4GKKI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkkI00
4B3SE 2UXCI 1H72C 4UTGA 4JV5I 5GMEA 2V2VA 2VQFI 4XTJA 2V8PA 4X66I 3K1JA 4KQVA 1Z0CA 2UXBE 2HHHE 4PU9A 1FWLA 3K17A 3ZZUA 1J5EI 1Z0EA 4LF8E 1MX0A 4LF4E 1I94E 1ZXMA 4FWHA 4URLA 4PRVA 4JI6E 1N34E 1HNWE 2BM0A 4JI0I 2Q2EB 4GKKI 3WU4A 1NHJA 1Z5BA 5IT9C 1N33I 2V2QA 3PYEA 3WU5A 4DR5I 1BKNA 4DUYI 2F4VI 3B78A 1ZM3A 5A2QQ 2GS8A 4JI8E 4HYMA 3J81Q 2DEJA 4LFAI 4DV0I 4GKJE 3QT6A 5L3JA 1FKAE 1ZM2A 4UT4A 2A2CA 4DV2I 2LJPA 3HULA 1U2RA 3H4LA 2J7KA 4Z7CA 4LF9E 4YHHE 4WUCA 2UXDI 1ZM9A 4KHPE 4B3SI 4LFCI 5BR8E 4JI3E 5A2QC 2UXBI 2HHHI 1Z0GA 2AJ4A 1N36E 1FWKA 2UUCE 4FN5A 1XNQI 4DR4E 3J81C 3QT5A 2NPFA 2HFSA 1Z5AA 4LF8I 4LF4I 2VQEI 2EFGA 1I94I 1XMOE 4DUZE 4DXLA 4ED4A 5LMUI 3WU6A 1ELOA 4LFBE 4JI7E 1Z0TA 2OI2A 4JI6I 3LPSA 4DV5E 4DPYA 2BV3A 3V5RA 1XNRE 4DV3E 1MU5A 4JI4E 1UEKA 1S16A 1HNZE 5FLXQ 4B3RE 4DR7I 4NXNE 3PYDA 2HKJA 4JI1E 3ZKBA 4DV6E 3LTOA 4AQYE 4DV4E 4DR3E 4JI2I 4JI8I 4NXME 2BM1A 1ZM4A 1B63A 4DV1E 4GKJI 1XMQE 4X65E 1EI1A 5LL6R 3ZZ0A 1VISA 3D4JA 3WU3A 2WW4A 1N32E 2X7IA 1IBME 1RREA 1FI4A 1FJGI 2VF3A 3T1YE 4LF9I 4YHHI 4KHPI 4LF6E 5FLXC 4YY3E 4B3TE 5BR8I 3T1HE 4JI3I 4FW9A 1IBLE 2ZBKB 4X62E 1N36I 2UUBE 2UUCI 4DPTA 5GMDA 4DR4I 4P7AA 4DR6E 3CWVA 4DUZI 4LFBI 4JYAE 4JI7I 1EA6A 4DV5I 4DR1E 4M1KA 4DPXA 4HACB 2V2ZA 4JI4I 1QZRA 3B82A 4USKA 5LMNE 1HNXE 1HNZI 1Z5CA 4B3RI 1H74A 4DPWA 4NXNI 4MYUA 4JI1I 4DUYE 4DV6I 1KKHA 4AQYI 4DV4I 4I3HA 2XEXA 4DR3I 4K0KE 3PYFA 4NXMI 4X64E 4JG4A 1K47A 1Z0BA 4DV1I 4X65I 4JI5E 4R1FA 1N34I 1HNWI 1S4EA 1WUUA 4DV2E 1HR0E 5IWAE 2E5LE 1Z0VA 1PIEA 1N0VC 1N32I 1IBMI 1H7SA 3V2UC 1KTVA 5IT9Q 3T1YI 2HFUA 4ZVIA 1B62A 4LF6I 1NHHA 2UXDE 4YY3I 4B3TI 2R3VA 4DU8A 4LFCE 3B8HA 3T1HI 1Z0WA 1A6FA 4LF5E 1IBLI 1IBKE 4DV7E 2UU9E 4B3ME 4OX9E 4X62I 2UUBI 1KIJA 1Z59A 1RR9A 3ZZTA 1XNQE 2A2DA 4DR6I 3QT8A 4WUBA 4PRXA 4DPUA 3J7AM 4DR2E 2VQEE 3OTOE 2ZM6E 3QT7A 1ZXNA 4LF7E 5LMUE 4JYAI 1PKPA 2UUAE 4DR1I 4DU7A 2UXCE 4JV5E 3J80Q 2VQFE 2X36A 5LMNI 1HNXI 4X66E 4DR7E 4WUDA 1J5EE 4MYTA 4HXZA 2V34A 4K0KI 4JI2E 1NZ0A 4HY1A 4RPFA 1XMOI 4X64I 3JAMQ 4JI5I 3M6AA 3J7AG 1HR0I 1NHIA 3GONA 5IWAI 2HK2A 4DV3I 4JI0E 1XNRI 3Q1QA 4GKKE 2E5LI 2R42A 1D6TA 1N33E 3PYGA 1DARA 4FWDA 1MG7A 1FNMA 4DR5E 1FJGE 2F4VE 3J80C 2CZ9A 1N0UA 1OJ4A 2ZITA 4EMDA 3LNUA 4HACA 3ZM7A 4LFAE 2E1RA 4USMA 4LF5I 1XMQI 1IBKI 4DV7I 2UU9I 4DV0E 4B3MI 4OX9I 3ZKDA 3F0NA 4P52A 3JAMC 2HKEA 4Z7YA 4DR2I 3OTOI 1XHKA 2ZM6I 4FWGA 1PVGA 2HK3A 4LF7I 1H7UA 2DEIA 1KVKA 1H73A 2UUAI
chains in the Genus database with same CATH superfamily
4IFDA 2IOPA 4B3SE 4FW6A 2UXCI 1H72C 4UTGA 4QNKA 4JV5I 5GMEA 2V2VA 2VQFI 4XTJA 2V8PA 2PO1A 2VESA 5DNLA 4X66I 3K1JA 4KQVA 1Z0CA 2UXBE 2HHHE 4PU9A 1FWLA 4AIDA 3L7ZB 3K17A 3ZZUA 1J5EI 1Z0EA 4LF8E 1MX0A 4LF4E 4IZJB 1I94E 4IZKB 1ZXMA 4FWHA 4URLA 4PRVA 4BA2B 1Y6ZA 4JI6E 1N34E 1HNWE 5C0XB 3K85A 2BM0A 3L7ZA 4JI0I 2Q2EB 4GKKI 3WU4A 1NHJA 1Z5BA 3U1KA 2NN6D 5IT9C 5FWKA 1N33I 2V2QA 4J3DA 3PYEA 3Q6NA 1Y4SA 3GMEA 3WU5A 4DR5I 1USVA 2C37A 1BKNA 4DUYI 2F4VI 3B78A 5EL9A 5DRPA 2GO4A 3CDIA 4BA2A 1E3PA 1ZM3A 3P3GA 2BR2B 4MU1A 5A2QQ 2GS8A 4JI8E 4HYMA 3J81Q 2DEJA 5DRRA 4LFAI 4DV0I 4GKJE 3QT6A 5L3JA 1FKAE 1RHYA 2O1UA 1ZM2A 1P42A 4UT4A 2A2CA 4DV2I 2LJPA 3HULA 4N3OA 4IS9A 4OO1D 1U2RA 3H4LA 4IFDE 1OYRA 2NN6B 1OYPA 2J7KA 4Z7CA 4LF9E 4YHHE 3HKMA 4WUCA 2UXDI 1ZM9A 5DROA 4KHPE 4B3SI 4LFCI 5BR8E 4JI3E 3P06A 5A2QC 2UXBI 1UDSA 2HHHI 1Z0GA 2AJ4A 1N36E 1FWKA 2UUCE 4FN5A 1XNQI 4DR4E 3J81C 3M7NG 3QT5A 2NPFA 2NN6A 2HFSA 1Z5AA 2PO0B 4LF8I 1OYSA 5ELWA 2BA1D 4LF4I 3Q6MA 2IOQA 2VQEI 2EFGA 1I94I 3UHMA 1XMOE 4DUZE 2J65A 4DXLA 4ED4A 5LMUI 3WU6A 1ELOA 4LFBE 4OO1B 4JI7E 1R6LA 1Z0TA 2OI2A 4JI6I 2C39A 3LPSA 4DV5E 4BA1A 4DPYA 2CG9A 2BV3A 3V5RA 1XNRE 4DV3E 1MU5A 1UDQA 4MQYA 4IFDF 4JI4E 1UEKA 1S16A 2O1WA 1HNZE 4OKGA 5FLXQ 4OO1C 4B3RE 3PS3A 4DR7I 2PO2B 4NXNE 3PYDA 2HKJA 4JI1E 3ZKBA 4OO1A 3LTOA 4DV6E 4AQYE 4DV4E 4DR3E 4JI2I 4JI8I 4LPFA 4NXME 2BM1A 2Z5EA 1ZM4A 5JEAF 1B63A 4DV1E 4GKJI 1XMQE 4X65E 1EI1A 3HJCA 3P3CA 1USUA 5K36F 4LCFA 5LL6R 4MU3A 2PO2A 3DD6A 2Z5CB 3ZZ0A 1VISA 3D4JA 3WU3A 2WW4A 1N32E 2X7IA 2PNLA 4IZJA 1IBME 1RREA 1R6MA 4IZKA 1FI4A 1FJGI 2VF3A 3T1YE 5DRQA 4LF9I 2JT2A 4YHHI 5C0XC 4ISAA 5C0XA 4KHPI 4LF6E 5FLXC 4YY3E 2Z5CA 4B3TE 5BR8I 3T1HE 4JI3I 4FW9A 1IBLE 2CGEA 2ZBKB 4X62E 1N36I 2UUBE 2UUCI 4DPTA 5GMDA 4DR4I 4P7AA 4AM3A 4DR6E 4FW7A 2PNZB 3CWVA 2BR2A 2GQ0A 4IFDD 4DUZI 4OZEA 2O1VA 4LFBI 4JYAE 4JI7I 1EA6A 4GQUA 4DV5I 4DR1E 3P3EA 4M1KA 4DPXA 4HACB 2V2ZA 4OO1E 4JI4I 2PNZA 2BA0G 2CVEA 3M7ND 1QZRA 3B82A 4USKA 5LMNE 3M85D 1HNXE 1HNZI 1Z5CA 4MU0A 1E3HA 1H74A 2NN6C 4DPWA 4B3RI 5JEAD 1UDNA 4NXNI 2WP8B 4MYUA 4JI1I 4DUYE 4DV6I 1KKHA 4AQYI 4QNJA 5K36D 3M85G 4DV4I 4U3BA 1Y5YA 2IESA 2XEXA 4I3HA 4DR3I 4K0KE 3PYFA 4NXMI 4FW4A 4X64E 4JG4A 1K47A 1Z0BA 4DV1I 4X65I 4JI5E 4R1FA 1N34I 1HNWI 1S4EA 4IFDB 1WUUA 2JEBB 4DV2E 1HR0E 5IWAE 2AE8A 3CDJA 2PO0A 2E5LE 1Z0VA 4MU4A 1PIEA 1N0VC 5C0XE 1N32I 1IBMI 1H7SA 3V2UC 1HK7A 1KTVA 5IT9Q 3T1YI 4ZVIA 2HFUA 3P76A 3H1CA 3GLLA 4LCHA 1B62A 4NBQA 3U1YA 4LF6I 1NHHA 2UXDE 4YY3I 2JEBA 5JEAB 1UDOA 4B3TI 2GO3A 2R3VA 4DU8A 4LFCE 3B8HA 3T1HI 5EKWA 1Z0WA 1A6FA 3KRNA 5K36B 1YHCA 4LF5E 1IBLI 1IBKE 4DV7E 2UU9E 4B3ME 4OX9E 4X62I 2UUBI 1KIJA 1Z59A 1RR9A 3ZZTA 1XNQE 2A2DA 4DR6I 3QT8A 4WUBA 4PRXA 4DPUA 3J7AM 5JEAC 2F1DA 4DR2E 3PS2A 2VQEE 4LCGA 5JEAA 3OTOE 3PS1A 2C37B 2ZM6E 3QT7A 5K36C 1ZXNA 4LF7E 5LMUE 4JYAI 1PKPA 4AIMA 5K36A 2UUAE 4DR1I 2JEAB 2IERA 3B4TA 4DU7A 2JE6B 2NN6E 5C0XF 2UXCE 4JV5E 3J80Q 2VQFE 2X36A 5LMNI 1HNXI 4X66E 4FW5A 4DR7E 4WUDA 5DNXA 2O1TA 1J5EE 2JEAA 4MYTA 4HXZA 2V34A 4K0KI 4JI2E 1NZ0A 2JE6A 4HY1A 4RPFA 1XMOI 4X64I 3JAMQ 4MDTA 4JI5I 3M6AA 2BA0D 3J7AG 1HR0I 1NHIA 2PNMA 3GONA 2HK2A 5IWAI 4DV3I 4JI0E 2WNRB 3GCMA 1XNRI 3Q1QA 4GKKE 2E5LI 2R42A 1D6TA 1N33E 3PYGA 1DARA 4FWDA 4U3DA 1MG7A 1Y60A 1FNMA 4FW3A 4DR5E 1FJGE 2F4VE 3PRYA 3J80C 2C38B 2NN6F 2CZ9A 1N0UA 1OJ4A 2ZITA 4EMDA 3LNUA 4HACA 2WNRA 1VI7A 3ZM7A 4LFAE 3NZKA 1Y4UA 2E1RA 4USMA 4LF5I 1XMQI 1IBKI 4DV7I 2UU9I 4DV0E 4B3MI 4OX9I 3ZKDA 2C39B 5JEAE 2Z5BB 4BA1B 3F0NA 4IZJD 2WP8A 4P52A 5K36E 2C38A 3JAMC 2HKEA 1YH8A 4Z7YA 4DR2I 2PO1B 2O3ZA 5C0XD 3OTOI 1XHKA 2ZM6I 1XXEA 4FWGA 1PVGA 2HK3A 4LF7I 1H7UA 2DEIA 1KVKA 2BA1G 1H73A 2UUAI 4LOMA 4IFDC 4OO1F 2Z5BA
chains in the Genus database with same CATH topology
2IOPA 4B3SE 2UXCI 1H72C 4UTGA 4JV5I 5GMEA 2V2VA 2VQFI 4XTJA 2V8PA 4X66I 3K1JA 4KQVA 1Z0CA 2UXBE 2HHHE 4PU9A 1FWLA 3K17A 3ZZUA 1J5EI 1Z0EA 4LF8E 1MX0A 4LF4E 4IZJB 1I94E 4IZKB 1ZXMA 4FWHA 4URLA 4PRVA 1Y6ZA 4JI6E 1N34E 1HNWE 3K85A 2BM0A 4JI0I 2Q2EB 4GKKI 3WU4A 1NHJA 1Z5BA 5IT9C 5FWKA 1N33I 2V2QA 3PYEA 3Q6NA 1Y4SA 3WU5A 4DR5I 1USVA 1BKNA 4DUYI 2F4VI 3B78A 1ZM3A 5A2QQ 2GS8A 4JI8E 4HYMA 3J81Q 2DEJA 4LFAI 4DV0I 4GKJE 3QT6A 5L3JA 1FKAE 2O1UA 1ZM2A 4UT4A 2A2CA 4DV2I 2LJPA 3HULA 4N3OA 1U2RA 3H4LA 2J7KA 4Z7CA 4LF9E 4YHHE 4WUCA 2UXDI 1ZM9A 4KHPE 4B3SI 4LFCI 5BR8E 4JI3E 3P06A 5A2QC 2UXBI 2HHHI 1Z0GA 2AJ4A 1N36E 1FWKA 2UUCE 4FN5A 1XNQI 4DR4E 3J81C 3QT5A 2NPFA 2HFSA 1Z5AA 4LF8I 4LF4I 3Q6MA 2IOQA 2VQEI 2EFGA 1I94I 1XMOE 4DUZE 4DXLA 4ED4A 5LMUI 3WU6A 1ELOA 4LFBE 4JI7E 1Z0TA 2OI2A 4JI6I 3LPSA 4DV5E 4DPYA 2CG9A 2BV3A 3V5RA 1XNRE 4DV3E 1MU5A 4JI4E 1UEKA 1S16A 2O1WA 1HNZE 5FLXQ 4B3RE 4DR7I 4NXNE 3PYDA 2HKJA 4JI1E 3ZKBA 4DV6E 3LTOA 4AQYE 4DV4E 4DR3E 4JI2I 4JI8I 4NXME 2BM1A 2Z5EA 1ZM4A 1B63A 4DV1E 4GKJI 1XMQE 4X65E 1EI1A 3HJCA 1USUA 5LL6R 2Z5CB 3ZZ0A 1VISA 3D4JA 3WU3A 2WW4A 1N32E 2X7IA 2PNLA 4IZJA 1IBME 1RREA 4IZKA 1FI4A 1FJGI 2VF3A 3T1YE 4LF9I 4YHHI 4KHPI 4LF6E 5FLXC 4YY3E 2Z5CA 4B3TE 5BR8I 3T1HE 4JI3I 4FW9A 1IBLE 2CGEA 2ZBKB 4X62E 1N36I 2UUBE 2UUCI 4DPTA 5GMDA 4DR4I 4P7AA 4DR6E 3CWVA 2GQ0A 4DUZI 2O1VA 4LFBI 4JYAE 4JI7I 1EA6A 4DV5I 4DR1E 4M1KA 4DPXA 4HACB 2V2ZA 4JI4I 1QZRA 3B82A 4USKA 5LMNE 1HNXE 1HNZI 1Z5CA 4B3RI 1H74A 4DPWA 4NXNI 4MYUA 4JI1I 4DUYE 4DV6I 1KKHA 4AQYI 4DV4I 4I3HA 2XEXA 4DR3I 4K0KE 3PYFA 4NXMI 4X64E 4JG4A 1K47A 1Z0BA 4DV1I 4X65I 4JI5E 4R1FA 1N34I 1HNWI 1S4EA 1WUUA 4DV2E 1HR0E 5IWAE 2E5LE 1Z0VA 1PIEA 1N0VC 1N32I 1IBMI 1H7SA 3V2UC 1HK7A 1KTVA 5IT9Q 3T1YI 2HFUA 4ZVIA 1B62A 4LF6I 1NHHA 2UXDE 4YY3I 4B3TI 2R3VA 4DU8A 4LFCE 3B8HA 3T1HI 1Z0WA 1A6FA 4LF5E 1IBLI 1IBKE 4DV7E 2UU9E 4B3ME 4OX9E 4X62I 2UUBI 1KIJA 1Z59A 1RR9A 3ZZTA 1XNQE 2A2DA 4DR6I 3QT8A 4WUBA 4PRXA 4DPUA 3J7AM 4DR2E 2VQEE 3OTOE 2ZM6E 3QT7A 1ZXNA 4LF7E 5LMUE 4JYAI 1PKPA 2UUAE 4DR1I 4DU7A 2UXCE 4JV5E 3J80Q 2VQFE 2X36A 5LMNI 1HNXI 4X66E 4DR7E 4WUDA 2O1TA 1J5EE 4MYTA 4HXZA 2V34A 4K0KI 4JI2E 1NZ0A 4HY1A 4RPFA 1XMOI 4X64I 3JAMQ 4JI5I 3M6AA 3J7AG 1HR0I 1NHIA 2PNMA 3GONA 2HK2A 5IWAI 4DV3I 4JI0E 1XNRI 3Q1QA 4GKKE 2E5LI 2R42A 1D6TA 1N33E 3PYGA 1DARA 4FWDA 1MG7A 1FNMA 4DR5E 1FJGE 2F4VE 3PRYA 3J80C 2CZ9A 1N0UA 1OJ4A 2ZITA 4EMDA 3LNUA 4HACA 3ZM7A 4LFAE 1Y4UA 2E1RA 4USMA 4LF5I 1XMQI 1IBKI 4DV7I 2UU9I 4DV0E 4B3MI 4OX9I 3ZKDA 2Z5BB 3F0NA 4IZJD 4P52A 3JAMC 2HKEA 4Z7YA 4DR2I 3OTOI 1XHKA 2ZM6I 4FWGA 1PVGA 2HK3A 4LF7I 1H7UA 2DEIA 1KVKA 1H73A 2UUAI 2Z5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S E;  2UXC I;  1H72 C;  4UTG A;  4JV5 I;  5GME A;  2V2V A;  2VQF I;  4XTJ A;  2V8P A;  4X66 I;  3K1J A;  4KQV A;  1Z0C A;  2UXB E;  2HHH E;  4PU9 A;  1FWL A;  3K17 A;  3ZZU A;  1J5E I;  1Z0E A;  4LF8 E;  1MX0 A;  4LF4 E;  1I94 E;  1ZXM A;  4FWH A;  4URL A;  4PRV A;  4JI6 E;  1N34 E;  1HNW E;  2BM0 A;  4JI0 I;  2Q2E B;  4GKK I;  3WU4 A;  1NHJ A;  1Z5B A;  5IT9 C;  1N33 I;  2V2Q A;  3PYE A;  3WU5 A;  4DR5 I;  1BKN A;  4DUY I;  2F4V I;  3B78 A;  1ZM3 A;  5A2Q Q;  2GS8 A;  4JI8 E;  4HYM A;  3J81 Q;  2DEJ A;  4LFA I;  4DV0 I;  4GKJ E;  3QT6 A;  5L3J A;  1FKA E;  1ZM2 A;  4UT4 A;  2A2C A;  4DV2 I;  2LJP A;  3HUL A;  1U2R A;  3H4L A;  2J7K A;  4Z7C A;  4LF9 E;  4YHH E;  4WUC A;  2UXD I;  1ZM9 A;  4KHP E;  4B3S I;  4LFC I;  5BR8 E;  4JI3 E;  5A2Q C;  2UXB I;  2HHH I;  1Z0G A;  2AJ4 A;  1N36 E;  1FWK A;  2UUC E;  4FN5 A;  1XNQ I;  4DR4 E;  3J81 C;  3QT5 A;  2NPF A;  2HFS A;  1Z5A A;  4LF8 I;  4LF4 I;  2VQE I;  2EFG A;  1I94 I;  1XMO E;  4DUZ E;  4DXL A;  4ED4 A;  5LMU I;  3WU6 A;  1ELO A;  4LFB E;  4JI7 E;  1Z0T A;  2OI2 A;  4JI6 I;  3LPS A;  4DV5 E;  4DPY A;  2BV3 A;  3V5R A;  1XNR E;  4DV3 E;  1MU5 A;  4JI4 E;  1UEK A;  1S16 A;  1HNZ E;  5FLX Q;  4B3R E;  4DR7 I;  4NXN E;  3PYD A;  2HKJ A;  4JI1 E;  3ZKB A;  4DV6 E;  3LTO A;  4AQY E;  4DV4 E;  4DR3 E;  4JI2 I;  4JI8 I;  4NXM E;  2BM1 A;  1ZM4 A;  1B63 A;  4DV1 E;  4GKJ I;  1XMQ E;  4X65 E;  1EI1 A;  5LL6 R;  3ZZ0 A;  1VIS A;  3D4J A;  3WU3 A;  2WW4 A;  1N32 E;  2X7I A;  1IBM E;  1RRE A;  1FI4 A;  1FJG I;  2VF3 A;  3T1Y E;  4LF9 I;  4YHH I;  4KHP I;  4LF6 E;  5FLX C;  4YY3 E;  4B3T E;  5BR8 I;  3T1H E;  4JI3 I;  4FW9 A;  1IBL E;  2ZBK B;  4X62 E;  1N36 I;  2UUB E;  2UUC I;  4DPT A;  5GMD A;  4DR4 I;  4P7A A;  4DR6 E;  3CWV A;  4DUZ I;  4LFB I;  4JYA E;  4JI7 I;  1EA6 A;  4DV5 I;  4DR1 E;  4M1K A;  4DPX A;  4HAC B;  2V2Z A;  4JI4 I;  1QZR A;  3B82 A;  4USK A;  5LMN E;  1HNX E;  1HNZ I;  1Z5C A;  4B3R I;  1H74 A;  4DPW A;  4NXN I;  4MYU A;  4JI1 I;  4DUY E;  4DV6 I;  1KKH A;  4AQY I;  4DV4 I;  4I3H A;  2XEX A;  4DR3 I;  4K0K E;  3PYF A;  4NXM I;  4X64 E;  4JG4 A;  1K47 A;  1Z0B A;  4DV1 I;  4X65 I;  4JI5 E;  4R1F A;  1N34 I;  1HNW I;  1S4E A;  1WUU A;  4DV2 E;  1HR0 E;  5IWA E;  2E5L E;  1Z0V A;  1PIE A;  1N0V C;  1N32 I;  1IBM I;  1H7S A;  3V2U C;  1KTV A;  5IT9 Q;  3T1Y I;  2HFU A;  4ZVI A;  1B62 A;  4LF6 I;  1NHH A;  2UXD E;  4YY3 I;  4B3T I;  2R3V A;  4DU8 A;  4LFC E;  3B8H A;  3T1H I;  1Z0W A;  1A6F A;  4LF5 E;  1IBL I;  1IBK E;  4DV7 E;  2UU9 E;  4B3M E;  4OX9 E;  4X62 I;  2UUB I;  1KIJ A;  1Z59 A;  1RR9 A;  3ZZT A;  1XNQ E;  2A2D A;  4DR6 I;  3QT8 A;  4WUB A;  4PRX A;  4DPU A;  3J7A M;  4DR2 E;  2VQE E;  3OTO E;  2ZM6 E;  3QT7 A;  1ZXN A;  4LF7 E;  5LMU E;  4JYA I;  1PKP A;  2UUA E;  4DR1 I;  4DU7 A;  2UXC E;  4JV5 E;  3J80 Q;  2VQF E;  2X36 A;  5LMN I;  1HNX I;  4X66 E;  4DR7 E;  4WUD A;  1J5E E;  4MYT A;  4HXZ A;  2V34 A;  4K0K I;  4JI2 E;  1NZ0 A;  4HY1 A;  4RPF A;  1XMO I;  4X64 I;  3JAM Q;  4JI5 I;  3M6A A;  3J7A G;  1HR0 I;  1NHI A;  3GON A;  5IWA I;  2HK2 A;  4DV3 I;  4JI0 E;  1XNR I;  3Q1Q A;  4GKK E;  2E5L I;  2R42 A;  1D6T A;  1N33 E;  3PYG A;  1DAR A;  4FWD A;  1MG7 A;  1FNM A;  4DR5 E;  1FJG E;  2F4V E;  3J80 C;  2CZ9 A;  1N0U A;  1OJ4 A;  2ZIT A;  4EMD A;  3LNU A;  4HAC A;  3ZM7 A;  4LFA E;  2E1R A;  4USM A;  4LF5 I;  1XMQ I;  1IBK I;  4DV7 I;  2UU9 I;  4DV0 E;  4B3M I;  4OX9 I;  3ZKD A;  3F0N A;  4P52 A;  3JAM C;  2HKE A;  4Z7Y A;  4DR2 I;  3OTO I;  1XHK A;  2ZM6 I;  4FWG A;  1PVG A;  2HK3 A;  4LF7 I;  1H7U A;  2DEI A;  1KVK A;  1H73 A;  2UUA I; 
#chains in the Genus database with same CATH topology
 4IFD A;  2IOP A;  4B3S E;  4FW6 A;  2UXC I;  1H72 C;  4UTG A;  4QNK A;  4JV5 I;  5GME A;  2V2V A;  2VQF I;  4XTJ A;  2V8P A;  2PO1 A;  2VES A;  5DNL A;  4X66 I;  3K1J A;  4KQV A;  1Z0C A;  2UXB E;  2HHH E;  4PU9 A;  1FWL A;  4AID A;  3L7Z B;  3K17 A;  3ZZU A;  1J5E I;  1Z0E A;  4LF8 E;  1MX0 A;  4LF4 E;  4IZJ B;  1I94 E;  4IZK B;  1ZXM A;  4FWH A;  4URL A;  4PRV A;  4BA2 B;  1Y6Z A;  4JI6 E;  1N34 E;  1HNW E;  5C0X B;  3K85 A;  2BM0 A;  3L7Z A;  4JI0 I;  2Q2E B;  4GKK I;  3WU4 A;  1NHJ A;  1Z5B A;  3U1K A;  2NN6 D;  5IT9 C;  5FWK A;  1N33 I;  2V2Q A;  4J3D A;  3PYE A;  3Q6N A;  1Y4S A;  3GME A;  3WU5 A;  4DR5 I;  1USV A;  2C37 A;  1BKN A;  4DUY I;  2F4V I;  3B78 A;  5EL9 A;  5DRP A;  2GO4 A;  3CDI A;  4BA2 A;  1E3P A;  1ZM3 A;  3P3G A;  2BR2 B;  4MU1 A;  5A2Q Q;  2GS8 A;  4JI8 E;  4HYM A;  3J81 Q;  2DEJ A;  5DRR A;  4LFA I;  4DV0 I;  4GKJ E;  3QT6 A;  5L3J A;  1FKA E;  1RHY A;  2O1U A;  1ZM2 A;  1P42 A;  4UT4 A;  2A2C A;  4DV2 I;  2LJP A;  3HUL A;  4N3O A;  4IS9 A;  4OO1 D;  1U2R A;  3H4L A;  4IFD E;  1OYR A;  2NN6 B;  1OYP A;  2J7K A;  4Z7C A;  4LF9 E;  4YHH E;  3HKM A;  4WUC A;  2UXD I;  1ZM9 A;  5DRO A;  4KHP E;  4B3S I;  4LFC I;  5BR8 E;  4JI3 E;  3P06 A;  5A2Q C;  2UXB I;  1UDS A;  2HHH I;  1Z0G A;  2AJ4 A;  1N36 E;  1FWK A;  2UUC E;  4FN5 A;  1XNQ I;  4DR4 E;  3J81 C;  3M7N G;  3QT5 A;  2NPF A;  2NN6 A;  2HFS A;  1Z5A A;  2PO0 B;  4LF8 I;  1OYS A;  5ELW A;  2BA1 D;  4LF4 I;  3Q6M A;  2IOQ A;  2VQE I;  2EFG A;  1I94 I;  3UHM A;  1XMO E;  4DUZ E;  2J65 A;  4DXL A;  4ED4 A;  5LMU I;  3WU6 A;  1ELO A;  4LFB E;  4OO1 B;  4JI7 E;  1R6L A;  1Z0T A;  2OI2 A;  4JI6 I;  2C39 A;  3LPS A;  4DV5 E;  4BA1 A;  4DPY A;  2CG9 A;  2BV3 A;  3V5R A;  1XNR E;  4DV3 E;  1MU5 A;  1UDQ A;  4MQY A;  4IFD F;  4JI4 E;  1UEK A;  1S16 A;  2O1W A;  1HNZ E;  4OKG A;  5FLX Q;  4OO1 C;  4B3R E;  3PS3 A;  4DR7 I;  2PO2 B;  4NXN E;  3PYD A;  2HKJ A;  4JI1 E;  3ZKB A;  4OO1 A;  3LTO A;  4DV6 E;  4AQY E;  4DV4 E;  4DR3 E;  4JI2 I;  4JI8 I;  4LPF A;  4NXM E;  2BM1 A;  2Z5E A;  1ZM4 A;  5JEA F;  1B63 A;  4DV1 E;  4GKJ I;  1XMQ E;  4X65 E;  1EI1 A;  3HJC A;  3P3C A;  1USU A;  5K36 F;  4LCF A;  5LL6 R;  4MU3 A;  2PO2 A;  3DD6 A;  2Z5C B;  3ZZ0 A;  1VIS A;  3D4J A;  3WU3 A;  2WW4 A;  1N32 E;  2X7I A;  2PNL A;  4IZJ A;  1IBM E;  1RRE A;  1R6M A;  4IZK A;  1FI4 A;  1FJG I;  2VF3 A;  3T1Y E;  5DRQ A;  4LF9 I;  2JT2 A;  4YHH I;  5C0X C;  4ISA A;  5C0X A;  4KHP I;  4LF6 E;  5FLX C;  4YY3 E;  2Z5C A;  4B3T E;  5BR8 I;  3T1H E;  4JI3 I;  4FW9 A;  1IBL E;  2CGE A;  2ZBK B;  4X62 E;  1N36 I;  2UUB E;  2UUC I;  4DPT A;  5GMD A;  4DR4 I;  4P7A A;  4AM3 A;  4DR6 E;  4FW7 A;  2PNZ B;  3CWV A;  2BR2 A;  2GQ0 A;  4IFD D;  4DUZ I;  4OZE A;  2O1V A;  4LFB I;  4JYA E;  4JI7 I;  1EA6 A;  4GQU A;  4DV5 I;  4DR1 E;  3P3E A;  4M1K A;  4DPX A;  4HAC B;  2V2Z A;  4OO1 E;  4JI4 I;  2PNZ A;  2BA0 G;  2CVE A;  3M7N D;  1QZR A;  3B82 A;  4USK A;  5LMN E;  3M85 D;  1HNX E;  1HNZ I;  1Z5C A;  4MU0 A;  1E3H A;  1H74 A;  2NN6 C;  4DPW A;  4B3R I;  5JEA D;  1UDN A;  4NXN I;  2WP8 B;  4MYU A;  4JI1 I;  4DUY E;  4DV6 I;  1KKH A;  4AQY I;  4QNJ A;  5K36 D;  3M85 G;  4DV4 I;  4U3B A;  1Y5Y A;  2IES A;  2XEX A;  4I3H A;  4DR3 I;  4K0K E;  3PYF A;  4NXM I;  4FW4 A;  4X64 E;  4JG4 A;  1K47 A;  1Z0B A;  4DV1 I;  4X65 I;  4JI5 E;  4R1F A;  1N34 I;  1HNW I;  1S4E A;  4IFD B;  1WUU A;  2JEB B;  4DV2 E;  1HR0 E;  5IWA E;  2AE8 A;  3CDJ A;  2PO0 A;  2E5L E;  1Z0V A;  4MU4 A;  1PIE A;  1N0V C;  5C0X E;  1N32 I;  1IBM I;  1H7S A;  3V2U C;  1HK7 A;  1KTV A;  5IT9 Q;  3T1Y I;  4ZVI A;  2HFU A;  3P76 A;  3H1C A;  3GLL A;  4LCH A;  1B62 A;  4NBQ A;  3U1Y A;  4LF6 I;  1NHH A;  2UXD E;  4YY3 I;  2JEB A;  5JEA B;  1UDO A;  4B3T I;  2GO3 A;  2R3V A;  4DU8 A;  4LFC E;  3B8H A;  3T1H I;  5EKW A;  1Z0W A;  1A6F A;  3KRN A;  5K36 B;  1YHC A;  4LF5 E;  1IBL I;  1IBK E;  4DV7 E;  2UU9 E;  4B3M E;  4OX9 E;  4X62 I;  2UUB I;  1KIJ A;  1Z59 A;  1RR9 A;  3ZZT A;  1XNQ E;  2A2D A;  4DR6 I;  3QT8 A;  4WUB A;  4PRX A;  4DPU A;  3J7A M;  5JEA C;  2F1D A;  4DR2 E;  3PS2 A;  2VQE E;  4LCG A;  5JEA A;  3OTO E;  3PS1 A;  2C37 B;  2ZM6 E;  3QT7 A;  5K36 C;  1ZXN A;  4LF7 E;  5LMU E;  4JYA I;  1PKP A;  4AIM A;  5K36 A;  2UUA E;  4DR1 I;  2JEA B;  2IER A;  3B4T A;  4DU7 A;  2JE6 B;  2NN6 E;  5C0X F;  2UXC E;  4JV5 E;  3J80 Q;  2VQF E;  2X36 A;  5LMN I;  1HNX I;  4X66 E;  4FW5 A;  4DR7 E;  4WUD A;  5DNX A;  2O1T A;  1J5E E;  2JEA A;  4MYT A;  4HXZ A;  2V34 A;  4K0K I;  4JI2 E;  1NZ0 A;  2JE6 A;  4HY1 A;  4RPF A;  1XMO I;  4X64 I;  3JAM Q;  4MDT A;  4JI5 I;  3M6A A;  2BA0 D;  3J7A G;  1HR0 I;  1NHI A;  2PNM A;  3GON A;  2HK2 A;  5IWA I;  4DV3 I;  4JI0 E;  2WNR B;  3GCM A;  1XNR I;  3Q1Q A;  4GKK E;  2E5L I;  2R42 A;  1D6T A;  1N33 E;  3PYG A;  1DAR A;  4FWD A;  4U3D A;  1MG7 A;  1Y60 A;  1FNM A;  4FW3 A;  4DR5 E;  1FJG E;  2F4V E;  3PRY A;  3J80 C;  2C38 B;  2NN6 F;  2CZ9 A;  1N0U A;  1OJ4 A;  2ZIT A;  4EMD A;  3LNU A;  4HAC A;  2WNR A;  1VI7 A;  3ZM7 A;  4LFA E;  3NZK A;  1Y4U A;  2E1R A;  4USM A;  4LF5 I;  1XMQ I;  1IBK I;  4DV7 I;  2UU9 I;  4DV0 E;  4B3M I;  4OX9 I;  3ZKD A;  2C39 B;  5JEA E;  2Z5B B;  4BA1 B;  3F0N A;  4IZJ D;  2WP8 A;  4P52 A;  5K36 E;  2C38 A;  3JAM C;  2HKE A;  1YH8 A;  4Z7Y A;  4DR2 I;  2PO1 B;  2O3Z A;  5C0X D;  3OTO I;  1XHK A;  2ZM6 I;  1XXE A;  4FWG A;  1PVG A;  2HK3 A;  4LF7 I;  1H7U A;  2DEI A;  1KVK A;  2BA1 G;  1H73 A;  2UUA I;  4LOM A;  4IFD C;  4OO1 F;  2Z5B A; 
#chains in the Genus database with same CATH homology
 2IOP A;  4B3S E;  2UXC I;  1H72 C;  4UTG A;  4JV5 I;  5GME A;  2V2V A;  2VQF I;  4XTJ A;  2V8P A;  4X66 I;  3K1J A;  4KQV A;  1Z0C A;  2UXB E;  2HHH E;  4PU9 A;  1FWL A;  3K17 A;  3ZZU A;  1J5E I;  1Z0E A;  4LF8 E;  1MX0 A;  4LF4 E;  4IZJ B;  1I94 E;  4IZK B;  1ZXM A;  4FWH A;  4URL A;  4PRV A;  1Y6Z A;  4JI6 E;  1N34 E;  1HNW E;  3K85 A;  2BM0 A;  4JI0 I;  2Q2E B;  4GKK I;  3WU4 A;  1NHJ A;  1Z5B A;  5IT9 C;  5FWK A;  1N33 I;  2V2Q A;  3PYE A;  3Q6N A;  1Y4S A;  3WU5 A;  4DR5 I;  1USV A;  1BKN A;  4DUY I;  2F4V I;  3B78 A;  1ZM3 A;  5A2Q Q;  2GS8 A;  4JI8 E;  4HYM A;  3J81 Q;  2DEJ A;  4LFA I;  4DV0 I;  4GKJ E;  3QT6 A;  5L3J A;  1FKA E;  2O1U A;  1ZM2 A;  4UT4 A;  2A2C A;  4DV2 I;  2LJP A;  3HUL A;  4N3O A;  1U2R A;  3H4L A;  2J7K A;  4Z7C A;  4LF9 E;  4YHH E;  4WUC A;  2UXD I;  1ZM9 A;  4KHP E;  4B3S I;  4LFC I;  5BR8 E;  4JI3 E;  3P06 A;  5A2Q C;  2UXB I;  2HHH I;  1Z0G A;  2AJ4 A;  1N36 E;  1FWK A;  2UUC E;  4FN5 A;  1XNQ I;  4DR4 E;  3J81 C;  3QT5 A;  2NPF A;  2HFS A;  1Z5A A;  4LF8 I;  4LF4 I;  3Q6M A;  2IOQ A;  2VQE I;  2EFG A;  1I94 I;  1XMO E;  4DUZ E;  4DXL A;  4ED4 A;  5LMU I;  3WU6 A;  1ELO A;  4LFB E;  4JI7 E;  1Z0T A;  2OI2 A;  4JI6 I;  3LPS A;  4DV5 E;  4DPY A;  2CG9 A;  2BV3 A;  3V5R A;  1XNR E;  4DV3 E;  1MU5 A;  4JI4 E;  1UEK A;  1S16 A;  2O1W A;  1HNZ E;  5FLX Q;  4B3R E;  4DR7 I;  4NXN E;  3PYD A;  2HKJ A;  4JI1 E;  3ZKB A;  4DV6 E;  3LTO A;  4AQY E;  4DV4 E;  4DR3 E;  4JI2 I;  4JI8 I;  4NXM E;  2BM1 A;  2Z5E A;  1ZM4 A;  1B63 A;  4DV1 E;  4GKJ I;  1XMQ E;  4X65 E;  1EI1 A;  3HJC A;  1USU A;  5LL6 R;  2Z5C B;  3ZZ0 A;  1VIS A;  3D4J A;  3WU3 A;  2WW4 A;  1N32 E;  2X7I A;  2PNL A;  4IZJ A;  1IBM E;  1RRE A;  4IZK A;  1FI4 A;  1FJG I;  2VF3 A;  3T1Y E;  4LF9 I;  4YHH I;  4KHP I;  4LF6 E;  5FLX C;  4YY3 E;  2Z5C A;  4B3T E;  5BR8 I;  3T1H E;  4JI3 I;  4FW9 A;  1IBL E;  2CGE A;  2ZBK B;  4X62 E;  1N36 I;  2UUB E;  2UUC I;  4DPT A;  5GMD A;  4DR4 I;  4P7A A;  4DR6 E;  3CWV A;  2GQ0 A;  4DUZ I;  2O1V A;  4LFB I;  4JYA E;  4JI7 I;  1EA6 A;  4DV5 I;  4DR1 E;  4M1K A;  4DPX A;  4HAC B;  2V2Z A;  4JI4 I;  1QZR A;  3B82 A;  4USK A;  5LMN E;  1HNX E;  1HNZ I;  1Z5C A;  4B3R I;  1H74 A;  4DPW A;  4NXN I;  4MYU A;  4JI1 I;  4DUY E;  4DV6 I;  1KKH A;  4AQY I;  4DV4 I;  4I3H A;  2XEX A;  4DR3 I;  4K0K E;  3PYF A;  4NXM I;  4X64 E;  4JG4 A;  1K47 A;  1Z0B A;  4DV1 I;  4X65 I;  4JI5 E;  4R1F A;  1N34 I;  1HNW I;  1S4E A;  1WUU A;  4DV2 E;  1HR0 E;  5IWA E;  2E5L E;  1Z0V A;  1PIE A;  1N0V C;  1N32 I;  1IBM I;  1H7S A;  3V2U C;  1HK7 A;  1KTV A;  5IT9 Q;  3T1Y I;  2HFU A;  4ZVI A;  1B62 A;  4LF6 I;  1NHH A;  2UXD E;  4YY3 I;  4B3T I;  2R3V A;  4DU8 A;  4LFC E;  3B8H A;  3T1H I;  1Z0W A;  1A6F A;  4LF5 E;  1IBL I;  1IBK E;  4DV7 E;  2UU9 E;  4B3M E;  4OX9 E;  4X62 I;  2UUB I;  1KIJ A;  1Z59 A;  1RR9 A;  3ZZT A;  1XNQ E;  2A2D A;  4DR6 I;  3QT8 A;  4WUB A;  4PRX A;  4DPU A;  3J7A M;  4DR2 E;  2VQE E;  3OTO E;  2ZM6 E;  3QT7 A;  1ZXN A;  4LF7 E;  5LMU E;  4JYA I;  1PKP A;  2UUA E;  4DR1 I;  4DU7 A;  2UXC E;  4JV5 E;  3J80 Q;  2VQF E;  2X36 A;  5LMN I;  1HNX I;  4X66 E;  4DR7 E;  4WUD A;  2O1T A;  1J5E E;  4MYT A;  4HXZ A;  2V34 A;  4K0K I;  4JI2 E;  1NZ0 A;  4HY1 A;  4RPF A;  1XMO I;  4X64 I;  3JAM Q;  4JI5 I;  3M6A A;  3J7A G;  1HR0 I;  1NHI A;  2PNM A;  3GON A;  2HK2 A;  5IWA I;  4DV3 I;  4JI0 E;  1XNR I;  3Q1Q A;  4GKK E;  2E5L I;  2R42 A;  1D6T A;  1N33 E;  3PYG A;  1DAR A;  4FWD A;  1MG7 A;  1FNM A;  4DR5 E;  1FJG E;  2F4V E;  3PRY A;  3J80 C;  2CZ9 A;  1N0U A;  1OJ4 A;  2ZIT A;  4EMD A;  3LNU A;  4HAC A;  3ZM7 A;  4LFA E;  1Y4U A;  2E1R A;  4USM A;  4LF5 I;  1XMQ I;  1IBK I;  4DV7 I;  2UU9 I;  4DV0 E;  4B3M I;  4OX9 I;  3ZKD A;  2Z5B B;  3F0N A;  4IZJ D;  4P52 A;  3JAM C;  2HKE A;  4Z7Y A;  4DR2 I;  3OTO I;  1XHK A;  2ZM6 I;  4FWG A;  1PVG A;  2HK3 A;  4LF7 I;  1H7U A;  2DEI A;  1KVK A;  1H73 A;  2UUA I;  2Z5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...