 1JQYD 1G51A 4KY5A 1V1QA 2SEBD 4BY7H 1LTAD 4CDCC 5GAGC 1A3TA 4DGZA 1EIHA 4C56C 4EQNA 3N52A 2F52A 1PDQA 4EGVA 2OXPA 4C3JB 5K5PA 3I70A 1G6ZA 1JOKA 4HMJA 3G6JB 1HCZA 2VUMG 1G291 3C1FA 4B08A 3NELA 4YY3Q 4ME3A 5AJ3Q 5C44H 4MZ9A 2JSOA 1EY6A 2EXDA 4H13C 2EXZA 1KLUD 4FDBA 4KHZA 3J80c 1SYBA 1RHPA 3P75A 3HFZB 5KEEA 2ALYB 3SHLA 3CMAA 2GA4B 3MXGA 4OONA 1VQEA 3T4AC 3AEVA 5LMNQ 5CBEE 5M3FH 1HZAA 4HAEA 2IX0A 3V96A 4FXKC 4DR2L 1J5EQ 4RGMA 3J81c 1BXTA 3AU7A 4KN7C 5D14A 3X3NA 1XX8A 4NKLA 3J81j 1VQ7A 3HP3A 4I7ZC 3QOLA 3CCSA 3HOYH 3S9WA 3I4NG 1GKHA 5KIXA 5M5YH 2UU9L 2CW0D 4DAMA 3L0OA 1D5XC 4C3JH 4JI4Q 2E2DC 3VR6A 1X54A 2MNAA 2RA4A 4DK3C 3MEFA 4X3SA 4DV7Q 1A3UA 5C5LA 4DNRB 1Q90A 1I94Q 1A63A 1STNA 3MXNB 1YJWA 4DR6Q 1YNXA 4KY6A 3A54A 1GJXA 3HGBA 3PQIA 1O78A 1YHAA 4X3KA 3S16H 1TWAH 5LMUQ 3I4MG 2PQAB 1IYUA 2KCTA 1N34L 1GM5A 2PCFB 3HKSA 1B1ZA 4IJLA 1EQQA 4A3DG 1ENFA 4GOPB 1D1IA 1NMFA 5FLXc 1E3PA 1PA6A 1E2WA 3A8IE 3ZYYX 4DAYB 4HJ7A 3MWYW 4RAUC 5C0XJ 2F0KA 2OT2A 1H9JA 2L12A 2HHHQ 1EIGA 3NXWA 1Q1BA 5C4JH 2D2CC 2UUCQ 3CP0A 2XIWA 1NTGA 1QZGA 3OTOQ 1IW7D 4A93G 5IYBH 4X62L 4N9TA 1Z9FA 3D3RA 1SNQA 1IXRA 1M4VA 3AFPA 1DZ1A 3K5MA 4LF5Q 2YTVA 5HGTA 4BBRH 2HQLA 4APVA 3GO5A 3NK9A 4CGYB 1WTWA 2BE5D 3J80E 1E0BA 3MZ5A 1ESFA 2Z6KC 2E2HB 2NN6H 1L0WA 2ZTEA 4OIKA 1PFSA 3RR5A 3AB9A 3BVZA 4YWKA 2B2UA 3UDFA 2JA8H 2JA6G 2F0WA 4X64L 3GTKB 3RN5A 3GTGB 1YJNA 1MSGA 2QW7A 1HQRD 1SE8A 2YTYA 4XQQA 1ET9A 4LF7Q 1G2SA 1IYVA 5EKKA 4CDDC 1AE3A 1LT4D 4POFA 1I50B 3I8ZA 1EFWA 3DM1A 3CRLC 1LUZA 3K59A 4WJ3M 1WTQA 4YCVA 2A5HA 4IFDJ 3D6CA 1QB5D 4LW1A 1X6OA 1XXGA 2UUAL 1SMXA 4WORA 4F8MA 2L4NA 2F0IA 5KGUA 5AJ3L 4A3KG 2NN6I 1N32L 1JCKB 3OMCA 1S5DD 1BVSA 4Q0FA 3DWAA 2EYHA 2R7DA 1XMOL 3CCLA 3H6MA 2F0VA 1K83H 4JI3L 5IYCG 2RDFA 4A3FB 4XT3B 3BS1A 4UP8A 1KQSA 1LABA 4CJ1B 5LMNL 1HA5A 4K2LA 3KF8A 5ELBA 4XQNA 1LT3D 1UUPA 3C3LA 4LFBQ 3CCUA 2R61A 4AYBG 2FMCA 2CQAA 1AFPA 2D5DA 2E75C 1E1OA 5EBCA 2NVXB 4HSVA 2K05A 1I4HA 4LAAA 1AW7A 1HFNA 1BUVT 1EQTA 4A3IG 1LT5D 3NQTA 4FF4A 1KAWA 1JC7A 1Y1WG 1A8VA 1O7YA 3HG9A 2QKIC 2K5HA 4XXEA 4DF7A 2YU9B 2M9VA 2Y0SE 1U9RA 3F2DA 3PO2H 5JJLA 4K0KL 4RCOA 3QWNA 3FRPB 1PTOF 4GNXB 4IPDA 2QGQA 4TRDA 4AQYL 3CQZB 3DEPA 1YHQA 2QF7A 3LGJA 1GVPA 1RF2D 3S1RB 2CKZB 4A3JB 3GTMH 3J7YW 4R4CA 2MGSA 4LFAQ 1HQMC 4DV6L 1VQDA 3CPWA 3S2HH 1PTOH 3CD6A 1KRSA 2CH4W 1YEZA 1OXUA 3TP6A 1NR2A 4IPCA 2K5WA 4PZ7A 3H3VC 2K5NA 3BDLA 3OTOL 2CVRA 4PMCA 3GTQH 3E6ZX 4B9XA 1QUQA 2IT1A 1I4RA 2Z4HA 1RODA 2JA7H 2JP1A 2DY8A 4P71A 2XRSD 4JOIA 2EZVA 3QG1A 3ERSX 2Z4IA 3GV3A 1VMPA 5M5XB 3K80C 3NEMA 2NTSA 4LUZA 3D8GA 2UUBQ 3R3OA 3S14H 5M3FG 2KVMA 3MXPA 4MNOA 4K14A 1TY0A 4Z9CB 1PH9A 5EQ0A 2OWOA 3E9IA 1TVXA 2F3IA 3Q23A 1C4QA 3PO3H 3Q6SA 2A6HC 2Q8RE 3QIAA 2OEOA 1GUTA 3RD4A 2KCNA 4J8QA 1JB7A 3S1QB 1W6KA 2A69D 2CQOA 4YHHL 2R7ZG 5H1SE 4LMQD 1K3BC 2JN4A 4IN3A 3FVQA 2K01A 2KHSA 2K28A 3PO2G 3HOVB 2RBMA 1PH4A 1VQ9A 5K36H 3W3AA 1JORA 1I6VC 4L6TB 1SNOA 4KJOA 5HGQA 2PZUA 1W3SA 4RGNA 4XT1B 3S2DB 1OXSC 1QNUA 2K03A 4NP5A 5JJIA 5DLQE 2LY7A 3QR8A 1U4LA 3SEBA 5JPMC 2R93B 2F0DA 1N32Q 3PIOA 1XNQL 1EYAA 1UE7A 2YTXA 4C1NK 5IGGA 1EEID 4RCNA 1LTTD 1CKOA 5FKAC 1AN8A 2ID0A 1VQOA 4GKJQ 2VY3A 1SMYD 4HJ9A 3T53B 2Z0SA 1VQ5A 2O4XA 1Y8PB 1QVFA 1VQIA 3BZKA 4LFBL 2IPKD 2JEBI 2LXJA 4UPAA 4RFBA 2F4IA 3H0GB 2F0GA 2PW7A 2IHFA 5IGFA 4OELB 3FPPA 1IKMA 4PMBA 4K2KA 1RL2A 2B63H 3KJPA 3GTOB 2RVLA 5J3BA 1SROA 3CC7A 1X65A 1VQCA 3NP8A 3S14B 4JI2L 3FEWX 1WTOA 5E3FA 4HJAA 3CC2A 3U9OA 4V0BA 4XIGS 1Q46A 4RGTA 2NVXH 5CMDA 1J8IA 3GD7A 2QEJC 1K0SA 4LF6Q 4JI0L 5ELDA 2JA5H 1LTSD 3GTQB 2P5ZX 4HIDA 5M9OA 5C44G 5EKLA 4AIMA 1STYA 2K6AA 1H95A 2FXQA 3TZUA 3GP7A 4YCUA 5C3XA 4K6DA 1WFQA 2L0CA 3TBIB 4G7OC 1HPCA 1WVLA 3NTHA 1TQOA 3PUZA 3U4VA 5FLXE 3TP7A 2MFIA 3CCRA 1AZPA 5T1GA 5JJKA 4YY3L 2UU9Q 1LTLA 4LFCQ 4R4IA 2G9HD 2DY7A 4Y7NH 3K81C 1NUCA 3OOCA 2E2HH 2CHBD 2EY6A 4GOPC 2E2JB 1N33Q 1F2ZA 1V1PB 4FNFA 1PVOA 4DV4Q 2R3ZA 1EY7A 2ASBA 4LNQA 3OW7A 4C3JG 2ZTCA 4DR6L 3SK5A 5KNCA 2PNRC 3R93A 4A93H 4A3GG 2VW9A 1KIXA 1G2TA 3S24A 1NJIC 1VQAA 4N8FA 1ML0D 1UEBA 2VL6A 1SJED 4OGQC 3JAML 2A68C 4N9PA 1JOOA 1CSQA 3L3OC 4B3TL 4JI4L 4A3MG 1OTCA 3PUYA 4RKBA 3CW2C 1CZWA 1PFBA 3A8KE 2HHHL 1KABA 3UE0A 4DK6C 5IGDA 1R4PB 5JEAH 4JYAQ 4X65L 4QGUA 4DR4L 5FO8B 5C4XG 1X3PA 3MC0B 5C3EB 4HJ5A 1E7ZA 3MXNA 1VQFA 4X62Q 2F4VL 4ZYSA 3Q22A 3DXJC 4E6IA 1N34Q 3HKZB 2JA5G 2XWBB 4UHVA 5IYBG 1MD2D 1G91A 1I4XA 4FO2A 1X55A 1CKMA 1WOCA 4B3RL 3M4OB 2NYZD 2Z6BA 3GTPH 1QNKA 2R7ZH 5IODA 4GS3A 2PQAA 3AYHB 2UUCL 1V1OA 4KKSA 1EL0A 3GTOH 1X32A 4IFDI 3PGZA 2EJFC 2K33A 3EN2A 1SSOA 4ZUIA 1SYFA 2EOTA 3MHBA 3I56A 1PRTD 1PH3A 4LF7L 2HQEA 4IOAA 4L5TA 3K7UC 3A7LA 4A3EH 4A3BG 1SNDA 1D5ZC 5IWAQ 5DM73 2B3GA 2WAQE 2YV5A 4QQBX 2J0TD 3T1HL 1YIJA 4XDXA 4A93B 4B9WA 5KYLA 5C0XH 1WYDA 4QUCA 3PSIA 1PH5A 5I2XA 3I4LA 1FGBD 1IL8A 1HNWL 5M3MB 2PZTA 2WKCA 3E5SA 2B63B 1T5EA 5IGCA 2R92B 4JI0Q 5KYIA 2L1BA 5A2QL 4DUYL 3H3VI 5JVH3 1D7QA 1SDFA 2ICIA 1YI2A 1L1OB 1P8LA 1Q1EA 2AUJD 4HIOA 1WI5A 2PO4A 1YZ6A 4K5VA 4B3ML 5K36G 1J9OA 2FFKB 3R8BA 4JG2A 2F0JA 3V2TA 3VR4A 1KD1C 4BWGB 1F9PA 2WAQB 4MN3A 4DAPA 5CC4A 3K0XA 4GLXA 2J7ZA 2AMCB 1IBKL 4JI5Q 2XGTA 3MEHA 1KDAA 2L5TA 1EEFD 1BNZA 2KJXA 3R2TA 2LS01 1X3EA 5JJZA 3H3VH 2PI2E 4DV2L 4JI7Q 2XRQD 4K8IA 4LF9L 2GVAA 2HUGA 3GQBA 4DV3Q 1BCPB 1BCPF 4FXDA 1VQBA 1LV9A 2X6LA 5J39A 3X3MA 2MJ8A 4QUFA 1PHJA 3GTLB 2SNMA 3TMEA 2EYLA 1H9KA 1TWHH 4DUZL 2N49A 2ZTDA 4JI8L 1CHQD 1HZCA 3HOUG 3MA2B 4NDXA 5F2DA 2EY2A 1QOHA 4FVMA 1JB3A 1BF4A 2DNCA 4JBMA 1BCPD 3KOJA 4BY7G 1RDPD 3Q24A 4DV1L 2EYMA 1DJRD 3NBHB 1ENCA 2XN9C 4H02A 4AYBB 3GTPB 3GTMB 4IFDH 1HRJA 1U0LA 4R1JA 2F4VQ 1IKLA 1GUNA 1F9RA 4IUPA 1LT6D 2E5LQ 2HCIA 2RHQB 1ENAA 1CA6A 1ZYRC 3C2PA 5BN4A 3CAMA 3TN2A 3GTJB 4DV6Q 3RNUA 4TQUS 2F3WA 5C3EH 1KAAA 5ELFA 1NMGA 1PTOC 4EQ5A 4OWWB 1FNVA 3GTLH 4OO1G 1VQGA 2JXMB 3A5UA 4BY1B 2K5VA 3DEOA 5C0XI 4A3FH 1TKWB 2N88A 4IUQA 1S40A 2AQ2B 2B2TC 1KXLA 1L2FA 2JA8G 4O0AA 5FO9B 2CFMA 3D31A 3Q8DA 3E0EA 2AUKA 2WB1E 2NWGA 2D9UA 3ICEA 5IY0A 3TSSA 1FJGQ 1BDOA 4ODGA 3ULPA 2L15A 1KNAA 3RLFA 2F03A 2UUBL 4DNIA 1SN8A 2SOBA 1TWCB 4DN4M 4QIWB 1STEA 4RHSA 1EYGA 1HNXL 4WRDA 3TDQA 3S17B 4YWLA 4M8AA 5FOBB 2X6GA 4EQOA 3H94A 2EDGA 4MTNA 4B3SL 3L7ZC 4RKLA 3W5OA 2Q8TA 2ZT9C 4A3CH 4DV0L 1HH2P 1EY8A 1EY5A 2F0HA 3IAYA 2BA0A 3HOWH 4GLAC 1MJEA 4JBWA 4OXPA 2WB1G 4C3HB 1DXMA 2R92H 3KBXA 4JV5L 4IPHA 1FL0A 2PQEA 4P74A 4NXML 3TS0A 4LF8L 1BBXC 5CV4A 2MUYA 1CI3M 2E8GA 3D6WA 5I4DA 4HIKA 4DR1L 4HCEA 3U50C 1TU2B 4GN5A 3CCEA 1PLFA 1XNQQ 1PH7A 4JI5L 3S1QH 3J80L 2AKWB 4ZUJA 3A56A 1KDBA 4Q5VA 3M85A 4GKJL 4JI2Q 2VB3X 2Y0SG 4DV2Q 1B3QA 1LTID 2F0QA 2JE6I 1D8LA 2FJ2A 1SNMA 1I6HH 4IURA 2DJFC 1PZJD 4CDFC 4LF6L 1EU4A 4GKKL 1B2TA 1X3GA 2IX1A 5GADC 3K7AH 1DCZA 2GN5A 3CMEA 1X56A 3T13A 4G7ZC 1Y69U 4DXGA 3VYSA 2AQ1B 3UDGA 2N8NA 1NE3A 1S4ZA 3F1ZA 2NB0A 4R4TA 2IWHA 4C2MH 1MHWC 3M9BA 3WDNA 2KOLA 1BKBA 4BXXH 1GUWA 3A8JE 3F2UA 1VQ6A 1N33L 1F9QA 3OSOA 3G4SA 1EY0A 1NAPA 2F1MA 2B39A 3AMUA 2DUDA 3DUZA 4GNXC 3W2DA 3DLLA 1B8AA 4DR5L 3KF8B 4FF2A 4A3EB 1JICA 4CKCA 1Y1VH 1NR4A 2NVYH 4A3BH 2JJQA 4U673 1HZ9A 5I9PA 2B8GA 3S1NH 5LMNW 1YHBA 4DV5L 1S72A 1RIPA 1O7IA 1QILA 2I46A 3EA6A 1L1OA 4I65A 3WOEA 2RKSA 4ABNA 5CR3A 4TKOB 1B4OA 1EQRA 4NB3A 4ULLA 3BJUA 5C5MA 4DR4Q 4RGOS 1IZ6A 1DGSA 4K5XA 4OIJA 3E3XA 5C4HA 2Q2IA 3NWSA 4Y52H 3RZDB 1Q86C 3J80i 2JA6B 3OWEB 5GAEC 3S1MH 4C3IG 1E1TA 1DM0B 1GUSA 2F0TA 4HMIA 4A4IA 2B8FA 5EAYA 3ND8A 2F0NA 5IT9L 5DEHA 2XTIA 5LHY1 1YJ9A 5KNDA 2E76C 2WINB 4TVAB 3CU7A 2F3VA 3D4DA 4KKUA 4A3GB 1U4MA 1B70B 1A2TA 3GTKH 4BBSG 4DXFA 2PI2A 3CPFA 2H4OA 5IP7G 2I5MX 3MFGA 2V1CC 4JV5Q 2JA7G 4XQJA 1CFMA 2FMMA 4NXMQ 5ELCA 1TWFB 5HURA 3FKIG 4FXGC 3DWPA 4P75A 4CKBA 3L2PA 3FKIH 1KC8C 5CBAE 4B3RQ 1XPOA 4UAIA 3H15A 2M00A 1SEBD 2B2WC 4A3CG 3T56B 2Z1CA 2CCZA 1JT8A 3BYYB 3M4YA 5IGEA 1TR5A 5G3LF 2PZWA 4J15A 2B2VA 2B2UC 3K5OA 3NE5B 3VA5A 5JEAJ 3HKZG 3CCVA 3I2ZA 4K8JA 4G7HC 1WTRA 4ZCKA 4GOPA 1SFOB 4I7AA 4KHPQ 1DD2A 1RCVD 1B9MA 3LX0A 2B29A 1PYBA 5EBDA 2A8VA 1D6EC 4LUOA 1ASZA 4JK1C 2A6ED 4ZK9B 1Z7TA 1SBBB 4IOCA 1C0AA 3G6EA 2NZHA 1EIYB 5CYUA 2OF1A 1FVIA 1X3QA 4PZ8A 3Q0AA 3K6OA 2C5CA 1VQMA 3M3YH 3FMCA 1B44D 1OXXK 3EJIA 4U68A 1MSHA 3HOXH 4GNXA 4CBVA 1ZEQX 1G6PA 2MO0A 3K0YA 1WD1A 3U58A 4POGA 4ZQ3A 4O2DA 4KMUC 4P72A 3OYYA 3EROA 3URYA 3D0FA 5IT9c 4DV7L 3L9AX 3QOJA 2EYPA 3KLSA 2BCOA 1NNXA 1XJVA 3HOYG 2CH4A 2JQOA 3NBIA 2I07B 5J1ZA 1SFOH 4LF9Q 1I3QH 1I4PA 3ZJYC 3T1YL 3PCOB 2Z8LA 4C1NI 5M3MG 4LF4L 4FF1A 3JAME 5IP9H 1A0IA 3O13A 1PH8A 4V190 3G7LA 3RMHA 1S5ED 3RZDH 1IHZA 5HY6A 5LL6X 3KYHC 1IBKQ 3U4ZA 1QE6A 2CWAA 1ASYA 4DR3L 4OWTB 4F87A 4GN4B 5COYA 5IOCA 2RDGA 4NMZA 4QL5A 2NVTB 3HOWG 1VQ8A 1TS3A 3CF5A 2MPMA 2KQ3A 5DAUA 3NQIA 3I55A 1ZKOA 3NTIA 3PMFA 1AH9A 3CXCA 1OO9B 1S5BD 5EGTA 5LMUL 1HJPA 5BR8Q 1BO0A 1VQPA 1VF7A 5CV9A 3GTGH 5I2YA 4KY7A 4AH6A 1PRTB 2VQFQ 4DUZQ 4ID6A 4XTCS 4NXNQ 2R7ZB 3BDOA 3WOFA 3HOZG 2DNEA 4H0LC 2K52A 1TS5A 1CTMA 3KFUA 2VXWA 1SXTA 3CCMA 1BCPC 1VQLA 1QZHA 3NBHA 2K75A 3NPPA 4A3MH 4OO1H 2E74C 3TS2A 1TWAB 3HOXG 1MGSA 4X64Q 4KN4C 2R93G 2RF4A 2E5LL 1KLGD 1S3OA 5JEAG 1RTOA 3ND9A 5ELNA 2IHEA 2E2JH 4DR7L 1M1KC 3C1EA 1JMCA 5KRUA 2LKVA 3HOUB 4K5WA 3UDXA 3J81i 1TS2A 1FJGL 1W6JA 3SDZA 1ICFB 4A76A 3T51B 1HR0Q 3K58A 3TQYA 5M5XH 4A3JH 3RZOB 4EX5A 2Q8IB 4ZLTF 2HD3A 1Q8IA 3GV6A 1A6XA 4M1UB 2UUAQ 4AYBE 2VQEQ 1PRTF 1LTRD 3VA7A 5I6WA 1CSPA 1STBA 3SXHA 3J81L 5AFWA 5I9OA 3PO3B 3I91A 4IZ8A 1L1OC 4HN7A 1XMOQ 1IW7C 3EFXD 4JI3Q 2GVBA 1L0XB 1EU3A 3BDCA 3S16B 3GTJH 4DV0Q 1IBLQ 2XWJB 1RTNA 2NTTA 5D3DA 2HT1A 4BXXG 4A3DH 1K8MA 2PMZB 3CCQA 2R6GA 4BY1H 4WJWA 1QWYA 1MBYA 2A1AA 3MAQA 2EYJA 3SK6A 1HNXQ 3J7AF 3S1RH 1WCMB 4QCLA 3MTSA 2K32A 1VQ4A 1H9SB 2VB2X 5C44B 4B3SQ 2EIFA 1Y1VB 2PNHA 3IL8A 3HOZH 1RD9D 2F0SA 2XNAC 3VR2A 4JCVE 2K4KA 4G4KA 2EVBA 2EQSA 2N78A 4RH6A 2K7VA 4GZYC 1B50A 5C6AA 2DGYA 2EY1A 4HR7B 4HSPA 1KRTA 5FJ8H 1HFGA 3WWVA 1C48A 2VUMB 4RA8A 3PIPA 4PMWA 3SVMA 4C3IH 3OIQA 3VYTA 3G71A 1XYIA 4GLVB 5CORA 5JAVA 3STBD 2IW3A 1P16A 4L5QA 1SE2A 1B7YB 2KBNA 3SE0A 4WJ4A 4F7XA 3CCJA 1VQKA 3NWTA 2KHJA 1GD7A 4IUTA 4DNTB 1WTXA 2KEEA 5FLMH 1EYDA 2E2IB 4CKEA 1HZBA 1DYQA 4FF3A 2WB1B 4C3HG 1OXTA 2F0FA 3KBGA 3VYUA 4PQXA 4JI6L 2B2TA 3I4NB 4GKKQ 1JJGA 5BR8L 1UE1A 4X66L 4DFAA 4R8NA 4R4QA 1WTVA 2IJ0A 4A3MB 4QY7A 2KCMA 2BH2A 1CK1A 1HTLD 1SR3A 3I90A 1M90C 3KDFB 1STAA 1EOTA 3EQLC 2Y0SB 1TWFH 5JOBA 2B2YA 5FO7B 5C3EG 4HTHA 1FNUA 1QJOA 4OX9L 3TP5A 2RDHA 1IYJB 3J7AV 2ZXOA 3I4MB 1KDCA 4DV5Q 4DAYA 3I3CA 1CQFA 2L9HA 3FHWA 5EPKA 5IT9E 1JWUD 5J22A 4GN3B 5C0XG 5FK9C 1NY4A 2BH8A 2X69A 5D65A 2OQ0A 5GROA 4JW0A 4KLKA 2L55A 1JE5A 2QCPX 4OO1I 2F0UA 3NUCA 3VYRA 4YWMA 1R4QB 1TY2A 1G8ZD 1Q12A 1Q3LA 1J6QA 4DR5Q 1EUJA 4C2MB 2VQEL 5JVG3 5JPNC 1KHIA 1K0RA 3SGIA 2K1BA 3BG3A 1GOZA 1FR3A 4PG3A 5E1FA 1Q82C 1QUQB 1XMQQ 1NCVA 2K14A 3H91A 1EZ6A 1LACA 2MP1A 2YYZA 1DONA 4BA1I 1XPUA 1II3A 2F0PA 2E2IH 3K5NA 3OW2A 1IBLL 1HNZL 3J7ZC 2SNSA 3BU2A 2NVYB 3ERQA 5E7NA 2R92G 2XSCA 2EJMA 2RHSB 2QILA 3KLWA 4KKTA 1IBML 4R8IA 4EQPA 3FP9A 2IX3A 2TMPA 1F2YA 1XNRQ 1V8QA 3RZOH 4R9WA 2WP8J 1AEXA 3VDYA 3C46A 3ER0A 1VS0A 3B6YA 5CV7A 3U9SA 3H09A 2QA4A 1UAPA 1K9MC 1I6HB 1GUGA 3KLRA 3I73A 4ILWA 4NPSA 1YNNC 1FYCA 5D3IB 3PIP3 2LSSA 4UDUC 2ZM6L 5IYCH 4OHJA 1YITA 1S5CD 2WAQG 2A68D 4Y7NB 4J1MA 4LJZC 5ELOA 4KHPL 2Z6KA 3ULLA 5CV8A 2H5XA 1LO5D 1EQVA 1JE4A 1SRUA 4PV1C 1SE4A 4ME5A 4KHVA 2A73B 1AP0A 3OMGA 1JWSD 2KEDA 3HKZE 4BBRG 1HA6A 4IALA 3AQQA 1PYSB 1SMYC 2LXKA 1O7LA 3QJYA 4RMFA 4P73A 2JA7B 4LFCL 2HIVA 1N9WA 1HTPA 3MFYA 3G48A 4KV6A 1U5KA 2ZJPA 1PRTC 2LMCB 2G5DA 4NW2A 3HRZC 4A3IB 4DV4L 1WTPA 5M5WB 1N8RC 2B2VC 4ZKCB 1SJHD 3ONAB 2WACA 1CKNB 2MO1A 1VMCA 4XYOA 4BY7B 1EOVA 3BVMA 3T1YQ 3IKJA 4DU9A 2UXDQ 3DWQA 1XWEA 2Q2HA 3HOUH 1Q8KA 4CDEC 3BYTB 4CJ0B 3CHBD 1PFNA 3A0JA 3GDEA 1K8OA 2L11A 4K6LA 5C4ZA 1CZGA 4O1NA 4KD3A 4MIUA 4HJ8A 4IFDG 4DAVA 1PTOD 1PZID 2A6HD 4S3SA 2I5HA 2LFNA 3R2IA 5G3LD 1SNPA 1PH1A 2QDBA 1I50H 1H9MA 5LL6S 2ZJQA 1SYDA 1PMRA 2ICEC 2IY5B 4DK1A 3CRKC 4X65Q 5FLXL 2K50A 4BY1G 5EPLA 4KI0A 3I4MH 3TRZA 3IFTA 1X3FA 4X6AH 1D2BA 1EZ8A 5CV6A 4DPGA 2ZJRA 2HDMA 4A3IH 3TEHB 4LF4Q 3ITPA 4JI1Q 4KTAA 4FYDA 2VNUD 1O7ZA 2VQFL 1KL9A 4L5SA 4WFN3 1MKHA 4O42A 1TWHB 4B3TQ 1PYWD 1C9OA 5IIFA 1N36L 4UY8C 2F0LA 1AE2A 4DR3Q 3KF6B 2KCCA 2B2WA 2RSOA 2NUCA 3HOYB 3V05A 3KDFA 3P7JA 4L63B 1STHA 4JYAL 2BDOA 2XVSA 1SNCA 2NVQH 3HEJA 3N6RA 3E9HA 2NZOA 1T9HA 5IYDH 1D5MC 3VR3A 1OXVA 3OIPA 4XYQA 1PFMA 2C9OA 2OCEA 3M3YB 1VDZA 5E4XA 3A55A 3T16A 1HXYD 4NXNL 2R93H 1I4QA 1Y8NB 3HOWB 4BS9A 2A19A 3PF4A 1PXUA
chains in the Genus database with same CATH topology
1PH3A 2MNAA 3HOVG 3PCOB 4DK3C 3T1HQ 3MEFA 5M3MG 4LF4L 4DV7Q 4LF7L 5IP9H 4IOAA 1Y14B 1A0IA 4L5TA 1I94Q 1PH8A 1A63A 3K7UC 4JOIC 4A3EH 4A3BG 3MXNB 1YJWA 4DR6Q 1YNXA 5IWAQ 1HNWQ 3RZDH 2B3GA 5HY6A 2WAQE 3KYHC 1IBKQ 3U4ZA 3ULJA 2YV5A 1YHAA 4QQBX 2CWAA 2AWOA 1ASYA 3S16H 4DR3L 1TWAH 4OWTB 2N3SA 5LMUQ 4GN4B 4DUYQ 3T1HL 1YIJA 1K8AC 3I4MG 2PQAB 2KCTA 1N34L 4QL5A 1YBYA 3HOWG 1VQ8A 1GM5A 4DR7Q 3HKSA 3CF5A 1WYDA 1VQNA 3PSIA 4IJLA 1PH5A 1EQQA 4A3DG 3K8AA 4GOPB 1NMFA 5IWAL 5FLXc 1E3PA 3I55A 1PA6A 1HNWL 4DAYB 4HJ7A 1HR0L 1AH9A 3CXCA 4DR2Q 5C0XJ 4JI0Q 2HHHQ 5LMUL 4DUYL 1R9TH 3H3VI 1HJPA 1Q1BA 5BR8Q 1D7QA 1VQPA 1YI2A 2HIXA 3UDIA 1L1OB 3GTGH 5C4JH 1P8LA 1Q1EA 4AH6A 3CP0A 2UUCQ 1MJCA 1E24A 2VQFQ 1NTGA 1QZGA 4DUZQ 4PZ6A 4HIOA 1WI5A 3OTOQ 1C7YA 4NXNQ 4XTCS 4A93G 1YZ6A 3H0GH 5IYBH 4X62L 3HOZG 4B3ML 2K52A 1Z9FA 5K36G 1NBWA 1EIFA 3KFUA 1IXRA 4JG2A 3W1BA 3CCMA 3AFPA 1KD1C 4LF5Q 5FLMG 1VQLA 5IE8A 2YTVA 1I94L 1QZHA 4BBRH 2HQLA 1EWIA 4APVA 2K75A 4A75A 3GO5A 4A3MH 2OTLA 3K0XA 4A3LH 3TS2A 4GLXA 2AMCB 3HOXG 4B3MQ 4X64Q 1IBKL 4DV3L 3PUWA 2R93G 5IYDG 2XGTA 4JI5Q 2RF4A 2Z6KC 2E5LL 3TREA 1S3OA 3M4OH 1L0WA 1YVCA 5JEAG 2ZTEA 5ELNA 2ATWA 2IHEA 3PV0A 2E2JH 2R7FA 1M1KC 3PO3G 3S15H 4DR7L 1X3EA 1JMCA 1PFSA 3RR5A 4YWKA 3UDXA 3J81i 1PV4A 2PI2E 1FJGL 3UDFA 5IP9G 2JA8H 4DV2L 3H3VH 4JI7Q 4JI8Q 2JA6G 4A76A 4LF9L 4X64L 2GVAA 1HR0Q 3J7A5 4DV3Q 3TQYA 5M5XH 3RN5A 4A3JH 4EX5A 1VQBA 1YJNA 1Q7YC 2UXCL 1SE8A 2YTYA 3S17H 1PHJA 4LF7Q 3W1GA 1UWVA 2UUAQ 1V43A 1TWHH 1AE3A 4AYBE 2VQEQ 1SLJA 4POFA 4DUZL 2I5LX 4DV1Q 1CSPA 2N49A 2ZTDA 4A3EG 1EFWA 4JI7L 4JI8L 1UE5A 1LUZA 4WJ3M 1HZCA 4YCVA 3HOUG 2KHIA 4IFDJ 1L1OC 1XMOQ 1WCMG 4JI6Q 1FGUA 4LW1A 4R4OA 4JI3Q 4JI1L 1X6OA 2GVBA 4X66Q 1K73C 4JBMA 2UUAL 1SMXA 3F8TA 3GTJH 4DV0Q 4LF5L 4BBSH 3KOJA 4BY7G 1Q81C 1Y1VG 4DV1L 3NBHB 5AJ3L 3PUVA 4H02A 4A3KG 1IBLQ 4A3DH 1U0LA 2HT1A 4R1JA 2NN6I 4BXXG 2F4VQ 3KJOA 1N32L 1BVSA 3CCLA 1XMOL 2R7DA 3CCQA 2R6GA 4BY1H 3PF5A 2E5LQ 4JI3L 1K83H 5IYCG 1K8GA 2RHQB 2A1AA 1TWCH 1TXYA 1KQSA 4UP8A 1HNXQ 2I0QA 3CAMA 3S1RH 4OX9Q 5LMNL 2D0PA 4DV6Q 3JAMc 3RNUA 4LFBQ 4TQUS 1VQ4A 3RLOA 5C3EH 4ALPA 3CCUA 1NMGA 4B3SQ 2EIFA 4EQ5A 2PNHA 4OWWB 2JA9A 3GTLH 3HOZH 1VQGA 4AYBG 4OO1G 3A5UA 2K5VA 2K4KA 4JCVE 2EQSA 5C0XI 2N78A 1E1OA 1UE6A 1W2BA 4A3FH 4IJHA 2DGYA 2D62A 4A3FG 1KRTA 4A3IG 1S40A 5FJ8H 3WWVA 1KXLA 1L2FA 1KAWA 2JA8G 3PIPA 4O0AA 4PMWA 2CFMA 3D31A 3Q8DA 1Y1WG 1A8VA 3NENA 4C3IH 3RLNA 3G71A 3E0EA 2K5HA 4GLVB 5C4XG 2WB1E 5JJLA 2Y0SE 3PO2H 3F2DA 4K0KL 3ICEA 5IY0A 3STBD 1FJGQ 1P16A 2L15A 3ULPA 4L5QA 3RLFA 4GNXB 4IPDA 1B7YB 2KBNA 1Z47A 2QGQA 4WJ4A 3CCJA 1VQKA 2UUBL 4DNIA 4AQYL 3M4QA 1SN8A 2KHJA 1GD7A 1YHQA 3LGJA 5FLMH 1GVPA 2CKZB 1HZBA 1BBUA 1EYGA 1HNXL 3GTMH 4R4CA 2YU9H 4LFAQ 4YWLA 1OXTA 4DV6L 1VQDA 4LWCA 3CPWA 3S2HH 1HNZQ 2AHOB 3HOVH 5GQOA 3CD6A 1KRSA 3F2BA 4MTNA 4B3SL 4JI6L 4JBKA 4GKKQ 1JJGA 1YEZA 2KENA 3L7ZC 1OXUA 5BR8L 5M5WH 1UE1A 3W5OA 4X66L 4IPCA 2QEXA 4R4QA 4A3CH 3I7FA 4DV0L 4PZ7A 4QY7A 1HH2P 4LF8Q 2K5NA 2KCMA 2BH2A 3OTOL 3CC4A 3GTQH 1SR3A 2BA0A 3HOWH 1XMQL 1M90C 4GLAC 2Q2UA 1QUQA 1MJEA 2IT1A 3IRBA 4JBWA 3KDFB 4A3JG 1IBMQ 4OXPA 2D0OA 1XNRL 5M3MH 2JA7H 2WB1G 4OWXB 1QVCA 1TWFH 2R92H 4JV5L 4IPHA 1IL2A 5C3EG 2UXBQ 1FL0A 4P71A 1JJCB 4P74A 4NXML 3TS0A 4LF8L 4OX9L 4JOIA 1I5FA 1TWGH 1IYJB 3ERSX 2E8GA 4DR1L 4HIKA 4DV5Q 3K80C 3U50C 3NEMA 4GN5A 4LUZA 3CCEA 4IO9A 3RN2A 2UUBQ 1XNQQ 4A3GH 3FHWA 3S14H 1PH7A 4JI5L 3S1QH 5C0XG 4GN3B 5M3FG 5FJ8G 1NY4A 2BH8A 2AKWB 4MNOA 2OQ0A 5GROA 3M85A 4KLKA 4UP9A 4GKJL 1PH9A 3A74A 4JI2Q 1JE5A 2OWOA 2B63G 4OO1I 4A3KH 3E9IA 2Y0SG 2F3IA 1PH6A 4YWMA 4DV2Q 3PO3H 4DR1Q 1CKNA 2JE6I 1D8LA 1Q12A 1I6HH 2ES2A 4LF6L 2UXCQ 3I4OA 1J6QA 4DR5Q 1JB7A 4GKKL 3AFQA 1X3GA 2IX1A 3M7NA 2CQOA 4YHHL 1EUJA 5GADC 2R7ZG 3K7AH 5H1SE 1HR0W 2VQEL 2GN5A 3CMEA 1X56A 4K0KQ 1KHIA 1K0RA 2MQHA 3SGIA 5C4XH 3PO2G 1VQJA 1PH4A 2NN6G 4PG3A 1Q82C 1VQ9A 1QUQB 4L5RC 3I4NH 1XMQQ 2VZAA 3F2CA 4AQYQ 5HGQA 2K14A 2ZM6Q 2OTJA 1W3SA 3UDGA 2N8NA 1OXSC 4JBJA 3UE1A 2WFWA 1NE3A 2YYZA 4BA1I 5JJIA 1XPUA 3F1ZA 5DLQE 1QVGA 3EBEA 4LFAL 4R4TA 2E2IH 3STBC 4C2MH 4DKAC 3OW2A 1IBLL 3M9BA 1HNZL 3JAMi 3PUXA 1N32Q 3J7ZC 5IP7H 1BKBA 3PIOA 1XNQL 4BXXH 1UE7A 2YTXA 4HIMA 1J5EL 2OQKA 1VQ6A 2PMZE 1N33L 3BU2A 2UXDL 3G4SA 5E7NA 1CKOA 2R92G 4GKJQ 2ID0A 1VQOA 2VY3A 2RHSB 2JA6H 2AWNA 3KF6A 2Z0SA 3KLWA 4HJ9A 3JC66 1VQ5A 1QVFA 1VQIA 3BZKA 1GO3E 1IBML 4LFBL 1V9PA 2DUDA 1BBWA 2JEBI 2LXJA 3FP9A 4GNXC 1XNRQ 3RZOH 4UPAA 2JK8A 3DLLA 2WP8J 3VDYA 1B8AA 2IHFA 1LM0A 4DR5L 3KF8B 3ER0A 3B6YA 1VS0A 4YHHQ 1Y1VH 4QIWE 2QA4A 4A3BH 2NVYH 1K9MC 2JJQA 3DM3A 1HZ9A 3S1NH 1RL2A 4RG1A 5LMNW 4BA2I 2B63H 4UP7A 4NPSA 1YHBA 4DV5L 1S72A 1RIPA 1O7IA 1A62A 1WJJA 2LSSA 3KJPA 1L1OA 2ZM6L 5IYCH 1YITA 2WAQG 1LYLA 1EQRA 1SROA 5J3BA 3CC7A 3EIVA 4A3LG 2RCNA 4NB3A 5ELOA 4KHPL 2Z6KA 2VUMH 1X65A 1VQCA 3ULLA 4JI2L 3BJUA 4HJAA 3CC2A 3H0GG 2H5XA 4XIGS 1SRUA 1Q46A 4DR4Q 2NVXH 3S2DH 1IZ6A 1XPRA 1XTDA 1DGSA 2C35B 4QJFA 3GD7A 4LF6Q 2Q2IA 4Y52H 4JI0L 3HKZE 1Q86C 4BBRG 2BA1A 3CQZH 3J80i 2JA5H 3AQQA 1PYSB 2LXKA 4HIDA 5GAEC 2Q2TA 5C44G 3S1MH 1E1TA 4RMFA 4P73A 4AIMA 3M4PA 4A4IA 4C3HH 1H95A 4LFCL 2CWPA 2FXQA 2HIVA 3BZCA 5EAYA 1N9WA 4YCUA 3G48A 1U5KA 2ZJPA 1CUKA 1MIUA 1WFQA 2XTIA 1YJ9A 1JJ2A 2VS1A 1K3RA 3PUZA 3U4VA 4TVAB 4DV4L 2MFIA 3CCRA 4IPGA 1N8RC 1PH2A 5JJKA 4JC0A 4YY3L 1B70B 2UU9Q 1X9NA 4YCWA 1LTLA 3I56A 1CKNB 4R4IA 1VCIA 2MO1A 1Y1WH 1N36Q 4LFCQ 3GTKH 4BBSG 4Y7NH 3K81C 2E2HH 2PI2A 3CPFA 4GOPC 1EOVA 5IP7G 2I5MX 3T1YQ 2V1CC 4JV5Q 1N33Q 2JA7G 2UXBL 2UXDQ 2Q2HA 3HOUH 4LUVA 4NXMQ 1Q8KA 1PVOA 4DV4Q 1E22A 5GAHC 3FKIG 4LF9Q 3A0JA 3GDEA 2ASBA 4P75A 4LNQA 3L2PA 2ZTCA 1VQHA 1WCMH 3A5ZB 4HJ8A 3FKIH 1KC8C 3T1YL 2JEAI 4DR6L 4IFDG 4B3RQ 1XPOA 3H15A 2NVTH 4A93H 4A3GG 1G51A 2VW9A 2I5HA 1V1QA 1PH1A 1KIXA 2CCZA 4BY7H 4A3CG 3S24A 1NJIC 1JT8A 1I50H 1VQAA 5GAGC 2ZJQA 1UEBA 2VL6A 2IY5B 4J15A 4X65Q 2K50A 4BY1G 1CSQA 4KI0A 2F52A 4B3TL 3I4MH 4JI4L 5JEAJ 4A3MG 3HKZG 3PUYA 1X3FA 3I2ZA 3CCVA 1OTCA 3CW2C 4X6AH 4DPGA 2ZJRA 3TRZA 4GOPA 2HHHL 4A3IH 4KHPQ 3TEHB 3UE0A 4LF4Q 4DK6C 4JI1Q 2B29A 1PYBA 2A8VA 1G291 2VUMG 2VNUD 4LUOA 4JYAQ 1ASZA 2VQFL 4X65L 1KL9A 4QGUA 4L5SA 4DR4L 3NELA 4YY3Q 4IOCA 1MKHA 4ME3A 5AJ3Q 1E7ZA 5C44H 4HJ5A 1C0AA 4MZ9A 2NZHA 3G6EA 1C9OA 2EXDA 1N36L 1EIYB 1FVIA 4B3TQ 4UY8C 1VQFA 4X62Q 2F4VL 1AE2A 4PZ8A 4DR3Q 4FDBA 4KHZA 3KF6B 1VQMA 3J80c 1N34Q 3M3YH 3HFZB 3KDFA 2ALYB 2JA5G 1OXXK 4JYAL 3CMAA 4OONA 1VQEA 5IYBG 3AEVA 5LMNQ 2NVQH 5M3FH 1HZAA 3HOXH 1X55A 2IX0A 4GNXA 3E9HA 1CKMA 1WOCA 1G6PA 2NZOA 2MO0A 4DR2L 1T9HA 4B3RL 1J5EQ 5IYDH 3J81c 3U58A 3GTPH 4POGA 2R7ZH 4O2DA 4P72A 1OXVA 4GS3A 3OYYA 2PQAA 3J81j 3D0FA 5IT9c 3AYHB 1VQ7A 2UUCL 4DV7L 2OCEA 3CCSA 3HOYH 3I4NG 1GKHA 3GTOH 5M5YH 2UU9L 4IFDI 3PGZA 3EN2A 4DAMA 3L0OA 4NXNL 1XJVA 3HOYG 2R93H 2JQOA 4C3JH 1SFOH 4JI4Q 1I3QH 3ZJYC 2A19A 3PF4A 1X54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH3 A;  2MNA A;  3HOV G;  3PCO B;  4DK3 C;  3T1H Q;  3MEF A;  5M3M G;  4LF4 L;  4DV7 Q;  4LF7 L;  5IP9 H;  4IOA A;  1Y14 B;  1A0I A;  4L5T A;  1I94 Q;  1PH8 A;  1A63 A;  3K7U C;  4JOI C;  4A3E H;  4A3B G;  3MXN B;  1YJW A;  4DR6 Q;  1YNX A;  5IWA Q;  1HNW Q;  3RZD H;  2B3G A;  5HY6 A;  2WAQ E;  3KYH C;  1IBK Q;  3U4Z A;  3ULJ A;  2YV5 A;  1YHA A;  4QQB X;  2CWA A;  2AWO A;  1ASY A;  3S16 H;  4DR3 L;  1TWA H;  4OWT B;  2N3S A;  5LMU Q;  4GN4 B;  4DUY Q;  3T1H L;  1YIJ A;  1K8A C;  3I4M G;  2PQA B;  2KCT A;  1N34 L;  4QL5 A;  1YBY A;  3HOW G;  1VQ8 A;  1GM5 A;  4DR7 Q;  3HKS A;  3CF5 A;  1WYD A;  1VQN A;  3PSI A;  4IJL A;  1PH5 A;  1EQQ A;  4A3D G;  3K8A A;  4GOP B;  1NMF A;  5IWA L;  5FLX c;  1E3P A;  3I55 A;  1PA6 A;  1HNW L;  4DAY B;  4HJ7 A;  1HR0 L;  1AH9 A;  3CXC A;  4DR2 Q;  5C0X J;  4JI0 Q;  2HHH Q;  5LMU L;  4DUY L;  1R9T H;  3H3V I;  1HJP A;  1Q1B A;  5BR8 Q;  1D7Q A;  1VQP A;  1YI2 A;  2HIX A;  3UDI A;  1L1O B;  3GTG H;  5C4J H;  1P8L A;  1Q1E A;  4AH6 A;  3CP0 A;  2UUC Q;  1MJC A;  1E24 A;  2VQF Q;  1NTG A;  1QZG A;  4DUZ Q;  4PZ6 A;  4HIO A;  1WI5 A;  3OTO Q;  1C7Y A;  4NXN Q;  4XTC S;  4A93 G;  1YZ6 A;  3H0G H;  5IYB H;  4X62 L;  3HOZ G;  4B3M L;  2K52 A;  1Z9F A;  5K36 G;  1NBW A;  1EIF A;  3KFU A;  1IXR A;  4JG2 A;  3W1B A;  3CCM A;  3AFP A;  1KD1 C;  4LF5 Q;  5FLM G;  1VQL A;  5IE8 A;  2YTV A;  1I94 L;  1QZH A;  4BBR H;  2HQL A;  1EWI A;  4APV A;  2K75 A;  4A75 A;  3GO5 A;  4A3M H;  2OTL A;  3K0X A;  4A3L H;  3TS2 A;  4GLX A;  2AMC B;  3HOX G;  4B3M Q;  4X64 Q;  1IBK L;  4DV3 L;  3PUW A;  2R93 G;  5IYD G;  2XGT A;  4JI5 Q;  2RF4 A;  2Z6K C;  2E5L L;  3TRE A;  1S3O A;  3M4O H;  1L0W A;  1YVC A;  5JEA G;  2ZTE A;  5ELN A;  2ATW A;  2IHE A;  3PV0 A;  2E2J H;  2R7F A;  1M1K C;  3PO3 G;  3S15 H;  4DR7 L;  1X3E A;  1JMC A;  1PFS A;  3RR5 A;  4YWK A;  3UDX A;  3J81 i;  1PV4 A;  2PI2 E;  1FJG L;  3UDF A;  5IP9 G;  2JA8 H;  4DV2 L;  3H3V H;  4JI7 Q;  4JI8 Q;  2JA6 G;  4A76 A;  4LF9 L;  4X64 L;  2GVA A;  1HR0 Q;  3J7A 5;  4DV3 Q;  3TQY A;  5M5X H;  3RN5 A;  4A3J H;  4EX5 A;  1VQB A;  1YJN A;  1Q7Y C;  2UXC L;  1SE8 A;  2YTY A;  3S17 H;  1PHJ A;  4LF7 Q;  3W1G A;  1UWV A;  2UUA Q;  1V43 A;  1TWH H;  1AE3 A;  4AYB E;  2VQE Q;  1SLJ A;  4POF A;  4DUZ L;  2I5L X;  4DV1 Q;  1CSP A;  2N49 A;  2ZTD A;  4A3E G;  1EFW A;  4JI7 L;  4JI8 L;  1UE5 A;  1LUZ A;  4WJ3 M;  1HZC A;  4YCV A;  3HOU G;  2KHI A;  4IFD J;  1L1O C;  1XMO Q;  1WCM G;  4JI6 Q;  1FGU A;  4LW1 A;  4R4O A;  4JI3 Q;  4JI1 L;  1X6O A;  2GVB A;  4X66 Q;  1K73 C;  4JBM A;  2UUA L;  1SMX A;  3F8T A;  3GTJ H;  4DV0 Q;  4LF5 L;  4BBS H;  3KOJ A;  4BY7 G;  1Q81 C;  1Y1V G;  4DV1 L;  3NBH B;  5AJ3 L;  3PUV A;  4H02 A;  4A3K G;  1IBL Q;  4A3D H;  1U0L A;  2HT1 A;  4R1J A;  2NN6 I;  4BXX G;  2F4V Q;  3KJO A;  1N32 L;  1BVS A;  3CCL A;  1XMO L;  2R7D A;  3CCQ A;  2R6G A;  4BY1 H;  3PF5 A;  2E5L Q;  4JI3 L;  1K83 H;  5IYC G;  1K8G A;  2RHQ B;  2A1A A;  1TWC H;  1TXY A;  1KQS A;  4UP8 A;  1HNX Q;  2I0Q A;  3CAM A;  3S1R H;  4OX9 Q;  5LMN L;  2D0P A;  4DV6 Q;  3JAM c;  3RNU A;  4LFB Q;  4TQU S;  1VQ4 A;  3RLO A;  5C3E H;  4ALP A;  3CCU A;  1NMG A;  4B3S Q;  2EIF A;  4EQ5 A;  2PNH A;  4OWW B;  2JA9 A;  3GTL H;  3HOZ H;  1VQG A;  4AYB G;  4OO1 G;  3A5U A;  2K5V A;  2K4K A;  4JCV E;  2EQS A;  5C0X I;  2N78 A;  1E1O A;  1UE6 A;  1W2B A;  4A3F H;  4IJH A;  2DGY A;  2D62 A;  4A3F G;  1KRT A;  4A3I G;  1S40 A;  5FJ8 H;  3WWV A;  1KXL A;  1L2F A;  1KAW A;  2JA8 G;  3PIP A;  4O0A A;  4PMW A;  2CFM A;  3D31 A;  3Q8D A;  1Y1W G;  1A8V A;  3NEN A;  4C3I H;  3RLN A;  3G71 A;  3E0E A;  2K5H A;  4GLV B;  5C4X G;  2WB1 E;  5JJL A;  2Y0S E;  3PO2 H;  3F2D A;  4K0K L;  3ICE A;  5IY0 A;  3STB D;  1FJG Q;  1P16 A;  2L15 A;  3ULP A;  4L5Q A;  3RLF A;  4GNX B;  4IPD A;  1B7Y B;  2KBN A;  1Z47 A;  2QGQ A;  4WJ4 A;  3CCJ A;  1VQK A;  2UUB L;  4DNI A;  4AQY L;  3M4Q A;  1SN8 A;  2KHJ A;  1GD7 A;  1YHQ A;  3LGJ A;  5FLM H;  1GVP A;  2CKZ B;  1HZB A;  1BBU A;  1EYG A;  1HNX L;  3GTM H;  4R4C A;  2YU9 H;  4LFA Q;  4YWL A;  1OXT A;  4DV6 L;  1VQD A;  4LWC A;  3CPW A;  3S2H H;  1HNZ Q;  2AHO B;  3HOV H;  5GQO A;  3CD6 A;  1KRS A;  3F2B A;  4MTN A;  4B3S L;  4JI6 L;  4JBK A;  4GKK Q;  1JJG A;  1YEZ A;  2KEN A;  3L7Z C;  1OXU A;  5BR8 L;  5M5W H;  1UE1 A;  3W5O A;  4X66 L;  4IPC A;  2QEX A;  4R4Q A;  4A3C H;  3I7F A;  4DV0 L;  4PZ7 A;  4QY7 A;  1HH2 P;  4LF8 Q;  2K5N A;  2KCM A;  2BH2 A;  3OTO L;  3CC4 A;  3GTQ H;  1SR3 A;  2BA0 A;  3HOW H;  1XMQ L;  1M90 C;  4GLA C;  2Q2U A;  1QUQ A;  1MJE A;  2IT1 A;  3IRB A;  4JBW A;  3KDF B;  4A3J G;  1IBM Q;  4OXP A;  2D0O A;  1XNR L;  5M3M H;  2JA7 H;  2WB1 G;  4OWX B;  1QVC A;  1TWF H;  2R92 H;  4JV5 L;  4IPH A;  1IL2 A;  5C3E G;  2UXB Q;  1FL0 A;  4P71 A;  1JJC B;  4P74 A;  4NXM L;  3TS0 A;  4LF8 L;  4OX9 L;  4JOI A;  1I5F A;  1TWG H;  1IYJ B;  3ERS X;  2E8G A;  4DR1 L;  4HIK A;  4DV5 Q;  3K80 C;  3U50 C;  3NEM A;  4GN5 A;  4LUZ A;  3CCE A;  4IO9 A;  3RN2 A;  2UUB Q;  1XNQ Q;  4A3G H;  3FHW A;  3S14 H;  1PH7 A;  4JI5 L;  3S1Q H;  5C0X G;  4GN3 B;  5M3F G;  5FJ8 G;  1NY4 A;  2BH8 A;  2AKW B;  4MNO A;  2OQ0 A;  5GRO A;  3M85 A;  4KLK A;  4UP9 A;  4GKJ L;  1PH9 A;  3A74 A;  4JI2 Q;  1JE5 A;  2OWO A;  2B63 G;  4OO1 I;  4A3K H;  3E9I A;  2Y0S G;  2F3I A;  1PH6 A;  4YWM A;  4DV2 Q;  3PO3 H;  4DR1 Q;  1CKN A;  2JE6 I;  1D8L A;  1Q12 A;  1I6H H;  2ES2 A;  4LF6 L;  2UXC Q;  3I4O A;  1J6Q A;  4DR5 Q;  1JB7 A;  4GKK L;  3AFQ A;  1X3G A;  2IX1 A;  3M7N A;  2CQO A;  4YHH L;  1EUJ A;  5GAD C;  2R7Z G;  3K7A H;  5H1S E;  1HR0 W;  2VQE L;  2GN5 A;  3CME A;  1X56 A;  4K0K Q;  1KHI A;  1K0R A;  2MQH A;  3SGI A;  5C4X H;  3PO2 G;  1VQJ A;  1PH4 A;  2NN6 G;  4PG3 A;  1Q82 C;  1VQ9 A;  1QUQ B;  4L5R C;  3I4N H;  1XMQ Q;  2VZA A;  3F2C A;  4AQY Q;  5HGQ A;  2K14 A;  2ZM6 Q;  2OTJ A;  1W3S A;  3UDG A;  2N8N A;  1OXS C;  4JBJ A;  3UE1 A;  2WFW A;  1NE3 A;  2YYZ A;  4BA1 I;  5JJI A;  1XPU A;  3F1Z A;  5DLQ E;  1QVG A;  3EBE A;  4LFA L;  4R4T A;  2E2I H;  3STB C;  4C2M H;  4DKA C;  3OW2 A;  1IBL L;  3M9B A;  1HNZ L;  3JAM i;  3PUX A;  1N32 Q;  3J7Z C;  5IP7 H;  1BKB A;  3PIO A;  1XNQ L;  4BXX H;  1UE7 A;  2YTX A;  4HIM A;  1J5E L;  2OQK A;  1VQ6 A;  2PMZ E;  1N33 L;  3BU2 A;  2UXD L;  3G4S A;  5E7N A;  1CKO A;  2R92 G;  4GKJ Q;  2ID0 A;  1VQO A;  2VY3 A;  2RHS B;  2JA6 H;  2AWN A;  3KF6 A;  2Z0S A;  3KLW A;  4HJ9 A;  3JC6 6;  1VQ5 A;  1QVF A;  1VQI A;  3BZK A;  1GO3 E;  1IBM L;  4LFB L;  1V9P A;  2DUD A;  1BBW A;  2JEB I;  2LXJ A;  3FP9 A;  4GNX C;  1XNR Q;  3RZO H;  4UPA A;  2JK8 A;  3DLL A;  2WP8 J;  3VDY A;  1B8A A;  2IHF A;  1LM0 A;  4DR5 L;  3KF8 B;  3ER0 A;  3B6Y A;  1VS0 A;  4YHH Q;  1Y1V H;  4QIW E;  2QA4 A;  4A3B H;  2NVY H;  1K9M C;  2JJQ A;  3DM3 A;  1HZ9 A;  3S1N H;  1RL2 A;  4RG1 A;  5LMN W;  4BA2 I;  2B63 H;  4UP7 A;  4NPS A;  1YHB A;  4DV5 L;  1S72 A;  1RIP A;  1O7I A;  1A62 A;  1WJJ A;  2LSS A;  3KJP A;  1L1O A;  2ZM6 L;  5IYC H;  1YIT A;  2WAQ G;  1LYL A;  1EQR A;  1SRO A;  5J3B A;  3CC7 A;  3EIV A;  4A3L G;  2RCN A;  4NB3 A;  5ELO A;  4KHP L;  2Z6K A;  2VUM H;  1X65 A;  1VQC A;  3ULL A;  4JI2 L;  3BJU A;  4HJA A;  3CC2 A;  3H0G G;  2H5X A;  4XIG S;  1SRU A;  1Q46 A;  4DR4 Q;  2NVX H;  3S2D H;  1IZ6 A;  1XPR A;  1XTD A;  1DGS A;  2C35 B;  4QJF A;  3GD7 A;  4LF6 Q;  2Q2I A;  4Y52 H;  4JI0 L;  3HKZ E;  1Q86 C;  4BBR G;  2BA1 A;  3CQZ H;  3J80 i;  2JA5 H;  3AQQ A;  1PYS B;  2LXK A;  4HID A;  5GAE C;  2Q2T A;  5C44 G;  3S1M H;  1E1T A;  4RMF A;  4P73 A;  4AIM A;  3M4P A;  4A4I A;  4C3H H;  1H95 A;  4LFC L;  2CWP A;  2FXQ A;  2HIV A;  3BZC A;  5EAY A;  1N9W A;  4YCU A;  3G48 A;  1U5K A;  2ZJP A;  1CUK A;  1MIU A;  1WFQ A;  2XTI A;  1YJ9 A;  1JJ2 A;  2VS1 A;  1K3R A;  3PUZ A;  3U4V A;  4TVA B;  4DV4 L;  2MFI A;  3CCR A;  4IPG A;  1N8R C;  1PH2 A;  5JJK A;  4JC0 A;  4YY3 L;  1B70 B;  2UU9 Q;  1X9N A;  4YCW A;  1LTL A;  3I56 A;  1CKN B;  4R4I A;  1VCI A;  2MO1 A;  1Y1W H;  1N36 Q;  4LFC Q;  3GTK H;  4BBS G;  4Y7N H;  3K81 C;  2E2H H;  2PI2 A;  3CPF A;  4GOP C;  1EOV A;  5IP7 G;  2I5M X;  3T1Y Q;  2V1C C;  4JV5 Q;  1N33 Q;  2JA7 G;  2UXB L;  2UXD Q;  2Q2H A;  3HOU H;  4LUV A;  4NXM Q;  1Q8K A;  1PVO A;  4DV4 Q;  1E22 A;  5GAH C;  3FKI G;  4LF9 Q;  3A0J A;  3GDE A;  2ASB A;  4P75 A;  4LNQ A;  3L2P A;  2ZTC A;  1VQH A;  1WCM H;  3A5Z B;  4HJ8 A;  3FKI H;  1KC8 C;  3T1Y L;  2JEA I;  4DR6 L;  4IFD G;  4B3R Q;  1XPO A;  3H15 A;  2NVT H;  4A93 H;  4A3G G;  1G51 A;  2VW9 A;  2I5H A;  1V1Q A;  1PH1 A;  1KIX A;  2CCZ A;  4BY7 H;  4A3C G;  3S24 A;  1NJI C;  1JT8 A;  1I50 H;  1VQA A;  5GAG C;  2ZJQ A;  1UEB A;  2VL6 A;  2IY5 B;  4J15 A;  4X65 Q;  2K50 A;  4BY1 G;  1CSQ A;  4KI0 A;  2F52 A;  4B3T L;  3I4M H;  4JI4 L;  5JEA J;  4A3M G;  3HKZ G;  3PUY A;  1X3F A;  3I2Z A;  3CCV A;  1OTC A;  3CW2 C;  4X6A H;  4DPG A;  2ZJR A;  3TRZ A;  4GOP A;  2HHH L;  4A3I H;  4KHP Q;  3TEH B;  3UE0 A;  4LF4 Q;  4DK6 C;  4JI1 Q;  2B29 A;  1PYB A;  2A8V A;  1G29 1;  2VUM G;  2VNU D;  4LUO A;  4JYA Q;  1ASZ A;  2VQF L;  4X65 L;  1KL9 A;  4QGU A;  4L5S A;  4DR4 L;  3NEL A;  4YY3 Q;  4IOC A;  1MKH A;  4ME3 A;  5AJ3 Q;  1E7Z A;  5C44 H;  4HJ5 A;  1C0A A;  4MZ9 A;  2NZH A;  3G6E A;  1C9O A;  2EXD A;  1N36 L;  1EIY B;  1FVI A;  4B3T Q;  4UY8 C;  1VQF A;  4X62 Q;  2F4V L;  1AE2 A;  4PZ8 A;  4DR3 Q;  4FDB A;  4KHZ A;  3KF6 B;  1VQM A;  3J80 c;  1N34 Q;  3M3Y H;  3HFZ B;  3KDF A;  2ALY B;  2JA5 G;  1OXX K;  4JYA L;  3CMA A;  4OON A;  1VQE A;  5IYB G;  3AEV A;  5LMN Q;  2NVQ H;  5M3F H;  1HZA A;  3HOX H;  1X55 A;  2IX0 A;  4GNX A;  3E9H A;  1CKM A;  1WOC A;  1G6P A;  2NZO A;  2MO0 A;  4DR2 L;  1T9H A;  4B3R L;  1J5E Q;  5IYD H;  3J81 c;  3U58 A;  3GTP H;  4POG A;  2R7Z H;  4O2D A;  4P72 A;  1OXV A;  4GS3 A;  3OYY A;  2PQA A;  3J81 j;  3D0F A;  5IT9 c;  3AYH B;  1VQ7 A;  2UUC L;  4DV7 L;  2OCE A;  3CCS A;  3HOY H;  3I4N G;  1GKH A;  3GTO H;  5M5Y H;  2UU9 L;  4IFD I;  3PGZ A;  3EN2 A;  4DAM A;  3L0O A;  4NXN L;  1XJV A;  3HOY G;  2R93 H;  2JQO A;  4C3J H;  1SFO H;  4JI4 Q;  1I3Q H;  3ZJY C;  2A19 A;  3PF4 A;  1X54 A; 
#chains in the Genus database with same CATH topology
 3HOV G;  3PO2 B;  3T1H Q;  1S5F D;  1Y14 B;  4DA2 A;  5E4W C;  4JOI C;  1LTG D;  2F0O A;  2BDN A;  3HS0 C;  1HNW Q;  3P1H A;  1GHK A;  4J6H A;  5ISR A;  3DMU A;  3ULJ A;  2AWO A;  1K8A C;  2N3S A;  4DUY Q;  3NSW A;  2MHV A;  2PW5 A;  1YBY A;  4DR7 Q;  2BOS A;  1VQN A;  2AQ3 B;  3A7A B;  1E2Z A;  4H7B A;  4DK0 A;  3K8A A;  4TSS A;  5IWA L;  1F2M A;  3QO2 A;  4H44 C;  1BQQ T;  1HR0 L;  4DR2 Q;  5IGB A;  1R9T H;  1WTH A;  2HIX A;  3TZD A;  3UDI A;  1STG A;  2EPB A;  1H9S A;  1SYG A;  2FHT A;  3HOX B;  1MJC A;  3NTK A;  1E24 A;  1EFI D;  4ZAI A;  4PZ6 A;  2KUM A;  1ET6 A;  1RJT A;  1C7Y A;  4PNY A;  1EY4 A;  3H0G H;  2KEC A;  1EWC A;  1NBW A;  4A3D B;  1HHV A;  1EIF A;  3W1B A;  1L0Y B;  5FLM G;  4QB4 A;  1MI2 A;  3VR5 A;  5IE8 A;  1I94 L;  4MHE A;  1EWI A;  3IFD A;  5C3W A;  4A75 A;  2OTL A;  1I4G A;  4A3L H;  3K5L A;  4CJ2 C;  5DM6 3;  4B3M Q;  5CGK A;  4DV3 L;  3PUW A;  5IYD G;  3NHH A;  3TRE A;  4RHR A;  3M4O H;  1YVC A;  2V4D A;  3KUP A;  2ATW A;  3PV0 A;  3S15 H;  2R7F A;  3PO3 G;  1ESR A;  1B3A A;  1TT2 A;  1PV4 A;  5IP9 G;  1EYC A;  1U4P A;  4JI8 Q;  4QF4 A;  3J7A 5;  5A2Q E;  2WKD A;  1SAP A;  2UXC L;  1KNE A;  1Q7Y C;  1JOQ A;  2RQX A;  3S17 H;  3LWU A;  1ILQ A;  2CW0 C;  3W1G A;  1UWV A;  5EPJ A;  1CT1 D;  1V43 A;  1SLJ A;  1HUM A;  5EKI A;  1JWM D;  2I5L X;  4DV1 Q;  4A3E G;  4JI7 L;  1UE5 A;  2N55 A;  2DJG C;  2BE5 C;  2KHI A;  2WV6 D;  1WCM G;  4X3T A;  4JI6 Q;  1FGU A;  4LK1 C;  4R4O A;  4JI1 L;  1K73 C;  4X66 Q;  3F8T A;  4LF5 L;  4BBS H;  2NZ1 D;  1Q81 C;  1Y1V G;  3PUV A;  5L37 A;  3KJO A;  1CA5 A;  3PF5 A;  1K8G A;  1CHP D;  1VF5 C;  1TWC H;  1RKN A;  1TXY A;  1R9T B;  2I0Q A;  3E0J A;  4OL7 A;  4OX9 Q;  2D0P A;  3JAM c;  2EE1 A;  2K5Q A;  2K04 A;  3RLO A;  2ZXR A;  4EVO A;  4ALP A;  1M8A A;  2JYO A;  4C3I B;  1F9S A;  4FP5 D;  2JA9 A;  1QCB D;  2HCC A;  4YIJ A;  1QG7 A;  3BVG A;  4A3K B;  1GUO A;  1U4R A;  3LNN A;  1CM9 A;  1W2B A;  1UE6 A;  4IJH A;  1T5X D;  2D62 A;  4HCS A;  4A3F G;  3EVQ A;  1B53 A;  3KLS X;  3BZD B;  2EY5 A;  3K7A B;  2O2L D;  3NEN A;  5NUC A;  3RLN A;  5C4X B;  4BBS B;  3FPU B;  2NBF A;  2SDF A;  4JVZ A;  4F88 A;  1Z47 A;  4RWS C;  3FKI B;  3M4Q A;  1TII D;  3LWE A;  2JA5 B;  3SR1 A;  4G57 A;  1DOL A;  2A74 C;  3RUZ A;  4KK7 A;  1BBU A;  3TP8 A;  2YU9 H;  1EWH A;  1Y1W B;  4LWC A;  1PZK D;  1HNZ Q;  2AHO B;  2A69 C;  1YNJ C;  5GQO A;  3HOV H;  5BN3 A;  2Z9H A;  5BN5 A;  2ZXP A;  3F2B A;  4JBK A;  2J4X A;  2KEN A;  1WD0 A;  5M5W H;  2QEX A;  1XTC D;  3J81 E;  3I7F A;  4LF8 Q;  4KD4 A;  3CC4 A;  1XMQ L;  2Q2U A;  3KK7 A;  1IBM Q;  3IRB A;  3S1M B;  4CHT B;  4A3J G;  2D0O A;  1LLR D;  1O80 A;  1K28 A;  1UNS A;  5M3M H;  1XNR L;  1HUN A;  1A3V A;  4OWX B;  1QVC A;  1EY9 A;  4A3B B;  1IL2 A;  2UXB Q;  2A6E C;  3FDT A;  1H9R A;  1JJC B;  1Z6H A;  1SYC A;  1I5F A;  1TWG H;  3P20 A;  2H1E A;  2M2L A;  1LTB D;  3RN2 A;  4A3G H;  4IO9 A;  4IUN A;  4X3U A;  5FJ8 G;  3HZX A;  5A35 A;  1V1P A;  5ELE A;  4UP9 A;  1DOK A;  3A74 A;  2B63 G;  4A3K H;  3OPO A;  1PH6 A;  3K57 A;  4DR1 Q;  1CKN A;  4HED A;  2ES2 A;  4ZKB B;  3DHQ A;  2UXC Q;  1BR9 A;  3I4O A;  3OHX C;  4IUU A;  3AFQ A;  3M7N A;  2B2Y C;  1BOS A;  1HR0 W;  3S2H B;  4K0K Q;  5EJW A;  1A2U A;  2MQH A;  5C4X H;  5M3F B;  1PTO B;  1FD7 D;  1F77 A;  1VQJ A;  4N8X 1;  2F0M A;  2NN6 G;  4L5R C;  3MXU A;  4P2C B;  1SE3 A;  5DNF A;  3I4N H;  3OWF A;  2VZA A;  3CKI B;  3F2C A;  4AQY Q;  2ZM6 Q;  2OTJ A;  2HDL A;  1ICW A;  2K5D A;  2F0E A;  4JBJ A;  2WFW A;  3UE1 A;  3D4W A;  1YNJ D;  1TWG B;  2NVQ B;  2ENB A;  2EYO A;  1QVG A;  2QDL A;  3EBE A;  4LFA L;  3STB C;  4DKA C;  3I72 A;  5I6Y A;  3JAM i;  1I3Q B;  3PUX A;  1KTK A;  4MTK A;  5IP7 H;  1NSN S;  4HIM A;  1J5E L;  2OQK A;  5KNB A;  2PMZ E;  2UXD L;  1A15 A;  2JA6 H;  1K83 B;  2AWN A;  3KF6 A;  3JC6 6;  4QMG A;  1GO3 E;  1V9P A;  1BBW A;  2WII B;  2JK8 A;  1DOM A;  4IUV A;  1GXD C;  1ILP A;  1YNN D;  1LM0 A;  2FIN B;  3M7G A;  4YHH Q;  3PIO 3;  3HOZ B;  4QIW E;  2G9D A;  2PPB C;  3DM3 A;  2RCF A;  1GHJ A;  4RG1 A;  4BA2 I;  4UP7 A;  4BBR B;  1A62 A;  1B9N A;  1WJJ A;  5M5Y B;  1TS4 A;  1LYL A;  2KA7 A;  3EIV A;  4A3L G;  2RCN A;  2VUM H;  3H0G G;  1JR0 D;  2DN8 A;  4OEM B;  1ONL A;  3S2D H;  1ZYR D;  1XPR A;  3MVV A;  1XTD A;  1FNW A;  2C35 B;  4QJF A;  3SK4 A;  1D1K A;  1UEA B;  2BA1 A;  3CQZ H;  4IQZ A;  2Q2T A;  3M4P A;  4C3H H;  2CWP A;  3BZC A;  4ZRZ A;  2O5I C;  1CUK A;  1MIU A;  1JJ2 A;  2VS1 A;  5CV5 A;  1K3R A;  3QB3 A;  3S1N B;  1C8C A;  2JA8 B;  2IL8 A;  4IPG A;  1PH2 A;  1Y8O B;  4JC0 A;  1CQV A;  5C4J B;  2RSN A;  1X9N A;  4YCW A;  1ZXT A;  1Y1W H;  1VCI A;  1N36 Q;  2O5J C;  3D4R A;  3S15 B;  2UXB L;  2PYK A;  4KJN A;  2EJG C;  1SYE A;  4LUV A;  3SK8 A;  2TSS A;  5TSS A;  1E22 A;  1E2V A;  5GAH C;  4L8J A;  2EYF A;  4JPB W;  1F2L A;  3A5Z B;  1VQH A;  1WCM H;  1AZQ A;  2JEA I;  3UI2 A;  5T1I A;  2NVT H;  1JQY D;  1G51 A;  4KY5 A;  1V1Q A;  2SEB D;  4BY7 H;  1LTA D;  4CDC C;  5GAG C;  1A3T A;  4DGZ A;  1EIH A;  4C56 C;  4EQN A;  3N52 A;  2F52 A;  1PDQ A;  4EGV A;  2OXP A;  4C3J B;  5K5P A;  3I70 A;  1G6Z A;  1JOK A;  4HMJ A;  3G6J B;  1HCZ A;  2VUM G;  1G29 1;  3C1F A;  4B08 A;  3NEL A;  4YY3 Q;  4ME3 A;  5AJ3 Q;  5C44 H;  4MZ9 A;  2JSO A;  1EY6 A;  2EXD A;  4H13 C;  2EXZ A;  1KLU D;  4FDB A;  4KHZ A;  3J80 c;  1SYB A;  1RHP A;  3P75 A;  3HFZ B;  5KEE A;  2ALY B;  3SHL A;  3CMA A;  2GA4 B;  3MXG A;  4OON A;  1VQE A;  3T4A C;  3AEV A;  5LMN Q;  5CBE E;  5M3F H;  1HZA A;  4HAE A;  2IX0 A;  3V96 A;  4FXK C;  4DR2 L;  1J5E Q;  4RGM A;  3J81 c;  1BXT A;  3AU7 A;  4KN7 C;  5D14 A;  3X3N A;  1XX8 A;  4NKL A;  3J81 j;  1VQ7 A;  3HP3 A;  4I7Z C;  3QOL A;  3CCS A;  3HOY H;  3S9W A;  3I4N G;  1GKH A;  5KIX A;  5M5Y H;  2UU9 L;  2CW0 D;  4DAM A;  3L0O A;  1D5X C;  4C3J H;  4JI4 Q;  2E2D C;  3VR6 A;  1X54 A;  2MNA A;  2RA4 A;  4DK3 C;  3MEF A;  4X3S A;  4DV7 Q;  1A3U A;  5C5L A;  4DNR B;  1Q90 A;  1I94 Q;  1A63 A;  1STN A;  3MXN B;  1YJW A;  4DR6 Q;  1YNX A;  4KY6 A;  3A54 A;  1GJX A;  3HGB A;  3PQI A;  1O78 A;  1YHA A;  4X3K A;  3S16 H;  1TWA H;  5LMU Q;  3I4M G;  2PQA B;  1IYU A;  2KCT A;  1N34 L;  1GM5 A;  2PCF B;  3HKS A;  1B1Z A;  4IJL A;  1EQQ A;  4A3D G;  1ENF A;  4GOP B;  1D1I A;  1NMF A;  5FLX c;  1E3P A;  1PA6 A;  1E2W A;  3A8I E;  3ZYY X;  4DAY B;  4HJ7 A;  3MWY W;  4RAU C;  5C0X J;  2F0K A;  2OT2 A;  1H9J A;  2L12 A;  2HHH Q;  1EIG A;  3NXW A;  1Q1B A;  5C4J H;  2D2C C;  2UUC Q;  3CP0 A;  2XIW A;  1NTG A;  1QZG A;  3OTO Q;  1IW7 D;  4A93 G;  5IYB H;  4X62 L;  4N9T A;  1Z9F A;  3D3R A;  1SNQ A;  1IXR A;  1M4V A;  3AFP A;  1DZ1 A;  3K5M A;  4LF5 Q;  2YTV A;  5HGT A;  4BBR H;  2HQL A;  4APV A;  3GO5 A;  3NK9 A;  4CGY B;  1WTW A;  2BE5 D;  3J80 E;  1E0B A;  3MZ5 A;  1ESF A;  2Z6K C;  2E2H B;  2NN6 H;  1L0W A;  2ZTE A;  4OIK A;  1PFS A;  3RR5 A;  3AB9 A;  3BVZ A;  4YWK A;  2B2U A;  3UDF A;  2JA8 H;  2JA6 G;  2F0W A;  4X64 L;  3GTK B;  3RN5 A;  3GTG B;  1YJN A;  1MSG A;  2QW7 A;  1HQR D;  1SE8 A;  2YTY A;  4XQQ A;  1ET9 A;  4LF7 Q;  1G2S A;  1IYV A;  5EKK A;  4CDD C;  1AE3 A;  1LT4 D;  4POF A;  1I50 B;  3I8Z A;  1EFW A;  3DM1 A;  3CRL C;  1LUZ A;  3K59 A;  4WJ3 M;  1WTQ A;  4YCV A;  2A5H A;  4IFD J;  3D6C A;  1QB5 D;  4LW1 A;  1X6O A;  1XXG A;  2UUA L;  1SMX A;  4WOR A;  4F8M A;  2L4N A;  2F0I A;  5KGU A;  5AJ3 L;  4A3K G;  2NN6 I;  1N32 L;  1JCK B;  3OMC A;  1S5D D;  1BVS A;  4Q0F A;  3DWA A;  2EYH A;  2R7D A;  1XMO L;  3CCL A;  3H6M A;  2F0V A;  1K83 H;  4JI3 L;  5IYC G;  2RDF A;  4A3F B;  4XT3 B;  3BS1 A;  4UP8 A;  1KQS A;  1LAB A;  4CJ1 B;  5LMN L;  1HA5 A;  4K2L A;  3KF8 A;  5ELB A;  4XQN A;  1LT3 D;  1UUP A;  3C3L A;  4LFB Q;  3CCU A;  2R61 A;  4AYB G;  2FMC A;  2CQA A;  1AFP A;  2D5D A;  2E75 C;  1E1O A;  5EBC A;  2NVX B;  4HSV A;  2K05 A;  1I4H A;  4LAA A;  1AW7 A;  1HFN A;  1BUV T;  1EQT A;  4A3I G;  1LT5 D;  3NQT A;  4FF4 A;  1KAW A;  1JC7 A;  1Y1W G;  1A8V A;  1O7Y A;  3HG9 A;  2QKI C;  2K5H A;  4XXE A;  4DF7 A;  2YU9 B;  2M9V A;  2Y0S E;  1U9R A;  3F2D A;  3PO2 H;  5JJL A;  4K0K L;  4RCO A;  3QWN A;  3FRP B;  1PTO F;  4GNX B;  4IPD A;  2QGQ A;  4TRD A;  4AQY L;  3CQZ B;  3DEP A;  1YHQ A;  2QF7 A;  3LGJ A;  1GVP A;  1RF2 D;  3S1R B;  2CKZ B;  4A3J B;  3GTM H;  3J7Y W;  4R4C A;  2MGS A;  4LFA Q;  1HQM C;  4DV6 L;  1VQD A;  3CPW A;  3S2H H;  1PTO H;  3CD6 A;  1KRS A;  2CH4 W;  1YEZ A;  1OXU A;  3TP6 A;  1NR2 A;  4IPC A;  2K5W A;  4PZ7 A;  3H3V C;  2K5N A;  3BDL A;  3OTO L;  2CVR A;  4PMC A;  3GTQ H;  3E6Z X;  4B9X A;  1QUQ A;  2IT1 A;  1I4R A;  2Z4H A;  1ROD A;  2JA7 H;  2JP1 A;  2DY8 A;  4P71 A;  2XRS D;  4JOI A;  2EZV A;  3QG1 A;  3ERS X;  2Z4I A;  3GV3 A;  1VMP A;  5M5X B;  3K80 C;  3NEM A;  2NTS A;  4LUZ A;  3D8G A;  2UUB Q;  3R3O A;  3S14 H;  5M3F G;  2KVM A;  3MXP A;  4MNO A;  4K14 A;  1TY0 A;  4Z9C B;  1PH9 A;  5EQ0 A;  2OWO A;  3E9I A;  1TVX A;  2F3I A;  3Q23 A;  1C4Q A;  3PO3 H;  3Q6S A;  2A6H C;  2Q8R E;  3QIA A;  2OEO A;  1GUT A;  3RD4 A;  2KCN A;  4J8Q A;  1JB7 A;  3S1Q B;  1W6K A;  2A69 D;  2CQO A;  4YHH L;  2R7Z G;  5H1S E;  4LMQ D;  1K3B C;  2JN4 A;  4IN3 A;  3FVQ A;  2K01 A;  2KHS A;  2K28 A;  3PO2 G;  3HOV B;  2RBM A;  1PH4 A;  1VQ9 A;  5K36 H;  3W3A A;  1JOR A;  1I6V C;  4L6T B;  1SNO A;  4KJO A;  5HGQ A;  2PZU A;  1W3S A;  4RGN A;  4XT1 B;  3S2D B;  1OXS C;  1QNU A;  2K03 A;  4NP5 A;  5JJI A;  5DLQ E;  2LY7 A;  3QR8 A;  1U4L A;  3SEB A;  5JPM C;  2R93 B;  2F0D A;  1N32 Q;  3PIO A;  1XNQ L;  1EYA A;  1UE7 A;  2YTX A;  4C1N K;  5IGG A;  1EEI D;  4RCN A;  1LTT D;  1CKO A;  5FKA C;  1AN8 A;  2ID0 A;  1VQO A;  4GKJ Q;  2VY3 A;  1SMY D;  4HJ9 A;  3T53 B;  2Z0S A;  1VQ5 A;  2O4X A;  1Y8P B;  1QVF A;  1VQI A;  3BZK A;  4LFB L;  2IPK D;  2JEB I;  2LXJ A;  4UPA A;  4RFB A;  2F4I A;  3H0G B;  2F0G A;  2PW7 A;  2IHF A;  5IGF A;  4OEL B;  3FPP A;  1IKM A;  4PMB A;  4K2K A;  1RL2 A;  2B63 H;  3KJP A;  3GTO B;  2RVL A;  5J3B A;  1SRO A;  3CC7 A;  1X65 A;  1VQC A;  3NP8 A;  3S14 B;  4JI2 L;  3FEW X;  1WTO A;  5E3F A;  4HJA A;  3CC2 A;  3U9O A;  4V0B A;  4XIG S;  1Q46 A;  4RGT A;  2NVX H;  5CMD A;  1J8I A;  3GD7 A;  2QEJ C;  1K0S A;  4LF6 Q;  4JI0 L;  5ELD A;  2JA5 H;  1LTS D;  3GTQ B;  2P5Z X;  4HID A;  5M9O A;  5C44 G;  5EKL A;  4AIM A;  1STY A;  2K6A A;  1H95 A;  2FXQ A;  3TZU A;  3GP7 A;  4YCU A;  5C3X A;  4K6D A;  1WFQ A;  2L0C A;  3TBI B;  4G7O C;  1HPC A;  1WVL A;  3NTH A;  1TQO A;  3PUZ A;  3U4V A;  5FLX E;  3TP7 A;  2MFI A;  3CCR A;  1AZP A;  5T1G A;  5JJK A;  4YY3 L;  2UU9 Q;  1LTL A;  4LFC Q;  4R4I A;  2G9H D;  2DY7 A;  4Y7N H;  3K81 C;  1NUC A;  3OOC A;  2E2H H;  2CHB D;  2EY6 A;  4GOP C;  2E2J B;  1N33 Q;  1F2Z A;  1V1P B;  4FNF A;  1PVO A;  4DV4 Q;  2R3Z A;  1EY7 A;  2ASB A;  4LNQ A;  3OW7 A;  4C3J G;  2ZTC A;  4DR6 L;  3SK5 A;  5KNC A;  2PNR C;  3R93 A;  4A93 H;  4A3G G;  2VW9 A;  1KIX A;  1G2T A;  3S24 A;  1NJI C;  1VQA A;  4N8F A;  1ML0 D;  1UEB A;  2VL6 A;  1SJE D;  4OGQ C;  3JAM L;  2A68 C;  4N9P A;  1JOO A;  1CSQ A;  3L3O C;  4B3T L;  4JI4 L;  4A3M G;  1OTC A;  3PUY A;  4RKB A;  3CW2 C;  1CZW A;  1PFB A;  3A8K E;  2HHH L;  1KAB A;  3UE0 A;  4DK6 C;  5IGD A;  1R4P B;  5JEA H;  4JYA Q;  4X65 L;  4QGU A;  4DR4 L;  5FO8 B;  5C4X G;  1X3P A;  3MC0 B;  5C3E B;  4HJ5 A;  1E7Z A;  3MXN A;  1VQF A;  4X62 Q;  2F4V L;  4ZYS A;  3Q22 A;  3DXJ C;  4E6I A;  1N34 Q;  3HKZ B;  2JA5 G;  2XWB B;  4UHV A;  5IYB G;  1MD2 D;  1G91 A;  1I4X A;  4FO2 A;  1X55 A;  1CKM A;  1WOC A;  4B3R L;  3M4O B;  2NYZ D;  2Z6B A;  3GTP H;  1QNK A;  2R7Z H;  5IOD A;  4GS3 A;  2PQA A;  3AYH B;  2UUC L;  1V1O A;  4KKS A;  1EL0 A;  3GTO H;  1X32 A;  4IFD I;  3PGZ A;  2EJF C;  2K33 A;  3EN2 A;  1SSO A;  4ZUI A;  1SYF A;  2EOT A;  3MHB A;  3I56 A;  1PRT D;  1PH3 A;  4LF7 L;  2HQE A;  4IOA A;  4L5T A;  3K7U C;  3A7L A;  4A3E H;  4A3B G;  1SND A;  1D5Z C;  5IWA Q;  5DM7 3;  2B3G A;  2WAQ E;  2YV5 A;  4QQB X;  2J0T D;  3T1H L;  1YIJ A;  4XDX A;  4A93 B;  4B9W A;  5KYL A;  5C0X H;  1WYD A;  4QUC A;  3PSI A;  1PH5 A;  5I2X A;  3I4L A;  1FGB D;  1IL8 A;  1HNW L;  5M3M B;  2PZT A;  2WKC A;  3E5S A;  2B63 B;  1T5E A;  5IGC A;  2R92 B;  4JI0 Q;  5KYI A;  2L1B A;  5A2Q L;  4DUY L;  3H3V I;  5JVH 3;  1D7Q A;  1SDF A;  2ICI A;  1YI2 A;  1L1O B;  1P8L A;  1Q1E A;  2AUJ D;  4HIO A;  1WI5 A;  2PO4 A;  1YZ6 A;  4K5V A;  4B3M L;  5K36 G;  1J9O A;  2FFK B;  3R8B A;  4JG2 A;  2F0J A;  3V2T A;  3VR4 A;  1KD1 C;  4BWG B;  1F9P A;  2WAQ B;  4MN3 A;  4DAP A;  5CC4 A;  3K0X A;  4GLX A;  2J7Z A;  2AMC B;  1IBK L;  4JI5 Q;  2XGT A;  3MEH A;  1KDA A;  2L5T A;  1EEF D;  1BNZ A;  2KJX A;  3R2T A;  2LS0 1;  1X3E A;  5JJZ A;  3H3V H;  2PI2 E;  4DV2 L;  4JI7 Q;  2XRQ D;  4K8I A;  4LF9 L;  2GVA A;  2HUG A;  3GQB A;  4DV3 Q;  1BCP B;  1BCP F;  4FXD A;  1VQB A;  1LV9 A;  2X6L A;  5J39 A;  3X3M A;  2MJ8 A;  4QUF A;  1PHJ A;  3GTL B;  2SNM A;  3TME A;  2EYL A;  1H9K A;  1TWH H;  4DUZ L;  2N49 A;  2ZTD A;  4JI8 L;  1CHQ D;  1HZC A;  3HOU G;  3MA2 B;  4NDX A;  5F2D A;  2EY2 A;  1QOH A;  4FVM A;  1JB3 A;  1BF4 A;  2DNC A;  4JBM A;  1BCP D;  3KOJ A;  4BY7 G;  1RDP D;  3Q24 A;  4DV1 L;  2EYM A;  1DJR D;  3NBH B;  1ENC A;  2XN9 C;  4H02 A;  4AYB B;  3GTP B;  3GTM B;  4IFD H;  1HRJ A;  1U0L A;  4R1J A;  2F4V Q;  1IKL A;  1GUN A;  1F9R A;  4IUP A;  1LT6 D;  2E5L Q;  2HCI A;  2RHQ B;  1ENA A;  1CA6 A;  1ZYR C;  3C2P A;  5BN4 A;  3CAM A;  3TN2 A;  3GTJ B;  4DV6 Q;  3RNU A;  4TQU S;  2F3W A;  5C3E H;  1KAA A;  5ELF A;  1NMG A;  1PTO C;  4EQ5 A;  4OWW B;  1FNV A;  3GTL H;  4OO1 G;  1VQG A;  2JXM B;  3A5U A;  4BY1 B;  2K5V A;  3DEO A;  5C0X I;  4A3F H;  1TKW B;  2N88 A;  4IUQ A;  1S40 A;  2AQ2 B;  2B2T C;  1KXL A;  1L2F A;  2JA8 G;  4O0A A;  5FO9 B;  2CFM A;  3D31 A;  3Q8D A;  3E0E A;  2AUK A;  2WB1 E;  2NWG A;  2D9U A;  3ICE A;  5IY0 A;  3TSS A;  1FJG Q;  1BDO A;  4ODG A;  3ULP A;  2L15 A;  1KNA A;  3RLF A;  2F03 A;  2UUB L;  4DNI A;  1SN8 A;  2SOB A;  1TWC B;  4DN4 M;  4QIW B;  1STE A;  4RHS A;  1EYG A;  1HNX L;  4WRD A;  3TDQ A;  3S17 B;  4YWL A;  4M8A A;  5FOB B;  2X6G A;  4EQO A;  3H94 A;  2EDG A;  4MTN A;  4B3S L;  3L7Z C;  4RKL A;  3W5O A;  2Q8T A;  2ZT9 C;  4A3C H;  4DV0 L;  1HH2 P;  1EY8 A;  1EY5 A;  2F0H A;  3IAY A;  2BA0 A;  3HOW H;  4GLA C;  1MJE A;  4JBW A;  4OXP A;  2WB1 G;  4C3H B;  1DXM A;  2R92 H;  3KBX A;  4JV5 L;  4IPH A;  1FL0 A;  2PQE A;  4P74 A;  4NXM L;  3TS0 A;  4LF8 L;  1BBX C;  5CV4 A;  2MUY A;  1CI3 M;  2E8G A;  3D6W A;  5I4D A;  4HIK A;  4DR1 L;  4HCE A;  3U50 C;  1TU2 B;  4GN5 A;  3CCE A;  1PLF A;  1XNQ Q;  1PH7 A;  4JI5 L;  3S1Q H;  3J80 L;  2AKW B;  4ZUJ A;  3A56 A;  1KDB A;  4Q5V A;  3M85 A;  4GKJ L;  4JI2 Q;  2VB3 X;  2Y0S G;  4DV2 Q;  1B3Q A;  1LTI D;  2F0Q A;  2JE6 I;  1D8L A;  2FJ2 A;  1SNM A;  1I6H H;  4IUR A;  2DJF C;  1PZJ D;  4CDF C;  4LF6 L;  1EU4 A;  4GKK L;  1B2T A;  1X3G A;  2IX1 A;  5GAD C;  3K7A H;  1DCZ A;  2GN5 A;  3CME A;  1X56 A;  3T13 A;  4G7Z C;  1Y69 U;  4DXG A;  3VYS A;  2AQ1 B;  3UDG A;  2N8N A;  1NE3 A;  1S4Z A;  3F1Z A;  2NB0 A;  4R4T A;  2IWH A;  4C2M H;  1MHW C;  3M9B A;  3WDN A;  2KOL A;  1BKB A;  4BXX H;  1GUW A;  3A8J E;  3F2U A;  1VQ6 A;  1N33 L;  1F9Q A;  3OSO A;  3G4S A;  1EY0 A;  1NAP A;  2F1M A;  2B39 A;  3AMU A;  2DUD A;  3DUZ A;  4GNX C;  3W2D A;  3DLL A;  1B8A A;  4DR5 L;  3KF8 B;  4FF2 A;  4A3E B;  1JIC A;  4CKC A;  1Y1V H;  1NR4 A;  2NVY H;  4A3B H;  2JJQ A;  4U67 3;  1HZ9 A;  5I9P A;  2B8G A;  3S1N H;  5LMN W;  1YHB A;  4DV5 L;  1S72 A;  1RIP A;  1O7I A;  1QIL A;  2I46 A;  3EA6 A;  1L1O A;  4I65 A;  3WOE A;  2RKS A;  4ABN A;  5CR3 A;  4TKO B;  1B4O A;  1EQR A;  4NB3 A;  4ULL A;  3BJU A;  5C5M A;  4DR4 Q;  4RGO S;  1IZ6 A;  1DGS A;  4K5X A;  4OIJ A;  3E3X A;  5C4H A;  2Q2I A;  3NWS A;  4Y52 H;  3RZD B;  1Q86 C;  3J80 i;  2JA6 B;  3OWE B;  5GAE C;  3S1M H;  4C3I G;  1E1T A;  1DM0 B;  1GUS A;  2F0T A;  4HMI A;  4A4I A;  2B8F A;  5EAY A;  3ND8 A;  2F0N A;  5IT9 L;  5DEH A;  2XTI A;  5LHY 1;  1YJ9 A;  5KND A;  2E76 C;  2WIN B;  4TVA B;  3CU7 A;  2F3V A;  3D4D A;  4KKU A;  4A3G B;  1U4M A;  1B70 B;  1A2T A;  3GTK H;  4BBS G;  4DXF A;  2PI2 A;  3CPF A;  2H4O A;  5IP7 G;  2I5M X;  3MFG A;  2V1C C;  4JV5 Q;  2JA7 G;  4XQJ A;  1CFM A;  2FMM A;  4NXM Q;  5ELC A;  1TWF B;  5HUR A;  3FKI G;  4FXG C;  3DWP A;  4P75 A;  4CKB A;  3L2P A;  3FKI H;  1KC8 C;  5CBA E;  4B3R Q;  1XPO A;  4UAI A;  3H15 A;  2M00 A;  1SEB D;  2B2W C;  4A3C G;  3T56 B;  2Z1C A;  2CCZ A;  1JT8 A;  3BYY B;  3M4Y A;  5IGE A;  1TR5 A;  5G3L F;  2PZW A;  4J15 A;  2B2V A;  2B2U C;  3K5O A;  3NE5 B;  3VA5 A;  5JEA J;  3HKZ G;  3CCV A;  3I2Z A;  4K8J A;  4G7H C;  1WTR A;  4ZCK A;  4GOP A;  1SFO B;  4I7A A;  4KHP Q;  1DD2 A;  1RCV D;  1B9M A;  3LX0 A;  2B29 A;  1PYB A;  5EBD A;  2A8V A;  1D6E C;  4LUO A;  1ASZ A;  4JK1 C;  2A6E D;  4ZK9 B;  1Z7T A;  1SBB B;  4IOC A;  1C0A A;  3G6E A;  2NZH A;  1EIY B;  5CYU A;  2OF1 A;  1FVI A;  1X3Q A;  4PZ8 A;  3Q0A A;  3K6O A;  2C5C A;  1VQM A;  3M3Y H;  3FMC A;  1B44 D;  1OXX K;  3EJI A;  4U68 A;  1MSH A;  3HOX H;  4GNX A;  4CBV A;  1ZEQ X;  1G6P A;  2MO0 A;  3K0Y A;  1WD1 A;  3U58 A;  4POG A;  4ZQ3 A;  4O2D A;  4KMU C;  4P72 A;  3OYY A;  3ERO A;  3URY A;  3D0F A;  5IT9 c;  4DV7 L;  3L9A X;  3QOJ A;  2EYP A;  3KLS A;  2BCO A;  1NNX A;  1XJV A;  3HOY G;  2CH4 A;  2JQO A;  3NBI A;  2I07 B;  5J1Z A;  1SFO H;  4LF9 Q;  1I3Q H;  1I4P A;  3ZJY C;  3T1Y L;  3PCO B;  2Z8L A;  4C1N I;  5M3M G;  4LF4 L;  4FF1 A;  3JAM E;  5IP9 H;  1A0I A;  3O13 A;  1PH8 A;  4V19 0;  3G7L A;  3RMH A;  1S5E D;  3RZD H;  1IHZ A;  5HY6 A;  5LL6 X;  3KYH C;  1IBK Q;  3U4Z A;  1QE6 A;  2CWA A;  1ASY A;  4DR3 L;  4OWT B;  4F87 A;  4GN4 B;  5COY A;  5IOC A;  2RDG A;  4NMZ A;  4QL5 A;  2NVT B;  3HOW G;  1VQ8 A;  1TS3 A;  3CF5 A;  2MPM A;  2KQ3 A;  5DAU A;  3NQI A;  3I55 A;  1ZKO A;  3NTI A;  3PMF A;  1AH9 A;  3CXC A;  1OO9 B;  1S5B D;  5EGT A;  5LMU L;  1HJP A;  5BR8 Q;  1BO0 A;  1VQP A;  1VF7 A;  5CV9 A;  3GTG H;  5I2Y A;  4KY7 A;  4AH6 A;  1PRT B;  2VQF Q;  4DUZ Q;  4ID6 A;  4XTC S;  4NXN Q;  2R7Z B;  3BDO A;  3WOF A;  3HOZ G;  2DNE A;  4H0L C;  2K52 A;  1TS5 A;  1CTM A;  3KFU A;  2VXW A;  1SXT A;  3CCM A;  1BCP C;  1VQL A;  1QZH A;  3NBH A;  2K75 A;  3NPP A;  4A3M H;  4OO1 H;  2E74 C;  3TS2 A;  1TWA B;  3HOX G;  1MGS A;  4X64 Q;  4KN4 C;  2R93 G;  2RF4 A;  2E5L L;  1KLG D;  1S3O A;  5JEA G;  1RTO A;  3ND9 A;  5ELN A;  2IHE A;  2E2J H;  4DR7 L;  1M1K C;  3C1E A;  1JMC A;  5KRU A;  2LKV A;  3HOU B;  4K5W A;  3UDX A;  3J81 i;  1TS2 A;  1FJG L;  1W6J A;  3SDZ A;  1ICF B;  4A76 A;  3T51 B;  1HR0 Q;  3K58 A;  3TQY A;  5M5X H;  4A3J H;  3RZO B;  4EX5 A;  2Q8I B;  4ZLT F;  2HD3 A;  1Q8I A;  3GV6 A;  1A6X A;  4M1U B;  2UUA Q;  4AYB E;  2VQE Q;  1PRT F;  1LTR D;  3VA7 A;  5I6W A;  1CSP A;  1STB A;  3SXH A;  3J81 L;  5AFW A;  5I9O A;  3PO3 B;  3I91 A;  4IZ8 A;  1L1O C;  4HN7 A;  1XMO Q;  1IW7 C;  3EFX D;  4JI3 Q;  2GVB A;  1L0X B;  1EU3 A;  3BDC A;  3S16 B;  3GTJ H;  4DV0 Q;  1IBL Q;  2XWJ B;  1RTN A;  2NTT A;  5D3D A;  2HT1 A;  4BXX G;  4A3D H;  1K8M A;  2PMZ B;  3CCQ A;  2R6G A;  4BY1 H;  4WJW A;  1QWY A;  1MBY A;  2A1A A;  3MAQ A;  2EYJ A;  3SK6 A;  1HNX Q;  3J7A F;  3S1R H;  1WCM B;  4QCL A;  3MTS A;  2K32 A;  1VQ4 A;  1H9S B;  2VB2 X;  5C44 B;  4B3S Q;  2EIF A;  1Y1V B;  2PNH A;  3IL8 A;  3HOZ H;  1RD9 D;  2F0S A;  2XNA C;  3VR2 A;  4JCV E;  2K4K A;  4G4K A;  2EVB A;  2EQS A;  2N78 A;  4RH6 A;  2K7V A;  4GZY C;  1B50 A;  5C6A A;  2DGY A;  2EY1 A;  4HR7 B;  4HSP A;  1KRT A;  5FJ8 H;  1HFG A;  3WWV A;  1C48 A;  2VUM B;  4RA8 A;  3PIP A;  4PMW A;  3SVM A;  4C3I H;  3OIQ A;  3VYT A;  3G71 A;  1XYI A;  4GLV B;  5COR A;  5JAV A;  3STB D;  2IW3 A;  1P16 A;  4L5Q A;  1SE2 A;  1B7Y B;  2KBN A;  3SE0 A;  4WJ4 A;  4F7X A;  3CCJ A;  1VQK A;  3NWT A;  2KHJ A;  1GD7 A;  4IUT A;  4DNT B;  1WTX A;  2KEE A;  5FLM H;  1EYD A;  2E2I B;  4CKE A;  1HZB A;  1DYQ A;  4FF3 A;  2WB1 B;  4C3H G;  1OXT A;  2F0F A;  3KBG A;  3VYU A;  4PQX A;  4JI6 L;  2B2T A;  3I4N B;  4GKK Q;  1JJG A;  5BR8 L;  1UE1 A;  4X66 L;  4DFA A;  4R8N A;  4R4Q A;  1WTV A;  2IJ0 A;  4A3M B;  4QY7 A;  2KCM A;  2BH2 A;  1CK1 A;  1HTL D;  1SR3 A;  3I90 A;  1M90 C;  3KDF B;  1STA A;  1EOT A;  3EQL C;  2Y0S B;  1TWF H;  5JOB A;  2B2Y A;  5FO7 B;  5C3E G;  4HTH A;  1FNU A;  1QJO A;  4OX9 L;  3TP5 A;  2RDH A;  1IYJ B;  3J7A V;  2ZXO A;  3I4M B;  1KDC A;  4DV5 Q;  4DAY A;  3I3C A;  1CQF A;  2L9H A;  3FHW A;  5EPK A;  5IT9 E;  1JWU D;  5J22 A;  4GN3 B;  5C0X G;  5FK9 C;  1NY4 A;  2BH8 A;  2X69 A;  5D65 A;  2OQ0 A;  5GRO A;  4JW0 A;  4KLK A;  2L55 A;  1JE5 A;  2QCP X;  4OO1 I;  2F0U A;  3NUC A;  3VYR A;  4YWM A;  1R4Q B;  1TY2 A;  1G8Z D;  1Q12 A;  1Q3L A;  1J6Q A;  4DR5 Q;  1EUJ A;  4C2M B;  2VQE L;  5JVG 3;  5JPN C;  1KHI A;  1K0R A;  3SGI A;  2K1B A;  3BG3 A;  1GOZ A;  1FR3 A;  4PG3 A;  5E1F A;  1Q82 C;  1QUQ B;  1XMQ Q;  1NCV A;  2K14 A;  3H91 A;  1EZ6 A;  1LAC A;  2MP1 A;  2YYZ A;  1DON A;  4BA1 I;  1XPU A;  1II3 A;  2F0P A;  2E2I H;  3K5N A;  3OW2 A;  1IBL L;  1HNZ L;  3J7Z C;  2SNS A;  3BU2 A;  2NVY B;  3ERQ A;  5E7N A;  2R92 G;  2XSC A;  2EJM A;  2RHS B;  2QIL A;  3KLW A;  4KKT A;  1IBM L;  4R8I A;  4EQP A;  3FP9 A;  2IX3 A;  2TMP A;  1F2Y A;  1XNR Q;  1V8Q A;  3RZO H;  4R9W A;  2WP8 J;  1AEX A;  3VDY A;  3C46 A;  3ER0 A;  1VS0 A;  3B6Y A;  5CV7 A;  3U9S A;  3H09 A;  2QA4 A;  1UAP A;  1K9M C;  1I6H B;  1GUG A;  3KLR A;  3I73 A;  4ILW A;  4NPS A;  1YNN C;  1FYC A;  5D3I B;  3PIP 3;  2LSS A;  4UDU C;  2ZM6 L;  5IYC H;  4OHJ A;  1YIT A;  1S5C D;  2WAQ G;  2A68 D;  4Y7N B;  4J1M A;  4LJZ C;  5ELO A;  4KHP L;  2Z6K A;  3ULL A;  5CV8 A;  2H5X A;  1LO5 D;  1EQV A;  1JE4 A;  1SRU A;  4PV1 C;  1SE4 A;  4ME5 A;  4KHV A;  2A73 B;  1AP0 A;  3OMG A;  1JWS D;  2KED A;  3HKZ E;  4BBR G;  1HA6 A;  4IAL A;  3AQQ A;  1PYS B;  1SMY C;  2LXK A;  1O7L A;  3QJY A;  4RMF A;  4P73 A;  2JA7 B;  4LFC L;  2HIV A;  1N9W A;  1HTP A;  3MFY A;  3G48 A;  4KV6 A;  1U5K A;  2ZJP A;  1PRT C;  2LMC B;  2G5D A;  4NW2 A;  3HRZ C;  4A3I B;  4DV4 L;  1WTP A;  5M5W B;  1N8R C;  2B2V C;  4ZKC B;  1SJH D;  3ONA B;  2WAC A;  1CKN B;  2MO1 A;  1VMC A;  4XYO A;  4BY7 B;  1EOV A;  3BVM A;  3T1Y Q;  3IKJ A;  4DU9 A;  2UXD Q;  3DWQ A;  1XWE A;  2Q2H A;  3HOU H;  1Q8K A;  4CDE C;  3BYT B;  4CJ0 B;  3CHB D;  1PFN A;  3A0J A;  3GDE A;  1K8O A;  2L11 A;  4K6L A;  5C4Z A;  1CZG A;  4O1N A;  4KD3 A;  4MIU A;  4HJ8 A;  4IFD G;  4DAV A;  1PTO D;  1PZI D;  2A6H D;  4S3S A;  2I5H A;  2LFN A;  3R2I A;  5G3L D;  1SNP A;  1PH1 A;  2QDB A;  1I50 H;  1H9M A;  5LL6 S;  2ZJQ A;  1SYD A;  1PMR A;  2ICE C;  2IY5 B;  4DK1 A;  3CRK C;  4X65 Q;  5FLX L;  2K50 A;  4BY1 G;  5EPL A;  4KI0 A;  3I4M H;  3TRZ A;  3IFT A;  1X3F A;  4X6A H;  1D2B A;  1EZ8 A;  5CV6 A;  4DPG A;  2ZJR A;  2HDM A;  4A3I H;  3TEH B;  4LF4 Q;  3ITP A;  4JI1 Q;  4KTA A;  4FYD A;  2VNU D;  1O7Z A;  2VQF L;  1KL9 A;  4L5S A;  4WFN 3;  1MKH A;  4O42 A;  1TWH B;  4B3T Q;  1PYW D;  1C9O A;  5IIF A;  1N36 L;  4UY8 C;  2F0L A;  1AE2 A;  4DR3 Q;  3KF6 B;  2KCC A;  2B2W A;  2RSO A;  2NUC A;  3HOY B;  3V05 A;  3KDF A;  3P7J A;  4L63 B;  1STH A;  4JYA L;  2BDO A;  2XVS A;  1SNC A;  2NVQ H;  3HEJ A;  3N6R A;  3E9H A;  2NZO A;  1T9H A;  5IYD H;  1D5M C;  3VR3 A;  1OXV A;  3OIP A;  4XYQ A;  1PFM A;  2C9O A;  2OCE A;  3M3Y B;  1VDZ A;  5E4X A;  3A55 A;  3T16 A;  1HXY D;  4NXN L;  2R93 H;  1I4Q A;  1Y8N B;  3HOW B;  4BS9 A;  2A19 A;  3PF4 A;  1PXU A; 
#chains in the Genus database with same CATH homology
 1PH3 A;  2MNA A;  3HOV G;  3PCO B;  4DK3 C;  3T1H Q;  3MEF A;  5M3M G;  4LF4 L;  4DV7 Q;  4LF7 L;  5IP9 H;  4IOA A;  1Y14 B;  1A0I A;  4L5T A;  1I94 Q;  1PH8 A;  1A63 A;  3K7U C;  4JOI C;  4A3E H;  4A3B G;  3MXN B;  1YJW A;  4DR6 Q;  1YNX A;  5IWA Q;  1HNW Q;  3RZD H;  2B3G A;  5HY6 A;  2WAQ E;  3KYH C;  1IBK Q;  3U4Z A;  3ULJ A;  2YV5 A;  1YHA A;  4QQB X;  2CWA A;  2AWO A;  1ASY A;  3S16 H;  4DR3 L;  1TWA H;  4OWT B;  2N3S A;  5LMU Q;  4GN4 B;  4DUY Q;  3T1H L;  1YIJ A;  1K8A C;  3I4M G;  2PQA B;  2KCT A;  1N34 L;  4QL5 A;  1YBY A;  3HOW G;  1VQ8 A;  1GM5 A;  4DR7 Q;  3HKS A;  3CF5 A;  1WYD A;  1VQN A;  3PSI A;  4IJL A;  1PH5 A;  1EQQ A;  4A3D G;  3K8A A;  4GOP B;  1NMF A;  5IWA L;  5FLX c;  1E3P A;  3I55 A;  1PA6 A;  1HNW L;  4DAY B;  4HJ7 A;  1HR0 L;  1AH9 A;  3CXC A;  4DR2 Q;  5C0X J;  4JI0 Q;  2HHH Q;  5LMU L;  4DUY L;  1R9T H;  3H3V I;  1HJP A;  1Q1B A;  5BR8 Q;  1D7Q A;  1VQP A;  1YI2 A;  2HIX A;  3UDI A;  1L1O B;  3GTG H;  5C4J H;  1P8L A;  1Q1E A;  4AH6 A;  3CP0 A;  2UUC Q;  1MJC A;  1E24 A;  2VQF Q;  1NTG A;  1QZG A;  4DUZ Q;  4PZ6 A;  4HIO A;  1WI5 A;  3OTO Q;  1C7Y A;  4NXN Q;  4XTC S;  4A93 G;  1YZ6 A;  3H0G H;  5IYB H;  4X62 L;  3HOZ G;  4B3M L;  2K52 A;  1Z9F A;  5K36 G;  1NBW A;  1EIF A;  3KFU A;  1IXR A;  4JG2 A;  3W1B A;  3CCM A;  3AFP A;  1KD1 C;  4LF5 Q;  5FLM G;  1VQL A;  5IE8 A;  2YTV A;  1I94 L;  1QZH A;  4BBR H;  2HQL A;  1EWI A;  4APV A;  2K75 A;  4A75 A;  3GO5 A;  4A3M H;  2OTL A;  3K0X A;  4A3L H;  3TS2 A;  4GLX A;  2AMC B;  3HOX G;  4B3M Q;  4X64 Q;  1IBK L;  4DV3 L;  3PUW A;  2R93 G;  5IYD G;  2XGT A;  4JI5 Q;  2RF4 A;  2Z6K C;  2E5L L;  3TRE A;  1S3O A;  3M4O H;  1L0W A;  1YVC A;  5JEA G;  2ZTE A;  5ELN A;  2ATW A;  2IHE A;  3PV0 A;  2E2J H;  2R7F A;  1M1K C;  3PO3 G;  3S15 H;  4DR7 L;  1X3E A;  1JMC A;  1PFS A;  3RR5 A;  4YWK A;  3UDX A;  3J81 i;  1PV4 A;  2PI2 E;  1FJG L;  3UDF A;  5IP9 G;  2JA8 H;  4DV2 L;  3H3V H;  4JI7 Q;  4JI8 Q;  2JA6 G;  4A76 A;  4LF9 L;  4X64 L;  2GVA A;  1HR0 Q;  3J7A 5;  4DV3 Q;  3TQY A;  5M5X H;  3RN5 A;  4A3J H;  4EX5 A;  1VQB A;  1YJN A;  1Q7Y C;  2UXC L;  1SE8 A;  2YTY A;  3S17 H;  1PHJ A;  4LF7 Q;  3W1G A;  1UWV A;  2UUA Q;  1V43 A;  1TWH H;  1AE3 A;  4AYB E;  2VQE Q;  1SLJ A;  4POF A;  4DUZ L;  2I5L X;  4DV1 Q;  1CSP A;  2N49 A;  2ZTD A;  4A3E G;  1EFW A;  4JI7 L;  4JI8 L;  1UE5 A;  1LUZ A;  4WJ3 M;  1HZC A;  4YCV A;  3HOU G;  2KHI A;  4IFD J;  1L1O C;  1XMO Q;  1WCM G;  4JI6 Q;  1FGU A;  4LW1 A;  4R4O A;  4JI3 Q;  4JI1 L;  1X6O A;  2GVB A;  4X66 Q;  1K73 C;  4JBM A;  2UUA L;  1SMX A;  3F8T A;  3GTJ H;  4DV0 Q;  4LF5 L;  4BBS H;  3KOJ A;  4BY7 G;  1Q81 C;  1Y1V G;  4DV1 L;  3NBH B;  5AJ3 L;  3PUV A;  4H02 A;  4A3K G;  1IBL Q;  4A3D H;  1U0L A;  2HT1 A;  4R1J A;  2NN6 I;  4BXX G;  2F4V Q;  3KJO A;  1N32 L;  1BVS A;  3CCL A;  1XMO L;  2R7D A;  3CCQ A;  2R6G A;  4BY1 H;  3PF5 A;  2E5L Q;  4JI3 L;  1K83 H;  5IYC G;  1K8G A;  2RHQ B;  2A1A A;  1TWC H;  1TXY A;  1KQS A;  4UP8 A;  1HNX Q;  2I0Q A;  3CAM A;  3S1R H;  4OX9 Q;  5LMN L;  2D0P A;  4DV6 Q;  3JAM c;  3RNU A;  4LFB Q;  4TQU S;  1VQ4 A;  3RLO A;  5C3E H;  4ALP A;  3CCU A;  1NMG A;  4B3S Q;  2EIF A;  4EQ5 A;  2PNH A;  4OWW B;  2JA9 A;  3GTL H;  3HOZ H;  1VQG A;  4AYB G;  4OO1 G;  3A5U A;  2K5V A;  2K4K A;  4JCV E;  2EQS A;  5C0X I;  2N78 A;  1E1O A;  1UE6 A;  1W2B A;  4A3F H;  4IJH A;  2DGY A;  2D62 A;  4A3F G;  1KRT A;  4A3I G;  1S40 A;  5FJ8 H;  3WWV A;  1KXL A;  1L2F A;  1KAW A;  2JA8 G;  3PIP A;  4O0A A;  4PMW A;  2CFM A;  3D31 A;  3Q8D A;  1Y1W G;  1A8V A;  3NEN A;  4C3I H;  3RLN A;  3G71 A;  3E0E A;  2K5H A;  4GLV B;  5C4X G;  2WB1 E;  5JJL A;  2Y0S E;  3PO2 H;  3F2D A;  4K0K L;  3ICE A;  5IY0 A;  3STB D;  1FJG Q;  1P16 A;  2L15 A;  3ULP A;  4L5Q A;  3RLF A;  4GNX B;  4IPD A;  1B7Y B;  2KBN A;  1Z47 A;  2QGQ A;  4WJ4 A;  3CCJ A;  1VQK A;  2UUB L;  4DNI A;  4AQY L;  3M4Q A;  1SN8 A;  2KHJ A;  1GD7 A;  1YHQ A;  3LGJ A;  5FLM H;  1GVP A;  2CKZ B;  1HZB A;  1BBU A;  1EYG A;  1HNX L;  3GTM H;  4R4C A;  2YU9 H;  4LFA Q;  4YWL A;  1OXT A;  4DV6 L;  1VQD A;  4LWC A;  3CPW A;  3S2H H;  1HNZ Q;  2AHO B;  3HOV H;  5GQO A;  3CD6 A;  1KRS A;  3F2B A;  4MTN A;  4B3S L;  4JI6 L;  4JBK A;  4GKK Q;  1JJG A;  1YEZ A;  2KEN A;  3L7Z C;  1OXU A;  5BR8 L;  5M5W H;  1UE1 A;  3W5O A;  4X66 L;  4IPC A;  2QEX A;  4R4Q A;  4A3C H;  3I7F A;  4DV0 L;  4PZ7 A;  4QY7 A;  1HH2 P;  4LF8 Q;  2K5N A;  2KCM A;  2BH2 A;  3OTO L;  3CC4 A;  3GTQ H;  1SR3 A;  2BA0 A;  3HOW H;  1XMQ L;  1M90 C;  4GLA C;  2Q2U A;  1QUQ A;  1MJE A;  2IT1 A;  3IRB A;  4JBW A;  3KDF B;  4A3J G;  1IBM Q;  4OXP A;  2D0O A;  1XNR L;  5M3M H;  2JA7 H;  2WB1 G;  4OWX B;  1QVC A;  1TWF H;  2R92 H;  4JV5 L;  4IPH A;  1IL2 A;  5C3E G;  2UXB Q;  1FL0 A;  4P71 A;  1JJC B;  4P74 A;  4NXM L;  3TS0 A;  4LF8 L;  4OX9 L;  4JOI A;  1I5F A;  1TWG H;  1IYJ B;  3ERS X;  2E8G A;  4DR1 L;  4HIK A;  4DV5 Q;  3K80 C;  3U50 C;  3NEM A;  4GN5 A;  4LUZ A;  3CCE A;  4IO9 A;  3RN2 A;  2UUB Q;  1XNQ Q;  4A3G H;  3FHW A;  3S14 H;  1PH7 A;  4JI5 L;  3S1Q H;  5C0X G;  4GN3 B;  5M3F G;  5FJ8 G;  1NY4 A;  2BH8 A;  2AKW B;  4MNO A;  2OQ0 A;  5GRO A;  3M85 A;  4KLK A;  4UP9 A;  4GKJ L;  1PH9 A;  3A74 A;  4JI2 Q;  1JE5 A;  2OWO A;  2B63 G;  4OO1 I;  4A3K H;  3E9I A;  2Y0S G;  2F3I A;  1PH6 A;  4YWM A;  4DV2 Q;  3PO3 H;  4DR1 Q;  1CKN A;  2JE6 I;  1D8L A;  1Q12 A;  1I6H H;  2ES2 A;  4LF6 L;  2UXC Q;  3I4O A;  1J6Q A;  4DR5 Q;  1JB7 A;  4GKK L;  3AFQ A;  1X3G A;  2IX1 A;  3M7N A;  2CQO A;  4YHH L;  1EUJ A;  5GAD C;  2R7Z G;  3K7A H;  5H1S E;  1HR0 W;  2VQE L;  2GN5 A;  3CME A;  1X56 A;  4K0K Q;  1KHI A;  1K0R A;  2MQH A;  3SGI A;  5C4X H;  3PO2 G;  1VQJ A;  1PH4 A;  2NN6 G;  4PG3 A;  1Q82 C;  1VQ9 A;  1QUQ B;  4L5R C;  3I4N H;  1XMQ Q;  2VZA A;  3F2C A;  4AQY Q;  5HGQ A;  2K14 A;  2ZM6 Q;  2OTJ A;  1W3S A;  3UDG A;  2N8N A;  1OXS C;  4JBJ A;  3UE1 A;  2WFW A;  1NE3 A;  2YYZ A;  4BA1 I;  5JJI A;  1XPU A;  3F1Z A;  5DLQ E;  1QVG A;  3EBE A;  4LFA L;  4R4T A;  2E2I H;  3STB C;  4C2M H;  4DKA C;  3OW2 A;  1IBL L;  3M9B A;  1HNZ L;  3JAM i;  3PUX A;  1N32 Q;  3J7Z C;  5IP7 H;  1BKB A;  3PIO A;  1XNQ L;  4BXX H;  1UE7 A;  2YTX A;  4HIM A;  1J5E L;  2OQK A;  1VQ6 A;  2PMZ E;  1N33 L;  3BU2 A;  2UXD L;  3G4S A;  5E7N A;  1CKO A;  2R92 G;  4GKJ Q;  2ID0 A;  1VQO A;  2VY3 A;  2RHS B;  2JA6 H;  2AWN A;  3KF6 A;  2Z0S A;  3KLW A;  4HJ9 A;  3JC6 6;  1VQ5 A;  1QVF A;  1VQI A;  3BZK A;  1GO3 E;  1IBM L;  4LFB L;  1V9P A;  2DUD A;  1BBW A;  2JEB I;  2LXJ A;  3FP9 A;  4GNX C;  1XNR Q;  3RZO H;  4UPA A;  2JK8 A;  3DLL A;  2WP8 J;  3VDY A;  1B8A A;  2IHF A;  1LM0 A;  4DR5 L;  3KF8 B;  3ER0 A;  3B6Y A;  1VS0 A;  4YHH Q;  1Y1V H;  4QIW E;  2QA4 A;  4A3B H;  2NVY H;  1K9M C;  2JJQ A;  3DM3 A;  1HZ9 A;  3S1N H;  1RL2 A;  4RG1 A;  5LMN W;  4BA2 I;  2B63 H;  4UP7 A;  4NPS A;  1YHB A;  4DV5 L;  1S72 A;  1RIP A;  1O7I A;  1A62 A;  1WJJ A;  2LSS A;  3KJP A;  1L1O A;  2ZM6 L;  5IYC H;  1YIT A;  2WAQ G;  1LYL A;  1EQR A;  1SRO A;  5J3B A;  3CC7 A;  3EIV A;  4A3L G;  2RCN A;  4NB3 A;  5ELO A;  4KHP L;  2Z6K A;  2VUM H;  1X65 A;  1VQC A;  3ULL A;  4JI2 L;  3BJU A;  4HJA A;  3CC2 A;  3H0G G;  2H5X A;  4XIG S;  1SRU A;  1Q46 A;  4DR4 Q;  2NVX H;  3S2D H;  1IZ6 A;  1XPR A;  1XTD A;  1DGS A;  2C35 B;  4QJF A;  3GD7 A;  4LF6 Q;  2Q2I A;  4Y52 H;  4JI0 L;  3HKZ E;  1Q86 C;  4BBR G;  2BA1 A;  3CQZ H;  3J80 i;  2JA5 H;  3AQQ A;  1PYS B;  2LXK A;  4HID A;  5GAE C;  2Q2T A;  5C44 G;  3S1M H;  1E1T A;  4RMF A;  4P73 A;  4AIM A;  3M4P A;  4A4I A;  4C3H H;  1H95 A;  4LFC L;  2CWP A;  2FXQ A;  2HIV A;  3BZC A;  5EAY A;  1N9W A;  4YCU A;  3G48 A;  1U5K A;  2ZJP A;  1CUK A;  1MIU A;  1WFQ A;  2XTI A;  1YJ9 A;  1JJ2 A;  2VS1 A;  1K3R A;  3PUZ A;  3U4V A;  4TVA B;  4DV4 L;  2MFI A;  3CCR A;  4IPG A;  1N8R C;  1PH2 A;  5JJK A;  4JC0 A;  4YY3 L;  1B70 B;  2UU9 Q;  1X9N A;  4YCW A;  1LTL A;  3I56 A;  1CKN B;  4R4I A;  1VCI A;  2MO1 A;  1Y1W H;  1N36 Q;  4LFC Q;  3GTK H;  4BBS G;  4Y7N H;  3K81 C;  2E2H H;  2PI2 A;  3CPF A;  4GOP C;  1EOV A;  5IP7 G;  2I5M X;  3T1Y Q;  2V1C C;  4JV5 Q;  1N33 Q;  2JA7 G;  2UXB L;  2UXD Q;  2Q2H A;  3HOU H;  4LUV A;  4NXM Q;  1Q8K A;  1PVO A;  4DV4 Q;  1E22 A;  5GAH C;  3FKI G;  4LF9 Q;  3A0J A;  3GDE A;  2ASB A;  4P75 A;  4LNQ A;  3L2P A;  2ZTC A;  1VQH A;  1WCM H;  3A5Z B;  4HJ8 A;  3FKI H;  1KC8 C;  3T1Y L;  2JEA I;  4DR6 L;  4IFD G;  4B3R Q;  1XPO A;  3H15 A;  2NVT H;  4A93 H;  4A3G G;  1G51 A;  2VW9 A;  2I5H A;  1V1Q A;  1PH1 A;  1KIX A;  2CCZ A;  4BY7 H;  4A3C G;  3S24 A;  1NJI C;  1JT8 A;  1I50 H;  1VQA A;  5GAG C;  2ZJQ A;  1UEB A;  2VL6 A;  2IY5 B;  4J15 A;  4X65 Q;  2K50 A;  4BY1 G;  1CSQ A;  4KI0 A;  2F52 A;  4B3T L;  3I4M H;  4JI4 L;  5JEA J;  4A3M G;  3HKZ G;  3PUY A;  1X3F A;  3I2Z A;  3CCV A;  1OTC A;  3CW2 C;  4X6A H;  4DPG A;  2ZJR A;  3TRZ A;  4GOP A;  2HHH L;  4A3I H;  4KHP Q;  3TEH B;  3UE0 A;  4LF4 Q;  4DK6 C;  4JI1 Q;  2B29 A;  1PYB A;  2A8V A;  1G29 1;  2VUM G;  2VNU D;  4LUO A;  4JYA Q;  1ASZ A;  2VQF L;  4X65 L;  1KL9 A;  4QGU A;  4L5S A;  4DR4 L;  3NEL A;  4YY3 Q;  4IOC A;  1MKH A;  4ME3 A;  5AJ3 Q;  1E7Z A;  5C44 H;  4HJ5 A;  1C0A A;  4MZ9 A;  2NZH A;  3G6E A;  1C9O A;  2EXD A;  1N36 L;  1EIY B;  1FVI A;  4B3T Q;  4UY8 C;  1VQF A;  4X62 Q;  2F4V L;  1AE2 A;  4PZ8 A;  4DR3 Q;  4FDB A;  4KHZ A;  3KF6 B;  1VQM A;  3J80 c;  1N34 Q;  3M3Y H;  3HFZ B;  3KDF A;  2ALY B;  2JA5 G;  1OXX K;  4JYA L;  3CMA A;  4OON A;  1VQE A;  5IYB G;  3AEV A;  5LMN Q;  2NVQ H;  5M3F H;  1HZA A;  3HOX H;  1X55 A;  2IX0 A;  4GNX A;  3E9H A;  1CKM A;  1WOC A;  1G6P A;  2NZO A;  2MO0 A;  4DR2 L;  1T9H A;  4B3R L;  1J5E Q;  5IYD H;  3J81 c;  3U58 A;  3GTP H;  4POG A;  2R7Z H;  4O2D A;  4P72 A;  1OXV A;  4GS3 A;  3OYY A;  2PQA A;  3J81 j;  3D0F A;  5IT9 c;  3AYH B;  1VQ7 A;  2UUC L;  4DV7 L;  2OCE A;  3CCS A;  3HOY H;  3I4N G;  1GKH A;  3GTO H;  5M5Y H;  2UU9 L;  4IFD I;  3PGZ A;  3EN2 A;  4DAM A;  3L0O A;  4NXN L;  1XJV A;  3HOY G;  2R93 H;  2JQO A;  4C3J H;  1SFO H;  4JI4 Q;  1I3Q H;  3ZJY C;  2A19 A;  3PF4 A;  1X54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...