4GKKI

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4gkkI00
1N0UA 1H7SA 2LJPA 1H73A 4JV5I 4DPTA 2E5LI 1NHJA 1IBKE 3JAMC 2V2QA 4JYAI 4PU9A 3J80Q 1KTVA 4WUDA 3WU5A 4JI3I 1S4EA 4DUYI 3H4LA 4DR7E 2BM0A 1Z0EA 4X65E 4JI5I 2HK2A 4WUBA 4JI8E 1OJ4A 4FW9A 1PKPA 1Z0TA 1XNRE 1RREA 2NPFA 1Z0BA 3LPSA 4X64E 3ZM7A 1KVKA 4DU7A 4NXME 1J5EI 1H74A 5A2QQ 1XNQE 1RR9A 2UU9E 3D4JA 2R42A 4HACA 4DR7I 4X65I 1N36E 4DR6E 1Z5BA 4NXNI 5FLXC 4DV4I 4X62I 3QT6A 1HR0E 4DR1E 5GMEA 1UEKA 1ZM3A 4HYMA 1IBLI 4FN5A 1EA6A 4DV0E 4FWGA 1H72C 4DV5E 4Z7YA 1ZXNA 4DV7E 4LF6I 4K0KE 1Z0VA 4LFCI 1B63A 4B3SE 4GKJI 2DEIA 4JI4E 1FJGI 4DPWA 4X66I 4EMDA 2UXCI 1H7UA 4JV5E 2E5LE 5GMDA 2UUAI 1Z5AA 2UXDI 2A2DA 3B8HA 2EFGA 4B3RI 4DV5I 4MYUA 4DV7I 5L3JA 4GKKI 4MYTA 4K0KI 5BR8I 3OTOI 2GS8A 4B3MI 4DUYE 1ZXMA 2V2ZA 4JI5E 4JG4A 1ZM9A 4DPXA 4DV1I 3QT7A 1Z0CA 4XTJA 5IWAI 3HULA 4KHPI 3J7AG 2UXBI 2V34A 2AJ4A 4DV3I 4DR5I 2XEXA 4OX9I 4JI6I 4P52A 4YY3E 4KQVA 1J5EE 1U2RA 2F4VI 4NXNE 1PVGA 2E1RA 3T1YI 4ED4A 4B3TE 4DXLA 4HACB 2V8PA 4USKA 3ZKBA 1Z0GA 4DV4E 2ZITA 1NHIA 2HFSA 4X62E 4JI0E 1WUUA 2HFUA 4YY3I 5IT9C 1IBLE 4LF5E 1XMQI 4LFBI 4B3TI 4I3HA 4LF6E 4JI1I 5LMNE 4LFCE 3WU3A 4GKJE 4JI0I 3JAMQ 4P7AA 4YHHI 3PYFA 1FJGE 4X66E 1ZM2A 2UXCE 3K17A 2HHHE 2UUAE 2UXDE 4LF7E 4JI2I 1HNWI 3V5RA 3J81Q 1FWKA 1N34I 4B3RE 2ZBKB 4LF5I 2X36A 4LFAE 1Z5CA 2CZ9A 4GKKE 3PYDA 4LF9E 5BR8E 3OTOE 4DV6I 3V2UC 5LMNI 1HNZI 4B3ME 3WU4A 2V2VA 1PIEA 5LMUE 3CWVA 3GONA 4FWDA 1N32I 1MX0A 4DV1E 1VISA 2HHHI 4DR4I 4LF7I 3K1JA 3J80C 5IWAE 2UXBE 4KHPE 4UT4A 3F0NA 4DV3E 4DR5E 4OX9E 4LFAI 4JI6E 5FLXQ 1KKHA 1MU5A 4LF9I 2BV3A 2F4VE 4DUZI 2R3VA 4LF8I 1FNMA 5LMUI 3Q1QA 3T1YE 1QZRA 1I94I 4UTGA 2ZM6E 2VF3A 4LF4E 4DR2I 1XHKA 2WW4A 5A2QC 1Z0WA 3PYGA 1EI1A 4RPFA 1D6TA 4URLA 2HK3A 3ZZ0A 4WUCA 2VQFI 1B62A 2BM1A 3B78A 2UUBI 4AQYI 1XMQE 4LFBE 2VQEI 4JI1E 4PRVA 2Q2EB 2ZM6I 1K47A 4DPUA 4LF4I 3T1HE 1FI4A 1HNXI 3ZKDA 1IBMI 4YHHE 4JI7E 3J81C 3QT5A 4Z7CA 1N33I 4DR3I 4JI2E 1HNWE 2A2CA 3B82A 2UUCE 1N34E 4DPYA 1IBKI 4ZVIA 1ELOA 3M6AA 4DU8A 4DV6E 1HNZE 3T1HI 4M1KA 3ZZTA 4JI7I 1N32E 1KIJA 4DR4E 4HXZA 2OI2A 4R1FA 2UUCI 4JI8I 3QT8A 1MG7A 3PYEA 4PRXA 1XNRI 4DV2E 3WU6A 5LL6R 1FKAE 4X64I 4DUZE 4NXMI 4LF8E 4HY1A 1XNQI 2UU9I 5IT9Q 2HKJA 1I94E 3J7AM 1N36I 4DR6I 2X7IA 3LNUA 1BKNA 4DR2E 2DEJA 3ZZUA 2J7KA 3LTOA 4DV2I 1N0VC 1FWLA 1HR0I 1XMOE 4DR1I 1NZ0A 1DARA 2VQFE 1NHHA 2UUBE 4AQYE 4DV0I 2VQEE 4JYAE 4FWHA 4USMA 1HNXE 1ZM4A 1IBME 4JI3E 1Z59A 1A6FA 1S16A 4B3SI 2HKEA 4JI4I 1N33E 4DR3E 1XMOI
chains in the Genus database with same CATH superfamily
1N0UA 1H7SA 1YH8A 2LJPA 1H73A 4OO1A 5K36C 4JV5I 4DPTA 2E5LI 1NHJA 1IBKE 3H1CA 4BA1B 3JAMC 2V2QA 4JYAI 1USVA 4PU9A 3J80Q 1KTVA 4WUDA 3B4TA 3WU5A 4MU1A 3P3CA 4JI3I 1S4EA 1USUA 2O1WA 4LOMA 4DUYI 3H4LA 4MQYA 2BM0A 4DR7E 1Z0EA 4X65E 4JI5I 2HK2A 4BA1A 4WUBA 4JI8E 1OJ4A 4FW9A 1PKPA 4OO1F 1Z0TA 4IZJD 1XNRE 5C0XA 3M85D 1YHCA 2PO1B 1RREA 2NPFA 1Z0BA 3LPSA 4X64E 3ZM7A 5JEAA 1KVKA 4DU7A 4NXME 4NBQA 1J5EI 1E3PA 1H74A 5A2QQ 1XNQE 1RR9A 2UU9E 3D4JA 2R42A 4HACA 4DR7I 3M7ND 4X65I 1N36E 4DR6E 1Z5BA 4NXNI 5FLXC 2AE8A 2C38B 4DV4I 2BA1G 3GCMA 1OYSA 1R6LA 4X62I 3QT6A 1OYPA 1HR0E 2PO2A 4DR1E 2J65A 5GMEA 1UEKA 4IFDB 4OO1C 2GQ0A 1ZM3A 2IOPA 4HYMA 4IS9A 1IBLI 4FN5A 1EA6A 4DV0E 4FWGA 3P76A 1H72C 5DRPA 4DV5E 2JE6B 4Z7YA 1ZXNA 4DV7E 3P06A 4LF6I 4K0KE 2F1DA 1Z0VA 4LFCI 1B63A 4B3SE 4GKJI 2DEIA 4JI4E 5K36E 2C37A 1FJGI 4DPWA 4X66I 1R6MA 4EMDA 1UDNA 2UXCI 1H7UA 4JV5E 2E5LE 5GMDA 3L7ZA 2UUAI 4MU0A 1Z5AA 2BA0D 2JE6A 2UXDI 2A2DA 2PNLA 1XXEA 3B8HA 2EFGA 5K36D 5C0XC 4B3RI 4DV5I 1OYRA 4MYUA 4DV7I 2JEBA 5L3JA 4GKKI 4MYTA 4K0KI 3P3GA 4LCFA 5BR8I 3OTOI 2GS8A 5DRRA 4FW4A 1Y4UA 5DROA 4B3MI 4DUYE 1ZXMA 2V2ZA 4JI5E 4IFDF 4JG4A 1ZM9A 1VI7A 4DPXA 1Y4SA 3PS3A 4DV1I 3QT7A 4FW3A 1Z0CA 3DD6A 5DRQA 5DNLA 4XTJA 5IWAI 3HULA 4KHPI 3J7AG 2UXBI 2V34A 2AJ4A 5ELWA 4DV3I 4DR5I 2XEXA 4OX9I 4JI6I 4P52A 5C0XB 4YY3E 4KQVA 4IFDD 1J5EE 1U2RA 5JEAB 2F4VI 2O1TA 2WP8A 3CDJA 3PS2A 4NXNE 4AIDA 1PVGA 2E1RA 3T1YI 4ED4A 4B3TE 4DXLA 4HACB 4USKA 2V8PA 3ZKBA 1Z0GA 4DV4E 4BA2A 2ZITA 1NHIA 2HFSA 4X62E 4JI0E 5DNXA 4IFDC 1WUUA 2NN6B 4OO1E 4GQUA 4AIMA 2HFUA 4YY3I 5IT9C 2JEAB 2GO4A 1IBLE 4MU3A 2PO2B 3NZKA 4FW7A 4OO1D 4LF5E 1UDOA 1XMQI 3Q6NA 4LFBI 4B3TI 5EL9A 4I3HA 4LF6E 3P3EA 4JI1I 2NN6A 5LMNE 4LFCE 3WU3A 4GKJE 4JI0I 3JAMQ 4LPFA 4P7AA 2JEAA 1RHYA 4YHHI 3PYFA 5C0XF 1FJGE 3PRYA 4X66E 1ZM2A 2BA1D 2UXCE 3K17A 2C39B 2HHHE 2UUAE 5JEAF 2UXDE 4LF7E 2C37B 4JI2I 1HNWI 2O3ZA 3V5RA 3J81Q 1UDQA 1FWKA 1N34I 4B3RE 2ZBKB 3L7ZB 2PO0B 4LF5I 3GLLA 2X36A 4LFAE 4ISAA 1Z5CA 2CZ9A 4GKKE 4N3OA 4MU4A 3PYDA 4LF9E 5BR8E 5C0XD 3OTOE 4DV6I 3V2UC 5LMNI 1HNZI 2JEBB 4B3ME 2NN6F 3WU4A 2C39A 2V2VA 5JEAD 4LCGA 3HKMA 1PIEA 5LMUE 3CWVA 3GONA 4FWDA 3HJCA 1N32I 1E3HA 1MX0A 4DV1E 4OKGA 1VISA 2HHHI 3UHMA 4DR4I 2PO0A 4LF7I 3K1JA 3J80C 2IOQA 5IWAE 2UXBE 4KHPE 3KRNA 4UT4A 3F0NA 4DV3E 4DR5E 4OX9E 2CG9A 4LFAI 4JI6E 5FLXQ 5JEAC 1KKHA 1MU5A 4LF9I 1HK7A 2BV3A 2F4VE 4DUZI 2R3VA 4LF8I 1FNMA 5LMUI 3Q1QA 3T1YE 1QZRA 3K85A 4IZJA 2WP8B 1I94I 4UTGA 4IZKB 2ZM6E 2NN6C 1Y6ZA 4IFDE 2VF3A 4LF4E 2Z5CB 4DR2I 1XHKA 4BA2B 2WW4A 5A2QC 4QNJA 1Z0WA 3PYGA 1EI1A 3GMEA 4RPFA 1D6TA 4URLA 4AM3A 2HK3A 3ZZ0A 4WUCA 2VQFI 1B62A 2BM1A 3U1KA 3B78A 4IZKA 2UUBI 4AQYI 2JT2A 1XMQE 4LFBE 2Z5CA 2VQEI 4JI1E 4PRVA 2Q2EB 2ZM6I 1K47A 4DPUA 2Z5BA 4LF4I 3T1HE 2GO3A 1FI4A 1HNXI 3ZKDA 1IBMI 4FW5A 4YHHE 4JI7E 3J81C 3QT5A 4Z7CA 1N33I 4U3DA 4DR3I 4JI2E 1Y60A 4OZEA 3M85G 1HNWE 2A2CA 3B82A 2Z5EA 2UUCE 4FW6A 1N34E 4DPYA 1IBKI 2O1UA 5K36B 1Y5YA 4ZVIA 1ELOA 3M6AA 4DU8A 4DV6E 2VESA 1HNZE 2PNMA 3T1HI 3M7NG 4M1KA 3ZZTA 4JI7I 2IESA 1N32E 5EKWA 1KIJA 4DR4E 4HXZA 4LCHA 3U1YA 5K36A 5C0XE 2OI2A 4R1FA 2UUCI 4JI8I 3QT8A 2PO1A 5JEAE 1MG7A 3PYEA 4PRXA 1XNRI 4DV2E 3WU6A 5LL6R 4QNKA 1FKAE 4X64I 4DUZE 2O1VA 4NXMI 4LF8E 4HY1A 1XNQI 2C38A 2UU9I 5IT9Q 2NN6E 2HKJA 1I94E 5FWKA 2PNZB 3J7AM 1N36I 4DR6I 2X7IA 3LNUA 2CGEA 1BKNA 4DR2E 2DEJA 3ZZUA 5K36F 4IZJB 4J3DA 2J7KA 4U3BA 3LTOA 2CVEA 2NN6D 3PS1A 4IFDA 4DV2I 2BA0G 1N0VC 1FWLA 1UDSA 1HR0I 1XMOE 2BR2B 4DR1I 1NZ0A 2WNRB 1DARA 4MDTA 2VQFE 1P42A 2IERA 1NHHA 2UUBE 2PNZA 4AQYE 4DV0I 4OO1B 2VQEE 4JYAE 3CDIA 4FWHA 4USMA 1HNXE 1ZM4A 1IBME 2BR2A 4JI3E 1Z59A 1A6FA 3Q6MA 2WNRA 1S16A 2Z5BB 4B3SI 2HKEA 4JI4I 1N33E 4DR3E 1XMOI
chains in the Genus database with same CATH topology
1N0UA 1H7SA 2LJPA 1H73A 4JV5I 4DPTA 2E5LI 1NHJA 1IBKE 3JAMC 2V2QA 4JYAI 1USVA 4PU9A 3J80Q 1KTVA 4WUDA 3WU5A 4JI3I 1S4EA 1USUA 2O1WA 4DUYI 3H4LA 4DR7E 2BM0A 1Z0EA 4X65E 4JI5I 2HK2A 4WUBA 4JI8E 1OJ4A 4FW9A 1PKPA 1Z0TA 4IZJD 1XNRE 1RREA 2NPFA 1Z0BA 3LPSA 4X64E 3ZM7A 1KVKA 4DU7A 4NXME 1J5EI 1H74A 5A2QQ 1XNQE 1RR9A 2UU9E 3D4JA 2R42A 4HACA 4DR7I 4X65I 1N36E 4DR6E 1Z5BA 4NXNI 5FLXC 4DV4I 4X62I 3QT6A 1HR0E 4DR1E 5GMEA 1UEKA 2GQ0A 1ZM3A 2IOPA 4HYMA 1IBLI 4FN5A 1EA6A 4DV0E 4FWGA 1H72C 4DV5E 4Z7YA 1ZXNA 4DV7E 3P06A 4LF6I 4K0KE 1Z0VA 4LFCI 1B63A 4B3SE 4GKJI 2DEIA 4JI4E 1FJGI 4DPWA 4X66I 4EMDA 2UXCI 1H7UA 4JV5E 2E5LE 5GMDA 2UUAI 1Z5AA 2UXDI 2A2DA 2PNLA 3B8HA 2EFGA 4B3RI 4DV5I 4MYUA 4DV7I 5L3JA 4GKKI 4MYTA 4K0KI 5BR8I 3OTOI 2GS8A 1Y4UA 4B3MI 4DUYE 1ZXMA 2V2ZA 4JI5E 4JG4A 1ZM9A 4DPXA 1Y4SA 4DV1I 3QT7A 1Z0CA 4XTJA 5IWAI 3HULA 4KHPI 3J7AG 2UXBI 2V34A 2AJ4A 4DV3I 4DR5I 2XEXA 4OX9I 4JI6I 4P52A 4YY3E 4KQVA 1J5EE 1U2RA 2F4VI 2O1TA 4NXNE 1PVGA 2E1RA 3T1YI 4ED4A 4B3TE 4DXLA 4HACB 2V8PA 4USKA 3ZKBA 4DV4E 1Z0GA 2ZITA 1NHIA 2HFSA 4X62E 4JI0E 1WUUA 2HFUA 4YY3I 5IT9C 1IBLE 4LF5E 1XMQI 3Q6NA 4LFBI 4B3TI 4I3HA 4LF6E 4JI1I 5LMNE 4LFCE 3WU3A 4GKJE 4JI0I 3JAMQ 4P7AA 4YHHI 3PYFA 1FJGE 3PRYA 4X66E 1ZM2A 2UXCE 3K17A 2HHHE 2UUAE 2UXDE 4LF7E 4JI2I 1HNWI 3V5RA 3J81Q 1FWKA 1N34I 4B3RE 2ZBKB 4LF5I 2X36A 4LFAE 1Z5CA 2CZ9A 4GKKE 4N3OA 3PYDA 4LF9E 5BR8E 3OTOE 4DV6I 3V2UC 5LMNI 1HNZI 4B3ME 3WU4A 2V2VA 1PIEA 5LMUE 3CWVA 3GONA 4FWDA 3HJCA 1N32I 1MX0A 4DV1E 1VISA 2HHHI 4DR4I 4LF7I 3K1JA 3J80C 2IOQA 5IWAE 2UXBE 4KHPE 4UT4A 3F0NA 4DV3E 4DR5E 4OX9E 2CG9A 4LFAI 4JI6E 5FLXQ 1KKHA 1MU5A 4LF9I 1HK7A 2BV3A 2F4VE 4DUZI 2R3VA 4LF8I 1FNMA 5LMUI 3Q1QA 3T1YE 1QZRA 3K85A 4IZJA 1I94I 4IZKB 4UTGA 2ZM6E 1Y6ZA 2VF3A 4LF4E 2Z5CB 4DR2I 1XHKA 2WW4A 5A2QC 1Z0WA 3PYGA 1EI1A 4RPFA 1D6TA 4URLA 2HK3A 3ZZ0A 4WUCA 2VQFI 1B62A 2BM1A 3B78A 4IZKA 2UUBI 4AQYI 1XMQE 4LFBE 2Z5CA 2VQEI 4JI1E 4PRVA 2Q2EB 2ZM6I 1K47A 4DPUA 2Z5BA 4LF4I 3T1HE 1FI4A 1HNXI 3ZKDA 1IBMI 4YHHE 4JI7E 3J81C 3QT5A 4Z7CA 1N33I 4DR3I 4JI2E 1HNWE 2A2CA 3B82A 2Z5EA 2UUCE 1N34E 4DPYA 1IBKI 2O1UA 4ZVIA 1ELOA 3M6AA 4DU8A 4DV6E 1HNZE 2PNMA 3T1HI 4M1KA 3ZZTA 4JI7I 1N32E 1KIJA 4DR4E 4HXZA 2OI2A 4R1FA 2UUCI 4JI8I 3QT8A 1MG7A 3PYEA 4PRXA 1XNRI 4DV2E 3WU6A 5LL6R 1FKAE 4X64I 4DUZE 2O1VA 4NXMI 4LF8E 4HY1A 1XNQI 2UU9I 5IT9Q 2HKJA 1I94E 5FWKA 3J7AM 1N36I 4DR6I 2X7IA 3LNUA 2CGEA 1BKNA 4DR2E 2DEJA 3ZZUA 4IZJB 2J7KA 3LTOA 4DV2I 1N0VC 1FWLA 1HR0I 1XMOE 4DR1I 1NZ0A 1DARA 2VQFE 1NHHA 2UUBE 4AQYE 4DV0I 2VQEE 4JYAE 4FWHA 4USMA 1HNXE 1ZM4A 1IBME 4JI3E 1Z59A 1A6FA 3Q6MA 1S16A 2Z5BB 4B3SI 2HKEA 4JI4I 1N33E 4DR3E 1XMOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0U A;  1H7S A;  2LJP A;  1H73 A;  4JV5 I;  4DPT A;  2E5L I;  1NHJ A;  1IBK E;  3JAM C;  2V2Q A;  4JYA I;  4PU9 A;  3J80 Q;  1KTV A;  4WUD A;  3WU5 A;  4JI3 I;  1S4E A;  4DUY I;  3H4L A;  4DR7 E;  2BM0 A;  1Z0E A;  4X65 E;  4JI5 I;  2HK2 A;  4WUB A;  4JI8 E;  1OJ4 A;  4FW9 A;  1PKP A;  1Z0T A;  1XNR E;  1RRE A;  2NPF A;  1Z0B A;  3LPS A;  4X64 E;  3ZM7 A;  1KVK A;  4DU7 A;  4NXM E;  1J5E I;  1H74 A;  5A2Q Q;  1XNQ E;  1RR9 A;  2UU9 E;  3D4J A;  2R42 A;  4HAC A;  4DR7 I;  4X65 I;  1N36 E;  4DR6 E;  1Z5B A;  4NXN I;  5FLX C;  4DV4 I;  4X62 I;  3QT6 A;  1HR0 E;  4DR1 E;  5GME A;  1UEK A;  1ZM3 A;  4HYM A;  1IBL I;  4FN5 A;  1EA6 A;  4DV0 E;  4FWG A;  1H72 C;  4DV5 E;  4Z7Y A;  1ZXN A;  4DV7 E;  4LF6 I;  4K0K E;  1Z0V A;  4LFC I;  1B63 A;  4B3S E;  4GKJ I;  2DEI A;  4JI4 E;  1FJG I;  4DPW A;  4X66 I;  4EMD A;  2UXC I;  1H7U A;  4JV5 E;  2E5L E;  5GMD A;  2UUA I;  1Z5A A;  2UXD I;  2A2D A;  3B8H A;  2EFG A;  4B3R I;  4DV5 I;  4MYU A;  4DV7 I;  5L3J A;  4GKK I;  4MYT A;  4K0K I;  5BR8 I;  3OTO I;  2GS8 A;  4B3M I;  4DUY E;  1ZXM A;  2V2Z A;  4JI5 E;  4JG4 A;  1ZM9 A;  4DPX A;  4DV1 I;  3QT7 A;  1Z0C A;  4XTJ A;  5IWA I;  3HUL A;  4KHP I;  3J7A G;  2UXB I;  2V34 A;  2AJ4 A;  4DV3 I;  4DR5 I;  2XEX A;  4OX9 I;  4JI6 I;  4P52 A;  4YY3 E;  4KQV A;  1J5E E;  1U2R A;  2F4V I;  4NXN E;  1PVG A;  2E1R A;  3T1Y I;  4ED4 A;  4B3T E;  4DXL A;  4HAC B;  2V8P A;  4USK A;  3ZKB A;  1Z0G A;  4DV4 E;  2ZIT A;  1NHI A;  2HFS A;  4X62 E;  4JI0 E;  1WUU A;  2HFU A;  4YY3 I;  5IT9 C;  1IBL E;  4LF5 E;  1XMQ I;  4LFB I;  4B3T I;  4I3H A;  4LF6 E;  4JI1 I;  5LMN E;  4LFC E;  3WU3 A;  4GKJ E;  4JI0 I;  3JAM Q;  4P7A A;  4YHH I;  3PYF A;  1FJG E;  4X66 E;  1ZM2 A;  2UXC E;  3K17 A;  2HHH E;  2UUA E;  2UXD E;  4LF7 E;  4JI2 I;  1HNW I;  3V5R A;  3J81 Q;  1FWK A;  1N34 I;  4B3R E;  2ZBK B;  4LF5 I;  2X36 A;  4LFA E;  1Z5C A;  2CZ9 A;  4GKK E;  3PYD A;  4LF9 E;  5BR8 E;  3OTO E;  4DV6 I;  3V2U C;  5LMN I;  1HNZ I;  4B3M E;  3WU4 A;  2V2V A;  1PIE A;  5LMU E;  3CWV A;  3GON A;  4FWD A;  1N32 I;  1MX0 A;  4DV1 E;  1VIS A;  2HHH I;  4DR4 I;  4LF7 I;  3K1J A;  3J80 C;  5IWA E;  2UXB E;  4KHP E;  4UT4 A;  3F0N A;  4DV3 E;  4DR5 E;  4OX9 E;  4LFA I;  4JI6 E;  5FLX Q;  1KKH A;  1MU5 A;  4LF9 I;  2BV3 A;  2F4V E;  4DUZ I;  2R3V A;  4LF8 I;  1FNM A;  5LMU I;  3Q1Q A;  3T1Y E;  1QZR A;  1I94 I;  4UTG A;  2ZM6 E;  2VF3 A;  4LF4 E;  4DR2 I;  1XHK A;  2WW4 A;  5A2Q C;  1Z0W A;  3PYG A;  1EI1 A;  4RPF A;  1D6T A;  4URL A;  2HK3 A;  3ZZ0 A;  4WUC A;  2VQF I;  1B62 A;  2BM1 A;  3B78 A;  2UUB I;  4AQY I;  1XMQ E;  4LFB E;  2VQE I;  4JI1 E;  4PRV A;  2Q2E B;  2ZM6 I;  1K47 A;  4DPU A;  4LF4 I;  3T1H E;  1FI4 A;  1HNX I;  3ZKD A;  1IBM I;  4YHH E;  4JI7 E;  3J81 C;  3QT5 A;  4Z7C A;  1N33 I;  4DR3 I;  4JI2 E;  1HNW E;  2A2C A;  3B82 A;  2UUC E;  1N34 E;  4DPY A;  1IBK I;  4ZVI A;  1ELO A;  3M6A A;  4DU8 A;  4DV6 E;  1HNZ E;  3T1H I;  4M1K A;  3ZZT A;  4JI7 I;  1N32 E;  1KIJ A;  4DR4 E;  4HXZ A;  2OI2 A;  4R1F A;  2UUC I;  4JI8 I;  3QT8 A;  1MG7 A;  3PYE A;  4PRX A;  1XNR I;  4DV2 E;  3WU6 A;  5LL6 R;  1FKA E;  4X64 I;  4DUZ E;  4NXM I;  4LF8 E;  4HY1 A;  1XNQ I;  2UU9 I;  5IT9 Q;  2HKJ A;  1I94 E;  3J7A M;  1N36 I;  4DR6 I;  2X7I A;  3LNU A;  1BKN A;  4DR2 E;  2DEJ A;  3ZZU A;  2J7K A;  3LTO A;  4DV2 I;  1N0V C;  1FWL A;  1HR0 I;  1XMO E;  4DR1 I;  1NZ0 A;  1DAR A;  2VQF E;  1NHH A;  2UUB E;  4AQY E;  4DV0 I;  2VQE E;  4JYA E;  4FWH A;  4USM A;  1HNX E;  1ZM4 A;  1IBM E;  4JI3 E;  1Z59 A;  1A6F A;  1S16 A;  4B3S I;  2HKE A;  4JI4 I;  1N33 E;  4DR3 E;  1XMO I; 
#chains in the Genus database with same CATH topology
 1N0U A;  1H7S A;  1YH8 A;  2LJP A;  1H73 A;  4OO1 A;  5K36 C;  4JV5 I;  4DPT A;  2E5L I;  1NHJ A;  1IBK E;  3H1C A;  4BA1 B;  3JAM C;  2V2Q A;  4JYA I;  1USV A;  4PU9 A;  3J80 Q;  1KTV A;  4WUD A;  3B4T A;  3WU5 A;  4MU1 A;  3P3C A;  4JI3 I;  1S4E A;  1USU A;  2O1W A;  4LOM A;  4DUY I;  3H4L A;  4MQY A;  2BM0 A;  4DR7 E;  1Z0E A;  4X65 E;  4JI5 I;  2HK2 A;  4BA1 A;  4WUB A;  4JI8 E;  1OJ4 A;  4FW9 A;  1PKP A;  4OO1 F;  1Z0T A;  4IZJ D;  1XNR E;  5C0X A;  3M85 D;  1YHC A;  2PO1 B;  1RRE A;  2NPF A;  1Z0B A;  3LPS A;  4X64 E;  3ZM7 A;  5JEA A;  1KVK A;  4DU7 A;  4NXM E;  4NBQ A;  1J5E I;  1E3P A;  1H74 A;  5A2Q Q;  1XNQ E;  1RR9 A;  2UU9 E;  3D4J A;  2R42 A;  4HAC A;  4DR7 I;  3M7N D;  4X65 I;  1N36 E;  4DR6 E;  1Z5B A;  4NXN I;  5FLX C;  2AE8 A;  2C38 B;  4DV4 I;  2BA1 G;  3GCM A;  1OYS A;  1R6L A;  4X62 I;  3QT6 A;  1OYP A;  1HR0 E;  2PO2 A;  4DR1 E;  2J65 A;  5GME A;  1UEK A;  4IFD B;  4OO1 C;  2GQ0 A;  1ZM3 A;  2IOP A;  4HYM A;  4IS9 A;  1IBL I;  4FN5 A;  1EA6 A;  4DV0 E;  4FWG A;  3P76 A;  1H72 C;  5DRP A;  4DV5 E;  2JE6 B;  4Z7Y A;  1ZXN A;  4DV7 E;  3P06 A;  4LF6 I;  4K0K E;  2F1D A;  1Z0V A;  4LFC I;  1B63 A;  4B3S E;  4GKJ I;  2DEI A;  4JI4 E;  5K36 E;  2C37 A;  1FJG I;  4DPW A;  4X66 I;  1R6M A;  4EMD A;  1UDN A;  2UXC I;  1H7U A;  4JV5 E;  2E5L E;  5GMD A;  3L7Z A;  2UUA I;  4MU0 A;  1Z5A A;  2BA0 D;  2JE6 A;  2UXD I;  2A2D A;  2PNL A;  1XXE A;  3B8H A;  2EFG A;  5K36 D;  5C0X C;  4B3R I;  4DV5 I;  1OYR A;  4MYU A;  4DV7 I;  2JEB A;  5L3J A;  4GKK I;  4MYT A;  4K0K I;  3P3G A;  4LCF A;  5BR8 I;  3OTO I;  2GS8 A;  5DRR A;  4FW4 A;  1Y4U A;  5DRO A;  4B3M I;  4DUY E;  1ZXM A;  2V2Z A;  4JI5 E;  4IFD F;  4JG4 A;  1ZM9 A;  1VI7 A;  4DPX A;  1Y4S A;  3PS3 A;  4DV1 I;  3QT7 A;  4FW3 A;  1Z0C A;  3DD6 A;  5DRQ A;  5DNL A;  4XTJ A;  5IWA I;  3HUL A;  4KHP I;  3J7A G;  2UXB I;  2V34 A;  2AJ4 A;  5ELW A;  4DV3 I;  4DR5 I;  2XEX A;  4OX9 I;  4JI6 I;  4P52 A;  5C0X B;  4YY3 E;  4KQV A;  4IFD D;  1J5E E;  1U2R A;  5JEA B;  2F4V I;  2O1T A;  2WP8 A;  3CDJ A;  3PS2 A;  4NXN E;  4AID A;  1PVG A;  2E1R A;  3T1Y I;  4ED4 A;  4B3T E;  4DXL A;  4HAC B;  4USK A;  2V8P A;  3ZKB A;  1Z0G A;  4DV4 E;  4BA2 A;  2ZIT A;  1NHI A;  2HFS A;  4X62 E;  4JI0 E;  5DNX A;  4IFD C;  1WUU A;  2NN6 B;  4OO1 E;  4GQU A;  4AIM A;  2HFU A;  4YY3 I;  5IT9 C;  2JEA B;  2GO4 A;  1IBL E;  4MU3 A;  2PO2 B;  3NZK A;  4FW7 A;  4OO1 D;  4LF5 E;  1UDO A;  1XMQ I;  3Q6N A;  4LFB I;  4B3T I;  5EL9 A;  4I3H A;  4LF6 E;  3P3E A;  4JI1 I;  2NN6 A;  5LMN E;  4LFC E;  3WU3 A;  4GKJ E;  4JI0 I;  3JAM Q;  4LPF A;  4P7A A;  2JEA A;  1RHY A;  4YHH I;  3PYF A;  5C0X F;  1FJG E;  3PRY A;  4X66 E;  1ZM2 A;  2BA1 D;  2UXC E;  3K17 A;  2C39 B;  2HHH E;  2UUA E;  5JEA F;  2UXD E;  4LF7 E;  2C37 B;  4JI2 I;  1HNW I;  2O3Z A;  3V5R A;  3J81 Q;  1UDQ A;  1FWK A;  1N34 I;  4B3R E;  2ZBK B;  3L7Z B;  2PO0 B;  4LF5 I;  3GLL A;  2X36 A;  4LFA E;  4ISA A;  1Z5C A;  2CZ9 A;  4GKK E;  4N3O A;  4MU4 A;  3PYD A;  4LF9 E;  5BR8 E;  5C0X D;  3OTO E;  4DV6 I;  3V2U C;  5LMN I;  1HNZ I;  2JEB B;  4B3M E;  2NN6 F;  3WU4 A;  2C39 A;  2V2V A;  5JEA D;  4LCG A;  3HKM A;  1PIE A;  5LMU E;  3CWV A;  3GON A;  4FWD A;  3HJC A;  1N32 I;  1E3H A;  1MX0 A;  4DV1 E;  4OKG A;  1VIS A;  2HHH I;  3UHM A;  4DR4 I;  2PO0 A;  4LF7 I;  3K1J A;  3J80 C;  2IOQ A;  5IWA E;  2UXB E;  4KHP E;  3KRN A;  4UT4 A;  3F0N A;  4DV3 E;  4DR5 E;  4OX9 E;  2CG9 A;  4LFA I;  4JI6 E;  5FLX Q;  5JEA C;  1KKH A;  1MU5 A;  4LF9 I;  1HK7 A;  2BV3 A;  2F4V E;  4DUZ I;  2R3V A;  4LF8 I;  1FNM A;  5LMU I;  3Q1Q A;  3T1Y E;  1QZR A;  3K85 A;  4IZJ A;  2WP8 B;  1I94 I;  4UTG A;  4IZK B;  2ZM6 E;  2NN6 C;  1Y6Z A;  4IFD E;  2VF3 A;  4LF4 E;  2Z5C B;  4DR2 I;  1XHK A;  4BA2 B;  2WW4 A;  5A2Q C;  4QNJ A;  1Z0W A;  3PYG A;  1EI1 A;  3GME A;  4RPF A;  1D6T A;  4URL A;  4AM3 A;  2HK3 A;  3ZZ0 A;  4WUC A;  2VQF I;  1B62 A;  2BM1 A;  3U1K A;  3B78 A;  4IZK A;  2UUB I;  4AQY I;  2JT2 A;  1XMQ E;  4LFB E;  2Z5C A;  2VQE I;  4JI1 E;  4PRV A;  2Q2E B;  2ZM6 I;  1K47 A;  4DPU A;  2Z5B A;  4LF4 I;  3T1H E;  2GO3 A;  1FI4 A;  1HNX I;  3ZKD A;  1IBM I;  4FW5 A;  4YHH E;  4JI7 E;  3J81 C;  3QT5 A;  4Z7C A;  1N33 I;  4U3D A;  4DR3 I;  4JI2 E;  1Y60 A;  4OZE A;  3M85 G;  1HNW E;  2A2C A;  3B82 A;  2Z5E A;  2UUC E;  4FW6 A;  1N34 E;  4DPY A;  1IBK I;  2O1U A;  5K36 B;  1Y5Y A;  4ZVI A;  1ELO A;  3M6A A;  4DU8 A;  4DV6 E;  2VES A;  1HNZ E;  2PNM A;  3T1H I;  3M7N G;  4M1K A;  3ZZT A;  4JI7 I;  2IES A;  1N32 E;  5EKW A;  1KIJ A;  4DR4 E;  4HXZ A;  4LCH A;  3U1Y A;  5K36 A;  5C0X E;  2OI2 A;  4R1F A;  2UUC I;  4JI8 I;  3QT8 A;  2PO1 A;  5JEA E;  1MG7 A;  3PYE A;  4PRX A;  1XNR I;  4DV2 E;  3WU6 A;  5LL6 R;  4QNK A;  1FKA E;  4X64 I;  4DUZ E;  2O1V A;  4NXM I;  4LF8 E;  4HY1 A;  1XNQ I;  2C38 A;  2UU9 I;  5IT9 Q;  2NN6 E;  2HKJ A;  1I94 E;  5FWK A;  2PNZ B;  3J7A M;  1N36 I;  4DR6 I;  2X7I A;  3LNU A;  2CGE A;  1BKN A;  4DR2 E;  2DEJ A;  3ZZU A;  5K36 F;  4IZJ B;  4J3D A;  2J7K A;  4U3B A;  3LTO A;  2CVE A;  2NN6 D;  3PS1 A;  4IFD A;  4DV2 I;  2BA0 G;  1N0V C;  1FWL A;  1UDS A;  1HR0 I;  1XMO E;  2BR2 B;  4DR1 I;  1NZ0 A;  2WNR B;  1DAR A;  4MDT A;  2VQF E;  1P42 A;  2IER A;  1NHH A;  2UUB E;  2PNZ A;  4AQY E;  4DV0 I;  4OO1 B;  2VQE E;  4JYA E;  3CDI A;  4FWH A;  4USM A;  1HNX E;  1ZM4 A;  1IBM E;  2BR2 A;  4JI3 E;  1Z59 A;  1A6F A;  3Q6M A;  2WNR A;  1S16 A;  2Z5B B;  4B3S I;  2HKE A;  4JI4 I;  1N33 E;  4DR3 E;  1XMO I; 
#chains in the Genus database with same CATH homology
 1N0U A;  1H7S A;  2LJP A;  1H73 A;  4JV5 I;  4DPT A;  2E5L I;  1NHJ A;  1IBK E;  3JAM C;  2V2Q A;  4JYA I;  1USV A;  4PU9 A;  3J80 Q;  1KTV A;  4WUD A;  3WU5 A;  4JI3 I;  1S4E A;  1USU A;  2O1W A;  4DUY I;  3H4L A;  4DR7 E;  2BM0 A;  1Z0E A;  4X65 E;  4JI5 I;  2HK2 A;  4WUB A;  4JI8 E;  1OJ4 A;  4FW9 A;  1PKP A;  1Z0T A;  4IZJ D;  1XNR E;  1RRE A;  2NPF A;  1Z0B A;  3LPS A;  4X64 E;  3ZM7 A;  1KVK A;  4DU7 A;  4NXM E;  1J5E I;  1H74 A;  5A2Q Q;  1XNQ E;  1RR9 A;  2UU9 E;  3D4J A;  2R42 A;  4HAC A;  4DR7 I;  4X65 I;  1N36 E;  4DR6 E;  1Z5B A;  4NXN I;  5FLX C;  4DV4 I;  4X62 I;  3QT6 A;  1HR0 E;  4DR1 E;  5GME A;  1UEK A;  2GQ0 A;  1ZM3 A;  2IOP A;  4HYM A;  1IBL I;  4FN5 A;  1EA6 A;  4DV0 E;  4FWG A;  1H72 C;  4DV5 E;  4Z7Y A;  1ZXN A;  4DV7 E;  3P06 A;  4LF6 I;  4K0K E;  1Z0V A;  4LFC I;  1B63 A;  4B3S E;  4GKJ I;  2DEI A;  4JI4 E;  1FJG I;  4DPW A;  4X66 I;  4EMD A;  2UXC I;  1H7U A;  4JV5 E;  2E5L E;  5GMD A;  2UUA I;  1Z5A A;  2UXD I;  2A2D A;  2PNL A;  3B8H A;  2EFG A;  4B3R I;  4DV5 I;  4MYU A;  4DV7 I;  5L3J A;  4GKK I;  4MYT A;  4K0K I;  5BR8 I;  3OTO I;  2GS8 A;  1Y4U A;  4B3M I;  4DUY E;  1ZXM A;  2V2Z A;  4JI5 E;  4JG4 A;  1ZM9 A;  4DPX A;  1Y4S A;  4DV1 I;  3QT7 A;  1Z0C A;  4XTJ A;  5IWA I;  3HUL A;  4KHP I;  3J7A G;  2UXB I;  2V34 A;  2AJ4 A;  4DV3 I;  4DR5 I;  2XEX A;  4OX9 I;  4JI6 I;  4P52 A;  4YY3 E;  4KQV A;  1J5E E;  1U2R A;  2F4V I;  2O1T A;  4NXN E;  1PVG A;  2E1R A;  3T1Y I;  4ED4 A;  4B3T E;  4DXL A;  4HAC B;  2V8P A;  4USK A;  3ZKB A;  4DV4 E;  1Z0G A;  2ZIT A;  1NHI A;  2HFS A;  4X62 E;  4JI0 E;  1WUU A;  2HFU A;  4YY3 I;  5IT9 C;  1IBL E;  4LF5 E;  1XMQ I;  3Q6N A;  4LFB I;  4B3T I;  4I3H A;  4LF6 E;  4JI1 I;  5LMN E;  4LFC E;  3WU3 A;  4GKJ E;  4JI0 I;  3JAM Q;  4P7A A;  4YHH I;  3PYF A;  1FJG E;  3PRY A;  4X66 E;  1ZM2 A;  2UXC E;  3K17 A;  2HHH E;  2UUA E;  2UXD E;  4LF7 E;  4JI2 I;  1HNW I;  3V5R A;  3J81 Q;  1FWK A;  1N34 I;  4B3R E;  2ZBK B;  4LF5 I;  2X36 A;  4LFA E;  1Z5C A;  2CZ9 A;  4GKK E;  4N3O A;  3PYD A;  4LF9 E;  5BR8 E;  3OTO E;  4DV6 I;  3V2U C;  5LMN I;  1HNZ I;  4B3M E;  3WU4 A;  2V2V A;  1PIE A;  5LMU E;  3CWV A;  3GON A;  4FWD A;  3HJC A;  1N32 I;  1MX0 A;  4DV1 E;  1VIS A;  2HHH I;  4DR4 I;  4LF7 I;  3K1J A;  3J80 C;  2IOQ A;  5IWA E;  2UXB E;  4KHP E;  4UT4 A;  3F0N A;  4DV3 E;  4DR5 E;  4OX9 E;  2CG9 A;  4LFA I;  4JI6 E;  5FLX Q;  1KKH A;  1MU5 A;  4LF9 I;  1HK7 A;  2BV3 A;  2F4V E;  4DUZ I;  2R3V A;  4LF8 I;  1FNM A;  5LMU I;  3Q1Q A;  3T1Y E;  1QZR A;  3K85 A;  4IZJ A;  1I94 I;  4IZK B;  4UTG A;  2ZM6 E;  1Y6Z A;  2VF3 A;  4LF4 E;  2Z5C B;  4DR2 I;  1XHK A;  2WW4 A;  5A2Q C;  1Z0W A;  3PYG A;  1EI1 A;  4RPF A;  1D6T A;  4URL A;  2HK3 A;  3ZZ0 A;  4WUC A;  2VQF I;  1B62 A;  2BM1 A;  3B78 A;  4IZK A;  2UUB I;  4AQY I;  1XMQ E;  4LFB E;  2Z5C A;  2VQE I;  4JI1 E;  4PRV A;  2Q2E B;  2ZM6 I;  1K47 A;  4DPU A;  2Z5B A;  4LF4 I;  3T1H E;  1FI4 A;  1HNX I;  3ZKD A;  1IBM I;  4YHH E;  4JI7 E;  3J81 C;  3QT5 A;  4Z7C A;  1N33 I;  4DR3 I;  4JI2 E;  1HNW E;  2A2C A;  3B82 A;  2Z5E A;  2UUC E;  1N34 E;  4DPY A;  1IBK I;  2O1U A;  4ZVI A;  1ELO A;  3M6A A;  4DU8 A;  4DV6 E;  1HNZ E;  2PNM A;  3T1H I;  4M1K A;  3ZZT A;  4JI7 I;  1N32 E;  1KIJ A;  4DR4 E;  4HXZ A;  2OI2 A;  4R1F A;  2UUC I;  4JI8 I;  3QT8 A;  1MG7 A;  3PYE A;  4PRX A;  1XNR I;  4DV2 E;  3WU6 A;  5LL6 R;  1FKA E;  4X64 I;  4DUZ E;  2O1V A;  4NXM I;  4LF8 E;  4HY1 A;  1XNQ I;  2UU9 I;  5IT9 Q;  2HKJ A;  1I94 E;  5FWK A;  3J7A M;  1N36 I;  4DR6 I;  2X7I A;  3LNU A;  2CGE A;  1BKN A;  4DR2 E;  2DEJ A;  3ZZU A;  4IZJ B;  2J7K A;  3LTO A;  4DV2 I;  1N0V C;  1FWL A;  1HR0 I;  1XMO E;  4DR1 I;  1NZ0 A;  1DAR A;  2VQF E;  1NHH A;  2UUB E;  4AQY E;  4DV0 I;  2VQE E;  4JYA E;  4FWH A;  4USM A;  1HNX E;  1ZM4 A;  1IBM E;  4JI3 E;  1Z59 A;  1A6F A;  3Q6M A;  1S16 A;  2Z5B B;  4B3S I;  2HKE A;  4JI4 I;  1N33 E;  4DR3 E;  1XMO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...