4GKKM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gkkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4gkkM02
1L2BA 4B3MM 3A46A 1K3WA 4JV5M 1R2ZA 1N32M 4LF7M 5IT9S 4JI4M 4PD2A 1PM5A 4GKKM 1PJJA 2EA0A 3JR5A 2Q2EB 3GQ4A 3J81S 1Z5CA 3VK8A 1Z5BA 4B3TM 3U6PA 1IBMM 3U6LA 3W0FA 4NRWA 4X66M 4PDIA 4DUZM 1HR0M 2UXDM 3A42A 4LFAM 1Q3BA 4JI6M 2ZBKB 4JI0M 5ITRA 1L1ZA 3SASA 4K0KM 4JI3M 4G4NA 3T1YM 2UU9M 5ITUA 3SAUA 2UXCM 3U6EA 4X62M 4DV5M 4LF8M 4LF5M 1XMQM 1FJGM 3GPUA 1MX0A 4JI2M 3C58A 1N34M 3TWKA 3OTOM 4MB7A 3T1HM 1HNZM 3DOAA 3GQ3A 4DV3M 5ITQA 4X65M 1N33M 2E5LM 4DV7M 2HKJA 1NNJA 2XZFA 5IWAM 1XC8A 4JI7M 3GP1A 1K3XA 4DV6M 2VQEM 2ZM6M 4KHPM 1KFVA 4AQYM 1HNXM 4PDGA 3SAVA 1L2CA 5ITTA 5LMUM 1Z59A 3U6QA 3J80S 3J7AS 1Q39A 4JI5M 1XNQM 4CISA 4JYAM 1MU5A 1R2YA 2F5QA 4DR7M 3JAMS 4G4QA 1PJIA 4ITQA 4DV0M 1Q3CA 1XNRM 3VK7A 4LF4M 2VQFM 4G4RA 3U6DA 2HHHM 4DR4M 1TDZA 4YY3M 4GKJM 2UUCM 3U6SA 1J5EM 2UUAM 1HNWM 4B3RM 4DUYM 3GQ5A 4NRVA 4DR5M 3SARA 1N36M 1IBLM 4G4OA 4JI1M 1XMOM 4DV4M 3SBJA 2F5OA 2UXBM 4DV1M 2UUBM 4JI8M 3SAWA 4OX9M 3A45A 1Z5AA 3GO8A 4NXMM 5LMNM 4B3SM 2OPFA 4DR6M 5FLXS 2OQ4A 4DV2M 2F4VM 5ITXA 4X64M 3U6MA 1IBKM 1TDHA 4LF9M 1EE8A 4LFBM 3GPYA 1I94M 2XZUA 5ITXE 4NXNM 3JR4A 2F5NA 4DR2M 3TWLA 1K82A 4DR3M 4LF6M 5BR8M 1L1TA 4YHHM 2F5SA 3U6CA 3GPPA 2F5PA 3GPXA 4LFCM 4PCZA 5A2QS 3TWMA 5ITYA 4DR1M 1L2DA 3SATA 3U6OA
chains in the Genus database with same CATH superfamily
4R71A 4B08A 3FTCA 5IZ7D 4B3MM 1VDLA 2KRUA 5F3WA 1K3WA 4JV5M 4LF7M 1NVMA 1TGUA 1XB2B 4LZZA 5IT9S 4JI4M 2V1UA 2KRKA 2L4FA 3FE3A 5KO3A 1PJJA 1DGHA 4NL4H 3K9OA 1GVNA 4WW0A 1R6BX 4IBDA 3E9SA 3VK8A 4MGZE 4B3TM 3GLGE 3UK6A 3U6LA 2LBCA 3A98B 3W0FA 3LCVB 2MROB 2Y0TA 2R0IA 4X66M 4PDIA 2DAGA 1VQ1A 1T6OA 4DUZM 4FW9A 3T38A 2UXDM 3PFIA 2D7EA 2XGNA 3KP1E 4M0DA 1EFUB 2I7PA 5FTKA 5ITRA 3KW6A 4LZJA 4Y28F 3SASA 2FNAA 2LWXA 3KOWE 3L29A 4K0KM 4IBJA 2ZAMA 2LNHC 3SYLA 5ITUA 4IBGA 3U6EA 2UXCM 1R7RA 3RGPA 3ZCBB 3U60A 1A5TA 1XHBA 2J7NA 1E32A 4ANRA 4JI2M 1OAIA 3C9PA 1NHGC 2CUZA 1N34M 2EUCA 3GQ3A 1DGBA 5FTLA 4DV3M 3MMPA 3FD9A 3FYDA 4X65M 4L8RC 2ZANA 1AIPC 1GKIA 2MGWA 3HHXA 3Q8GA 2HKJA 3HHZA 2Z3XA 3AL0C 5IWAM 1QYRA 4JI7M 4AKGA 5KQ8A 1ZV1A 2V6ZM 4FD2A 4DV6M 3PNYA 3V76A 1IXSB 2Z4RA 3FRHA 1SXJE 4FCWA 1QAMA 1XXHA 4CHTB 1HNXM 4I5SA 4Z6YA 4D82A 1SXJC 5FTNA 2MJ5B 1XXHE 1Z59A 3IG8A 4MGYE 3W0LB 2R45A 3SMPA 4HL4A 4LJ4A 3HU2A 4A3VB 1C1KA 1SXJB 2LVOC 4IJFA 3L25A 1V92A 4JYAM 3U61A 1OAOC 2QENA 3HHYA 2FS1A 1L8QA 3WHKA 1PJIA 1PRBA 1JR3D 3FUUA 4DV0M 4LRSA 2ZTCA 2LHCA 2WSFF 2VQFM 4LF4M 3I04M 3GLHA 1Y8GA 4CIZA 4GKJM 1OTRA 3ILKA 1QAOA 1J5EM 3GLHE 1BVSA 3HJSA 3ZH9B 3SMSA 1WXQA 5JI2E 4G4OA 3K8ZA 2XSZA 3IECA 4AZFA 3SBJA 3DZDA 1HT1E 1HJPA 3FUXA 4GC9A 4DV1M 1MJGM 2L6OA 3HY5A 4NXMM 3RFWA 2X49A 2L7IA 4B3SM 1H6UA 3WHLA 4KODA 4DR6M 5KPTA 1T3TA 2WSCF 2JY8A 3K92A 3HZJA 3E46A 2Z7JA 2CV1A 3J7BA 1EE8A 3AFHA 4GHLA 1IM2A 5E6JA 1QANA 1VEKA 3NWLA 4NXNM 4NSRA 4KT0F 1L1TA 4GIPA 4YHHM 2JWSA 3FRIA 2MR9A 5EJCA 1VDDA 1RU3A 4OVZB 2DHRA 5A2QS 1JB0F 5ITYA 2V1CA 1N75A 2C9OA 2KHHA 5DYGA 3L28A 1NO1A 1R4GA 4MGHA 2R62A 1E9RA 3AOEC 3HHWA 4GMQA 1VEGA 1R2ZA 2CEAA 1QUTA 2D7HA 3QAUA 4M9SA 1NSFA 4EIWA 1XWIA 3JR5A 2EA0A 4XGIA 1IXZA 4RF1A 3F92A 3J81S 3UMMA 3MK6A 4RNAA 1Z5BA 2JUJA 2OO9A 3B89A 4LJ7A 1ORYB 2C99A 1KSFX 2D7GA 2DAEA 3I4VA 3KOYE 2K0BX 4GITA 2I7NA 4QOSA 4R3DA 3SYKA 2B3TA 2L7HA 3A42A 1Q3BA 3CGWA 2Z4SA 3AKZA 3U5ZB 2QP9X 3B74A 4G4NA 4LJ9A 3K9PA 4LF8M 1DO2A 2RGHA 3AV0A 3CF6E 3KSXA 2WZJA 4GC5A 3GPUA 2O5RA 1GABA 2Y0QA 1NJGA 3C58A 3I01M 2XSZD 3VLFB 3GRYA 4AG5A 4OU7A 2FOIC 1QDRA 2R4JA 3DOAA 4JN6A 1HT2E 3GLGA 1N33M 3AOGA 2E5LM 1YSYA 1OIZA 1D0MA 1TR8A 3SHFA 2ZTDA 3FUWA 3LQRA 3LVWA 3GP1A 8CATA 2DZNB 2JNHA 2Y20A 5EP4A 1KFVA 3FTFA 1ZQ9A 4PDGA 2K9DA 1TH3A 3SAVA 2FFJA 1IN7A 1WIVA 4M9XA 1J09A 1OFHA 4I81A 3VDUA 2EKFA 1PJSA 3U6QA 1P3QQ 2Z8YM 1VEJA 3UGJA 1MU5A 2F5QA 4WP2A 1G41A 2XFSA 3JAMS 2BWBA 2YQZA 1W5SA 3KSJA 1XNRM 3HU1A 5DYIA 3CF0A 3VK7A 2HHHM 3U6DA 4IBKA 3DA1A 4B7FA 1TDZA 2BJWA 3J2PB 3E21A 3PVSA 5H37D 2R4EA 2K6BA 2K47A 4KLNA 1SXJA 3U6SA 1GL7A 4LCBA 3QYBA 4DUYM 2QBYB 3GQ5A 1OKSA 4MGKE 4DR5M 1N36M 3SARA 1CUKA 1G3IA 3GLFB 1XMOM 1Z6TA 3L26A 1I4WA 2X8AA 4IBEA 1WR1B 1D2NA 5EXTA 3LW5F 2EO2A 2C5RA 3BOSA 4OX9M 2DAMA 3GO8A 3SFZA 4AKIA 3PXGA 2KNAA 3GLIB 4BLCA 2JXNA 4LRTA 3LVVA 4IBCA 5FLXS 1VG5A 4IBIA 4DV2M 3GRUA 2F4VM 4RKUF 4R7GA 1V34A 2R44A 3E4RA 4CJ6A 2XZUA 4NSOB 3U60B 3TWLA 1NNUC 4LGYA 1UM8A 3CTWB 3U6CA 1J7KA 3W67A 3R9XB 4GRIA 1OIPA 4QHTA 2DWMA 1G71A 1HQCA 2DKLA 3QWLA 2DWLA 3TWMA 2XLJA 4BBAA 4DR1M 2JY7A 2NQ8C 4M0WA 3SATA 2R6FA 3B9PA 1DV0A 2XFTA 2LVQD 1IY1A 2KZUA 3BXWA 2CRUA 2CHQA 3I51A 3A46A 1QZEA 1N78A 3Q8XA 2LXEA 2O25A 1GJSA 4LJ5A 4WURA 2YR0A 2DAIA 1PM5A 2M60A 4OVZA 2Q2EB 3AJIB 4P17A 4QNMA 3GQ4A 1LTMA 1Z5CA 3B7QA 4GHAA 3U6PA 3D8LA 1W5TA 2VIIA 2XH9A 3FTDA 2DNAA 3KDSE 2VDBB 4BB9A 1OQYA 7CATA 2L4EA 1HR0M 3H4MA 4LFAM 2DVWB 3AOEA 1QZMA 3H4JA 2DAKA 4FCVA 1L1ZA 3FUVA 1T43A 1LV7A 2UU9M 2DZOB 3I4YA 2WSEF 1SXJD 2G8LA 2W82A 3KOXE 3SAUA 1F4IA 4X62M 4DBGB 4DV5M 4FWGA 1MX0A 3KP0E 5DNYA 4AI6A 3TWKA 3BBZA 1IN8A 3OTOM 1E94E 3T1HM 1EIJA 3TQSA 4LG2A 1KYIA 2EKKA 3VFDA 2R18A 3B7ZA 4OW0A 5EXSA 4DV7M 5EP2A 4B7GA 2OOAA 3HX3A 4IBBA 1YE9A 5KQDA 3M0EA 4AW4A 4I4LA 4L78A 4D81A 2G5GX 3FTEA 2FE8A 2RRUA 3LMMA 2CWBA 4MM3B 2Y21A 2YNMD 2QNJA 1IN5A 4GEWA 4Z8XA 2JZ1A 4GH9A 1D0KA 3B7NA 1ZMVA 3HJ8A 3J80S 1PJQA 1Q39A 1XNQM 4LJAA 3RE8A 1R2YA 2CE7A 4G4QA 2M5ZA 4ITQA 1Q3CA 1NY5A 4FVMA 4G4RA 1IN6A 1IY0A 2JA2A 3M7GA 1QUSA 4QNRA 4AG6A 1OFIA 2KZSA 5KPZA 1DGGA 2J7OA 2LTUA 4L16A 1ZMUA 2UUAM 2C96A 3KS8A 5FTJA 3D8BA 1S3SA 1WGNA 1IY2A 1NV9A 3EIHA 3FKEA 3KS4A 4NRVA 4P16A 3SC3A 1IBLM 4G3OA 4NC6A 4DV4M 2F5OA 2RGOA 5JI3E 2LVAA 5C1BA 4JI8M 1N77A 1QDTA 2DI0A 3CF2A 2QCUA 1V33A 3SAWA 1QAQA 1Z5AA 1Q02A 2DWNA 4G6ZA 3VDPA 2CFOA 4UN2B 2QBYA 2BJVA 1IXSA 2OPFA 4L15A 2CV0A 2L2DA 3VKHA 2C98A 2OQ4A 3GLFA 1WHCA 3KXEC 5ITXA 5EP1A 2VF7A 4X64M 3U6MA 4LF9M 4KO8A 4REZA 3GLFE 1I94M 4CGYB 5ITXE 2F5NA 2HAKA 4FWHA 4LF6M 5BR8M 2F5SA 3ZC7B 3GLIA 3K2LA 2QQ8A 2KW0A 3GPXA 1TF0B 3TL4X 3HWSA 1E9SA 3T15A 1DGHB 1MN3A 4PCZA 3GLIE 3GLGB 3MJ5A 2A5YB 1L2DA 5FTMA 4HEOA 3KOZE 3K1JA 3EIEA 1IQPA 1L2BA 2H1RA 3NBIA 4JXJA 1HQYE 2HWJA 1GLNA 1N32M 2ZAOA 2GNOA 4PD2A 5C18A 4IJEA 4GKKM 3C3EA 1SG9A 4QHSA 1ZMWA 4W5WA 2YFQA 2OOBA 2APLA 3FUTA 2KNVA 2KNZA 2EJSA 4LGMA 4QOZC 1YLAA 5KPRA 2J5YA 2QHOB 2BNKA 1IBMM 3R8FA 4B7HA 3IHPA 1G8PA 4RF0A 2XEPA 3HU3A 4NRWA 3VKGA 1QVRA 2JP7A 2VF8A 4MH0E 1C7YA 2JZ0A 5DFLA 2AHMA 4JI6M 2ZBKB 4JI0M 2O01F 2GQFA 1IN4A 4JI3M 3THGA 4II7A 2JY6B 4IBFA 4PT5A 3T1YM 3W68A 1OJLA 3MHVC 2DWZB 2HCBA 1X37A 2KEBA 2MH8A 2X4AA 1FJGM 2ERCA 4LF5M 1XMQM 2DXIA 5EXXA 1UFZA 1XXHB 3M6AA 4LY6A 4AKHA 1NV8A 1PGYA 2DENA 4F1IA 1HNZM 4MB7A 1D0LA 5ITQA 2KA6B 2JY5A 1DGFA 1NHWC 2LVNC 1NNJA 2XZFA 1R5LA 3L2AA 1XC8A 2R65A 1TTEA 1K3XA 1GJTA 1AUAA 4ZPXA 1FNNA 3U61B 2VQEM 2ZM6M 4KHPM 4AQYM 2HL7A 4LJ8A 2CHGA 4XK8F 1NJFA 1GL6A 1L2CA 5ITTA 1QQWA 5LMUM 4Q7JA 3GLHB 3C3DA 5EQTA 4NOOB 4IIWA 3PNVA 2QSFX 4S12A 1WJ7A 4F2LA 4JI5M 3J7AS 3RGSA 4CISA 4I8OA 3J27B 1NY6A 2BWEA 4DR7M 2L09A 5E26A 1G4AE 2QZ4A 3DFZA 2N35A 5EXPA 4DR4M 4M9ZA 1DO0A 4XBOA 2KDLA 5IREB 3HGIA 4YY3M 2LHGA 3U5ZA 2LH0A 4LJ6A 3L27A 2UUCM 1GO5A 3T6PA 3GRRA 1HNWM 2G3QA 4B3RM 2XF3A 4MGIE 3FYCA 3IG5A 1JQJC 3TE6A 3UJNA 4JI1M 4TUWA 2P5TA 2RKOA 2UXBM 4HLQA 3QYEA 3GRVA 2UUBM 2QPAA 4D80A 3HKPA 2DZLA 3ZQJA 3A45A 5LMNM 2H5XA 3UZUA 3TPZA 3LQQA 4FCTA 1PJTA 1G59A 1IXRC 4L4UA 1TH4A 1YUBA 5EP3A 3KFUG 2FH0A 1TH2A 5BPVA 1ZAEA 3HJQA 5L8RF 1TDHA 1IBKM 4FWDA 3GPYA 2DHYA 3LCUA 4LFBM 3SHGB 3JR4A 4DR2M 2CP8A 1K82A 2CV2A 4DR3M 3KVWA 3NBXX 4L6V6 3GPPA 2CHVA 2F5PA 1JR3A 5GKNA 2C9CA 4LFCM 2R46A 5FSWA 1WGLA 2LVPC 1IFYA 1JR3E 2KXEA 3U6OA
chains in the Genus database with same CATH topology
4B08A 3FTCA 5IZ7D 4B3MM 2KRUA 5F3WA 1K3WA 4JV5M 4LF7M 1NVMA 1TGUA 4LZZA 5IT9S 4JI4M 2V1UA 2KRKA 1PJJA 5KO3A 1DGHA 4NL4H 1GVNA 4WW0A 1R6BX 4IBDA 3E9SA 3VK8A 4MGZE 4B3TM 3UK6A 3U6LA 3A98B 3W0FA 2Y0TA 4X66M 4PDIA 4DUZM 4FW9A 3T38A 2UXDM 3PFIA 2D7EA 2XGNA 3KP1E 4M0DA 2I7PA 5FTKA 5ITRA 3KW6A 4LZJA 3SASA 4K0KM 2FNAA 2LWXA 3KOWE 3L29A 4IBJA 2ZAMA 2LNHC 3SYLA 5ITUA 4IBGA 3U6EA 2UXCM 1R7RA 3RGPA 3ZCBB 3U60A 1XHBA 2J7NA 1E32A 4JI2M 1NHGC 2CUZA 1N34M 2EUCA 3GQ3A 1DGBA 5FTLA 4DV3M 4X65M 3FD9A 3FYDA 4L8RC 2ZANA 1GKIA 3HHXA 3HHZA 2HKJA 2Z3XA 3AL0C 4AKGA 5IWAM 1QYRA 4JI7M 5KQ8A 2V6ZM 4FD2A 4DV6M 3PNYA 1IXSB 2Z4RA 1SXJE 4FCWA 1QAMA 1XXHA 4CHTB 1HNXM 4I5SA 4Z6YA 4D82A 1SXJC 5FTNA 1Z59A 3IG8A 4MGYE 3W0LB 2R45A 3SMPA 4HL4A 4LJ4A 3HU2A 4A3VB 1C1KA 1SXJB 4IJFA 3L25A 4JYAM 3U61A 2QENA 3HHYA 1L8QA 3WHKA 1PJIA 1JR3D 3FUUA 4DV0M 4LRSA 4LF4M 2VQFM 3GLHA 4GKJM 3ILKA 1QAOA 1J5EM 3HJSA 3ZH9B 3SMSA 1WXQA 5JI2E 4G4OA 3K8ZA 2XSZA 4AZFA 3SBJA 3DZDA 1HT1E 3FUXA 4GC9A 4DV1M 2L6OA 4NXMM 3RFWA 2X49A 2L7IA 4B3SM 1H6UA 3WHLA 4KODA 4DR6M 5KPTA 1T3TA 3K92A 2Z7JA 2CV1A 3J7BA 1EE8A 3AFHA 4GHLA 1IM2A 5E6JA 1QANA 4NXNM 3NWLA 4NSRA 1L1TA 4GIPA 4YHHM 5EJCA 1VDDA 4OVZB 2DHRA 5A2QS 5ITYA 2V1CA 1N75A 2C9OA 5DYGA 3L28A 4MGHA 2R62A 1E9RA 3AOEC 3HHWA 4GMQA 1R2ZA 2CEAA 2D7HA 3QAUA 4M9SA 1NSFA 4EIWA 1XWIA 3JR5A 2EA0A 4XGIA 1IXZA 4RF1A 3J81S 3UMMA 3MK6A 4RNAA 1Z5BA 4LJ7A 1ORYB 2C99A 1KSFX 2D7GA 3I4VA 4GITA 3KOYE 4QOSA 4R3DA 2I7NA 3SYKA 3SHFA 2L7HA 3A42A 1Q3BA 3AKZA 2Z4SA 3U5ZB 2QP9X 4G4NA 4LJ9A 4LF8M 1DO2A 2RGHA 3AV0A 3CF6E 3KSXA 4GC5A 3GPUA 2O5RA 2Y0QA 1NJGA 3C58A 3VLFB 2XSZD 3GRYA 4AG5A 4OU7A 2FOIC 3DOAA 2R4JA 4JN6A 1N33M 1HT2E 3GLGA 3AOGA 2E5LM 1YSYA 3FUWA 3LQRA 3LVWA 3GP1A 8CATA 2DZNB 2Y20A 5EP4A 1KFVA 3FTFA 1ZQ9A 4PDGA 3SAVA 1TH3A 2FFJA 1IN7A 4M9XA 1J09A 1OFHA 4I81A 3VDUA 3U6QA 3UGJA 1MU5A 2F5QA 1G41A 2XFSA 3JAMS 2YQZA 1W5SA 3KSJA 1XNRM 3HU1A 5DYIA 3CF0A 3VK7A 2HHHM 3U6DA 4IBKA 3DA1A 4B7FA 1TDZA 2BJWA 3J2PB 3PVSA 5H37D 2R4EA 4KLNA 2K47A 1SXJA 3U6SA 1GL7A 4LCBA 4DUYM 2QBYB 3GQ5A 4MGKE 4DR5M 1N36M 3SARA 1G3IA 3GLFB 1XMOM 1Z6TA 3L26A 1I4WA 2X8AA 4IBEA 1D2NA 5EXTA 2EO2A 2C5RA 3BOSA 4OX9M 3GO8A 3SFZA 4AKIA 3PXGA 3GLIB 4BLCA 4LRTA 3LVVA 4IBCA 5FLXS 4IBIA 4DV2M 3GRUA 2F4VM 4R7GA 3E4RA 2XZUA 4NSOB 3U60B 3TWLA 1NNUC 4LGYA 1UM8A 3CTWB 3U6CA 1J7KA 3R9XB 4GRIA 4QHTA 2DWMA 1HQCA 3QWLA 2DWLA 3TWMA 2XLJA 4BBAA 4DR1M 4M0WA 2NQ8C 3SATA 3B9PA 2XFTA 1N78A 1IY1A 2KZUA 3I51A 3A46A 2CHQA 3Q8XA 2LXEA 4LJ5A 4WURA 2YR0A 1PM5A 2M60A 4OVZA 2Q2EB 3AJIB 4QNMA 3GQ4A 1Z5CA 4GHAA 3U6PA 3D8LA 1W5TA 2VIIA 2XH9A 3FTDA 3KDSE 4BB9A 7CATA 1HR0M 3H4MA 4LFAM 2DVWB 3AOEA 1QZMA 4FCVA 1L1ZA 3FUVA 1LV7A 2UU9M 2DZOB 3I4YA 3SAUA 1SXJD 2G8LA 2W82A 3KOXE 4X62M 4DV5M 4FWGA 1MX0A 3KP0E 5DNYA 4AI6A 3TWKA 1IN8A 3OTOM 1E94E 3T1HM 3TQSA 4LG2A 1KYIA 3VFDA 2R18A 4OW0A 4DV7M 5EXSA 5EP2A 4B7GA 4IBBA 1YE9A 5KQDA 3M0EA 4AW4A 4I4LA 4L78A 4D81A 2G5GX 3FTEA 2FE8A 3LMMA 4MM3B 2Y21A 2YNMD 1IN5A 4Z8XA 4GH9A 3HJ8A 3J80S 1Q39A 1XNQM 4LJAA 3RE8A 1R2YA 2CE7A 4G4QA 2M5ZA 4ITQA 1Q3CA 1NY5A 4FVMA 4G4RA 1IN6A 1IY0A 2JA2A 3M7GA 4QNRA 4AG6A 1OFIA 2KZSA 5KPZA 1DGGA 2J7OA 4L16A 2UUAM 2C96A 3KS8A 5FTJA 3D8BA 1S3SA 1IY2A 3EIHA 3FKEA 4NRVA 3KS4A 4P16A 3SC3A 1IBLM 4DV4M 2F5OA 2RGOA 5JI3E 5C1BA 4JI8M 1N77A 3CF2A 2QCUA 3SAWA 1QAQA 1Z5AA 2DWNA 4G6ZA 3VDPA 2CFOA 2QBYA 2BJVA 2OPFA 3VKHA 4L15A 2CV0A 2C98A 2OQ4A 3GLFA 3KXEC 5ITXA 5EP1A 4X64M 3U6MA 4LF9M 4KO8A 4REZA 1I94M 4CGYB 5ITXE 2F5NA 4FWHA 4LF6M 5BR8M 2F5SA 3ZC7B 3GLIA 3K2LA 2KW0A 3GPXA 3TL4X 3HWSA 1E9SA 3T15A 1DGHB 4PCZA 3GLGB 3MJ5A 2A5YB 1L2DA 5FTMA 3KOZE 3K1JA 3EIEA 1IQPA 1L2BA 2H1RA 3NBIA 4JXJA 1HQYE 1GLNA 1N32M 2ZAOA 4PD2A 5C18A 4IJEA 4GKKM 4QHSA 4W5WA 2YFQA 3FUTA 4LGMA 4QOZC 5KPRA 1IBMM 2BNKA 3R8FA 4B7HA 4RF0A 1G8PA 4NRWA 2XEPA 3HU3A 3VKGA 1QVRA 4MH0E 2AHMA 4JI6M 2ZBKB 4JI0M 4JI3M 1IN4A 3THGA 4II7A 4IBFA 4PT5A 3T1YM 1OJLA 3MHVC 2DWZB 2HCBA 1X37A 2KEBA 2X4AA 1FJGM 2ERCA 4LF5M 1XMQM 2DXIA 5EXXA 3M6AA 1XXHB 4AKHA 4LY6A 1HNZM 4MB7A 5ITQA 2KA6B 1DGFA 1NHWC 1NNJA 2XZFA 1XC8A 3L2AA 2R65A 1K3XA 4ZPXA 1FNNA 3U61B 2VQEM 2ZM6M 4KHPM 4AQYM 2HL7A 4LJ8A 2CHGA 1NJFA 1GL6A 1L2CA 5ITTA 1QQWA 5LMUM 3GLHB 5EQTA 4NOOB 4IIWA 3PNVA 4S12A 4JI5M 3J7AS 3RGSA 4CISA 4I8OA 3J27B 1NY6A 4DR7M 2L09A 5E26A 1G4AE 2QZ4A 3DFZA 5EXPA 4DR4M 4M9ZA 1DO0A 4XBOA 5IREB 3HGIA 4YY3M 3U5ZA 2LH0A 4LJ6A 3L27A 2UUCM 3GRRA 1HNWM 4B3RM 2XF3A 4MGIE 3FYCA 3IG5A 1JQJC 3TE6A 3UJNA 4JI1M 4TUWA 2P5TA 2RKOA 2UXBM 4HLQA 3GRVA 2UUBM 2QPAA 4D80A 3HKPA 3A45A 5LMNM 3UZUA 3TPZA 3LQQA 4FCTA 1G59A 1IXRC 4L4UA 1TH4A 1YUBA 5EP3A 3KFUG 5BPVA 1TH2A 1ZAEA 3HJQA 1IBKM 1TDHA 4FWDA 3GPYA 4LFBM 3SHGB 3JR4A 4DR2M 1K82A 2CV2A 4DR3M 3KVWA 3GPPA 2CHVA 2F5PA 1JR3A 5GKNA 2C9CA 4LFCM 2R46A 5FSWA 2KXEA 3U6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2B A;  4B3M M;  3A46 A;  1K3W A;  4JV5 M;  1R2Z A;  1N32 M;  4LF7 M;  5IT9 S;  4JI4 M;  4PD2 A;  1PM5 A;  4GKK M;  1PJJ A;  2EA0 A;  3JR5 A;  2Q2E B;  3GQ4 A;  3J81 S;  1Z5C A;  3VK8 A;  1Z5B A;  4B3T M;  3U6P A;  1IBM M;  3U6L A;  3W0F A;  4NRW A;  4X66 M;  4PDI A;  4DUZ M;  1HR0 M;  2UXD M;  3A42 A;  4LFA M;  1Q3B A;  4JI6 M;  2ZBK B;  4JI0 M;  5ITR A;  1L1Z A;  3SAS A;  4K0K M;  4JI3 M;  4G4N A;  3T1Y M;  2UU9 M;  5ITU A;  3SAU A;  2UXC M;  3U6E A;  4X62 M;  4DV5 M;  4LF8 M;  4LF5 M;  1XMQ M;  1FJG M;  3GPU A;  1MX0 A;  4JI2 M;  3C58 A;  1N34 M;  3TWK A;  3OTO M;  4MB7 A;  3T1H M;  1HNZ M;  3DOA A;  3GQ3 A;  4DV3 M;  5ITQ A;  4X65 M;  1N33 M;  2E5L M;  4DV7 M;  2HKJ A;  1NNJ A;  2XZF A;  5IWA M;  1XC8 A;  4JI7 M;  3GP1 A;  1K3X A;  4DV6 M;  2VQE M;  2ZM6 M;  4KHP M;  1KFV A;  4AQY M;  1HNX M;  4PDG A;  3SAV A;  1L2C A;  5ITT A;  5LMU M;  1Z59 A;  3U6Q A;  3J80 S;  3J7A S;  1Q39 A;  4JI5 M;  1XNQ M;  4CIS A;  4JYA M;  1MU5 A;  1R2Y A;  2F5Q A;  4DR7 M;  3JAM S;  4G4Q A;  1PJI A;  4ITQ A;  4DV0 M;  1Q3C A;  1XNR M;  3VK7 A;  4LF4 M;  2VQF M;  4G4R A;  3U6D A;  2HHH M;  4DR4 M;  1TDZ A;  4YY3 M;  4GKJ M;  2UUC M;  3U6S A;  1J5E M;  2UUA M;  1HNW M;  4B3R M;  4DUY M;  3GQ5 A;  4NRV A;  4DR5 M;  3SAR A;  1N36 M;  1IBL M;  4G4O A;  4JI1 M;  1XMO M;  4DV4 M;  3SBJ A;  2F5O A;  2UXB M;  4DV1 M;  2UUB M;  4JI8 M;  3SAW A;  4OX9 M;  3A45 A;  1Z5A A;  3GO8 A;  4NXM M;  5LMN M;  4B3S M;  2OPF A;  4DR6 M;  5FLX S;  2OQ4 A;  4DV2 M;  2F4V M;  5ITX A;  4X64 M;  3U6M A;  1IBK M;  1TDH A;  4LF9 M;  1EE8 A;  4LFB M;  3GPY A;  1I94 M;  2XZU A;  5ITX E;  4NXN M;  3JR4 A;  2F5N A;  4DR2 M;  3TWL A;  1K82 A;  4DR3 M;  4LF6 M;  5BR8 M;  1L1T A;  4YHH M;  2F5S A;  3U6C A;  3GPP A;  2F5P A;  3GPX A;  4LFC M;  4PCZ A;  5A2Q S;  3TWM A;  5ITY A;  4DR1 M;  1L2D A;  3SAT A;  3U6O A; 
#chains in the Genus database with same CATH topology
 4R71 A;  4B08 A;  3FTC A;  5IZ7 D;  4B3M M;  1VDL A;  2KRU A;  5F3W A;  1K3W A;  4JV5 M;  4LF7 M;  1NVM A;  1TGU A;  1XB2 B;  4LZZ A;  5IT9 S;  4JI4 M;  2V1U A;  2KRK A;  2L4F A;  3FE3 A;  5KO3 A;  1PJJ A;  1DGH A;  4NL4 H;  3K9O A;  1GVN A;  4WW0 A;  1R6B X;  4IBD A;  3E9S A;  3VK8 A;  4MGZ E;  4B3T M;  3GLG E;  3UK6 A;  3U6L A;  2LBC A;  3A98 B;  3W0F A;  3LCV B;  2MRO B;  2Y0T A;  2R0I A;  4X66 M;  4PDI A;  2DAG A;  1VQ1 A;  1T6O A;  4DUZ M;  4FW9 A;  3T38 A;  2UXD M;  3PFI A;  2D7E A;  2XGN A;  3KP1 E;  4M0D A;  1EFU B;  2I7P A;  5FTK A;  5ITR A;  3KW6 A;  4LZJ A;  4Y28 F;  3SAS A;  2FNA A;  2LWX A;  3KOW E;  3L29 A;  4K0K M;  4IBJ A;  2ZAM A;  2LNH C;  3SYL A;  5ITU A;  4IBG A;  3U6E A;  2UXC M;  1R7R A;  3RGP A;  3ZCB B;  3U60 A;  1A5T A;  1XHB A;  2J7N A;  1E32 A;  4ANR A;  4JI2 M;  1OAI A;  3C9P A;  1NHG C;  2CUZ A;  1N34 M;  2EUC A;  3GQ3 A;  1DGB A;  5FTL A;  4DV3 M;  3MMP A;  3FD9 A;  3FYD A;  4X65 M;  4L8R C;  2ZAN A;  1AIP C;  1GKI A;  2MGW A;  3HHX A;  3Q8G A;  2HKJ A;  3HHZ A;  2Z3X A;  3AL0 C;  5IWA M;  1QYR A;  4JI7 M;  4AKG A;  5KQ8 A;  1ZV1 A;  2V6Z M;  4FD2 A;  4DV6 M;  3PNY A;  3V76 A;  1IXS B;  2Z4R A;  3FRH A;  1SXJ E;  4FCW A;  1QAM A;  1XXH A;  4CHT B;  1HNX M;  4I5S A;  4Z6Y A;  4D82 A;  1SXJ C;  5FTN A;  2MJ5 B;  1XXH E;  1Z59 A;  3IG8 A;  4MGY E;  3W0L B;  2R45 A;  3SMP A;  4HL4 A;  4LJ4 A;  3HU2 A;  4A3V B;  1C1K A;  1SXJ B;  2LVO C;  4IJF A;  3L25 A;  1V92 A;  4JYA M;  3U61 A;  1OAO C;  2QEN A;  3HHY A;  2FS1 A;  1L8Q A;  3WHK A;  1PJI A;  1PRB A;  1JR3 D;  3FUU A;  4DV0 M;  4LRS A;  2ZTC A;  2LHC A;  2WSF F;  2VQF M;  4LF4 M;  3I04 M;  3GLH A;  1Y8G A;  4CIZ A;  4GKJ M;  1OTR A;  3ILK A;  1QAO A;  1J5E M;  3GLH E;  1BVS A;  3HJS A;  3ZH9 B;  3SMS A;  1WXQ A;  5JI2 E;  4G4O A;  3K8Z A;  2XSZ A;  3IEC A;  4AZF A;  3SBJ A;  3DZD A;  1HT1 E;  1HJP A;  3FUX A;  4GC9 A;  4DV1 M;  1MJG M;  2L6O A;  3HY5 A;  4NXM M;  3RFW A;  2X49 A;  2L7I A;  4B3S M;  1H6U A;  3WHL A;  4KOD A;  4DR6 M;  5KPT A;  1T3T A;  2WSC F;  2JY8 A;  3K92 A;  3HZJ A;  3E46 A;  2Z7J A;  2CV1 A;  3J7B A;  1EE8 A;  3AFH A;  4GHL A;  1IM2 A;  5E6J A;  1QAN A;  1VEK A;  3NWL A;  4NXN M;  4NSR A;  4KT0 F;  1L1T A;  4GIP A;  4YHH M;  2JWS A;  3FRI A;  2MR9 A;  5EJC A;  1VDD A;  1RU3 A;  4OVZ B;  2DHR A;  5A2Q S;  1JB0 F;  5ITY A;  2V1C A;  1N75 A;  2C9O A;  2KHH A;  5DYG A;  3L28 A;  1NO1 A;  1R4G A;  4MGH A;  2R62 A;  1E9R A;  3AOE C;  3HHW A;  4GMQ A;  1VEG A;  1R2Z A;  2CEA A;  1QUT A;  2D7H A;  3QAU A;  4M9S A;  1NSF A;  4EIW A;  1XWI A;  3JR5 A;  2EA0 A;  4XGI A;  1IXZ A;  4RF1 A;  3F92 A;  3J81 S;  3UMM A;  3MK6 A;  4RNA A;  1Z5B A;  2JUJ A;  2OO9 A;  3B89 A;  4LJ7 A;  1ORY B;  2C99 A;  1KSF X;  2D7G A;  2DAE A;  3I4V A;  3KOY E;  2K0B X;  4GIT A;  2I7N A;  4QOS A;  4R3D A;  3SYK A;  2B3T A;  2L7H A;  3A42 A;  1Q3B A;  3CGW A;  2Z4S A;  3AKZ A;  3U5Z B;  2QP9 X;  3B74 A;  4G4N A;  4LJ9 A;  3K9P A;  4LF8 M;  1DO2 A;  2RGH A;  3AV0 A;  3CF6 E;  3KSX A;  2WZJ A;  4GC5 A;  3GPU A;  2O5R A;  1GAB A;  2Y0Q A;  1NJG A;  3C58 A;  3I01 M;  2XSZ D;  3VLF B;  3GRY A;  4AG5 A;  4OU7 A;  2FOI C;  1QDR A;  2R4J A;  3DOA A;  4JN6 A;  1HT2 E;  3GLG A;  1N33 M;  3AOG A;  2E5L M;  1YSY A;  1OIZ A;  1D0M A;  1TR8 A;  3SHF A;  2ZTD A;  3FUW A;  3LQR A;  3LVW A;  3GP1 A;  8CAT A;  2DZN B;  2JNH A;  2Y20 A;  5EP4 A;  1KFV A;  3FTF A;  1ZQ9 A;  4PDG A;  2K9D A;  1TH3 A;  3SAV A;  2FFJ A;  1IN7 A;  1WIV A;  4M9X A;  1J09 A;  1OFH A;  4I81 A;  3VDU A;  2EKF A;  1PJS A;  3U6Q A;  1P3Q Q;  2Z8Y M;  1VEJ A;  3UGJ A;  1MU5 A;  2F5Q A;  4WP2 A;  1G41 A;  2XFS A;  3JAM S;  2BWB A;  2YQZ A;  1W5S A;  3KSJ A;  1XNR M;  3HU1 A;  5DYI A;  3CF0 A;  3VK7 A;  2HHH M;  3U6D A;  4IBK A;  3DA1 A;  4B7F A;  1TDZ A;  2BJW A;  3J2P B;  3E21 A;  3PVS A;  5H37 D;  2R4E A;  2K6B A;  2K47 A;  4KLN A;  1SXJ A;  3U6S A;  1GL7 A;  4LCB A;  3QYB A;  4DUY M;  2QBY B;  3GQ5 A;  1OKS A;  4MGK E;  4DR5 M;  1N36 M;  3SAR A;  1CUK A;  1G3I A;  3GLF B;  1XMO M;  1Z6T A;  3L26 A;  1I4W A;  2X8A A;  4IBE A;  1WR1 B;  1D2N A;  5EXT A;  3LW5 F;  2EO2 A;  2C5R A;  3BOS A;  4OX9 M;  2DAM A;  3GO8 A;  3SFZ A;  4AKI A;  3PXG A;  2KNA A;  3GLI B;  4BLC A;  2JXN A;  4LRT A;  3LVV A;  4IBC A;  5FLX S;  1VG5 A;  4IBI A;  4DV2 M;  3GRU A;  2F4V M;  4RKU F;  4R7G A;  1V34 A;  2R44 A;  3E4R A;  4CJ6 A;  2XZU A;  4NSO B;  3U60 B;  3TWL A;  1NNU C;  4LGY A;  1UM8 A;  3CTW B;  3U6C A;  1J7K A;  3W67 A;  3R9X B;  4GRI A;  1OIP A;  4QHT A;  2DWM A;  1G71 A;  1HQC A;  2DKL A;  3QWL A;  2DWL A;  3TWM A;  2XLJ A;  4BBA A;  4DR1 M;  2JY7 A;  2NQ8 C;  4M0W A;  3SAT A;  2R6F A;  3B9P A;  1DV0 A;  2XFT A;  2LVQ D;  1IY1 A;  2KZU A;  3BXW A;  2CRU A;  2CHQ A;  3I51 A;  3A46 A;  1QZE A;  1N78 A;  3Q8X A;  2LXE A;  2O25 A;  1GJS A;  4LJ5 A;  4WUR A;  2YR0 A;  2DAI A;  1PM5 A;  2M60 A;  4OVZ A;  2Q2E B;  3AJI B;  4P17 A;  4QNM A;  3GQ4 A;  1LTM A;  1Z5C A;  3B7Q A;  4GHA A;  3U6P A;  3D8L A;  1W5T A;  2VII A;  2XH9 A;  3FTD A;  2DNA A;  3KDS E;  2VDB B;  4BB9 A;  1OQY A;  7CAT A;  2L4E A;  1HR0 M;  3H4M A;  4LFA M;  2DVW B;  3AOE A;  1QZM A;  3H4J A;  2DAK A;  4FCV A;  1L1Z A;  3FUV A;  1T43 A;  1LV7 A;  2UU9 M;  2DZO B;  3I4Y A;  2WSE F;  1SXJ D;  2G8L A;  2W82 A;  3KOX E;  3SAU A;  1F4I A;  4X62 M;  4DBG B;  4DV5 M;  4FWG A;  1MX0 A;  3KP0 E;  5DNY A;  4AI6 A;  3TWK A;  3BBZ A;  1IN8 A;  3OTO M;  1E94 E;  3T1H M;  1EIJ A;  3TQS A;  4LG2 A;  1KYI A;  2EKK A;  3VFD A;  2R18 A;  3B7Z A;  4OW0 A;  5EXS A;  4DV7 M;  5EP2 A;  4B7G A;  2OOA A;  3HX3 A;  4IBB A;  1YE9 A;  5KQD A;  3M0E A;  4AW4 A;  4I4L A;  4L78 A;  4D81 A;  2G5G X;  3FTE A;  2FE8 A;  2RRU A;  3LMM A;  2CWB A;  4MM3 B;  2Y21 A;  2YNM D;  2QNJ A;  1IN5 A;  4GEW A;  4Z8X A;  2JZ1 A;  4GH9 A;  1D0K A;  3B7N A;  1ZMV A;  3HJ8 A;  3J80 S;  1PJQ A;  1Q39 A;  1XNQ M;  4LJA A;  3RE8 A;  1R2Y A;  2CE7 A;  4G4Q A;  2M5Z A;  4ITQ A;  1Q3C A;  1NY5 A;  4FVM A;  4G4R A;  1IN6 A;  1IY0 A;  2JA2 A;  3M7G A;  1QUS A;  4QNR A;  4AG6 A;  1OFI A;  2KZS A;  5KPZ A;  1DGG A;  2J7O A;  2LTU A;  4L16 A;  1ZMU A;  2UUA M;  2C96 A;  3KS8 A;  5FTJ A;  3D8B A;  1S3S A;  1WGN A;  1IY2 A;  1NV9 A;  3EIH A;  3FKE A;  3KS4 A;  4NRV A;  4P16 A;  3SC3 A;  1IBL M;  4G3O A;  4NC6 A;  4DV4 M;  2F5O A;  2RGO A;  5JI3 E;  2LVA A;  5C1B A;  4JI8 M;  1N77 A;  1QDT A;  2DI0 A;  3CF2 A;  2QCU A;  1V33 A;  3SAW A;  1QAQ A;  1Z5A A;  1Q02 A;  2DWN A;  4G6Z A;  3VDP A;  2CFO A;  4UN2 B;  2QBY A;  2BJV A;  1IXS A;  2OPF A;  4L15 A;  2CV0 A;  2L2D A;  3VKH A;  2C98 A;  2OQ4 A;  3GLF A;  1WHC A;  3KXE C;  5ITX A;  5EP1 A;  2VF7 A;  4X64 M;  3U6M A;  4LF9 M;  4KO8 A;  4REZ A;  3GLF E;  1I94 M;  4CGY B;  5ITX E;  2F5N A;  2HAK A;  4FWH A;  4LF6 M;  5BR8 M;  2F5S A;  3ZC7 B;  3GLI A;  3K2L A;  2QQ8 A;  2KW0 A;  3GPX A;  1TF0 B;  3TL4 X;  3HWS A;  1E9S A;  3T15 A;  1DGH B;  1MN3 A;  4PCZ A;  3GLI E;  3GLG B;  3MJ5 A;  2A5Y B;  1L2D A;  5FTM A;  4HEO A;  3KOZ E;  3K1J A;  3EIE A;  1IQP A;  1L2B A;  2H1R A;  3NBI A;  4JXJ A;  1HQY E;  2HWJ A;  1GLN A;  1N32 M;  2ZAO A;  2GNO A;  4PD2 A;  5C18 A;  4IJE A;  4GKK M;  3C3E A;  1SG9 A;  4QHS A;  1ZMW A;  4W5W A;  2YFQ A;  2OOB A;  2APL A;  3FUT A;  2KNV A;  2KNZ A;  2EJS A;  4LGM A;  4QOZ C;  1YLA A;  5KPR A;  2J5Y A;  2QHO B;  2BNK A;  1IBM M;  3R8F A;  4B7H A;  3IHP A;  1G8P A;  4RF0 A;  2XEP A;  3HU3 A;  4NRW A;  3VKG A;  1QVR A;  2JP7 A;  2VF8 A;  4MH0 E;  1C7Y A;  2JZ0 A;  5DFL A;  2AHM A;  4JI6 M;  2ZBK B;  4JI0 M;  2O01 F;  2GQF A;  1IN4 A;  4JI3 M;  3THG A;  4II7 A;  2JY6 B;  4IBF A;  4PT5 A;  3T1Y M;  3W68 A;  1OJL A;  3MHV C;  2DWZ B;  2HCB A;  1X37 A;  2KEB A;  2MH8 A;  2X4A A;  1FJG M;  2ERC A;  4LF5 M;  1XMQ M;  2DXI A;  5EXX A;  1UFZ A;  1XXH B;  3M6A A;  4LY6 A;  4AKH A;  1NV8 A;  1PGY A;  2DEN A;  4F1I A;  1HNZ M;  4MB7 A;  1D0L A;  5ITQ A;  2KA6 B;  2JY5 A;  1DGF A;  1NHW C;  2LVN C;  1NNJ A;  2XZF A;  1R5L A;  3L2A A;  1XC8 A;  2R65 A;  1TTE A;  1K3X A;  1GJT A;  1AUA A;  4ZPX A;  1FNN A;  3U61 B;  2VQE M;  2ZM6 M;  4KHP M;  4AQY M;  2HL7 A;  4LJ8 A;  2CHG A;  4XK8 F;  1NJF A;  1GL6 A;  1L2C A;  5ITT A;  1QQW A;  5LMU M;  4Q7J A;  3GLH B;  3C3D A;  5EQT A;  4NOO B;  4IIW A;  3PNV A;  2QSF X;  4S12 A;  1WJ7 A;  4F2L A;  4JI5 M;  3J7A S;  3RGS A;  4CIS A;  4I8O A;  3J27 B;  1NY6 A;  2BWE A;  4DR7 M;  2L09 A;  5E26 A;  1G4A E;  2QZ4 A;  3DFZ A;  2N35 A;  5EXP A;  4DR4 M;  4M9Z A;  1DO0 A;  4XBO A;  2KDL A;  5IRE B;  3HGI A;  4YY3 M;  2LHG A;  3U5Z A;  2LH0 A;  4LJ6 A;  3L27 A;  2UUC M;  1GO5 A;  3T6P A;  3GRR A;  1HNW M;  2G3Q A;  4B3R M;  2XF3 A;  4MGI E;  3FYC A;  3IG5 A;  1JQJ C;  3TE6 A;  3UJN A;  4JI1 M;  4TUW A;  2P5T A;  2RKO A;  2UXB M;  4HLQ A;  3QYE A;  3GRV A;  2UUB M;  2QPA A;  4D80 A;  3HKP A;  2DZL A;  3ZQJ A;  3A45 A;  5LMN M;  2H5X A;  3UZU A;  3TPZ A;  3LQQ A;  4FCT A;  1PJT A;  1G59 A;  1IXR C;  4L4U A;  1TH4 A;  1YUB A;  5EP3 A;  3KFU G;  2FH0 A;  1TH2 A;  5BPV A;  1ZAE A;  3HJQ A;  5L8R F;  1TDH A;  1IBK M;  4FWD A;  3GPY A;  2DHY A;  3LCU A;  4LFB M;  3SHG B;  3JR4 A;  4DR2 M;  2CP8 A;  1K82 A;  2CV2 A;  4DR3 M;  3KVW A;  3NBX X;  4L6V 6;  3GPP A;  2CHV A;  2F5P A;  1JR3 A;  5GKN A;  2C9C A;  4LFC M;  2R46 A;  5FSW A;  1WGL A;  2LVP C;  1IFY A;  1JR3 E;  2KXE A;  3U6O A; 
#chains in the Genus database with same CATH homology
 4B08 A;  3FTC A;  5IZ7 D;  4B3M M;  2KRU A;  5F3W A;  1K3W A;  4JV5 M;  4LF7 M;  1NVM A;  1TGU A;  4LZZ A;  5IT9 S;  4JI4 M;  2V1U A;  2KRK A;  1PJJ A;  5KO3 A;  1DGH A;  4NL4 H;  1GVN A;  4WW0 A;  1R6B X;  4IBD A;  3E9S A;  3VK8 A;  4MGZ E;  4B3T M;  3UK6 A;  3U6L A;  3A98 B;  3W0F A;  2Y0T A;  4X66 M;  4PDI A;  4DUZ M;  4FW9 A;  3T38 A;  2UXD M;  3PFI A;  2D7E A;  2XGN A;  3KP1 E;  4M0D A;  2I7P A;  5FTK A;  5ITR A;  3KW6 A;  4LZJ A;  3SAS A;  4K0K M;  2FNA A;  2LWX A;  3KOW E;  3L29 A;  4IBJ A;  2ZAM A;  2LNH C;  3SYL A;  5ITU A;  4IBG A;  3U6E A;  2UXC M;  1R7R A;  3RGP A;  3ZCB B;  3U60 A;  1XHB A;  2J7N A;  1E32 A;  4JI2 M;  1NHG C;  2CUZ A;  1N34 M;  2EUC A;  3GQ3 A;  1DGB A;  5FTL A;  4DV3 M;  4X65 M;  3FD9 A;  3FYD A;  4L8R C;  2ZAN A;  1GKI A;  3HHX A;  3HHZ A;  2HKJ A;  2Z3X A;  3AL0 C;  4AKG A;  5IWA M;  1QYR A;  4JI7 M;  5KQ8 A;  2V6Z M;  4FD2 A;  4DV6 M;  3PNY A;  1IXS B;  2Z4R A;  1SXJ E;  4FCW A;  1QAM A;  1XXH A;  4CHT B;  1HNX M;  4I5S A;  4Z6Y A;  4D82 A;  1SXJ C;  5FTN A;  1Z59 A;  3IG8 A;  4MGY E;  3W0L B;  2R45 A;  3SMP A;  4HL4 A;  4LJ4 A;  3HU2 A;  4A3V B;  1C1K A;  1SXJ B;  4IJF A;  3L25 A;  4JYA M;  3U61 A;  2QEN A;  3HHY A;  1L8Q A;  3WHK A;  1PJI A;  1JR3 D;  3FUU A;  4DV0 M;  4LRS A;  4LF4 M;  2VQF M;  3GLH A;  4GKJ M;  3ILK A;  1QAO A;  1J5E M;  3HJS A;  3ZH9 B;  3SMS A;  1WXQ A;  5JI2 E;  4G4O A;  3K8Z A;  2XSZ A;  4AZF A;  3SBJ A;  3DZD A;  1HT1 E;  3FUX A;  4GC9 A;  4DV1 M;  2L6O A;  4NXM M;  3RFW A;  2X49 A;  2L7I A;  4B3S M;  1H6U A;  3WHL A;  4KOD A;  4DR6 M;  5KPT A;  1T3T A;  3K92 A;  2Z7J A;  2CV1 A;  3J7B A;  1EE8 A;  3AFH A;  4GHL A;  1IM2 A;  5E6J A;  1QAN A;  4NXN M;  3NWL A;  4NSR A;  1L1T A;  4GIP A;  4YHH M;  5EJC A;  1VDD A;  4OVZ B;  2DHR A;  5A2Q S;  5ITY A;  2V1C A;  1N75 A;  2C9O A;  5DYG A;  3L28 A;  4MGH A;  2R62 A;  1E9R A;  3AOE C;  3HHW A;  4GMQ A;  1R2Z A;  2CEA A;  2D7H A;  3QAU A;  4M9S A;  1NSF A;  4EIW A;  1XWI A;  3JR5 A;  2EA0 A;  4XGI A;  1IXZ A;  4RF1 A;  3J81 S;  3UMM A;  3MK6 A;  4RNA A;  1Z5B A;  4LJ7 A;  1ORY B;  2C99 A;  1KSF X;  2D7G A;  3I4V A;  4GIT A;  3KOY E;  4QOS A;  4R3D A;  2I7N A;  3SYK A;  3SHF A;  2L7H A;  3A42 A;  1Q3B A;  3AKZ A;  2Z4S A;  3U5Z B;  2QP9 X;  4G4N A;  4LJ9 A;  4LF8 M;  1DO2 A;  2RGH A;  3AV0 A;  3CF6 E;  3KSX A;  4GC5 A;  3GPU A;  2O5R A;  2Y0Q A;  1NJG A;  3C58 A;  3VLF B;  2XSZ D;  3GRY A;  4AG5 A;  4OU7 A;  2FOI C;  3DOA A;  2R4J A;  4JN6 A;  1N33 M;  1HT2 E;  3GLG A;  3AOG A;  2E5L M;  1YSY A;  3FUW A;  3LQR A;  3LVW A;  3GP1 A;  8CAT A;  2DZN B;  2Y20 A;  5EP4 A;  1KFV A;  3FTF A;  1ZQ9 A;  4PDG A;  3SAV A;  1TH3 A;  2FFJ A;  1IN7 A;  4M9X A;  1J09 A;  1OFH A;  4I81 A;  3VDU A;  3U6Q A;  3UGJ A;  1MU5 A;  2F5Q A;  1G41 A;  2XFS A;  3JAM S;  2YQZ A;  1W5S A;  3KSJ A;  1XNR M;  3HU1 A;  5DYI A;  3CF0 A;  3VK7 A;  2HHH M;  3U6D A;  4IBK A;  3DA1 A;  4B7F A;  1TDZ A;  2BJW A;  3J2P B;  3PVS A;  5H37 D;  2R4E A;  4KLN A;  2K47 A;  1SXJ A;  3U6S A;  1GL7 A;  4LCB A;  4DUY M;  2QBY B;  3GQ5 A;  4MGK E;  4DR5 M;  1N36 M;  3SAR A;  1G3I A;  3GLF B;  1XMO M;  1Z6T A;  3L26 A;  1I4W A;  2X8A A;  4IBE A;  1D2N A;  5EXT A;  2EO2 A;  2C5R A;  3BOS A;  4OX9 M;  3GO8 A;  3SFZ A;  4AKI A;  3PXG A;  3GLI B;  4BLC A;  4LRT A;  3LVV A;  4IBC A;  5FLX S;  4IBI A;  4DV2 M;  3GRU A;  2F4V M;  4R7G A;  3E4R A;  2XZU A;  4NSO B;  3U60 B;  3TWL A;  1NNU C;  4LGY A;  1UM8 A;  3CTW B;  3U6C A;  1J7K A;  3R9X B;  4GRI A;  4QHT A;  2DWM A;  1HQC A;  3QWL A;  2DWL A;  3TWM A;  2XLJ A;  4BBA A;  4DR1 M;  4M0W A;  2NQ8 C;  3SAT A;  3B9P A;  2XFT A;  1N78 A;  1IY1 A;  2KZU A;  3I51 A;  3A46 A;  2CHQ A;  3Q8X A;  2LXE A;  4LJ5 A;  4WUR A;  2YR0 A;  1PM5 A;  2M60 A;  4OVZ A;  2Q2E B;  3AJI B;  4QNM A;  3GQ4 A;  1Z5C A;  4GHA A;  3U6P A;  3D8L A;  1W5T A;  2VII A;  2XH9 A;  3FTD A;  3KDS E;  4BB9 A;  7CAT A;  1HR0 M;  3H4M A;  4LFA M;  2DVW B;  3AOE A;  1QZM A;  4FCV A;  1L1Z A;  3FUV A;  1LV7 A;  2UU9 M;  2DZO B;  3I4Y A;  3SAU A;  1SXJ D;  2G8L A;  2W82 A;  3KOX E;  4X62 M;  4DV5 M;  4FWG A;  1MX0 A;  3KP0 E;  5DNY A;  4AI6 A;  3TWK A;  1IN8 A;  3OTO M;  1E94 E;  3T1H M;  3TQS A;  4LG2 A;  1KYI A;  3VFD A;  2R18 A;  4OW0 A;  4DV7 M;  5EXS A;  5EP2 A;  4B7G A;  4IBB A;  1YE9 A;  5KQD A;  3M0E A;  4AW4 A;  4I4L A;  4L78 A;  4D81 A;  2G5G X;  3FTE A;  2FE8 A;  3LMM A;  4MM3 B;  2Y21 A;  2YNM D;  1IN5 A;  4Z8X A;  4GH9 A;  3HJ8 A;  3J80 S;  1Q39 A;  1XNQ M;  4LJA A;  3RE8 A;  1R2Y A;  2CE7 A;  4G4Q A;  2M5Z A;  4ITQ A;  1Q3C A;  1NY5 A;  4FVM A;  4G4R A;  1IN6 A;  1IY0 A;  2JA2 A;  3M7G A;  4QNR A;  4AG6 A;  1OFI A;  2KZS A;  5KPZ A;  1DGG A;  2J7O A;  4L16 A;  2UUA M;  2C96 A;  3KS8 A;  5FTJ A;  3D8B A;  1S3S A;  1IY2 A;  3EIH A;  3FKE A;  4NRV A;  3KS4 A;  4P16 A;  3SC3 A;  1IBL M;  4DV4 M;  2F5O A;  2RGO A;  5JI3 E;  5C1B A;  4JI8 M;  1N77 A;  3CF2 A;  2QCU A;  3SAW A;  1QAQ A;  1Z5A A;  2DWN A;  4G6Z A;  3VDP A;  2CFO A;  2QBY A;  2BJV A;  2OPF A;  3VKH A;  4L15 A;  2CV0 A;  2C98 A;  2OQ4 A;  3GLF A;  3KXE C;  5ITX A;  5EP1 A;  4X64 M;  3U6M A;  4LF9 M;  4KO8 A;  4REZ A;  1I94 M;  4CGY B;  5ITX E;  2F5N A;  4FWH A;  4LF6 M;  5BR8 M;  2F5S A;  3ZC7 B;  3GLI A;  3K2L A;  2KW0 A;  3GPX A;  3TL4 X;  3HWS A;  1E9S A;  3T15 A;  1DGH B;  4PCZ A;  3GLG B;  3MJ5 A;  2A5Y B;  1L2D A;  5FTM A;  3KOZ E;  3K1J A;  3EIE A;  1IQP A;  1L2B A;  2H1R A;  3NBI A;  4JXJ A;  1HQY E;  1GLN A;  1N32 M;  2ZAO A;  4PD2 A;  5C18 A;  4IJE A;  4GKK M;  4QHS A;  4W5W A;  2YFQ A;  3FUT A;  4LGM A;  4QOZ C;  5KPR A;  1IBM M;  2BNK A;  3R8F A;  4B7H A;  4RF0 A;  1G8P A;  4NRW A;  2XEP A;  3HU3 A;  3VKG A;  1QVR A;  4MH0 E;  2AHM A;  4JI6 M;  2ZBK B;  4JI0 M;  4JI3 M;  1IN4 A;  3THG A;  4II7 A;  4IBF A;  4PT5 A;  3T1Y M;  1OJL A;  3MHV C;  2DWZ B;  2HCB A;  1X37 A;  2KEB A;  2X4A A;  1FJG M;  2ERC A;  4LF5 M;  1XMQ M;  2DXI A;  5EXX A;  3M6A A;  1XXH B;  4AKH A;  4LY6 A;  1HNZ M;  4MB7 A;  5ITQ A;  2KA6 B;  1DGF A;  1NHW C;  1NNJ A;  2XZF A;  1XC8 A;  3L2A A;  2R65 A;  1K3X A;  4ZPX A;  1FNN A;  3U61 B;  2VQE M;  2ZM6 M;  4KHP M;  4AQY M;  2HL7 A;  4LJ8 A;  2CHG A;  1NJF A;  1GL6 A;  1L2C A;  5ITT A;  1QQW A;  5LMU M;  3GLH B;  5EQT A;  4NOO B;  4IIW A;  3PNV A;  4S12 A;  4JI5 M;  3J7A S;  3RGS A;  4CIS A;  4I8O A;  3J27 B;  1NY6 A;  4DR7 M;  2L09 A;  5E26 A;  1G4A E;  2QZ4 A;  3DFZ A;  5EXP A;  4DR4 M;  4M9Z A;  1DO0 A;  4XBO A;  5IRE B;  3HGI A;  4YY3 M;  3U5Z A;  2LH0 A;  4LJ6 A;  3L27 A;  2UUC M;  3GRR A;  1HNW M;  4B3R M;  2XF3 A;  4MGI E;  3FYC A;  3IG5 A;  1JQJ C;  3TE6 A;  3UJN A;  4JI1 M;  4TUW A;  2P5T A;  2RKO A;  2UXB M;  4HLQ A;  3GRV A;  2UUB M;  2QPA A;  4D80 A;  3HKP A;  3A45 A;  5LMN M;  3UZU A;  3TPZ A;  3LQQ A;  4FCT A;  1G59 A;  1IXR C;  4L4U A;  1TH4 A;  1YUB A;  5EP3 A;  3KFU G;  5BPV A;  1TH2 A;  1ZAE A;  3HJQ A;  1IBK M;  1TDH A;  4FWD A;  3GPY A;  4LFB M;  3SHG B;  3JR4 A;  4DR2 M;  1K82 A;  2CV2 A;  4DR3 M;  3KVW A;  3GPP A;  2CHV A;  2F5P A;  1JR3 A;  5GKN A;  2C9C A;  4LFC M;  2R46 A;  5FSW A;  2KXE A;  3U6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...