4GKKM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gkkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4gkkM02
1Q3BA 1XNQM 3U6MA 1NNJA 4DV2M 4DR4M 3OTOM 3GP1A 2EA0A 4LF4M 2VQEM 4AQYM 3DOAA 5ITQA 2F5PA 3SASA 4DV6M 2F4VM 2UU9M 1HNWM 4LF5M 2UUBM 1R2YA 3GO8A 4LF6M 3JR5A 1HR0M 1R2ZA 1I94M 1N34M 4G4OA 1FJGM 4KHPM 3J81S 3GPPA 4X66M 3SAUA 4B3TM 4NRWA 2UUCM 4JI4M 4B3RM 4NXNM 3U6LA 1IBKM 4X64M 3U6QA 1IBMM 4CISA 2F5OA 4G4NA 1K82A 4JI5M 4B3SM 4DR1M 1XMOM 1N36M 1HNZM 1XC8A 4DV3M 1HNXM 3U6EA 4PCZA 2XZUA 1N32M 4ITQA 4DV1M 4OX9M 1KFVA 4JI6M 2VQFM 4DR3M 1L2CA 1Z5AA 4LFCM 4JI7M 4JI3M 4DV4M 2ZBKB 5IT9S 4PD2A 4NRVA 4X62M 3SARA 5BR8M 2E5LM 3A42A 4G4RA 3GPXA 1L1ZA 4JI0M 1XNRM 1IBLM 3GPYA 1K3XA 3U6DA 3J80S 4DR7M 1TDHA 4JI8M 4LFAM 2F5SA 2HHHM 1L2BA 2OPFA 2UXBM 1N33M 3A45A 4DV5M 1K3WA 2HKJA 3SAVA 4DR6M 3GPUA 3VK7A 3J7AS 1XMQM 4B3MM 1Q39A 4PDGA 2Q2EB 3U6OA 4GKJM 3JR4A 1PM5A 4PDIA 5ITXE 5ITRA 5ITTA 1L2DA 4DR5M 3TWLA 1J5EM 4JYAM 5ITUA 3JAMS 5IWAM 4MB7A 3SAWA 3SATA 3W0FA 4DUZM 1Z5BA 2OQ4A 5LMUM 4JI1M 1TDZA 4X65M 3T1YM 4K0KM 4LFBM 4YY3M 1Z59A 3T1HM 2UXDM 3C58A 2UXCM 2F5NA 3U6PA 3TWKA 4G4QA 3A46A 3GQ3A 5A2QS 1MU5A 2F5QA 2ZM6M 4LF8M 4DV7M 1EE8A 4DV0M 4JV5M 5ITXA 4DR2M 3U6SA 1MX0A 5ITYA 3GQ4A 4DUYM 2UUAM 4NXMM 1Z5CA 3TWMA 4JI2M 3U6CA 1PJIA 4LF9M 4LF7M 1PJJA 1Q3CA 3SBJA 4YHHM 1L1TA 5FLXS 2XZFA 4GKKM 5LMNM 3GQ5A 3VK8A
chains in the Genus database with same CATH superfamily
1XNQM 4L78A 2ZANA 4PT5A 2L6OA 3OTOM 1IXSB 4IBGA 2BJVA 2FFJA 2JXNA 1NJGA 2Z8YM 3CF2A 4MGYE 3PXGA 3SASA 3EIEA 2EUCA 4CIZA 3HKPA 3WHLA 2DAEA 1F4IA 4F2LA 2BJWA 3SYKA 3GLGE 2XSZA 4AKGA 1IM2A 4LZJA 1D0MA 1XWIA 4LJ8A 1R5LA 4I4LA 3C3DA 4AZFA 3GLFB 2LWXA 3K8ZA 1TTEA 2JNHA 4AG6A 3HHZA 2ZAOA 1HT1E 3U6LA 2W82A 2FS1A 3EIHA 3K92A 1K82A 2I7NA 4LJ4A 4GMQA 4JXJA 4I81A 2CWBA 4B7HA 2LVQD 4D81A 3U6EA 3SHGB 1N32M 1YSYA 3AOEA 3ZQJA 2DHRA 2KNAA 4ITQA 4OX9M 2LXEA 3GLHA 4MGKE 2JZ1A 3FYDA 3HU1A 3TQSA 4JI6M 1TF0B 2DZNB 2WSEF 3MJ5A 1Z5AA 5EXTA 1LV7A 3RFWA 3VKGA 3T6PA 2N35A 2ZTDA 4R3DA 3V76A 4DV4M 2YQZA 2C99A 1WGLA 5IT9S 1NY6A 5IREB 4PD2A 4NRVA 1IN6A 1JQJC 1OIPA 2V1CA 4B08A 3UGJA 2QHOB 4QHTA 1XXHA 4LZZA 4A3VB 3CF0A 3R9XB 3IG5A 1IBLM 1V34A 2VF8A 1K3XA 4W5WA 5EP3A 4FD2A 2CHVA 1QDRA 2KA6B 1P3QQ 1YE9A 2KDLA 4R7GA 1SXJE 3UK6A 3W68A 4I8OA 3BBZA 3A45A 1QUTA 4G6ZA 4NL4H 2O01F 4NC6A 3LQRA 4M0WA 3GLGA 1XMQM 2DHYA 1IXZA 4P16A 1SG9A 2LHCA 4KO8A 4KODA 1QAOA 4IIWA 5JI2E 3U6OA 3B9PA 3SC3A 4DBGB 2Y0TA 5L8RF 5ITTA 2WZJA 4FWDA 1FNNA 3DZDA 1NSFA 1WR1B 4Q7JA 1G41A 2HL7A 3SAWA 2O5RA 4MB7A 3UZUA 2OOBA 3GRRA 1Z5BA 3W0FA 3FRHA 4LJ6A 3VDUA 1TH2A 3AL0C 4YY3M 2UXDM 3GLFA 1D0LA 2O25A 2Y0QA 4BB9A 1YLAA 3M6AA 2X49A 4IBCA 3HU2A 3M0EA 3PVSA 4XGIA 2QP9X 2LNHC 1MU5A 3KFUG 2R18A 3D8LA 4IBFA 4LF8M 2R4EA 2D7GA 1QZEA 2DXIA 2Z7JA 3Q8GA 4DR2M 1OKSA 4BBAA 2UUAM 3ILKA 5FTJA 1PJQA 2G5GX 4LF9M 3HHWA 5FTLA 2JZ0A 1XB2B 2CHGA 2WSCF 4NOOB 3HWSA 5FLXS 2XZFA 2DAGA 3KXEC 2DZOB 1XHBA 3H4MA 2JWSA 3M7GA 2KZUA 2JA2A 5DFLA 2Y20A 1TH4A 3KP0E 4GEWA 4DR4M 2DWNA 2EA0A 4IBIA 2CHQA 2VQEM 1R7RA 2HWJA 4GC9A 3PNVA 3UJNA 4HEOA 5EJCA 1G59A 4REZA 4Z6YA 3GLFE 4B7FA 2F4VM 4GIPA 3CF6E 2MR9A 2G8LA 3SYLA 1C1KA 5C1BA 2K0BX 2R6FA 4L6V6 2CEAA 3KP1E 4G4OA 4IBEA 5DYIA 3GPPA 1SXJA 1W5TA 5KO3A 3SAUA 4G3OA 2J5YA 1IY1A 2UUCM 4JI4M 2JY5A 4B3RM 2LH0A 4X64M 1IBKM 4HL4A 2JY8A 2NQ8C 5E6JA 2V6ZM 4JI5M 3KSJA 1E9SA 2RRUA 3IG8A 1YUBA 3SMPA 2C9CA 2XZUA 2XLJA 1JR3E 2DENA 3MHVC 3Q8XA 3LQQA 4OW0A 4DV1M 4L8RC 1VEGA 2LBCA 2MJ5B 2J7NA 1KFVA 1AUAA 3KDSE 2HAKA 1OTRA 3KVWA 4I5SA 3FD9A 3B74A 2DVWB 1E9RA 1GJTA 3ZH9B 2K47A 2QENA 2CRUA 3KOZE 1MJGM 3SARA 1W5SA 5BR8M 3HY5A 2Z4RA 3LCUA 1GL6A 1IXRC 1NNUC 1NV9A 1RU3A 1OJLA 3HZJA 3PNYA 4JI0M 1SXJB 3KS4A 1UFZA 3E21A 3NBXX 4LY6A 4MGZE 2Z4SA 3VLFB 4F1IA 4IJEA 3GPYA 2JUJA 4UN2B 3K9OA 3U5ZA 2EKKA 3PFIA 5EP4A 2R44A 4DR7M 1TDHA 3C9PA 1Q02A 2HHHM 4AI6A 1DV0A 1QAQA 2XSZD 4XK8F 5EXXA 1DGBA 1N33M 3ZC7B 2EJSA 1PGYA 1ZMVA 3HX3A 3SAVA 3FTDA 4RNAA 3VK7A 2AHMA 1ZAEA 2BWBA 2EO2A 3U61A 2C5RA 2MGWA 2I7PA 3JR4A 3U5ZB 2C98A 2QBYB 2L4FA 1ZQ9A 2Y21A 1L2DA 1IY0A 1S3SA 3QWLA 4QNRA 5ITUA 4QOSA 1DGFA 3SATA 1OAIA 3KW6A 3I04M 1TDZA 3B7QA 3F92A 1Z59A 2CE7A 4LGYA 1JR3D 1X37A 3C58A 3T38A 2UXCM 1GJSA 1NV8A 3U6PA 4LJ5A 4WW0A 3W0LB 2DWMA 2QBYA 2RGHA 2M5ZA 4G4QA 3GQ3A 3B89A 1QANA 4Z8XA 1TH3A 3FTCA 2KRKA 3GLHE 2M60A 2R62A 1IY2A 1EE8A 3DFZA 5FTMA 2VIIA 1Z6TA 3FKEA 3W67A 5ITYA 1OIZA 4CJ6A 3IECA 4M9XA 1NHWC 4RF1A 5KPRA 4DUYM 2R45A 1NVMA 4JI2M 4MGIE 4LF7M 2R4JA 3SBJA 1IFYA 5H37D 3B7NA 4AKHA 2ZAMA 3HJSA 2DKLA 4RKUF 7CATA 2L2DA 3GQ5A 2GQFA 4IBDA 4LRSA 1Q3BA 3LVVA 3RGPA 1R6BX 5DNYA 2KXEA 1NNJA 3IHPA 1OFIA 1EIJA 4GITA 4FCTA 3GP1A 2LVPC 4AQYM 5EXPA 2DNAA 3DOAA 1IN7A 4BLCA 5ITQA 3LW5F 1N78A 2XF3A 3K2LA 2UU9M 1G4AE 1G71A 1HNWM 2UUBM 3D8BA 1IN8A 3J7BA 3JR5A 1HR0M 2QPAA 1R2ZA 4NSRA 1N34M 1FJGM 4B7GA 2WSFF 2CP8A 1QDTA 3KOYE 3L2AA 3TL4X 4TUWA 4NXNM 2QNJA 3J2PB 2F5OA 2FE8A 1VEJA 1G3IA 1WHCA 1UM8A 1XMOM 1N36M 5BPVA 1PJIA 3FUTA 2DI0A 2C9OA 2FOIC 1QUSA 2RGOA 4GC5A 3E46A 3U60A 3RE8A 1TR8A 4GHAA 5C18A 3H4JA 3L26A 1N77A 2VQFM 4DR3M 2OOAA 3HHXA 2YR0A 5KQ8A 1C7YA 2ZBKB 1OAOC 5GKNA 4X62M 4LJ7A 4L4UA 2KEBA 3U61B 4P17A 1QZMA 2E5LM 4LG2A 1HQYE 1N75A 2K6BA 2L7HA 5FTNA 5EQTA 1ZMWA 2V1UA 2DWZB 1XNRM 2D7EA 2KNVA 3FYCA 3GRVA 3U6DA 4LGMA 4FWGA 1IXSA 2CUZA 2DWLA 1SXJC 1V33A 1ZV1A 4LFAM 1SXJD 1E32A 2HCBA 2VF7A 3KOWE 2OPFA 1L2BA 4OVZA 4AW4A 4AKIA 4DV5M 3I4YA 1AIPC 2HKJA 4DR6M 3AV0A 1IQPA 1HQCA 1J7KA 3J27B 4FCWA 4II7A 3FTEA 1D2NA 4IBKA 2X8AA 4PDGA 1OQYA 4WURA 2QQ8A 3LCVB 2JP7A 3VFDA 2B3TA 1PM5A 2LVAA 4PDIA 3I01M 2DAKA 2R65A 2L4EA 2L7IA 3C3EA 4FCVA 3KSXA 1J5EM 1QYRA 3BXWA 4MGHA 1ORYB 3QYEA 3THGA 5IWAM 5KQDA 4DUZM 3L27A 3SHFA 1D0KA 1XXHE 2APLA 2DAIA 4X65M 2A5YB 4MM3B 3T1YM 3HU3A 3T1HM 1GL7A 3GLHB 5KPTA 3RGSA 2J7OA 2DAMA 5EXSA 3FUWA 1IN5A 3GLIE 3A46A 4JN6A 3MMPA 5DYGA 4FW9A 2ZM6M 4L15A 1NY5A 2DZLA 2KRUA 5EP1A 4DV7M 2ZTCA 4KLNA 4JV5M 4DV0M 5ITXA 1DO2A 1V92A 1GKIA 3HHYA 3T15A 1EFUB 1Z5CA 1VDDA 3TWMA 2XFTA 1KYIA 3U6CA 2YFQA 3K9PA 2ERCA 3BOSA 3DA1A 4D80A 1Q3CA 5FSWA 1PJJA 1DO0A 4EIWA 1OFHA 1L1TA 5KPZA 2X4AA 4FVMA 1NJFA 4WP2A 1R4GA 1GLNA 5LMNM 3VK8A 4ANRA 3U6MA 2JY6B 1WJ7A 3L29A 4DV2M 4LJ9A 1G8PA 1QAMA 2L09A 4M9ZA 3ZCBB 3FUVA 4LF4M 2LVNC 2F5PA 4R71A 2H5XA 1NO1A 4DV6M 4HLQA 5FTKA 4Y28F 1T6OA 4LF5M 1J09A 4IBBA 1R2YA 3GO8A 4LF6M 4LRTA 2QZ4A 1I94M 1VG5A 4ZPXA 2LHGA 4QNMA 4KHPM 3J81S 4D82A 1WXQA 3FUUA 4X66M 4GRIA 4B3TM 4NRWA 1DGHB 3AKZA 3FE3A 4M0DA 5JI3E 1JB0F 3U6QA 1IBMM 4CISA 4G4NA 3CGWA 2BNKA 4B3SM 3MK6A 3QYBA 4CGYB 4DR1M 2CV1A 3B7ZA 3L28A 1HNZM 1XC8A 2MH8A 1WIVA 4DV3M 1HNXM 1HJPA 4PCZA 3E4RA 5E26A 2XEPA 2R0IA 5F3WA 3AOGA 3FUXA 3HJQA 1I4WA 3I51A 2LVOC 1XXHB 3KS8A 2KW0A 3GRYA 1BVSA 4QOZC 2KZSA 1L2CA 3NWLA 4LFCM 4JI7M 3KOXE 4JI3M 1GO5A 2Z3XA 3GLIB 4L16A 3FTFA 3UMMA 3AOEC 4IBJA 3A42A 4G4RA 1VQ1A 3GPXA 1L1ZA 1GABA 3FRIA 1GVNA 2FNAA 3AFHA 1KSFX 2YNMD 2LTUA 3HGIA 2QCUA 1NHGC 1DGGA 3J80S 2KHHA 3HJ8A 4RF0A 3WHKA 2K9DA 4JI8M 1QQWA 2KNZA 1ZMUA 2CFOA 4KT0F 5EP2A 2F5SA 4QHSA 4IJFA 2UXBM 3LMMA 4CHTB 1K3WA 1A5TA 3R8FA 2XFSA 2OO9A 1WGNA 2XH9A 4GH9A 3GPUA 3J7AS 3TPZA 3I4VA 1Q39A 3GRUA 2JY7A 3L25A 4LCBA 4GHLA 2CV0A 2P5TA 2Q2EB 4GKJM 5ITXE 5ITRA 3LVWA 1PRBA 2CV2A 4DR5M 3TWLA 3CTWB 2G3QA 4OU7A 4JYAM 1VDLA 1Y8GA 1PJTA 4B3MM 3JAMS 1IN4A 3SMSA 3AJIB 2OQ4A 1HT2E 5LMUM 4JI1M 3A98B 3GLIA 1PJSA 1JR3A 4K0KM 4LFBM 3QAUA 2R46A 4OVZB 1VEKA 2FH0A 1MN3A 4XBOA 2XGNA 2EKFA 4AG5A 1L8QA 3TE6A 2F5NA 2H1RA 1LTMA 3TWKA 3GLGB 3K1JA 2D7HA 2RKOA 2QSFX 1QVRA 1E94E 5A2QS 2F5QA 2VDBB 3SFZA 4M9SA 3VDPA 4FWHA 3NBIA 1T3TA 1MX0A 2BWEA 3GQ4A 3U6SA 2MROB 4NXMM 1TGUA 1T43A 3E9SA 4NSOB 2GNOA 1CUKA 4YHHM 5IZ7D 8CATA 4MH0E 2C96A 3U60B 4LJAA 4GKKM 1H6UA 1DGHA 4S12A 3VKHA
chains in the Genus database with same CATH topology
1XNQM 4L78A 2ZANA 4PT5A 2L6OA 3OTOM 1IXSB 4IBGA 2BJVA 2FFJA 1NJGA 3CF2A 4MGYE 3PXGA 3SASA 3EIEA 2EUCA 3HKPA 3WHLA 2BJWA 3SYKA 2XSZA 4AKGA 1IM2A 4LZJA 1XWIA 4LJ8A 4I4LA 4AZFA 3GLFB 2LWXA 3K8ZA 3HHZA 4AG6A 2ZAOA 1HT1E 3U6LA 2W82A 3EIHA 3K92A 1K82A 2I7NA 4LJ4A 4GMQA 4JXJA 4I81A 4B7HA 4D81A 3U6EA 3SHGB 1N32M 1YSYA 3AOEA 2DHRA 4ITQA 4OX9M 2LXEA 3GLHA 4MGKE 3HU1A 3FYDA 3TQSA 4JI6M 2DZNB 3MJ5A 1Z5AA 5EXTA 1LV7A 3RFWA 3VKGA 4R3DA 4DV4M 2YQZA 2C99A 5IT9S 1NY6A 5IREB 4PD2A 4NRVA 1IN6A 1JQJC 2V1CA 4B08A 3UGJA 4QHTA 1XXHA 4LZZA 4A3VB 3CF0A 3R9XB 3IG5A 1IBLM 1K3XA 4W5WA 5EP3A 4FD2A 2CHVA 2KA6B 1YE9A 4R7GA 1SXJE 3UK6A 4I8OA 3A45A 4G6ZA 4NL4H 3LQRA 4M0WA 3GLGA 1XMQM 1IXZA 4P16A 4KO8A 4KODA 3U6OA 1QAOA 4IIWA 5JI2E 3B9PA 3SC3A 2Y0TA 5ITTA 4FWDA 1FNNA 3DZDA 1NSFA 1G41A 2HL7A 3SAWA 2O5RA 4MB7A 3UZUA 3W0FA 3GRRA 1Z5BA 4LJ6A 3VDUA 1TH2A 3AL0C 4YY3M 2UXDM 3GLFA 2Y0QA 4BB9A 3M6AA 2X49A 4IBCA 3HU2A 3M0EA 3PVSA 4XGIA 2QP9X 2LNHC 1MU5A 3KFUG 2R18A 3D8LA 4IBFA 4LF8M 2D7GA 2R4EA 2DXIA 2Z7JA 4DR2M 4BBAA 2UUAM 3ILKA 5FTJA 2G5GX 4LF9M 3HHWA 5FTLA 2CHGA 4NOOB 3HWSA 5FLXS 2XZFA 3KXEC 2DZOB 1XHBA 3H4MA 3M7GA 2KZUA 2JA2A 2Y20A 1TH4A 3KP0E 4DR4M 2DWNA 2EA0A 4IBIA 2CHQA 2VQEM 1R7RA 4GC9A 3PNVA 3UJNA 5EJCA 1G59A 4REZA 4Z6YA 4B7FA 2F4VM 4GIPA 3CF6E 2G8LA 3SYLA 1C1KA 5C1BA 2CEAA 3KP1E 4G4OA 4IBEA 5DYIA 3GPPA 1SXJA 1W5TA 5KO3A 3SAUA 1IY1A 2UUCM 4JI4M 4B3RM 2LH0A 4X64M 1IBKM 4HL4A 5E6JA 2NQ8C 2V6ZM 4JI5M 3KSJA 1E9SA 3IG8A 1YUBA 3SMPA 2C9CA 2XZUA 2XLJA 3MHVC 3Q8XA 3LQQA 4OW0A 4DV1M 4L8RC 2J7NA 1KFVA 3KDSE 3KVWA 4I5SA 3FD9A 2DVWB 1E9RA 3ZH9B 2K47A 2QENA 3KOZE 3SARA 1W5SA 5BR8M 2Z4RA 1GL6A 1IXRC 1NNUC 3PNYA 1OJLA 4JI0M 1SXJB 3KS4A 4MGZE 4LY6A 3VLFB 2Z4SA 3GPYA 3U5ZA 4IJEA 3PFIA 5EP4A 4DR7M 1TDHA 2HHHM 4AI6A 1QAQA 2XSZD 5EXXA 1DGBA 1N33M 3ZC7B 3SAVA 3FTDA 4RNAA 3VK7A 2AHMA 1ZAEA 2EO2A 3U61A 2C5RA 2I7PA 3JR4A 3U5ZB 2C98A 2QBYB 1ZQ9A 2Y21A 1L2DA 1IY0A 1S3SA 3QWLA 4QNRA 5ITUA 4QOSA 1DGFA 3SATA 3KW6A 1TDZA 1Z59A 2CE7A 4LGYA 1JR3D 1X37A 3C58A 3T38A 2UXCM 3U6PA 4LJ5A 4WW0A 3W0LB 2DWMA 2QBYA 2RGHA 2M5ZA 4G4QA 3GQ3A 1QANA 4Z8XA 1TH3A 3FTCA 2KRKA 2M60A 2R62A 1IY2A 1EE8A 3DFZA 5FTMA 2VIIA 1Z6TA 3FKEA 5KPRA 5ITYA 4DUYM 3FTEA 4M9XA 1NHWC 4RF1A 2R45A 1NVMA 4JI2M 4MGIE 4LF7M 2R4JA 3SBJA 5H37D 4AKHA 2ZAMA 3HJSA 7CATA 3GQ5A 4IBDA 4LRSA 1Q3BA 3LVVA 3RGPA 1R6BX 5DNYA 2KXEA 1NNJA 1OFIA 4GITA 4FCTA 3GP1A 4AQYM 5EXPA 3DOAA 4BLCA 1IN7A 5ITQA 1N78A 2XF3A 3K2LA 2UU9M 1G4AE 1HNWM 2UUBM 3D8BA 1IN8A 3J7BA 3JR5A 1HR0M 2QPAA 1R2ZA 4NSRA 1N34M 1FJGM 4B7GA 3KOYE 3L2AA 3TL4X 4TUWA 4NXNM 3J2PB 2F5OA 2FE8A 1G3IA 1UM8A 1XMOM 1N36M 5BPVA 3FUTA 2FOIC 2C9OA 2RGOA 4GC5A 3U60A 3RE8A 4GHAA 5C18A 3L26A 1N77A 2VQFM 4DR3M 3HHXA 2YR0A 5KQ8A 2ZBKB 5GKNA 4X62M 4LJ7A 4L4UA 2KEBA 3U61B 1QZMA 2E5LM 4LG2A 1HQYE 1N75A 2L7HA 5FTNA 5EQTA 2V1UA 2DWZB 1XNRM 2D7EA 3FYCA 3GRVA 3U6DA 4LGMA 4FWGA 2CUZA 2DWLA 1SXJC 4LFAM 1SXJD 1E32A 2HCBA 1L2BA 3KOWE 2OPFA 4OVZA 4AW4A 4AKIA 4DV5M 3I4YA 2HKJA 4DR6M 4FCWA 3AV0A 1IQPA 1HQCA 1J7KA 3J27B 4II7A 1D2NA 4IBKA 2X8AA 4PDGA 4WURA 3VFDA 1PM5A 4PDIA 2R65A 2L7IA 4FCVA 3KSXA 1J5EM 1QYRA 4MGHA 3THGA 1ORYB 5IWAM 4DUZM 5KQDA 3L27A 3SHFA 4X65M 3T1YM 2A5YB 4MM3B 3HU3A 3T1HM 1GL7A 3GLHB 5KPTA 3RGSA 2J7OA 5EXSA 3FUWA 1IN5A 3A46A 4JN6A 5DYGA 4FW9A 2ZM6M 4L15A 1NY5A 2KRUA 4DV7M 5EP1A 4KLNA 4JV5M 4DV0M 5ITXA 1DO2A 1GKIA 3HHYA 3T15A 1Z5CA 3TWMA 1VDDA 2XFTA 1KYIA 3U6CA 2YFQA 1PJIA 2ERCA 3BOSA 3DA1A 4D80A 1Q3CA 5FSWA 1PJJA 1DO0A 4EIWA 1OFHA 1L1TA 5KPZA 2X4AA 4FVMA 1NJFA 1GLNA 5LMNM 3VK8A 3U6MA 3L29A 4DV2M 4LJ9A 1G8PA 1QAMA 2L09A 4M9ZA 3ZCBB 3FUVA 4LF4M 2F5PA 4DV6M 4HLQA 5FTKA 4LF5M 1J09A 4IBBA 1R2YA 3GO8A 4LF6M 4LRTA 2QZ4A 1I94M 4ZPXA 4QNMA 4KHPM 3J81S 4D82A 1WXQA 3FUUA 4X66M 4GRIA 4B3TM 4NRWA 1DGHB 3AKZA 4M0DA 5JI3E 3U6QA 1IBMM 4CISA 4G4NA 2BNKA 4B3SM 3MK6A 4CGYB 4DR1M 2CV1A 3L28A 1HNZM 1XC8A 4DV3M 1HNXM 4PCZA 3E4RA 5E26A 2XEPA 5F3WA 3AOGA 3FUXA 3HJQA 1I4WA 3I51A 3KS8A 1XXHB 2KW0A 3GRYA 4QOZC 2KZSA 1L2CA 3NWLA 4LFCM 4JI7M 3KOXE 4JI3M 2Z3XA 3GLIB 4L16A 3FTFA 3UMMA 3AOEC 4IBJA 3A42A 4G4RA 3GPXA 1L1ZA 1GVNA 2FNAA 3AFHA 1KSFX 2YNMD 3HGIA 2QCUA 1NHGC 1DGGA 3J80S 3HJ8A 4RF0A 3WHKA 4JI8M 1QQWA 2F5SA 5EP2A 2CFOA 4QHSA 4IJFA 2UXBM 3LMMA 4CHTB 1K3WA 3R8FA 2XFSA 2XH9A 4GH9A 3GPUA 3J7AS 3TPZA 3I4VA 1Q39A 3GRUA 3L25A 4LCBA 4GHLA 2CV0A 2P5TA 2Q2EB 4GKJM 5ITXE 5ITRA 3LVWA 2CV2A 4DR5M 3TWLA 3CTWB 4OU7A 4JYAM 4B3MM 3JAMS 1IN4A 3SMSA 3AJIB 2OQ4A 1HT2E 5LMUM 4JI1M 3A98B 3GLIA 1JR3A 4K0KM 4LFBM 3QAUA 2R46A 4OVZB 4XBOA 4AG5A 2XGNA 1L8QA 3TE6A 2F5NA 2H1RA 3TWKA 3GLGB 3K1JA 2D7HA 2RKOA 1QVRA 1E94E 5A2QS 2F5QA 3SFZA 4M9SA 3VDPA 4FWHA 3NBIA 1T3TA 1MX0A 3U6SA 3GQ4A 4NXMM 1TGUA 3E9SA 4NSOB 4YHHM 5IZ7D 8CATA 4MH0E 2C96A 3U60B 4LJAA 4GKKM 1H6UA 1DGHA 4S12A 3VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3B A;  1XNQ M;  3U6M A;  1NNJ A;  4DV2 M;  4DR4 M;  3OTO M;  3GP1 A;  2EA0 A;  4LF4 M;  2VQE M;  4AQY M;  3DOA A;  5ITQ A;  2F5P A;  3SAS A;  4DV6 M;  2F4V M;  2UU9 M;  1HNW M;  4LF5 M;  2UUB M;  1R2Y A;  3GO8 A;  4LF6 M;  3JR5 A;  1HR0 M;  1R2Z A;  1I94 M;  1N34 M;  4G4O A;  1FJG M;  4KHP M;  3J81 S;  3GPP A;  4X66 M;  3SAU A;  4B3T M;  4NRW A;  2UUC M;  4JI4 M;  4B3R M;  4NXN M;  3U6L A;  1IBK M;  4X64 M;  3U6Q A;  1IBM M;  4CIS A;  2F5O A;  4G4N A;  1K82 A;  4JI5 M;  4B3S M;  4DR1 M;  1XMO M;  1N36 M;  1HNZ M;  1XC8 A;  4DV3 M;  1HNX M;  3U6E A;  4PCZ A;  2XZU A;  1N32 M;  4ITQ A;  4DV1 M;  4OX9 M;  1KFV A;  4JI6 M;  2VQF M;  4DR3 M;  1L2C A;  1Z5A A;  4LFC M;  4JI7 M;  4JI3 M;  4DV4 M;  2ZBK B;  5IT9 S;  4PD2 A;  4NRV A;  4X62 M;  3SAR A;  5BR8 M;  2E5L M;  3A42 A;  4G4R A;  3GPX A;  1L1Z A;  4JI0 M;  1XNR M;  1IBL M;  3GPY A;  1K3X A;  3U6D A;  3J80 S;  4DR7 M;  1TDH A;  4JI8 M;  4LFA M;  2F5S A;  2HHH M;  1L2B A;  2OPF A;  2UXB M;  1N33 M;  3A45 A;  4DV5 M;  1K3W A;  2HKJ A;  3SAV A;  4DR6 M;  3GPU A;  3VK7 A;  3J7A S;  1XMQ M;  4B3M M;  1Q39 A;  4PDG A;  2Q2E B;  3U6O A;  4GKJ M;  3JR4 A;  1PM5 A;  4PDI A;  5ITX E;  5ITR A;  5ITT A;  1L2D A;  4DR5 M;  3TWL A;  1J5E M;  4JYA M;  5ITU A;  3JAM S;  5IWA M;  4MB7 A;  3SAW A;  3SAT A;  3W0F A;  4DUZ M;  1Z5B A;  2OQ4 A;  5LMU M;  4JI1 M;  1TDZ A;  4X65 M;  3T1Y M;  4K0K M;  4LFB M;  4YY3 M;  1Z59 A;  3T1H M;  2UXD M;  3C58 A;  2UXC M;  2F5N A;  3U6P A;  3TWK A;  4G4Q A;  3A46 A;  3GQ3 A;  5A2Q S;  1MU5 A;  2F5Q A;  2ZM6 M;  4LF8 M;  4DV7 M;  1EE8 A;  4DV0 M;  4JV5 M;  5ITX A;  4DR2 M;  3U6S A;  1MX0 A;  5ITY A;  3GQ4 A;  4DUY M;  2UUA M;  4NXM M;  1Z5C A;  3TWM A;  4JI2 M;  3U6C A;  1PJI A;  4LF9 M;  4LF7 M;  1PJJ A;  1Q3C A;  3SBJ A;  4YHH M;  1L1T A;  5FLX S;  2XZF A;  4GKK M;  5LMN M;  3GQ5 A;  3VK8 A; 
#chains in the Genus database with same CATH topology
 1XNQ M;  4L78 A;  2ZAN A;  4PT5 A;  2L6O A;  3OTO M;  1IXS B;  4IBG A;  2BJV A;  2FFJ A;  2JXN A;  1NJG A;  2Z8Y M;  3CF2 A;  4MGY E;  3PXG A;  3SAS A;  3EIE A;  2EUC A;  4CIZ A;  3HKP A;  3WHL A;  2DAE A;  1F4I A;  4F2L A;  2BJW A;  3SYK A;  3GLG E;  2XSZ A;  4AKG A;  1IM2 A;  4LZJ A;  1D0M A;  1XWI A;  4LJ8 A;  1R5L A;  4I4L A;  3C3D A;  4AZF A;  3GLF B;  2LWX A;  3K8Z A;  1TTE A;  2JNH A;  4AG6 A;  3HHZ A;  2ZAO A;  1HT1 E;  3U6L A;  2W82 A;  2FS1 A;  3EIH A;  3K92 A;  1K82 A;  2I7N A;  4LJ4 A;  4GMQ A;  4JXJ A;  4I81 A;  2CWB A;  4B7H A;  2LVQ D;  4D81 A;  3U6E A;  3SHG B;  1N32 M;  1YSY A;  3AOE A;  3ZQJ A;  2DHR A;  2KNA A;  4ITQ A;  4OX9 M;  2LXE A;  3GLH A;  4MGK E;  2JZ1 A;  3FYD A;  3HU1 A;  3TQS A;  4JI6 M;  1TF0 B;  2DZN B;  2WSE F;  3MJ5 A;  1Z5A A;  5EXT A;  1LV7 A;  3RFW A;  3VKG A;  3T6P A;  2N35 A;  2ZTD A;  4R3D A;  3V76 A;  4DV4 M;  2YQZ A;  2C99 A;  1WGL A;  5IT9 S;  1NY6 A;  5IRE B;  4PD2 A;  4NRV A;  1IN6 A;  1JQJ C;  1OIP A;  2V1C A;  4B08 A;  3UGJ A;  2QHO B;  4QHT A;  1XXH A;  4LZZ A;  4A3V B;  3CF0 A;  3R9X B;  3IG5 A;  1IBL M;  1V34 A;  2VF8 A;  1K3X A;  4W5W A;  5EP3 A;  4FD2 A;  2CHV A;  1QDR A;  2KA6 B;  1P3Q Q;  1YE9 A;  2KDL A;  4R7G A;  1SXJ E;  3UK6 A;  3W68 A;  4I8O A;  3BBZ A;  3A45 A;  1QUT A;  4G6Z A;  4NL4 H;  2O01 F;  4NC6 A;  3LQR A;  4M0W A;  3GLG A;  1XMQ M;  2DHY A;  1IXZ A;  4P16 A;  1SG9 A;  2LHC A;  4KO8 A;  4KOD A;  1QAO A;  4IIW A;  5JI2 E;  3U6O A;  3B9P A;  3SC3 A;  4DBG B;  2Y0T A;  5L8R F;  5ITT A;  2WZJ A;  4FWD A;  1FNN A;  3DZD A;  1NSF A;  1WR1 B;  4Q7J A;  1G41 A;  2HL7 A;  3SAW A;  2O5R A;  4MB7 A;  3UZU A;  2OOB A;  3GRR A;  1Z5B A;  3W0F A;  3FRH A;  4LJ6 A;  3VDU A;  1TH2 A;  3AL0 C;  4YY3 M;  2UXD M;  3GLF A;  1D0L A;  2O25 A;  2Y0Q A;  4BB9 A;  1YLA A;  3M6A A;  2X49 A;  4IBC A;  3HU2 A;  3M0E A;  3PVS A;  4XGI A;  2QP9 X;  2LNH C;  1MU5 A;  3KFU G;  2R18 A;  3D8L A;  4IBF A;  4LF8 M;  2R4E A;  2D7G A;  1QZE A;  2DXI A;  2Z7J A;  3Q8G A;  4DR2 M;  1OKS A;  4BBA A;  2UUA M;  3ILK A;  5FTJ A;  1PJQ A;  2G5G X;  4LF9 M;  3HHW A;  5FTL A;  2JZ0 A;  1XB2 B;  2CHG A;  2WSC F;  4NOO B;  3HWS A;  5FLX S;  2XZF A;  2DAG A;  3KXE C;  2DZO B;  1XHB A;  3H4M A;  2JWS A;  3M7G A;  2KZU A;  2JA2 A;  5DFL A;  2Y20 A;  1TH4 A;  3KP0 E;  4GEW A;  4DR4 M;  2DWN A;  2EA0 A;  4IBI A;  2CHQ A;  2VQE M;  1R7R A;  2HWJ A;  4GC9 A;  3PNV A;  3UJN A;  4HEO A;  5EJC A;  1G59 A;  4REZ A;  4Z6Y A;  3GLF E;  4B7F A;  2F4V M;  4GIP A;  3CF6 E;  2MR9 A;  2G8L A;  3SYL A;  1C1K A;  5C1B A;  2K0B X;  2R6F A;  4L6V 6;  2CEA A;  3KP1 E;  4G4O A;  4IBE A;  5DYI A;  3GPP A;  1SXJ A;  1W5T A;  5KO3 A;  3SAU A;  4G3O A;  2J5Y A;  1IY1 A;  2UUC M;  4JI4 M;  2JY5 A;  4B3R M;  2LH0 A;  4X64 M;  1IBK M;  4HL4 A;  2JY8 A;  2NQ8 C;  5E6J A;  2V6Z M;  4JI5 M;  3KSJ A;  1E9S A;  2RRU A;  3IG8 A;  1YUB A;  3SMP A;  2C9C A;  2XZU A;  2XLJ A;  1JR3 E;  2DEN A;  3MHV C;  3Q8X A;  3LQQ A;  4OW0 A;  4DV1 M;  4L8R C;  1VEG A;  2LBC A;  2MJ5 B;  2J7N A;  1KFV A;  1AUA A;  3KDS E;  2HAK A;  1OTR A;  3KVW A;  4I5S A;  3FD9 A;  3B74 A;  2DVW B;  1E9R A;  1GJT A;  3ZH9 B;  2K47 A;  2QEN A;  2CRU A;  3KOZ E;  1MJG M;  3SAR A;  1W5S A;  5BR8 M;  3HY5 A;  2Z4R A;  3LCU A;  1GL6 A;  1IXR C;  1NNU C;  1NV9 A;  1RU3 A;  1OJL A;  3HZJ A;  3PNY A;  4JI0 M;  1SXJ B;  3KS4 A;  1UFZ A;  3E21 A;  3NBX X;  4LY6 A;  4MGZ E;  2Z4S A;  3VLF B;  4F1I A;  4IJE A;  3GPY A;  2JUJ A;  4UN2 B;  3K9O A;  3U5Z A;  2EKK A;  3PFI A;  5EP4 A;  2R44 A;  4DR7 M;  1TDH A;  3C9P A;  1Q02 A;  2HHH M;  4AI6 A;  1DV0 A;  1QAQ A;  2XSZ D;  4XK8 F;  5EXX A;  1DGB A;  1N33 M;  3ZC7 B;  2EJS A;  1PGY A;  1ZMV A;  3HX3 A;  3SAV A;  3FTD A;  4RNA A;  3VK7 A;  2AHM A;  1ZAE A;  2BWB A;  2EO2 A;  3U61 A;  2C5R A;  2MGW A;  2I7P A;  3JR4 A;  3U5Z B;  2C98 A;  2QBY B;  2L4F A;  1ZQ9 A;  2Y21 A;  1L2D A;  1IY0 A;  1S3S A;  3QWL A;  4QNR A;  5ITU A;  4QOS A;  1DGF A;  3SAT A;  1OAI A;  3KW6 A;  3I04 M;  1TDZ A;  3B7Q A;  3F92 A;  1Z59 A;  2CE7 A;  4LGY A;  1JR3 D;  1X37 A;  3C58 A;  3T38 A;  2UXC M;  1GJS A;  1NV8 A;  3U6P A;  4LJ5 A;  4WW0 A;  3W0L B;  2DWM A;  2QBY A;  2RGH A;  2M5Z A;  4G4Q A;  3GQ3 A;  3B89 A;  1QAN A;  4Z8X A;  1TH3 A;  3FTC A;  2KRK A;  3GLH E;  2M60 A;  2R62 A;  1IY2 A;  1EE8 A;  3DFZ A;  5FTM A;  2VII A;  1Z6T A;  3FKE A;  3W67 A;  5ITY A;  1OIZ A;  4CJ6 A;  3IEC A;  4M9X A;  1NHW C;  4RF1 A;  5KPR A;  4DUY M;  2R45 A;  1NVM A;  4JI2 M;  4MGI E;  4LF7 M;  2R4J A;  3SBJ A;  1IFY A;  5H37 D;  3B7N A;  4AKH A;  2ZAM A;  3HJS A;  2DKL A;  4RKU F;  7CAT A;  2L2D A;  3GQ5 A;  2GQF A;  4IBD A;  4LRS A;  1Q3B A;  3LVV A;  3RGP A;  1R6B X;  5DNY A;  2KXE A;  1NNJ A;  3IHP A;  1OFI A;  1EIJ A;  4GIT A;  4FCT A;  3GP1 A;  2LVP C;  4AQY M;  5EXP A;  2DNA A;  3DOA A;  1IN7 A;  4BLC A;  5ITQ A;  3LW5 F;  1N78 A;  2XF3 A;  3K2L A;  2UU9 M;  1G4A E;  1G71 A;  1HNW M;  2UUB M;  3D8B A;  1IN8 A;  3J7B A;  3JR5 A;  1HR0 M;  2QPA A;  1R2Z A;  4NSR A;  1N34 M;  1FJG M;  4B7G A;  2WSF F;  2CP8 A;  1QDT A;  3KOY E;  3L2A A;  3TL4 X;  4TUW A;  4NXN M;  2QNJ A;  3J2P B;  2F5O A;  2FE8 A;  1VEJ A;  1G3I A;  1WHC A;  1UM8 A;  1XMO M;  1N36 M;  5BPV A;  1PJI A;  3FUT A;  2DI0 A;  2C9O A;  2FOI C;  1QUS A;  2RGO A;  4GC5 A;  3E46 A;  3U60 A;  3RE8 A;  1TR8 A;  4GHA A;  5C18 A;  3H4J A;  3L26 A;  1N77 A;  2VQF M;  4DR3 M;  2OOA A;  3HHX A;  2YR0 A;  5KQ8 A;  1C7Y A;  2ZBK B;  1OAO C;  5GKN A;  4X62 M;  4LJ7 A;  4L4U A;  2KEB A;  3U61 B;  4P17 A;  1QZM A;  2E5L M;  4LG2 A;  1HQY E;  1N75 A;  2K6B A;  2L7H A;  5FTN A;  5EQT A;  1ZMW A;  2V1U A;  2DWZ B;  1XNR M;  2D7E A;  2KNV A;  3FYC A;  3GRV A;  3U6D A;  4LGM A;  4FWG A;  1IXS A;  2CUZ A;  2DWL A;  1SXJ C;  1V33 A;  1ZV1 A;  4LFA M;  1SXJ D;  1E32 A;  2HCB A;  2VF7 A;  3KOW E;  2OPF A;  1L2B A;  4OVZ A;  4AW4 A;  4AKI A;  4DV5 M;  3I4Y A;  1AIP C;  2HKJ A;  4DR6 M;  3AV0 A;  1IQP A;  1HQC A;  1J7K A;  3J27 B;  4FCW A;  4II7 A;  3FTE A;  1D2N A;  4IBK A;  2X8A A;  4PDG A;  1OQY A;  4WUR A;  2QQ8 A;  3LCV B;  2JP7 A;  3VFD A;  2B3T A;  1PM5 A;  2LVA A;  4PDI A;  3I01 M;  2DAK A;  2R65 A;  2L4E A;  2L7I A;  3C3E A;  4FCV A;  3KSX A;  1J5E M;  1QYR A;  3BXW A;  4MGH A;  1ORY B;  3QYE A;  3THG A;  5IWA M;  5KQD A;  4DUZ M;  3L27 A;  3SHF A;  1D0K A;  1XXH E;  2APL A;  2DAI A;  4X65 M;  2A5Y B;  4MM3 B;  3T1Y M;  3HU3 A;  3T1H M;  1GL7 A;  3GLH B;  5KPT A;  3RGS A;  2J7O A;  2DAM A;  5EXS A;  3FUW A;  1IN5 A;  3GLI E;  3A46 A;  4JN6 A;  3MMP A;  5DYG A;  4FW9 A;  2ZM6 M;  4L15 A;  1NY5 A;  2DZL A;  2KRU A;  5EP1 A;  4DV7 M;  2ZTC A;  4KLN A;  4JV5 M;  4DV0 M;  5ITX A;  1DO2 A;  1V92 A;  1GKI A;  3HHY A;  3T15 A;  1EFU B;  1Z5C A;  1VDD A;  3TWM A;  2XFT A;  1KYI A;  3U6C A;  2YFQ A;  3K9P A;  2ERC A;  3BOS A;  3DA1 A;  4D80 A;  1Q3C A;  5FSW A;  1PJJ A;  1DO0 A;  4EIW A;  1OFH A;  1L1T A;  5KPZ A;  2X4A A;  4FVM A;  1NJF A;  4WP2 A;  1R4G A;  1GLN A;  5LMN M;  3VK8 A;  4ANR A;  3U6M A;  2JY6 B;  1WJ7 A;  3L29 A;  4DV2 M;  4LJ9 A;  1G8P A;  1QAM A;  2L09 A;  4M9Z A;  3ZCB B;  3FUV A;  4LF4 M;  2LVN C;  2F5P A;  4R71 A;  2H5X A;  1NO1 A;  4DV6 M;  4HLQ A;  5FTK A;  4Y28 F;  1T6O A;  4LF5 M;  1J09 A;  4IBB A;  1R2Y A;  3GO8 A;  4LF6 M;  4LRT A;  2QZ4 A;  1I94 M;  1VG5 A;  4ZPX A;  2LHG A;  4QNM A;  4KHP M;  3J81 S;  4D82 A;  1WXQ A;  3FUU A;  4X66 M;  4GRI A;  4B3T M;  4NRW A;  1DGH B;  3AKZ A;  3FE3 A;  4M0D A;  5JI3 E;  1JB0 F;  3U6Q A;  1IBM M;  4CIS A;  4G4N A;  3CGW A;  2BNK A;  4B3S M;  3MK6 A;  3QYB A;  4CGY B;  4DR1 M;  2CV1 A;  3B7Z A;  3L28 A;  1HNZ M;  1XC8 A;  2MH8 A;  1WIV A;  4DV3 M;  1HNX M;  1HJP A;  4PCZ A;  3E4R A;  5E26 A;  2XEP A;  2R0I A;  5F3W A;  3AOG A;  3FUX A;  3HJQ A;  1I4W A;  3I51 A;  2LVO C;  1XXH B;  3KS8 A;  2KW0 A;  3GRY A;  1BVS A;  4QOZ C;  2KZS A;  1L2C A;  3NWL A;  4LFC M;  4JI7 M;  3KOX E;  4JI3 M;  1GO5 A;  2Z3X A;  3GLI B;  4L16 A;  3FTF A;  3UMM A;  3AOE C;  4IBJ A;  3A42 A;  4G4R A;  1VQ1 A;  3GPX A;  1L1Z A;  1GAB A;  3FRI A;  1GVN A;  2FNA A;  3AFH A;  1KSF X;  2YNM D;  2LTU A;  3HGI A;  2QCU A;  1NHG C;  1DGG A;  3J80 S;  2KHH A;  3HJ8 A;  4RF0 A;  3WHK A;  2K9D A;  4JI8 M;  1QQW A;  2KNZ A;  1ZMU A;  2CFO A;  4KT0 F;  5EP2 A;  2F5S A;  4QHS A;  4IJF A;  2UXB M;  3LMM A;  4CHT B;  1K3W A;  1A5T A;  3R8F A;  2XFS A;  2OO9 A;  1WGN A;  2XH9 A;  4GH9 A;  3GPU A;  3J7A S;  3TPZ A;  3I4V A;  1Q39 A;  3GRU A;  2JY7 A;  3L25 A;  4LCB A;  4GHL A;  2CV0 A;  2P5T A;  2Q2E B;  4GKJ M;  5ITX E;  5ITR A;  3LVW A;  1PRB A;  2CV2 A;  4DR5 M;  3TWL A;  3CTW B;  2G3Q A;  4OU7 A;  4JYA M;  1VDL A;  1Y8G A;  1PJT A;  4B3M M;  3JAM S;  1IN4 A;  3SMS A;  3AJI B;  2OQ4 A;  1HT2 E;  5LMU M;  4JI1 M;  3A98 B;  3GLI A;  1PJS A;  1JR3 A;  4K0K M;  4LFB M;  3QAU A;  2R46 A;  4OVZ B;  1VEK A;  2FH0 A;  1MN3 A;  4XBO A;  2XGN A;  2EKF A;  4AG5 A;  1L8Q A;  3TE6 A;  2F5N A;  2H1R A;  1LTM A;  3TWK A;  3GLG B;  3K1J A;  2D7H A;  2RKO A;  2QSF X;  1QVR A;  1E94 E;  5A2Q S;  2F5Q A;  2VDB B;  3SFZ A;  4M9S A;  3VDP A;  4FWH A;  3NBI A;  1T3T A;  1MX0 A;  2BWE A;  3GQ4 A;  3U6S A;  2MRO B;  4NXM M;  1TGU A;  1T43 A;  3E9S A;  4NSO B;  2GNO A;  1CUK A;  4YHH M;  5IZ7 D;  8CAT A;  4MH0 E;  2C96 A;  3U60 B;  4LJA A;  4GKK M;  1H6U A;  1DGH A;  4S12 A;  3VKH A; 
#chains in the Genus database with same CATH homology
 1XNQ M;  4L78 A;  2ZAN A;  4PT5 A;  2L6O A;  3OTO M;  1IXS B;  4IBG A;  2BJV A;  2FFJ A;  1NJG A;  3CF2 A;  4MGY E;  3PXG A;  3SAS A;  3EIE A;  2EUC A;  3HKP A;  3WHL A;  2BJW A;  3SYK A;  2XSZ A;  4AKG A;  1IM2 A;  4LZJ A;  1XWI A;  4LJ8 A;  4I4L A;  4AZF A;  3GLF B;  2LWX A;  3K8Z A;  3HHZ A;  4AG6 A;  2ZAO A;  1HT1 E;  3U6L A;  2W82 A;  3EIH A;  3K92 A;  1K82 A;  2I7N A;  4LJ4 A;  4GMQ A;  4JXJ A;  4I81 A;  4B7H A;  4D81 A;  3U6E A;  3SHG B;  1N32 M;  1YSY A;  3AOE A;  2DHR A;  4ITQ A;  4OX9 M;  2LXE A;  3GLH A;  4MGK E;  3HU1 A;  3FYD A;  3TQS A;  4JI6 M;  2DZN B;  3MJ5 A;  1Z5A A;  5EXT A;  1LV7 A;  3RFW A;  3VKG A;  4R3D A;  4DV4 M;  2YQZ A;  2C99 A;  5IT9 S;  1NY6 A;  5IRE B;  4PD2 A;  4NRV A;  1IN6 A;  1JQJ C;  2V1C A;  4B08 A;  3UGJ A;  4QHT A;  1XXH A;  4LZZ A;  4A3V B;  3CF0 A;  3R9X B;  3IG5 A;  1IBL M;  1K3X A;  4W5W A;  5EP3 A;  4FD2 A;  2CHV A;  2KA6 B;  1YE9 A;  4R7G A;  1SXJ E;  3UK6 A;  4I8O A;  3A45 A;  4G6Z A;  4NL4 H;  3LQR A;  4M0W A;  3GLG A;  1XMQ M;  1IXZ A;  4P16 A;  4KO8 A;  4KOD A;  3U6O A;  1QAO A;  4IIW A;  5JI2 E;  3B9P A;  3SC3 A;  2Y0T A;  5ITT A;  4FWD A;  1FNN A;  3DZD A;  1NSF A;  1G41 A;  2HL7 A;  3SAW A;  2O5R A;  4MB7 A;  3UZU A;  3W0F A;  3GRR A;  1Z5B A;  4LJ6 A;  3VDU A;  1TH2 A;  3AL0 C;  4YY3 M;  2UXD M;  3GLF A;  2Y0Q A;  4BB9 A;  3M6A A;  2X49 A;  4IBC A;  3HU2 A;  3M0E A;  3PVS A;  4XGI A;  2QP9 X;  2LNH C;  1MU5 A;  3KFU G;  2R18 A;  3D8L A;  4IBF A;  4LF8 M;  2D7G A;  2R4E A;  2DXI A;  2Z7J A;  4DR2 M;  4BBA A;  2UUA M;  3ILK A;  5FTJ A;  2G5G X;  4LF9 M;  3HHW A;  5FTL A;  2CHG A;  4NOO B;  3HWS A;  5FLX S;  2XZF A;  3KXE C;  2DZO B;  1XHB A;  3H4M A;  3M7G A;  2KZU A;  2JA2 A;  2Y20 A;  1TH4 A;  3KP0 E;  4DR4 M;  2DWN A;  2EA0 A;  4IBI A;  2CHQ A;  2VQE M;  1R7R A;  4GC9 A;  3PNV A;  3UJN A;  5EJC A;  1G59 A;  4REZ A;  4Z6Y A;  4B7F A;  2F4V M;  4GIP A;  3CF6 E;  2G8L A;  3SYL A;  1C1K A;  5C1B A;  2CEA A;  3KP1 E;  4G4O A;  4IBE A;  5DYI A;  3GPP A;  1SXJ A;  1W5T A;  5KO3 A;  3SAU A;  1IY1 A;  2UUC M;  4JI4 M;  4B3R M;  2LH0 A;  4X64 M;  1IBK M;  4HL4 A;  5E6J A;  2NQ8 C;  2V6Z M;  4JI5 M;  3KSJ A;  1E9S A;  3IG8 A;  1YUB A;  3SMP A;  2C9C A;  2XZU A;  2XLJ A;  3MHV C;  3Q8X A;  3LQQ A;  4OW0 A;  4DV1 M;  4L8R C;  2J7N A;  1KFV A;  3KDS E;  3KVW A;  4I5S A;  3FD9 A;  2DVW B;  1E9R A;  3ZH9 B;  2K47 A;  2QEN A;  3KOZ E;  3SAR A;  1W5S A;  5BR8 M;  2Z4R A;  1GL6 A;  1IXR C;  1NNU C;  3PNY A;  1OJL A;  4JI0 M;  1SXJ B;  3KS4 A;  4MGZ E;  4LY6 A;  3VLF B;  2Z4S A;  3GPY A;  3U5Z A;  4IJE A;  3PFI A;  5EP4 A;  4DR7 M;  1TDH A;  2HHH M;  4AI6 A;  1QAQ A;  2XSZ D;  5EXX A;  1DGB A;  1N33 M;  3ZC7 B;  3SAV A;  3FTD A;  4RNA A;  3VK7 A;  2AHM A;  1ZAE A;  2EO2 A;  3U61 A;  2C5R A;  2I7P A;  3JR4 A;  3U5Z B;  2C98 A;  2QBY B;  1ZQ9 A;  2Y21 A;  1L2D A;  1IY0 A;  1S3S A;  3QWL A;  4QNR A;  5ITU A;  4QOS A;  1DGF A;  3SAT A;  3KW6 A;  1TDZ A;  1Z59 A;  2CE7 A;  4LGY A;  1JR3 D;  1X37 A;  3C58 A;  3T38 A;  2UXC M;  3U6P A;  4LJ5 A;  4WW0 A;  3W0L B;  2DWM A;  2QBY A;  2RGH A;  2M5Z A;  4G4Q A;  3GQ3 A;  1QAN A;  4Z8X A;  1TH3 A;  3FTC A;  2KRK A;  2M60 A;  2R62 A;  1IY2 A;  1EE8 A;  3DFZ A;  5FTM A;  2VII A;  1Z6T A;  3FKE A;  5KPR A;  5ITY A;  4DUY M;  3FTE A;  4M9X A;  1NHW C;  4RF1 A;  2R45 A;  1NVM A;  4JI2 M;  4MGI E;  4LF7 M;  2R4J A;  3SBJ A;  5H37 D;  4AKH A;  2ZAM A;  3HJS A;  7CAT A;  3GQ5 A;  4IBD A;  4LRS A;  1Q3B A;  3LVV A;  3RGP A;  1R6B X;  5DNY A;  2KXE A;  1NNJ A;  1OFI A;  4GIT A;  4FCT A;  3GP1 A;  4AQY M;  5EXP A;  3DOA A;  4BLC A;  1IN7 A;  5ITQ A;  1N78 A;  2XF3 A;  3K2L A;  2UU9 M;  1G4A E;  1HNW M;  2UUB M;  3D8B A;  1IN8 A;  3J7B A;  3JR5 A;  1HR0 M;  2QPA A;  1R2Z A;  4NSR A;  1N34 M;  1FJG M;  4B7G A;  3KOY E;  3L2A A;  3TL4 X;  4TUW A;  4NXN M;  3J2P B;  2F5O A;  2FE8 A;  1G3I A;  1UM8 A;  1XMO M;  1N36 M;  5BPV A;  3FUT A;  2FOI C;  2C9O A;  2RGO A;  4GC5 A;  3U60 A;  3RE8 A;  4GHA A;  5C18 A;  3L26 A;  1N77 A;  2VQF M;  4DR3 M;  3HHX A;  2YR0 A;  5KQ8 A;  2ZBK B;  5GKN A;  4X62 M;  4LJ7 A;  4L4U A;  2KEB A;  3U61 B;  1QZM A;  2E5L M;  4LG2 A;  1HQY E;  1N75 A;  2L7H A;  5FTN A;  5EQT A;  2V1U A;  2DWZ B;  1XNR M;  2D7E A;  3FYC A;  3GRV A;  3U6D A;  4LGM A;  4FWG A;  2CUZ A;  2DWL A;  1SXJ C;  4LFA M;  1SXJ D;  1E32 A;  2HCB A;  1L2B A;  3KOW E;  2OPF A;  4OVZ A;  4AW4 A;  4AKI A;  4DV5 M;  3I4Y A;  2HKJ A;  4DR6 M;  4FCW A;  3AV0 A;  1IQP A;  1HQC A;  1J7K A;  3J27 B;  4II7 A;  1D2N A;  4IBK A;  2X8A A;  4PDG A;  4WUR A;  3VFD A;  1PM5 A;  4PDI A;  2R65 A;  2L7I A;  4FCV A;  3KSX A;  1J5E M;  1QYR A;  4MGH A;  3THG A;  1ORY B;  5IWA M;  4DUZ M;  5KQD A;  3L27 A;  3SHF A;  4X65 M;  3T1Y M;  2A5Y B;  4MM3 B;  3HU3 A;  3T1H M;  1GL7 A;  3GLH B;  5KPT A;  3RGS A;  2J7O A;  5EXS A;  3FUW A;  1IN5 A;  3A46 A;  4JN6 A;  5DYG A;  4FW9 A;  2ZM6 M;  4L15 A;  1NY5 A;  2KRU A;  4DV7 M;  5EP1 A;  4KLN A;  4JV5 M;  4DV0 M;  5ITX A;  1DO2 A;  1GKI A;  3HHY A;  3T15 A;  1Z5C A;  3TWM A;  1VDD A;  2XFT A;  1KYI A;  3U6C A;  2YFQ A;  1PJI A;  2ERC A;  3BOS A;  3DA1 A;  4D80 A;  1Q3C A;  5FSW A;  1PJJ A;  1DO0 A;  4EIW A;  1OFH A;  1L1T A;  5KPZ A;  2X4A A;  4FVM A;  1NJF A;  1GLN A;  5LMN M;  3VK8 A;  3U6M A;  3L29 A;  4DV2 M;  4LJ9 A;  1G8P A;  1QAM A;  2L09 A;  4M9Z A;  3ZCB B;  3FUV A;  4LF4 M;  2F5P A;  4DV6 M;  4HLQ A;  5FTK A;  4LF5 M;  1J09 A;  4IBB A;  1R2Y A;  3GO8 A;  4LF6 M;  4LRT A;  2QZ4 A;  1I94 M;  4ZPX A;  4QNM A;  4KHP M;  3J81 S;  4D82 A;  1WXQ A;  3FUU A;  4X66 M;  4GRI A;  4B3T M;  4NRW A;  1DGH B;  3AKZ A;  4M0D A;  5JI3 E;  3U6Q A;  1IBM M;  4CIS A;  4G4N A;  2BNK A;  4B3S M;  3MK6 A;  4CGY B;  4DR1 M;  2CV1 A;  3L28 A;  1HNZ M;  1XC8 A;  4DV3 M;  1HNX M;  4PCZ A;  3E4R A;  5E26 A;  2XEP A;  5F3W A;  3AOG A;  3FUX A;  3HJQ A;  1I4W A;  3I51 A;  3KS8 A;  1XXH B;  2KW0 A;  3GRY A;  4QOZ C;  2KZS A;  1L2C A;  3NWL A;  4LFC M;  4JI7 M;  3KOX E;  4JI3 M;  2Z3X A;  3GLI B;  4L16 A;  3FTF A;  3UMM A;  3AOE C;  4IBJ A;  3A42 A;  4G4R A;  3GPX A;  1L1Z A;  1GVN A;  2FNA A;  3AFH A;  1KSF X;  2YNM D;  3HGI A;  2QCU A;  1NHG C;  1DGG A;  3J80 S;  3HJ8 A;  4RF0 A;  3WHK A;  4JI8 M;  1QQW A;  2F5S A;  5EP2 A;  2CFO A;  4QHS A;  4IJF A;  2UXB M;  3LMM A;  4CHT B;  1K3W A;  3R8F A;  2XFS A;  2XH9 A;  4GH9 A;  3GPU A;  3J7A S;  3TPZ A;  3I4V A;  1Q39 A;  3GRU A;  3L25 A;  4LCB A;  4GHL A;  2CV0 A;  2P5T A;  2Q2E B;  4GKJ M;  5ITX E;  5ITR A;  3LVW A;  2CV2 A;  4DR5 M;  3TWL A;  3CTW B;  4OU7 A;  4JYA M;  4B3M M;  3JAM S;  1IN4 A;  3SMS A;  3AJI B;  2OQ4 A;  1HT2 E;  5LMU M;  4JI1 M;  3A98 B;  3GLI A;  1JR3 A;  4K0K M;  4LFB M;  3QAU A;  2R46 A;  4OVZ B;  4XBO A;  4AG5 A;  2XGN A;  1L8Q A;  3TE6 A;  2F5N A;  2H1R A;  3TWK A;  3GLG B;  3K1J A;  2D7H A;  2RKO A;  1QVR A;  1E94 E;  5A2Q S;  2F5Q A;  3SFZ A;  4M9S A;  3VDP A;  4FWH A;  3NBI A;  1T3T A;  1MX0 A;  3U6S A;  3GQ4 A;  4NXM M;  1TGU A;  3E9S A;  4NSO B;  4YHH M;  5IZ7 D;  8CAT A;  4MH0 E;  2C96 A;  3U60 B;  4LJA A;  4GKK M;  1H6U A;  1DGH A;  4S12 A;  3VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...