4GKKM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gkkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4gkkM02
2UUCM 1Z5AA 4B3MM 4LF4M 1NNJA 3W0FA 5ITXE 1L2DA 2F5OA 4DV7M 2F5SA 1Z5BA 1XMOM 3J80S 3U6QA 4GKJM 1HNXM 4JI4M 1R2ZA 4OX9M 4AQYM 3SARA 1K3WA 4DV1M 4NXNM 4LF6M 4LF8M 3GQ5A 1L2CA 3TWMA 5IT9S 4K0KM 1PJIA 1FJGM 3J7AS 4G4RA 4NXMM 2F5QA 2F5NA 1Z59A 4DR7M 2F5PA 4YHHM 4DV4M 2OPFA 1Q3BA 1K3XA 4LFCM 3GPYA 3DOAA 4JI7M 3GO8A 4G4OA 4X66M 1XNRM 3VK7A 4JI5M 4ITQA 2Q2EB 4JI3M 5A2QS 5ITUA 3U6EA 1Z5CA 1HNWM 4CISA 4JV5M 3A45A 4DUYM 4DV2M 3A42A 3GPXA 2ZM6M 1N34M 1KFVA 4G4QA 1HR0M 4DR2M 2ZBKB 3C58A 1Q3CA 3U6SA 4JI0M 1IBMM 3TWKA 1TDZA 4B3RM 2UUBM 3SATA 3SBJA 4PCZA 2E5LM 4KHPM 3JR4A 4DR4M 1N36M 4PDIA 1MX0A 4B3SM 4JI8M 4B3TM 3GPPA 5ITRA 1J5EM 3SASA 4DV6M 2XZFA 5ITYA 4YY3M 3SAUA 4DR1M 2F4VM 4G4NA 5ITTA 4X65M 1PJJA 1IBKM 4DV0M 3SAWA 4JI6M 3GP1A 3U6DA 2HHHM 1XNQM 3VK8A 5BR8M 1TDHA 5IWAM 3A46A 3U6MA 4DR5M 4NRWA 5LMNM 1R2YA 4JYAM 2UXDM 1N32M 1N33M 2VQFM 4NRVA 4GKKM 2EA0A 3J81S 1Q39A 2VQEM 4LFAM 1MU5A 3T1YM 3U6OA 3GQ4A 5ITXA 3GPUA 4X62M 1L1TA 4DV3M 1XMQM 1XC8A 3OTOM 3T1HM 1L2BA 3U6LA 4PD2A 1PM5A 3U6PA 2UXBM 1I94M 1L1ZA 2UU9M 5ITQA 1EE8A 1IBLM 2OQ4A 4LF7M 2UUAM 4LF9M 3SAVA 2UXCM 4DR3M 4JI2M 3JAMS 4JI1M 5FLXS 4PDGA 3TWLA 2HKJA 4DR6M 3JR5A 5LMUM 4MB7A 4DUZM 1K82A 1HNZM 4LF5M 2XZUA 3U6CA 3GQ3A 4LFBM 4DV5M 4X64M
chains in the Genus database with same CATH superfamily
3TQSA 1Z5AA 3VKGA 3IHPA 2O01F 1E9RA 1C7YA 1Z5BA 2Y0TA 3DFZA 3GLIE 1XMOM 5C1BA 1HT2E 2FOIC 2H5XA 4B08A 2ZAOA 3HHZA 2R6FA 3BXWA 2JZ1A 3FTCA 4Q7JA 4OX9M 3LQRA 1V92A 4REZA 3SARA 3A98B 3HZJA 3MJ5A 1TH4A 3J7BA 2LNHC 1L2CA 3KP1E 1OJLA 4IBFA 4CIZA 3TWMA 2R46A 1PJIA 3Q8GA 2Y21A 2X49A 1A5TA 5EXSA 3ZH9B 3J7AS 4NXMM 2F5QA 2C9CA 2OOBA 2BNKA 4YHHM 4DV4M 1Q3BA 2HWJA 2JZ0A 1W5SA 4KO8A 3K9OA 2LH0A 1G3IA 2R65A 4B7GA 3K92A 1DV0A 3KP0E 4X66M 5IREB 1IXRC 1OQYA 3FUUA 4LRTA 2XH9A 3KSXA 2Q2EB 5EXPA 4B7FA 4LZZA 5DNYA 1E32A 3U6EA 2DXIA 2DWZB 4JV5M 1IQPA 4BBAA 4DV2M 2WSEF 3A42A 3EIHA 5H37D 2DZNB 2LTUA 1WGNA 2L2DA 1IY1A 3KVWA 2A5YB 5FSWA 2R62A 3E9SA 1T43A 4QNRA 2CV1A 4OVZB 2BJWA 3B74A 1TDZA 8CATA 1DO2A 3HHWA 4G6ZA 2D7GA 2E5LM 1N77A 3EIEA 1N36M 4PDIA 1MX0A 1GJTA 2KXEA 1IN5A 1ZAEA 2J7OA 3AOGA 4R7GA 4QOZC 4NC6A 4DV6M 2XZFA 5ITYA 3FTEA 2L7HA 1TH3A 1PJTA 3M7GA 3W0LB 1BVSA 1D0KA 4CGYB 3GLGE 1TDHA 3DA1A 3A46A 2VF8A 4DR5M 3ZQJA 1G71A 2N35A 1R2YA 2CV2A 4IIWA 3FKEA 4JYAM 2QHOB 3R9XB 4NRVA 3J81S 3B7QA 2EKKA 2Z7JA 4NL4H 3J27B 2Z3XA 1IFYA 1MU5A 2AHMA 4IBCA 4LGMA 5BPVA 2XEPA 3CF6E 5ITXA 3GPUA 1XMQM 3VLFB 1XC8A 2XFSA 2ZAMA 2CHVA 3OTOM 3T1HM 2XLJA 1VEKA 1PM5A 3F92A 5JI3E 4CJ6A 3UK6A 3U61B 1DGHB 5L8RF 2C5RA 2R0IA 3IG5A 3W68A 5ITQA 2UU9M 1G41A 2JP7A 2C99A 1OFIA 2LBCA 2GNOA 4DR3M 3AL0C 4II7A 4MGIE 3SMSA 4IBJA 4LY6A 1NY6A 4GH9A 4GC5A 4MM3B 3TWLA 2DAGA 1LTMA 3GRVA 4D80A 3JR5A 3GLGA 3HKPA 2CUZA 4JXJA 2Z4RA 4MB7A 1QDTA 4OVZA 2XSZA 1HNZM 4LF5M 5FTKA 4L8RC 2QCUA 2MR9A 3UGJA 1NJGA 5E6JA 2QBYA 4Z8XA 5ITXE 1L2DA 3WHLA 4DV7M 2X4AA 2LVAA 2K47A 5DFLA 1XWIA 3J80S 3SMPA 2HCBA 1QZEA 4JI4M 3HHXA 1R2ZA 5EQTA 4IBGA 2ZANA 1SXJE 4P16A 1NNUC 4NXNM 4DV1M 5IZ7D 4LF8M 2LHGA 4S12A 3T6PA 1G4AE 1L8QA 4HEOA 2O5RA 2JY8A 1YUBA 3KFUG 3SHFA 1FNNA 2Z8YM 3I4YA 4G4RA 2DWMA 2OO9A 2ZTCA 1Z59A 4ZPXA 3R8FA 3QAUA 2F5PA 2XSZD 1K3XA 3AOEA 1OFHA 1WGLA 2C98A 2DAIA 3AOEC 4LFCM 3GPYA 1N75A 3M0EA 4B7HA 4L4UA 2G8LA 3K2LA 3GO8A 2QENA 2VIIA 4JI5M 2CE7A 3U5ZA 4ITQA 2O25A 3KOYE 1QANA 2RKOA 5ITUA 1NO1A 2EUCA 3BOSA 1Z5CA 2KEBA 4CISA 1HNWM 4M9SA 2J5YA 4GRIA 1GVNA 2DKLA 3A45A 1C1KA 3SHGB 1IY2A 5KQ8A 3GPXA 2ZM6M 1N34M 2C9OA 4G4QA 5FTMA 2LXEA 3VDPA 3LVVA 1HR0M 2ZBKB 4L16A 3RFWA 3VKHA 1SXJA 2RGOA 4HLQA 2K6BA 2DHRA 2R4EA 2XGNA 3KW6A 4LZJA 2CHGA 3KS8A 3SC3A 2QBYB 3FUTA 4TUWA 3FRIA 3LCUA 1NY5A 3K9PA 3AFHA 4B3TM 3L2AA 4BLCA 4NSOB 3CF0A 3KS4A 4KLNA 1VDLA 4I81A 3MMPA 1J5EM 2P5TA 1DGBA 1QAQA 4PT5A 1IBKM 4X65M 2F4VM 1Z6TA 4DV0M 2KZUA 1GO5A 3GP1A 2FS1A 3U6DA 1XNQM 1HJPA 4F1IA 3FUWA 3V76A 1IXSB 4NRWA 2UXDM 1YE9A 2VQFM 1IN4A 4L15A 4Z6YA 1JB0F 2VQEM 1ZMVA 3B7ZA 2YR0A 3IG8A 4MGZE 3T1YM 1I4WA 3NBXX 2DAEA 2KRKA 3SFZA 3GQ4A 4LG2A 4G3OA 4FD2A 4GHAA 1G8PA 1L2BA 1WIVA 4OU7A 3U6PA 4GIPA 4LJAA 1ZV1A 2QSFX 1OKSA 2QQ8A 1I94M 1GKIA 1QVRA 2DZOB 4FCTA 4AG6A 1IN6A 3CGWA 1SXJC 1J09A 2DENA 1DO0A 4I4LA 3SYLA 3TL4X 3TE6A 3H4MA 3LCVB 2UUAM 4R3DA 3WHKA 3U60A 2MROB 3J2PB 1YSYA 4JI2M 3T15A 2FNAA 3JAMS 4JI1M 1TH2A 2D7HA 3DZDA 3GLHA 5FLXS 2KHHA 5DYIA 3U61A 3FTDA 1TGUA 2CRUA 1AUAA 3HGIA 1KSFX 1XXHA 4WP2A 3PXGA 1K82A 2XZUA 5KPRA 3GQ3A 3SAWA 4LFBM 2RRUA 2W82A 2VF7A 2JXNA 5FTLA 5JI2E 2V6ZM 1J7KA 4B3MM 2RGHA 1N78A 2F5OA 1IM2A 3HWSA 4RF1A 3MHVC 4AW4A 1WXQA 2KRUA 3VFDA 1P3QQ 2D7EA 4FWGA 3U6QA 1HNXM 1GL7A 3B89A 1IXSA 3C3DA 1H6UA 1NSFA 1QDRA 1K3WA 3GRUA 3Q8XA 4LF6M 3LMMA 4MGYE 2LVQD 3GQ5A 3LW5F 4MGKE 4IBBA 1XHBA 4K0KM 1EFUB 2LWXA 1OTRA 2BWEA 4WURA 3GLHE 3THGA 4DBGB 1FJGM 1JR3E 3CF2A 3RGSA 2DHYA 3HU3A 4LJ9A 2OPFA 3E4RA 3HU2A 4JI7M 3FUVA 1XXHE 2DAKA 1VQ1A 2X8AA 4FCWA 1F4IA 3KSJA 2JY6B 2G3QA 4MGHA 1TR8A 1NV8A 4RF0A 3UJNA 3VK7A 1HT1E 1T6OA 1NJFA 1T3TA 1SXJD 1E94E 1HQCA 1QZMA 2QZ4A 2YNMD 2XF3A 1OIZA 4L78A 2L09A 2DWNA 2R18A 1ZMUA 3FD9A 3LQQA 2K0BX 3VK8A 2QNJA 4QNMA 2CP8A 1D0MA 3UZUA 4DR2M 3C3EA 1VEJA 3MK6A 2KA6B 1Q3CA 1VEGA 3U6SA 1EIJA 3U5ZB 1IBMM 1NHWC 1G59A 4GITA 2UUBM 1WJ7A 3L29A 3SATA 2KNZA 3SBJA 1IN8A 1DGFA 3FYDA 4KHPM 1AIPC 1IN7A 1JR3D 1JR3A 4M0WA 4B3SM 4NSRA 4JI8M 3I01M 5ITRA 3NWLA 2R45A 4AG5A 2CHQA 3K1JA 1V33A 3M6AA 2G5GX 3FE3A 3SASA 3GLFB 3W67A 2HAKA 3HX3A 5ITTA 3IECA 1PJJA 2YQZA 2HHHM 2V1CA 3RE8A 5BR8M 1QUTA 2BJVA 2LVNC 3U6MA 3PNYA 4AKGA 3D8BA 3U60B 1JQJC 3PFIA 3KDSE 4D81A 2KDLA 4GKKM 3QYEA 2FFJA 2WZJA 1V34A 3PNVA 2EJSA 5KQDA 1L1TA 2MJ5B 1GL6A 2M60A 2FH0A 4P17A 4LGYA 2JNHA 2UXBM 2WSCF 1SG9A 1GABA 2LHCA 2L4EA 1Y8GA 2WSFF 5C18A 3HHYA 4AZFA 1UM8A 1IBLM 1GJSA 4GEWA 4QOSA 4IBDA 4LF9M 5KO3A 4I8OA 4LCBA 3SAVA 5GKNA 2UXCM 4FWDA 5EXTA 3I4VA 2JUJA 2BWBA 1RU3A 4GC9A 4LRSA 4XK8F 3KOWE 4LJ7A 4IBKA 1DGGA 2L7IA 2HKJA 5EP3A 4WW0A 4DR6M 3GLIB 3ZC7B 2I7PA 3UMMA 2CWBA 3U6CA 3AKZA 2R44A 4QHTA 4DV5M 2Y0QA 3C9PA 3ILKA 3QYBA 2KNAA 4RNAA 1NNJA 3W0FA 2UUCM 4LF4M 2H1RA 5DYGA 2F5SA 1TF0B 2Y20A 3GLFE 4XBOA 2DI0A 3FTFA 2B3TA 2DNAA 1SXJB 3I51A 3I04M 5EP4A 4GKJM 2HL7A 2R4JA 3E21A 1OAOC 1PRBA 2JWSA 1R6BX 4AQYM 2I7NA 3T38A 4AI6A 4CHTB 4D82A 2KZSA 4LJ6A 4Y28F 5IT9S 1ORYB 4JN6A 2KW0A 1ZMWA 5EP2A 1UFZA 3HJQA 4EIWA 2L6OA 3L27A 2F5NA 4BB9A 3D8LA 4LJ4A 1D0LA 2EKFA 3FYCA 2DWLA 4DR7M 2KNVA 5FTJA 1E9SA 2CFOA 1MN3A 1NHGC 3DOAA 3HU1A 2DVWB 5E26A 3KOZE 3LVWA 4M0DA 2QPAA 4F2LA 1IY0A 4G4OA 1R7RA 4M9ZA 1XNRM 4FCVA 2CV0A 2ERCA 2Z4SA 3E46A 4KODA 5EXXA 3L26A 3HJ8A 4JI3M 2FE8A 2L4FA 1QYRA 4KT0F 5A2QS 2DAMA 3GLFA 3K8ZA 2V1UA 4DUYM 2MH8A 2J7NA 3PVSA 1KFVA 3FUXA 1IXZA 1QAMA 1OAIA 3HY5A 4QHSA 3C58A 3SYKA 4IJEA 4JI0M 3TPZA 3TWKA 4B3RM 2VDBB 4GMQA 4PCZA 2ZTDA 2APLA 4A3VB 3JR4A 4FWHA 4DR4M 3B9PA 1OIPA 3NBIA 4GHLA 2LVOC 4M9XA 3L25A 4FW9A 4OW0A 3AV0A 3GPPA 3AJIB 2CEAA 1PJQA 4LJ8A 5FTNA 4ANRA 4RKUF 1LV7A 3QWLA 2NQ8C 1R5LA 1Q02A 4YY3M 4DR1M 3SAUA 4AKIA 4G4NA 1HQYE 1YLAA 5EP1A 4JI6M 4IJFA 1ZQ9A 4IBEA 5IWAM 1R4GA 3BBZA 3FRHA 4HL4A 5LMNM 4R71A 3CTWB 1N32M 1N33M 2EA0A 3HJSA 1Q39A 3RGPA 4LFAM 3B7NA 1NV9A 3U6OA 1DGHA 5EJCA 4X62M 4DV3M 3GRYA 2EO2A 1QUSA 2MGWA 1TTEA 1X37A 3GLIA 1XB2B 3U6LA 4PD2A 1CUKA 4XGIA 2C96A 5KPZA 2DZLA 2JY5A 5KPTA 1L1ZA 3L28A 1PJSA 2OOAA 3H4JA 4FVMA 2M5ZA 4LJ5A 1EE8A 2GQFA 3GRRA 2OQ4A 4LF7M 3VDUA 1S3SA 7CATA 1NVMA 1WHCA 1VG5A 1W5TA 2XFTA 3GLHB 3ZCBB 4NOOB 1VDDA 5F3WA 3KXEC 3KOXE 1PGYA 4UN2B 4IBIA 4I5SA 3GLGB 1D2NA 4MH0E 4PDGA 1WR1B 2K9DA 1QQWA 1QAOA 4W5WA 5LMUM 4L6V6 4DUZM 2JA2A 4AKHA 1KYIA 2JY7A 1GLNA 1MJGM 2YFQA 1XXHB 2LVPC 4X64M 2QP9X
chains in the Genus database with same CATH topology
3TQSA 1Z5AA 3VKGA 1E9RA 1Z5BA 2Y0TA 3DFZA 1XMOM 5C1BA 1HT2E 2FOIC 4B08A 2ZAOA 3HHZA 3FTCA 4OX9M 3LQRA 4REZA 3SARA 3A98B 3MJ5A 1TH4A 3J7BA 2LNHC 1L2CA 1OJLA 4IBFA 3TWMA 2R46A 1PJIA 2Y21A 2X49A 5EXSA 3J7AS 3ZH9B 4NXMM 2F5QA 2C9CA 2BNKA 4YHHM 4DV4M 1Q3BA 1W5SA 4KO8A 2LH0A 1G3IA 2R65A 4B7GA 3K92A 3KP0E 4X66M 5IREB 1IXRC 3FUUA 4LRTA 2XH9A 3KSXA 2Q2EB 5EXPA 4B7FA 4LZZA 5DNYA 1E32A 3U6EA 2DXIA 2DWZB 4JV5M 1IQPA 4BBAA 4DV2M 3A42A 3EIHA 5H37D 2DZNB 3KVWA 1IY1A 2A5YB 5FSWA 2R62A 3E9SA 4QNRA 2CV1A 4OVZB 2BJWA 1TDZA 8CATA 1DO2A 3HHWA 4G6ZA 2D7GA 2E5LM 1N77A 3EIEA 1N36M 4PDIA 1MX0A 2KXEA 1IN5A 1ZAEA 2J7OA 3AOGA 4R7GA 4QOZC 4DV6M 2XZFA 5ITYA 3FTEA 2L7HA 1TH3A 3M7GA 3W0LB 4CGYB 3VK8A 1TDHA 3DA1A 3A46A 4DR5M 1R2YA 4JYAM 2CV2A 4IIWA 3FKEA 3R9XB 4NRVA 3J81S 2Z7JA 2Z3XA 4NL4H 3J27B 1MU5A 2AHMA 4IBCA 4LGMA 5BPVA 2XEPA 3CF6E 5ITXA 3GPUA 1XMQM 3VLFB 1XC8A 2XFSA 2ZAMA 2CHVA 3OTOM 3T1HM 2XLJA 1PM5A 5JI3E 3UK6A 3U61B 1DGHB 2C5RA 3IG5A 2UU9M 5ITQA 1G41A 2C99A 1OFIA 4DR3M 3AL0C 4II7A 4MGIE 3SMSA 4IBJA 4LY6A 1NY6A 4GH9A 4GC5A 4MM3B 3TWLA 3GRVA 4D80A 3JR5A 3GLGA 3HKPA 2CUZA 4JXJA 2Z4RA 4MB7A 4OVZA 2XSZA 1HNZM 4LF5M 5FTKA 4L8RC 2QCUA 3UGJA 1NJGA 5E6JA 2QBYA 4Z8XA 5ITXE 1L2DA 3WHLA 4DV7M 2X4AA 2K47A 1XWIA 3J80S 3SMPA 2HCBA 4JI4M 3HHXA 1R2ZA 5EQTA 4IBGA 2ZANA 1SXJE 4P16A 1NNUC 4NXNM 4DV1M 5IZ7D 4LF8M 4S12A 1G4AE 1L8QA 2O5RA 1YUBA 3KFUG 3SHFA 1FNNA 3I4YA 4G4RA 2DWMA 4ZPXA 3R8FA 1Z59A 3QAUA 2F5PA 2XSZD 1K3XA 3AOEA 1OFHA 4LFCM 2C98A 3AOEC 3GPYA 1N75A 3M0EA 4B7HA 4L4UA 2G8LA 3K2LA 3GO8A 2QENA 2VIIA 4JI5M 2CE7A 3U5ZA 4ITQA 3KOYE 1QANA 2RKOA 5ITUA 2EUCA 3BOSA 1Z5CA 2KEBA 4CISA 1HNWM 4M9SA 4GRIA 1GVNA 3A45A 1C1KA 3SHGB 1IY2A 5KQ8A 3GPXA 2ZM6M 1N34M 2C9OA 4G4QA 5FTMA 2LXEA 3VDPA 3LVVA 1HR0M 2ZBKB 4L16A 3RFWA 3VKHA 1SXJA 2RGOA 4HLQA 2DHRA 2R4EA 2XGNA 3KW6A 4LZJA 2CHGA 3KS8A 3SC3A 2QBYB 3FUTA 4TUWA 1NY5A 3AFHA 4B3TM 3L2AA 4BLCA 4NSOB 3CF0A 4KLNA 4I81A 1J5EM 2P5TA 1DGBA 1QAQA 4PT5A 1IBKM 4X65M 2F4VM 1Z6TA 4DV0M 2KZUA 3GP1A 3U6DA 1XNQM 3FUWA 2UXDM 1IXSB 4NRWA 1YE9A 2VQFM 1IN4A 4L15A 4Z6YA 2VQEM 2YR0A 3IG8A 4MGZE 3T1YM 1I4WA 2KRKA 3SFZA 3GQ4A 4LG2A 4FD2A 4GHAA 1G8PA 1L2BA 4OU7A 3U6PA 4GIPA 4LJAA 1I94M 1GKIA 1QVRA 2DZOB 4FCTA 4AG6A 1IN6A 1SXJC 1J09A 3TL4X 1DO0A 4I4LA 3SYLA 3TE6A 3H4MA 2UUAM 4R3DA 3WHKA 3U60A 3J2PB 1YSYA 4JI2M 3T15A 2FNAA 3JAMS 4JI1M 1TH2A 2D7HA 3DZDA 3GLHA 5FLXS 5DYIA 3U61A 3FTDA 1TGUA 3HGIA 1KSFX 1XXHA 3PXGA 1K82A 2XZUA 5KPRA 3GQ3A 3SAWA 4LFBM 2W82A 5FTLA 4B3MM 1N78A 5JI2E 2V6ZM 1J7KA 2RGHA 2F5OA 1IM2A 3HWSA 4RF1A 3MHVC 4AW4A 1WXQA 2KRUA 3VFDA 2D7EA 3U6QA 4FWGA 1HNXM 1GL7A 1H6UA 1NSFA 1K3WA 3GRUA 3Q8XA 4LF6M 3LMMA 4MGYE 3GQ5A 4MGKE 4IBBA 1XHBA 4K0KM 2LWXA 4WURA 3THGA 1FJGM 3CF2A 3RGSA 3HU3A 4LJ9A 2OPFA 3E4RA 3HU2A 4JI7M 3FUVA 2X8AA 4FCWA 3KSJA 4MGHA 3UJNA 4RF0A 3VK7A 1HT1E 1NJFA 1T3TA 1SXJD 1E94E 1HQCA 1QZMA 2QZ4A 2YNMD 2XF3A 4L78A 2L09A 2DWNA 2R18A 3FD9A 3LQQA 4QNMA 3UZUA 4DR2M 3MK6A 2KA6B 1Q3CA 3U6SA 3U5ZB 1IBMM 1NHWC 1G59A 4GITA 2UUBM 3L29A 3SATA 3SBJA 1IN8A 1DGFA 3FYDA 4KHPM 1IN7A 1JR3D 1JR3A 4M0WA 4B3SM 4NSRA 4JI8M 5ITRA 3NWLA 2R45A 4AG5A 2CHQA 3K1JA 3SASA 3M6AA 2G5GX 3GLFB 1PJJA 5ITTA 2YQZA 2HHHM 2V1CA 3RE8A 5BR8M 2BJVA 3U6MA 3PNYA 4AKGA 3D8BA 3U60B 1JQJC 3PFIA 3KDSE 4D81A 4GKKM 2FFJA 3PNVA 5KQDA 1L1TA 1GL6A 2M60A 4LGYA 2UXBM 5C18A 3HHYA 4AZFA 1UM8A 1IBLM 4QOSA 4IBDA 4LF9M 5KO3A 4I8OA 4LCBA 3SAVA 5GKNA 2UXCM 4FWDA 5EXTA 3I4VA 4GC9A 4LRSA 3KOWE 4LJ7A 4IBKA 1DGGA 2L7IA 2HKJA 5EP3A 4WW0A 4DR6M 3GLIB 3ZC7B 2I7PA 3UMMA 3U6CA 3AKZA 4DV5M 4QHTA 2Y0QA 4RNAA 3ILKA 2UUCM 1NNJA 4LF4M 3W0FA 2H1RA 5DYGA 2F5SA 2Y20A 1XXHB 4XBOA 3FTFA 4GKJM 1SXJB 3I51A 5EP4A 2HL7A 2R4JA 1R6BX 4AQYM 2I7NA 3T38A 4AI6A 4CHTB 4D82A 2KZSA 4LJ6A 5IT9S 1ORYB 4JN6A 2KW0A 5EP2A 3HJQA 4EIWA 2L6OA 3L27A 2F5NA 4BB9A 3D8LA 4LJ4A 4DR7M 3FYCA 2DWLA 5FTJA 1E9SA 2CFOA 1NHGC 3DOAA 3HU1A 2DVWB 5E26A 3KOZE 3LVWA 4M0DA 2QPAA 1IY0A 4G4OA 1R7RA 4M9ZA 1XNRM 4FCVA 2CV0A 2ERCA 2Z4SA 4KODA 5EXXA 3L26A 3HJ8A 4JI3M 2FE8A 5A2QS 1QYRA 3GLFA 3K8ZA 2V1UA 4DUYM 2J7NA 3PVSA 1KFVA 3FUXA 1IXZA 1QAMA 4QHSA 3C58A 3SYKA 4IJEA 4JI0M 3TPZA 3TWKA 4B3RM 4GMQA 4PCZA 4A3VB 3JR4A 4FWHA 4DR4M 3B9PA 3NBIA 4GHLA 4M9XA 3L25A 4FW9A 4OW0A 3AV0A 3GPPA 3AJIB 2CEAA 4LJ8A 5FTNA 1LV7A 3QWLA 2NQ8C 4YY3M 4DR1M 4AKIA 4G4NA 1HQYE 5EP1A 4JI6M 4IJFA 1ZQ9A 4IBEA 5IWAM 4HL4A 5LMNM 1N32M 3CTWB 1N33M 2EA0A 3HJSA 1Q39A 3RGPA 4LFAM 3U6OA 1DGHA 5EJCA 4X62M 4DV3M 3GRYA 2EO2A 1X37A 3GLIA 3U6LA 4PD2A 4XGIA 2C96A 5KPZA 5KPTA 1L1ZA 3L28A 4FVMA 2M5ZA 4LJ5A 1EE8A 3GRRA 2OQ4A 4LF7M 3VDUA 1S3SA 7CATA 1NVMA 1W5TA 2XFTA 3GLHB 3ZCBB 4NOOB 1VDDA 5F3WA 3KXEC 3KOXE 4IBIA 4I5SA 3GLGB 1D2NA 4MH0E 4PDGA 1QQWA 1QAOA 4W5WA 5LMUM 4DUZM 2JA2A 4AKHA 1KYIA 1GLNA 2YFQA 3KP1E 3KS4A 3SAUA 4X64M 2QP9X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC M;  1Z5A A;  4B3M M;  4LF4 M;  1NNJ A;  3W0F A;  5ITX E;  1L2D A;  2F5O A;  4DV7 M;  2F5S A;  1Z5B A;  1XMO M;  3J80 S;  3U6Q A;  4GKJ M;  1HNX M;  4JI4 M;  1R2Z A;  4OX9 M;  4AQY M;  3SAR A;  1K3W A;  4DV1 M;  4NXN M;  4LF6 M;  4LF8 M;  3GQ5 A;  1L2C A;  3TWM A;  5IT9 S;  4K0K M;  1PJI A;  1FJG M;  3J7A S;  4G4R A;  4NXM M;  2F5Q A;  2F5N A;  1Z59 A;  4DR7 M;  2F5P A;  4YHH M;  4DV4 M;  2OPF A;  1Q3B A;  1K3X A;  4LFC M;  3GPY A;  3DOA A;  4JI7 M;  3GO8 A;  4G4O A;  4X66 M;  1XNR M;  3VK7 A;  4JI5 M;  4ITQ A;  2Q2E B;  4JI3 M;  5A2Q S;  5ITU A;  3U6E A;  1Z5C A;  1HNW M;  4CIS A;  4JV5 M;  3A45 A;  4DUY M;  4DV2 M;  3A42 A;  3GPX A;  2ZM6 M;  1N34 M;  1KFV A;  4G4Q A;  1HR0 M;  4DR2 M;  2ZBK B;  3C58 A;  1Q3C A;  3U6S A;  4JI0 M;  1IBM M;  3TWK A;  1TDZ A;  4B3R M;  2UUB M;  3SAT A;  3SBJ A;  4PCZ A;  2E5L M;  4KHP M;  3JR4 A;  4DR4 M;  1N36 M;  4PDI A;  1MX0 A;  4B3S M;  4JI8 M;  4B3T M;  3GPP A;  5ITR A;  1J5E M;  3SAS A;  4DV6 M;  2XZF A;  5ITY A;  4YY3 M;  3SAU A;  4DR1 M;  2F4V M;  4G4N A;  5ITT A;  4X65 M;  1PJJ A;  1IBK M;  4DV0 M;  3SAW A;  4JI6 M;  3GP1 A;  3U6D A;  2HHH M;  1XNQ M;  3VK8 A;  5BR8 M;  1TDH A;  5IWA M;  3A46 A;  3U6M A;  4DR5 M;  4NRW A;  5LMN M;  1R2Y A;  4JYA M;  2UXD M;  1N32 M;  1N33 M;  2VQF M;  4NRV A;  4GKK M;  2EA0 A;  3J81 S;  1Q39 A;  2VQE M;  4LFA M;  1MU5 A;  3T1Y M;  3U6O A;  3GQ4 A;  5ITX A;  3GPU A;  4X62 M;  1L1T A;  4DV3 M;  1XMQ M;  1XC8 A;  3OTO M;  3T1H M;  1L2B A;  3U6L A;  4PD2 A;  1PM5 A;  3U6P A;  2UXB M;  1I94 M;  1L1Z A;  2UU9 M;  5ITQ A;  1EE8 A;  1IBL M;  2OQ4 A;  4LF7 M;  2UUA M;  4LF9 M;  3SAV A;  2UXC M;  4DR3 M;  4JI2 M;  3JAM S;  4JI1 M;  5FLX S;  4PDG A;  3TWL A;  2HKJ A;  4DR6 M;  3JR5 A;  5LMU M;  4MB7 A;  4DUZ M;  1K82 A;  1HNZ M;  4LF5 M;  2XZU A;  3U6C A;  3GQ3 A;  4LFB M;  4DV5 M;  4X64 M; 
#chains in the Genus database with same CATH topology
 3TQS A;  1Z5A A;  3VKG A;  3IHP A;  2O01 F;  1E9R A;  1C7Y A;  1Z5B A;  2Y0T A;  3DFZ A;  3GLI E;  1XMO M;  5C1B A;  1HT2 E;  2FOI C;  2H5X A;  4B08 A;  2ZAO A;  3HHZ A;  2R6F A;  3BXW A;  2JZ1 A;  3FTC A;  4Q7J A;  4OX9 M;  3LQR A;  1V92 A;  4REZ A;  3SAR A;  3A98 B;  3HZJ A;  3MJ5 A;  1TH4 A;  3J7B A;  2LNH C;  1L2C A;  3KP1 E;  1OJL A;  4IBF A;  4CIZ A;  3TWM A;  2R46 A;  1PJI A;  3Q8G A;  2Y21 A;  2X49 A;  1A5T A;  5EXS A;  3ZH9 B;  3J7A S;  4NXM M;  2F5Q A;  2C9C A;  2OOB A;  2BNK A;  4YHH M;  4DV4 M;  1Q3B A;  2HWJ A;  2JZ0 A;  1W5S A;  4KO8 A;  3K9O A;  2LH0 A;  1G3I A;  2R65 A;  4B7G A;  3K92 A;  1DV0 A;  3KP0 E;  4X66 M;  5IRE B;  1IXR C;  1OQY A;  3FUU A;  4LRT A;  2XH9 A;  3KSX A;  2Q2E B;  5EXP A;  4B7F A;  4LZZ A;  5DNY A;  1E32 A;  3U6E A;  2DXI A;  2DWZ B;  4JV5 M;  1IQP A;  4BBA A;  4DV2 M;  2WSE F;  3A42 A;  3EIH A;  5H37 D;  2DZN B;  2LTU A;  1WGN A;  2L2D A;  1IY1 A;  3KVW A;  2A5Y B;  5FSW A;  2R62 A;  3E9S A;  1T43 A;  4QNR A;  2CV1 A;  4OVZ B;  2BJW A;  3B74 A;  1TDZ A;  8CAT A;  1DO2 A;  3HHW A;  4G6Z A;  2D7G A;  2E5L M;  1N77 A;  3EIE A;  1N36 M;  4PDI A;  1MX0 A;  1GJT A;  2KXE A;  1IN5 A;  1ZAE A;  2J7O A;  3AOG A;  4R7G A;  4QOZ C;  4NC6 A;  4DV6 M;  2XZF A;  5ITY A;  3FTE A;  2L7H A;  1TH3 A;  1PJT A;  3M7G A;  3W0L B;  1BVS A;  1D0K A;  4CGY B;  3GLG E;  1TDH A;  3DA1 A;  3A46 A;  2VF8 A;  4DR5 M;  3ZQJ A;  1G71 A;  2N35 A;  1R2Y A;  2CV2 A;  4IIW A;  3FKE A;  4JYA M;  2QHO B;  3R9X B;  4NRV A;  3J81 S;  3B7Q A;  2EKK A;  2Z7J A;  4NL4 H;  3J27 B;  2Z3X A;  1IFY A;  1MU5 A;  2AHM A;  4IBC A;  4LGM A;  5BPV A;  2XEP A;  3CF6 E;  5ITX A;  3GPU A;  1XMQ M;  3VLF B;  1XC8 A;  2XFS A;  2ZAM A;  2CHV A;  3OTO M;  3T1H M;  2XLJ A;  1VEK A;  1PM5 A;  3F92 A;  5JI3 E;  4CJ6 A;  3UK6 A;  3U61 B;  1DGH B;  5L8R F;  2C5R A;  2R0I A;  3IG5 A;  3W68 A;  5ITQ A;  2UU9 M;  1G41 A;  2JP7 A;  2C99 A;  1OFI A;  2LBC A;  2GNO A;  4DR3 M;  3AL0 C;  4II7 A;  4MGI E;  3SMS A;  4IBJ A;  4LY6 A;  1NY6 A;  4GH9 A;  4GC5 A;  4MM3 B;  3TWL A;  2DAG A;  1LTM A;  3GRV A;  4D80 A;  3JR5 A;  3GLG A;  3HKP A;  2CUZ A;  4JXJ A;  2Z4R A;  4MB7 A;  1QDT A;  4OVZ A;  2XSZ A;  1HNZ M;  4LF5 M;  5FTK A;  4L8R C;  2QCU A;  2MR9 A;  3UGJ A;  1NJG A;  5E6J A;  2QBY A;  4Z8X A;  5ITX E;  1L2D A;  3WHL A;  4DV7 M;  2X4A A;  2LVA A;  2K47 A;  5DFL A;  1XWI A;  3J80 S;  3SMP A;  2HCB A;  1QZE A;  4JI4 M;  3HHX A;  1R2Z A;  5EQT A;  4IBG A;  2ZAN A;  1SXJ E;  4P16 A;  1NNU C;  4NXN M;  4DV1 M;  5IZ7 D;  4LF8 M;  2LHG A;  4S12 A;  3T6P A;  1G4A E;  1L8Q A;  4HEO A;  2O5R A;  2JY8 A;  1YUB A;  3KFU G;  3SHF A;  1FNN A;  2Z8Y M;  3I4Y A;  4G4R A;  2DWM A;  2OO9 A;  2ZTC A;  1Z59 A;  4ZPX A;  3R8F A;  3QAU A;  2F5P A;  2XSZ D;  1K3X A;  3AOE A;  1OFH A;  1WGL A;  2C98 A;  2DAI A;  3AOE C;  4LFC M;  3GPY A;  1N75 A;  3M0E A;  4B7H A;  4L4U A;  2G8L A;  3K2L A;  3GO8 A;  2QEN A;  2VII A;  4JI5 M;  2CE7 A;  3U5Z A;  4ITQ A;  2O25 A;  3KOY E;  1QAN A;  2RKO A;  5ITU A;  1NO1 A;  2EUC A;  3BOS A;  1Z5C A;  2KEB A;  4CIS A;  1HNW M;  4M9S A;  2J5Y A;  4GRI A;  1GVN A;  2DKL A;  3A45 A;  1C1K A;  3SHG B;  1IY2 A;  5KQ8 A;  3GPX A;  2ZM6 M;  1N34 M;  2C9O A;  4G4Q A;  5FTM A;  2LXE A;  3VDP A;  3LVV A;  1HR0 M;  2ZBK B;  4L16 A;  3RFW A;  3VKH A;  1SXJ A;  2RGO A;  4HLQ A;  2K6B A;  2DHR A;  2R4E A;  2XGN A;  3KW6 A;  4LZJ A;  2CHG A;  3KS8 A;  3SC3 A;  2QBY B;  3FUT A;  4TUW A;  3FRI A;  3LCU A;  1NY5 A;  3K9P A;  3AFH A;  4B3T M;  3L2A A;  4BLC A;  4NSO B;  3CF0 A;  3KS4 A;  4KLN A;  1VDL A;  4I81 A;  3MMP A;  1J5E M;  2P5T A;  1DGB A;  1QAQ A;  4PT5 A;  1IBK M;  4X65 M;  2F4V M;  1Z6T A;  4DV0 M;  2KZU A;  1GO5 A;  3GP1 A;  2FS1 A;  3U6D A;  1XNQ M;  1HJP A;  4F1I A;  3FUW A;  3V76 A;  1IXS B;  4NRW A;  2UXD M;  1YE9 A;  2VQF M;  1IN4 A;  4L15 A;  4Z6Y A;  1JB0 F;  2VQE M;  1ZMV A;  3B7Z A;  2YR0 A;  3IG8 A;  4MGZ E;  3T1Y M;  1I4W A;  3NBX X;  2DAE A;  2KRK A;  3SFZ A;  3GQ4 A;  4LG2 A;  4G3O A;  4FD2 A;  4GHA A;  1G8P A;  1L2B A;  1WIV A;  4OU7 A;  3U6P A;  4GIP A;  4LJA A;  1ZV1 A;  2QSF X;  1OKS A;  2QQ8 A;  1I94 M;  1GKI A;  1QVR A;  2DZO B;  4FCT A;  4AG6 A;  1IN6 A;  3CGW A;  1SXJ C;  1J09 A;  2DEN A;  1DO0 A;  4I4L A;  3SYL A;  3TL4 X;  3TE6 A;  3H4M A;  3LCV B;  2UUA M;  4R3D A;  3WHK A;  3U60 A;  2MRO B;  3J2P B;  1YSY A;  4JI2 M;  3T15 A;  2FNA A;  3JAM S;  4JI1 M;  1TH2 A;  2D7H A;  3DZD A;  3GLH A;  5FLX S;  2KHH A;  5DYI A;  3U61 A;  3FTD A;  1TGU A;  2CRU A;  1AUA A;  3HGI A;  1KSF X;  1XXH A;  4WP2 A;  3PXG A;  1K82 A;  2XZU A;  5KPR A;  3GQ3 A;  3SAW A;  4LFB M;  2RRU A;  2W82 A;  2VF7 A;  2JXN A;  5FTL A;  5JI2 E;  2V6Z M;  1J7K A;  4B3M M;  2RGH A;  1N78 A;  2F5O A;  1IM2 A;  3HWS A;  4RF1 A;  3MHV C;  4AW4 A;  1WXQ A;  2KRU A;  3VFD A;  1P3Q Q;  2D7E A;  4FWG A;  3U6Q A;  1HNX M;  1GL7 A;  3B89 A;  1IXS A;  3C3D A;  1H6U A;  1NSF A;  1QDR A;  1K3W A;  3GRU A;  3Q8X A;  4LF6 M;  3LMM A;  4MGY E;  2LVQ D;  3GQ5 A;  3LW5 F;  4MGK E;  4IBB A;  1XHB A;  4K0K M;  1EFU B;  2LWX A;  1OTR A;  2BWE A;  4WUR A;  3GLH E;  3THG A;  4DBG B;  1FJG M;  1JR3 E;  3CF2 A;  3RGS A;  2DHY A;  3HU3 A;  4LJ9 A;  2OPF A;  3E4R A;  3HU2 A;  4JI7 M;  3FUV A;  1XXH E;  2DAK A;  1VQ1 A;  2X8A A;  4FCW A;  1F4I A;  3KSJ A;  2JY6 B;  2G3Q A;  4MGH A;  1TR8 A;  1NV8 A;  4RF0 A;  3UJN A;  3VK7 A;  1HT1 E;  1T6O A;  1NJF A;  1T3T A;  1SXJ D;  1E94 E;  1HQC A;  1QZM A;  2QZ4 A;  2YNM D;  2XF3 A;  1OIZ A;  4L78 A;  2L09 A;  2DWN A;  2R18 A;  1ZMU A;  3FD9 A;  3LQQ A;  2K0B X;  3VK8 A;  2QNJ A;  4QNM A;  2CP8 A;  1D0M A;  3UZU A;  4DR2 M;  3C3E A;  1VEJ A;  3MK6 A;  2KA6 B;  1Q3C A;  1VEG A;  3U6S A;  1EIJ A;  3U5Z B;  1IBM M;  1NHW C;  1G59 A;  4GIT A;  2UUB M;  1WJ7 A;  3L29 A;  3SAT A;  2KNZ A;  3SBJ A;  1IN8 A;  1DGF A;  3FYD A;  4KHP M;  1AIP C;  1IN7 A;  1JR3 D;  1JR3 A;  4M0W A;  4B3S M;  4NSR A;  4JI8 M;  3I01 M;  5ITR A;  3NWL A;  2R45 A;  4AG5 A;  2CHQ A;  3K1J A;  1V33 A;  3M6A A;  2G5G X;  3FE3 A;  3SAS A;  3GLF B;  3W67 A;  2HAK A;  3HX3 A;  5ITT A;  3IEC A;  1PJJ A;  2YQZ A;  2HHH M;  2V1C A;  3RE8 A;  5BR8 M;  1QUT A;  2BJV A;  2LVN C;  3U6M A;  3PNY A;  4AKG A;  3D8B A;  3U60 B;  1JQJ C;  3PFI A;  3KDS E;  4D81 A;  2KDL A;  4GKK M;  3QYE A;  2FFJ A;  2WZJ A;  1V34 A;  3PNV A;  2EJS A;  5KQD A;  1L1T A;  2MJ5 B;  1GL6 A;  2M60 A;  2FH0 A;  4P17 A;  4LGY A;  2JNH A;  2UXB M;  2WSC F;  1SG9 A;  1GAB A;  2LHC A;  2L4E A;  1Y8G A;  2WSF F;  5C18 A;  3HHY A;  4AZF A;  1UM8 A;  1IBL M;  1GJS A;  4GEW A;  4QOS A;  4IBD A;  4LF9 M;  5KO3 A;  4I8O A;  4LCB A;  3SAV A;  5GKN A;  2UXC M;  4FWD A;  5EXT A;  3I4V A;  2JUJ A;  2BWB A;  1RU3 A;  4GC9 A;  4LRS A;  4XK8 F;  3KOW E;  4LJ7 A;  4IBK A;  1DGG A;  2L7I A;  2HKJ A;  5EP3 A;  4WW0 A;  4DR6 M;  3GLI B;  3ZC7 B;  2I7P A;  3UMM A;  2CWB A;  3U6C A;  3AKZ A;  2R44 A;  4QHT A;  4DV5 M;  2Y0Q A;  3C9P A;  3ILK A;  3QYB A;  2KNA A;  4RNA A;  1NNJ A;  3W0F A;  2UUC M;  4LF4 M;  2H1R A;  5DYG A;  2F5S A;  1TF0 B;  2Y20 A;  3GLF E;  4XBO A;  2DI0 A;  3FTF A;  2B3T A;  2DNA A;  1SXJ B;  3I51 A;  3I04 M;  5EP4 A;  4GKJ M;  2HL7 A;  2R4J A;  3E21 A;  1OAO C;  1PRB A;  2JWS A;  1R6B X;  4AQY M;  2I7N A;  3T38 A;  4AI6 A;  4CHT B;  4D82 A;  2KZS A;  4LJ6 A;  4Y28 F;  5IT9 S;  1ORY B;  4JN6 A;  2KW0 A;  1ZMW A;  5EP2 A;  1UFZ A;  3HJQ A;  4EIW A;  2L6O A;  3L27 A;  2F5N A;  4BB9 A;  3D8L A;  4LJ4 A;  1D0L A;  2EKF A;  3FYC A;  2DWL A;  4DR7 M;  2KNV A;  5FTJ A;  1E9S A;  2CFO A;  1MN3 A;  1NHG C;  3DOA A;  3HU1 A;  2DVW B;  5E26 A;  3KOZ E;  3LVW A;  4M0D A;  2QPA A;  4F2L A;  1IY0 A;  4G4O A;  1R7R A;  4M9Z A;  1XNR M;  4FCV A;  2CV0 A;  2ERC A;  2Z4S A;  3E46 A;  4KOD A;  5EXX A;  3L26 A;  3HJ8 A;  4JI3 M;  2FE8 A;  2L4F A;  1QYR A;  4KT0 F;  5A2Q S;  2DAM A;  3GLF A;  3K8Z A;  2V1U A;  4DUY M;  2MH8 A;  2J7N A;  3PVS A;  1KFV A;  3FUX A;  1IXZ A;  1QAM A;  1OAI A;  3HY5 A;  4QHS A;  3C58 A;  3SYK A;  4IJE A;  4JI0 M;  3TPZ A;  3TWK A;  4B3R M;  2VDB B;  4GMQ A;  4PCZ A;  2ZTD A;  2APL A;  4A3V B;  3JR4 A;  4FWH A;  4DR4 M;  3B9P A;  1OIP A;  3NBI A;  4GHL A;  2LVO C;  4M9X A;  3L25 A;  4FW9 A;  4OW0 A;  3AV0 A;  3GPP A;  3AJI B;  2CEA A;  1PJQ A;  4LJ8 A;  5FTN A;  4ANR A;  4RKU F;  1LV7 A;  3QWL A;  2NQ8 C;  1R5L A;  1Q02 A;  4YY3 M;  4DR1 M;  3SAU A;  4AKI A;  4G4N A;  1HQY E;  1YLA A;  5EP1 A;  4JI6 M;  4IJF A;  1ZQ9 A;  4IBE A;  5IWA M;  1R4G A;  3BBZ A;  3FRH A;  4HL4 A;  5LMN M;  4R71 A;  3CTW B;  1N32 M;  1N33 M;  2EA0 A;  3HJS A;  1Q39 A;  3RGP A;  4LFA M;  3B7N A;  1NV9 A;  3U6O A;  1DGH A;  5EJC A;  4X62 M;  4DV3 M;  3GRY A;  2EO2 A;  1QUS A;  2MGW A;  1TTE A;  1X37 A;  3GLI A;  1XB2 B;  3U6L A;  4PD2 A;  1CUK A;  4XGI A;  2C96 A;  5KPZ A;  2DZL A;  2JY5 A;  5KPT A;  1L1Z A;  3L28 A;  1PJS A;  2OOA A;  3H4J A;  4FVM A;  2M5Z A;  4LJ5 A;  1EE8 A;  2GQF A;  3GRR A;  2OQ4 A;  4LF7 M;  3VDU A;  1S3S A;  7CAT A;  1NVM A;  1WHC A;  1VG5 A;  1W5T A;  2XFT A;  3GLH B;  3ZCB B;  4NOO B;  1VDD A;  5F3W A;  3KXE C;  3KOX E;  1PGY A;  4UN2 B;  4IBI A;  4I5S A;  3GLG B;  1D2N A;  4MH0 E;  4PDG A;  1WR1 B;  2K9D A;  1QQW A;  1QAO A;  4W5W A;  5LMU M;  4L6V 6;  4DUZ M;  2JA2 A;  4AKH A;  1KYI A;  2JY7 A;  1GLN A;  1MJG M;  2YFQ A;  1XXH B;  2LVP C;  4X64 M;  2QP9 X; 
#chains in the Genus database with same CATH homology
 3TQS A;  1Z5A A;  3VKG A;  1E9R A;  1Z5B A;  2Y0T A;  3DFZ A;  1XMO M;  5C1B A;  1HT2 E;  2FOI C;  4B08 A;  2ZAO A;  3HHZ A;  3FTC A;  4OX9 M;  3LQR A;  4REZ A;  3SAR A;  3A98 B;  3MJ5 A;  1TH4 A;  3J7B A;  2LNH C;  1L2C A;  1OJL A;  4IBF A;  3TWM A;  2R46 A;  1PJI A;  2Y21 A;  2X49 A;  5EXS A;  3J7A S;  3ZH9 B;  4NXM M;  2F5Q A;  2C9C A;  2BNK A;  4YHH M;  4DV4 M;  1Q3B A;  1W5S A;  4KO8 A;  2LH0 A;  1G3I A;  2R65 A;  4B7G A;  3K92 A;  3KP0 E;  4X66 M;  5IRE B;  1IXR C;  3FUU A;  4LRT A;  2XH9 A;  3KSX A;  2Q2E B;  5EXP A;  4B7F A;  4LZZ A;  5DNY A;  1E32 A;  3U6E A;  2DXI A;  2DWZ B;  4JV5 M;  1IQP A;  4BBA A;  4DV2 M;  3A42 A;  3EIH A;  5H37 D;  2DZN B;  3KVW A;  1IY1 A;  2A5Y B;  5FSW A;  2R62 A;  3E9S A;  4QNR A;  2CV1 A;  4OVZ B;  2BJW A;  1TDZ A;  8CAT A;  1DO2 A;  3HHW A;  4G6Z A;  2D7G A;  2E5L M;  1N77 A;  3EIE A;  1N36 M;  4PDI A;  1MX0 A;  2KXE A;  1IN5 A;  1ZAE A;  2J7O A;  3AOG A;  4R7G A;  4QOZ C;  4DV6 M;  2XZF A;  5ITY A;  3FTE A;  2L7H A;  1TH3 A;  3M7G A;  3W0L B;  4CGY B;  3VK8 A;  1TDH A;  3DA1 A;  3A46 A;  4DR5 M;  1R2Y A;  4JYA M;  2CV2 A;  4IIW A;  3FKE A;  3R9X B;  4NRV A;  3J81 S;  2Z7J A;  2Z3X A;  4NL4 H;  3J27 B;  1MU5 A;  2AHM A;  4IBC A;  4LGM A;  5BPV A;  2XEP A;  3CF6 E;  5ITX A;  3GPU A;  1XMQ M;  3VLF B;  1XC8 A;  2XFS A;  2ZAM A;  2CHV A;  3OTO M;  3T1H M;  2XLJ A;  1PM5 A;  5JI3 E;  3UK6 A;  3U61 B;  1DGH B;  2C5R A;  3IG5 A;  2UU9 M;  5ITQ A;  1G41 A;  2C99 A;  1OFI A;  4DR3 M;  3AL0 C;  4II7 A;  4MGI E;  3SMS A;  4IBJ A;  4LY6 A;  1NY6 A;  4GH9 A;  4GC5 A;  4MM3 B;  3TWL A;  3GRV A;  4D80 A;  3JR5 A;  3GLG A;  3HKP A;  2CUZ A;  4JXJ A;  2Z4R A;  4MB7 A;  4OVZ A;  2XSZ A;  1HNZ M;  4LF5 M;  5FTK A;  4L8R C;  2QCU A;  3UGJ A;  1NJG A;  5E6J A;  2QBY A;  4Z8X A;  5ITX E;  1L2D A;  3WHL A;  4DV7 M;  2X4A A;  2K47 A;  1XWI A;  3J80 S;  3SMP A;  2HCB A;  4JI4 M;  3HHX A;  1R2Z A;  5EQT A;  4IBG A;  2ZAN A;  1SXJ E;  4P16 A;  1NNU C;  4NXN M;  4DV1 M;  5IZ7 D;  4LF8 M;  4S12 A;  1G4A E;  1L8Q A;  2O5R A;  1YUB A;  3KFU G;  3SHF A;  1FNN A;  3I4Y A;  4G4R A;  2DWM A;  4ZPX A;  3R8F A;  1Z59 A;  3QAU A;  2F5P A;  2XSZ D;  1K3X A;  3AOE A;  1OFH A;  4LFC M;  2C98 A;  3AOE C;  3GPY A;  1N75 A;  3M0E A;  4B7H A;  4L4U A;  2G8L A;  3K2L A;  3GO8 A;  2QEN A;  2VII A;  4JI5 M;  2CE7 A;  3U5Z A;  4ITQ A;  3KOY E;  1QAN A;  2RKO A;  5ITU A;  2EUC A;  3BOS A;  1Z5C A;  2KEB A;  4CIS A;  1HNW M;  4M9S A;  4GRI A;  1GVN A;  3A45 A;  1C1K A;  3SHG B;  1IY2 A;  5KQ8 A;  3GPX A;  2ZM6 M;  1N34 M;  2C9O A;  4G4Q A;  5FTM A;  2LXE A;  3VDP A;  3LVV A;  1HR0 M;  2ZBK B;  4L16 A;  3RFW A;  3VKH A;  1SXJ A;  2RGO A;  4HLQ A;  2DHR A;  2R4E A;  2XGN A;  3KW6 A;  4LZJ A;  2CHG A;  3KS8 A;  3SC3 A;  2QBY B;  3FUT A;  4TUW A;  1NY5 A;  3AFH A;  4B3T M;  3L2A A;  4BLC A;  4NSO B;  3CF0 A;  4KLN A;  4I81 A;  1J5E M;  2P5T A;  1DGB A;  1QAQ A;  4PT5 A;  1IBK M;  4X65 M;  2F4V M;  1Z6T A;  4DV0 M;  2KZU A;  3GP1 A;  3U6D A;  1XNQ M;  3FUW A;  2UXD M;  1IXS B;  4NRW A;  1YE9 A;  2VQF M;  1IN4 A;  4L15 A;  4Z6Y A;  2VQE M;  2YR0 A;  3IG8 A;  4MGZ E;  3T1Y M;  1I4W A;  2KRK A;  3SFZ A;  3GQ4 A;  4LG2 A;  4FD2 A;  4GHA A;  1G8P A;  1L2B A;  4OU7 A;  3U6P A;  4GIP A;  4LJA A;  1I94 M;  1GKI A;  1QVR A;  2DZO B;  4FCT A;  4AG6 A;  1IN6 A;  1SXJ C;  1J09 A;  3TL4 X;  1DO0 A;  4I4L A;  3SYL A;  3TE6 A;  3H4M A;  2UUA M;  4R3D A;  3WHK A;  3U60 A;  3J2P B;  1YSY A;  4JI2 M;  3T15 A;  2FNA A;  3JAM S;  4JI1 M;  1TH2 A;  2D7H A;  3DZD A;  3GLH A;  5FLX S;  5DYI A;  3U61 A;  3FTD A;  1TGU A;  3HGI A;  1KSF X;  1XXH A;  3PXG A;  1K82 A;  2XZU A;  5KPR A;  3GQ3 A;  3SAW A;  4LFB M;  2W82 A;  5FTL A;  4B3M M;  1N78 A;  5JI2 E;  2V6Z M;  1J7K A;  2RGH A;  2F5O A;  1IM2 A;  3HWS A;  4RF1 A;  3MHV C;  4AW4 A;  1WXQ A;  2KRU A;  3VFD A;  2D7E A;  3U6Q A;  4FWG A;  1HNX M;  1GL7 A;  1H6U A;  1NSF A;  1K3W A;  3GRU A;  3Q8X A;  4LF6 M;  3LMM A;  4MGY E;  3GQ5 A;  4MGK E;  4IBB A;  1XHB A;  4K0K M;  2LWX A;  4WUR A;  3THG A;  1FJG M;  3CF2 A;  3RGS A;  3HU3 A;  4LJ9 A;  2OPF A;  3E4R A;  3HU2 A;  4JI7 M;  3FUV A;  2X8A A;  4FCW A;  3KSJ A;  4MGH A;  3UJN A;  4RF0 A;  3VK7 A;  1HT1 E;  1NJF A;  1T3T A;  1SXJ D;  1E94 E;  1HQC A;  1QZM A;  2QZ4 A;  2YNM D;  2XF3 A;  4L78 A;  2L09 A;  2DWN A;  2R18 A;  3FD9 A;  3LQQ A;  4QNM A;  3UZU A;  4DR2 M;  3MK6 A;  2KA6 B;  1Q3C A;  3U6S A;  3U5Z B;  1IBM M;  1NHW C;  1G59 A;  4GIT A;  2UUB M;  3L29 A;  3SAT A;  3SBJ A;  1IN8 A;  1DGF A;  3FYD A;  4KHP M;  1IN7 A;  1JR3 D;  1JR3 A;  4M0W A;  4B3S M;  4NSR A;  4JI8 M;  5ITR A;  3NWL A;  2R45 A;  4AG5 A;  2CHQ A;  3K1J A;  3SAS A;  3M6A A;  2G5G X;  3GLF B;  1PJJ A;  5ITT A;  2YQZ A;  2HHH M;  2V1C A;  3RE8 A;  5BR8 M;  2BJV A;  3U6M A;  3PNY A;  4AKG A;  3D8B A;  3U60 B;  1JQJ C;  3PFI A;  3KDS E;  4D81 A;  4GKK M;  2FFJ A;  3PNV A;  5KQD A;  1L1T A;  1GL6 A;  2M60 A;  4LGY A;  2UXB M;  5C18 A;  3HHY A;  4AZF A;  1UM8 A;  1IBL M;  4QOS A;  4IBD A;  4LF9 M;  5KO3 A;  4I8O A;  4LCB A;  3SAV A;  5GKN A;  2UXC M;  4FWD A;  5EXT A;  3I4V A;  4GC9 A;  4LRS A;  3KOW E;  4LJ7 A;  4IBK A;  1DGG A;  2L7I A;  2HKJ A;  5EP3 A;  4WW0 A;  4DR6 M;  3GLI B;  3ZC7 B;  2I7P A;  3UMM A;  3U6C A;  3AKZ A;  4DV5 M;  4QHT A;  2Y0Q A;  4RNA A;  3ILK A;  2UUC M;  1NNJ A;  4LF4 M;  3W0F A;  2H1R A;  5DYG A;  2F5S A;  2Y20 A;  1XXH B;  4XBO A;  3FTF A;  4GKJ M;  1SXJ B;  3I51 A;  5EP4 A;  2HL7 A;  2R4J A;  1R6B X;  4AQY M;  2I7N A;  3T38 A;  4AI6 A;  4CHT B;  4D82 A;  2KZS A;  4LJ6 A;  5IT9 S;  1ORY B;  4JN6 A;  2KW0 A;  5EP2 A;  3HJQ A;  4EIW A;  2L6O A;  3L27 A;  2F5N A;  4BB9 A;  3D8L A;  4LJ4 A;  4DR7 M;  3FYC A;  2DWL A;  5FTJ A;  1E9S A;  2CFO A;  1NHG C;  3DOA A;  3HU1 A;  2DVW B;  5E26 A;  3KOZ E;  3LVW A;  4M0D A;  2QPA A;  1IY0 A;  4G4O A;  1R7R A;  4M9Z A;  1XNR M;  4FCV A;  2CV0 A;  2ERC A;  2Z4S A;  4KOD A;  5EXX A;  3L26 A;  3HJ8 A;  4JI3 M;  2FE8 A;  5A2Q S;  1QYR A;  3GLF A;  3K8Z A;  2V1U A;  4DUY M;  2J7N A;  3PVS A;  1KFV A;  3FUX A;  1IXZ A;  1QAM A;  4QHS A;  3C58 A;  3SYK A;  4IJE A;  4JI0 M;  3TPZ A;  3TWK A;  4B3R M;  4GMQ A;  4PCZ A;  4A3V B;  3JR4 A;  4FWH A;  4DR4 M;  3B9P A;  3NBI A;  4GHL A;  4M9X A;  3L25 A;  4FW9 A;  4OW0 A;  3AV0 A;  3GPP A;  3AJI B;  2CEA A;  4LJ8 A;  5FTN A;  1LV7 A;  3QWL A;  2NQ8 C;  4YY3 M;  4DR1 M;  4AKI A;  4G4N A;  1HQY E;  5EP1 A;  4JI6 M;  4IJF A;  1ZQ9 A;  4IBE A;  5IWA M;  4HL4 A;  5LMN M;  1N32 M;  3CTW B;  1N33 M;  2EA0 A;  3HJS A;  1Q39 A;  3RGP A;  4LFA M;  3U6O A;  1DGH A;  5EJC A;  4X62 M;  4DV3 M;  3GRY A;  2EO2 A;  1X37 A;  3GLI A;  3U6L A;  4PD2 A;  4XGI A;  2C96 A;  5KPZ A;  5KPT A;  1L1Z A;  3L28 A;  4FVM A;  2M5Z A;  4LJ5 A;  1EE8 A;  3GRR A;  2OQ4 A;  4LF7 M;  3VDU A;  1S3S A;  7CAT A;  1NVM A;  1W5T A;  2XFT A;  3GLH B;  3ZCB B;  4NOO B;  1VDD A;  5F3W A;  3KXE C;  3KOX E;  4IBI A;  4I5S A;  3GLG B;  1D2N A;  4MH0 E;  4PDG A;  1QQW A;  1QAO A;  4W5W A;  5LMU M;  4DUZ M;  2JA2 A;  4AKH A;  1KYI A;  1GLN A;  2YFQ A;  3KP1 E;  3KS4 A;  3SAU A;  4X64 M;  2QP9 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...