4GKKM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gkkM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4gkkM02
1Q39A 5A2QS 3GPUA 4JI5M 3J80S 3J7AS 1Q3CA 3W0FA 1XMQM 1IBMM 4ITQA 4G4OA 1K3XA 4LF7M 3GPYA 2UUCM 4LF4M 1Q3BA 3U6EA 3SBJA 4B3MM 2UU9M 2F5PA 1L1ZA 1MU5A 4MB7A 4NXNM 1L2DA 4LFBM 2F5QA 4DV6M 4DV3M 2ZBKB 4NRVA 4JI0M 4X66M 1Z59A 4DV4M 3A42A 4DUYM 1KFVA 3U6DA 4NXMM 3TWLA 4X62M 2HHHM 3U6OA 4JI3M 4DR3M 3U6QA 4B3SM 5ITXE 4DV0M 1HNXM 4LFCM 1HNZM 2F5OA 3GO8A 1L1TA 4DV7M 1I94M 3OTOM 5IWAM 1NNJA 3JR5A 4KHPM 2HKJA 5BR8M 5FLXS 5ITRA 4JI1M 5LMUM 4X64M 1Z5BA 5ITXA 4B3TM 1R2YA 4LF8M 1IBLM 4LFAM 3JR4A 1N34M 1PJIA 1IBKM 4JI4M 3T1HM 4JI2M 4DR6M 2XZUA 3GQ5A 3DOAA 4PCZA 3U6PA 1N33M 4DV2M 1Z5CA 4LF5M 3GPPA 3A45A 3GQ3A 5ITQA 4DR5M 1K82A 1XMOM 3GQ4A 4CISA 2ZM6M 4DV5M 4JV5M 5ITUA 2OPFA 3SAVA 1N32M 3SATA 4AQYM 4GKKM 2UXCM 2VQEM 5LMNM 3TWKA 1K3WA 4K0KM 4DR7M 3U6CA 5ITTA 5ITYA 3GPXA 4JYAM 4JI8M 1XNRM 2F5SA 4JI7M 3J81S 1HR0M 1XNQM 1HNWM 1MX0A 1PJJA 4DR1M 1TDHA 4PDGA 3U6MA 4G4RA 4DR2M 1XC8A 2F4VM 2OQ4A 4YY3M 1Z5AA 3U6SA 4PDIA 4X65M 4G4NA 4DV1M 4PD2A 2UUBM 2F5NA 4DR4M 5IT9S 2XZFA 3SAWA 3SASA 3TWMA 4YHHM 4NRWA 3GP1A 1J5EM 3U6LA 4G4QA 1N36M 2EA0A 2E5LM 2UUAM 3A46A 4LF9M 2Q2EB 1PM5A 2VQFM 4B3RM 3VK7A 1EE8A 3SAUA 4JI6M 1TDZA 1L2BA 4GKJM 1R2ZA 1FJGM 3JAMS 3T1YM 3VK8A 4LF6M 3C58A 4OX9M 2UXBM 2UXDM 4DUZM 3SARA 1L2CA
chains in the Genus database with same CATH superfamily
2DZNB 3K92A 1Q39A 2BJWA 3H4MA 4NL4H 1XMQM 3EIHA 2D7GA 3KW6A 4G4OA 3SYLA 5FSWA 2J7NA 3CGWA 3E21A 4M0WA 4LF4M 1Q3BA 3J2PB 4UN2B 3MK6A 2UU9M 1N75A 3I04M 2FH0A 4MB7A 3SMSA 3FKEA 5FTMA 3T6PA 2CP8A 2JUJA 4LRTA 4LFBM 2F5QA 3KS8A 3AOGA 2XSZD 4FCWA 1QUTA 4JI0M 2C9CA 4IBGA 3VKGA 3PNVA 2WSEF 3PXGA 3GLHB 4NXMM 3FUXA 3J7BA 1DO2A 2X4AA 2DENA 3LW5F 3QYBA 4KODA 3ZH9B 2QENA 3VKHA 4KLNA 5IREB 4B3SM 1DGFA 3BBZA 1QAQA 1OQYA 2QSFX 4MH0E 2K6BA 3CTWB 3AJIB 4LJ4A 2DXIA 3GRVA 1L1TA 4QOSA 2CE7A 1IQPA 2R65A 4IBEA 2CFOA 3KSXA 4KHPM 4OW0A 1GJSA 2LVOC 5KPZA 1NV9A 3MHVC 5BR8M 3AKZA 2C9OA 4AKGA 4L15A 3C3DA 4D82A 4GMQA 3GLHA 1Z5BA 2APLA 3RE8A 2XGNA 4B3TM 3ZCBB 4P16A 2XSZA 1N34M 4L8RC 3FUVA 1OIPA 1R6BX 4OU7A 1OTRA 3W67A 1W5TA 1S3SA 5KQ8A 3KOYE 4DR6M 1VEGA 1WR1B 1E9RA 3D8LA 4PCZA 4IBJA 4XGIA 3U61B 4DV2M 1Z5CA 2GNOA 1NV8A 1GVNA 2KDLA 1TH4A 5FTKA 3A45A 2YQZA 1K82A 1XMOM 4KO8A 4GITA 3CF6E 2L09A 1QANA 3I01M 3KSJA 1TF0B 3HHYA 4CISA 1GO5A 1JQJC 1UM8A 3UZUA 4CHTB 1E94E 1GL7A 5ITUA 4IBKA 5C18A 3KS4A 3B74A 3L28A 4LZZA 2UXCM 4XK8F 4LGMA 4M9SA 2JY7A 2M60A 2DI0A 1N78A 1CUKA 4DR7M 3B9PA 3SFZA 1NHWC 1VG5A 3U6CA 3CF0A 2LH0A 1PGYA 1XB2B 3DFZA 3GPXA 2DWMA 4AKIA 3U61A 4OVZB 4F2LA 2X49A 3DA1A 3ZQJA 3PFIA 1A5TA 1WGLA 2DZOB 1NSFA 1XNQM 4I8OA 3R9XB 3AOEA 3HX3A 1YLAA 4PT5A 1HNWM 2D7EA 1GKIA 4DR1M 4RF1A 1TH2A 1XC8A 1L8QA 2LTUA 3IG5A 3GLFB 1ZAEA 1QDRA 1V92A 4NSOB 2H5XA 3E4RA 1R7RA 3GLIA 4DV1M 1IN6A 1NJFA 2F5NA 1YE9A 4DR4M 4OVZA 5IT9S 2XZFA 3SAWA 2B3TA 2LWXA 3TWMA 1QUSA 1XXHB 1NNUC 3L29A 3GLGB 2JZ0A 1D0MA 2G8LA 2FS1A 4GEWA 2DKLA 1RU3A 3IECA 4EIWA 2YR0A 1OJLA 1IY0A 4MGKE 2C98A 1IXSB 4LJ6A 2JXNA 2BNKA 3NBIA 1DGHB 1EE8A 1WJ7A 2CUZA 1L2BA 4GKJM 1MJGM 2CHGA 3VDPA 4D80A 1BVSA 1YSYA 3JAMS 3VK8A 3PVSA 4R71A 3GRUA 2R18A 1QAMA 3GPUA 2KNAA 4XBOA 4B08A 1Q3CA 3J7AS 4QNRA 3GLGA 3GLFE 2LVAA 2CWBA 3GPYA 1P3QQ 1IXSA 4FD2A 1WIVA 5EP3A 1L2DA 1GLNA 3BOSA 1DGHA 4DV3M 2ZBKB 4LY6A 3UK6A 2DWNA 2MJ5B 2FOIC 3A42A 1KFVA 3FTFA 3ZC7B 4BBAA 2HCBA 2QHOB 4I5SA 4X62M 5E26A 3K9OA 4JI3M 4DR3M 5EP4A 3EIEA 3FUTA 1V34A 2QNJA 3HU2A 3HJQA 1ZMVA 4QHSA 4M0DA 2F5OA 3GO8A 1WGNA 4MM3B 1NHGC 5DYGA 3VFDA 4FWGA 3M6AA 4B7HA 2A5YB 2MH8A 2QPAA 4RNAA 3RGPA 5IWAM 1I94M 3L25A 3FTCA 3C3EA 4MGZE 4JI1M 2Z4RA 5L8RF 5EXPA 4X64M 2RGOA 2Y21A 1T3TA 3LVWA 1YUBA 1R2YA 2YNMD 2MR9A 1IBLM 3CF2A 4AI6A 1QDTA 1KYIA 3KOZE 4IBBA 2ZAOA 1IBKM 1DO0A 1SXJE 4Z6YA 1E32A 3T1HM 1AIPC 3RFWA 2XZUA 3AOEC 3LMMA 1QZMA 2ERCA 3L27A 3UMMA 2DWLA 2CV0A 2O01F 1DGBA 1IY1A 5DFLA 4DBGB 2ZTCA 4LF5M 2KNVA 2JA2A 3FE3A 4DR5M 5ITQA 5DNYA 3GQ4A 2JY6B 2V1CA 4QHTA 1TR8A 4DV5M 1E9SA 4R7GA 4JV5M 3SAVA 4AG5A 1FNNA 5EP1A 4AQYM 2DAKA 1NVMA 1D0LA 3KVWA 2K0BX 4L78A 2KHHA 4NSRA 5ITYA 1VEJA 3T38A 2DZLA 2F5SA 2DAEA 4REZA 3K1JA 4G3OA 2VF7A 4LJAA 2KW0A 1IN5A 4WW0A 1HR0M 3M0EA 3FRHA 1IXRC 3ILKA 1D2NA 1TDHA 3U5ZB 3F92A 3U6MA 4A3VB 1IN7A 1QAOA 1W5SA 2R4JA 3U6SA 4PDIA 4L6V6 3K9PA 2D7HA 2MROB 4ZPXA 2XLJA 1T6OA 1QVRA 4PD2A 1VQ1A 2KEBA 4GC5A 1PJSA 2L4EA 4NOOB 2CRUA 3KOWE 7CATA 2LBCA 3SASA 4AKHA 2KRUA 2Y20A 4YHHM 1PJTA 4GHLA 3VDUA 3Q8XA 3GP1A 1J5EM 3M7GA 4AZFA 4WURA 2M5ZA 2Q2EB 1QYRA 2R4EA 1OFHA 1NY5A 4GHAA 3FYDA 3UJNA 3FUUA 1R2ZA 2OO9A 5KQDA 4TUWA 4D81A 1JR3E 1UFZA 2VIIA 4Z8XA 1ZMWA 4HL4A 4DUZM 2JY8A 3D8BA 3IG8A 1NO1A 3B89A 5A2QS 1VDDA 4NC6A 5EQTA 3W0FA 1IBMM 1XHBA 4I4LA 4ITQA 4RF0A 2VF8A 2XEPA 3TE6A 2MGWA 4F1IA 1ZQ9A 1PRBA 2HAKA 2R45A 4B7GA 2FFJA 3HZJA 1L1ZA 4CIZA 1MU5A 4NXNM 4IBDA 2YFQA 4DV6M 1C7YA 4NRVA 4X66M 3KP0E 3LQRA 4G6ZA 4WP2A 5EP2A 4DV4M 1GABA 1TH3A 2FNAA 4LJ7A 3FRIA 4M9ZA 1OAIA 1G3IA 2DVWB 3U6OA 3HJ8A 3GLFA 3LCUA 5ITXE 4QNMA 1HNXM 4LFCM 1LV7A 2I7PA 1HNZM 3LVVA 4DV7M 2DAGA 2L4FA 5KPTA 3JR5A 1XXHA 3AV0A 3E9SA 2HKJA 4KT0F 1SXJD 4FCTA 5ITRA 3C9PA 3NBXX 1IN8A 5C1BA 4MGHA 2G3QA 3U60B 3GLIE 1SXJB 2LVNC 2R44A 2CHQA 1PJIA 3A98B 2DHRA 1R4GA 1HJPA 2Z3XA 4LGYA 3K8ZA 3KP1E 3SHFA 3H4JA 3U6PA 1G8PA 3HU3A 1VDLA 2L7IA 3R8FA 1LTMA 1Q02A 2L6OA 4GH9A 2R46A 1IY2A 3HWSA 3MJ5A 2J5YA 3GQ3A 2XFTA 3U60A 2KXEA 2QP9X 1SXJA 1N32M 2CEAA 2JP7A 2N35A 3SATA 2V1UA 4LJ5A 3SYKA 4LRSA 4FW9A 3AFHA 2DHYA 4M9XA 3THGA 4ANRA 2VQEM 1I4WA 2Z4SA 3TWKA 1K3WA 3J27B 2EUCA 2CV2A 4K0KM 5FTJA 3GRRA 3QYEA 5ITTA 3FYCA 3VLFB 3KDSE 4JN6A 4JYAM 3TL4X 1XNRM 4JI7M 3I4YA 1TTEA 3HU1A 2GQFA 3V76A 1MX0A 2XF3A 2BJVA 1IN4A 4W5WA 4PDGA 2I7NA 2LVQD 5GKNA 1IM2A 4II7A 2JWSA 1Z5AA 1WXQA 2OQ4A 4X65M 2R0IA 3UGJA 1IFYA 2DAMA 1ORYB 1N77A 3I4VA 2UUBM 2BWBA 2QBYB 2EKFA 1OFIA 4GRIA 3W68A 3WHLA 4QOZC 4IIWA 1AUAA 1JR3D 1OIZA 1NY6A 2O25A 4G4QA 3U6LA 1V33A 2KZSA 2X8AA 4JXJA 4GIPA 3A46A 4LF9M 3I51A 3E46A 2JZ1A 2VQFM 4IJEA 5E6JA 3TPZA 3VK7A 4B3RM 4JI6M 2Z7JA 2EKKA 2Z8YM 1TDZA 1FJGM 3T1YM 2WZJA 1IXZA 2UXBM 2UXDM 2K47A 3SARA 2QBYA 1ZMUA 4JI5M 3J80S 2LHGA 1KSFX 4IJFA 2QZ4A 4L4UA 3Q8GA 1K3XA 2P5TA 3T15A 2JNHA 1DGGA 4LJ9A 1VEKA 2UUCM 1T43A 2RGHA 2L2DA 4P17A 3U6EA 2G5GX 3SBJA 4B3MM 2F5PA 5JI3E 1J09A 3HGIA 8CATA 2LHCA 3LQQA 5FTNA 3BXWA 1JR3A 2XFSA 5F3WA 4R3DA 2WSFF 1Z59A 1SG9A 4DUYM 2HL7A 3U5ZA 4HEOA 2NQ8C 3U6DA 3QWLA 1HQCA 3GRYA 3DZDA 3TWLA 2HHHM 2QQ8A 2CV1A 2K9DA 3GLHE 3HJSA 2C96A 3B7QA 2OOBA 3WHKA 3U6QA 1C1KA 4DV0M 4BLCA 1WHCA 2AHMA 2R6FA 3PNYA 5BPVA 3FTEA 4FWDA 1GL6A 3SC3A 2KRKA 2KNZA 2H1RA 3LCVB 3FTDA 3OTOM 1NNJA 2Y0QA 3FUWA 3HHWA 3HHXA 4LG2A 1SXJC 5FLXS 3SHGB 2XH9A 5LMUM 3NWLA 2RRUA 3GLIB 5H37D 5ITXA 3QAUA 3L26A 1H6UA 4L16A 4LF8M 3KXEC 4LFAM 3JR4A 2O5RA 4FVMA 4JI4M 2LVPC 3IHPA 1JB0F 1EFUB 1HT1E 4GC9A 4CJ6A 4JI2M 4FWHA 2W82A 3GQ5A 1PJQA 1EIJA 3DOAA 2Y0TA 1N33M 4LCBA 4IBFA 1QZEA 4RKUF 2JY5A 3L2AA 2J7OA 1HQYE 4Q7JA 5DYIA 3GPPA 1G59A 4IBCA 3KFUG 5EJCA 2ZM6M 5KPRA 2QCUA 1TGUA 2VDBB 2OPFA 2C5RA 4CGYB 4Y28F 2FE8A 4MGIE 4GKKM 5IZ7D 5LMNM 1XWIA 2HWJA 3KOXE 3RGSA 2RKOA 4I81A 1NJGA 1ZV1A 3B7ZA 2DAIA 4JI8M 5KO3A 3J81S 4IBIA 3HHZA 2KA6B 3W0LB 1PJJA 3TQSA 3HKPA 5FTLA 1G71A 4G4RA 2ZAMA 4DR2M 2F4VM 2L7HA 4HLQA 1MN3A 1F4IA 4YY3M 2OOAA 1Z6TA 4G4NA 1G41A 3MMPA 5EXSA 2KZUA 4LJ8A 5EXXA 2ZANA 2LXEA 3AL0C 2LNHC 3SMPA 2DNAA 4MGYE 4LZJA 3K2LA 1DV0A 1QQWA 1GJTA 1J7KA 1HT2E 2ZTDA 1R5LA 2EO2A 2V6ZM 4NRWA 4FCVA 2CHVA 5JI2E 1OKSA 2R62A 5EXTA 4AG6A 1XXHE 1N36M 4AW4A 3B7NA 3GLGE 1G4AE 2DWZB 2EA0A 1OAOC 1Y8GA 2EJSA 2E5LM 2UUAM 4BB9A 1PM5A 2BWEA 1X37A 4S12A 3SAUA 4LF7M 4B7FA 2C99A 2WSCF 4LF6M 3C58A 1D0KA 3HY5A 4OX9M 3FD9A 1L2CA
chains in the Genus database with same CATH topology
2DZNB 3K92A 1Q39A 2BJWA 3H4MA 4NL4H 1XMQM 3EIHA 2D7GA 3KW6A 4G4OA 3SYLA 5FSWA 2J7NA 4M0WA 4LF4M 1Q3BA 3J2PB 2UU9M 3MK6A 1N75A 4MB7A 3SMSA 3FKEA 5FTMA 4LRTA 4LFBM 2F5QA 3KS8A 3AOGA 2XSZD 4FCWA 4JI0M 2C9CA 4IBGA 3VKGA 3PNVA 3PXGA 3GLHB 4NXMM 3FUXA 3J7BA 1DO2A 2X4AA 4KODA 3VKHA 3ZH9B 2QENA 4KLNA 5IREB 4B3SM 1DGFA 1QAQA 4MH0E 3CTWB 3AJIB 4LJ4A 2DXIA 3GRVA 1L1TA 4QOSA 2CE7A 1IQPA 2R65A 4IBEA 2CFOA 3KSXA 4KHPM 4OW0A 5KPZA 3MHVC 5BR8M 3AKZA 2C9OA 4AKGA 4L15A 4D82A 4GMQA 3GLHA 1Z5BA 3RE8A 2XGNA 4B3TM 3ZCBB 4P16A 2XSZA 1N34M 4L8RC 3FUVA 1R6BX 4OU7A 1W5TA 1S3SA 5KQ8A 3KOYE 4DR6M 1E9RA 3D8LA 4PCZA 4IBJA 4XGIA 3U61B 4DV2M 1Z5CA 1GVNA 1TH4A 5FTKA 3A45A 2YQZA 1K82A 1XMOM 4KO8A 4GITA 3CF6E 2L09A 1QANA 3KSJA 3HHYA 4CISA 1JQJC 1UM8A 3UZUA 4CHTB 1E94E 1GL7A 5ITUA 4IBKA 5C18A 3KS4A 3L28A 4LZZA 2UXCM 4LGMA 4M9SA 2M60A 1N78A 4DR7M 3B9PA 3SFZA 1NHWC 3U6CA 2DWMA 3CF0A 2LH0A 3GPXA 3DFZA 4AKIA 3U61A 4OVZB 2X49A 3DA1A 3PFIA 2DZOB 1NSFA 1XNQM 4I8OA 3R9XB 3AOEA 1HNWM 4PT5A 2D7EA 1GKIA 4DR1M 4RF1A 1TH2A 1XC8A 1L8QA 3IG5A 3GLFB 1ZAEA 4NSOB 3E4RA 3GLIA 1R7RA 4DV1M 1IN6A 1NJFA 2F5NA 1YE9A 4DR4M 4OVZA 5IT9S 2XZFA 3SAWA 2LWXA 3TWMA 1XXHB 1NNUC 3L29A 3GLGB 2G8LA 4EIWA 2YR0A 1OJLA 1IY0A 4MGKE 2C98A 1IXSB 4LJ6A 2BNKA 3NBIA 1DGHB 1EE8A 1L2BA 2CUZA 4GKJM 2CHGA 3VDPA 4D80A 1YSYA 3JAMS 3VK8A 3PVSA 3GRUA 2R18A 1QAMA 3GPUA 4XBOA 4B08A 1Q3CA 3J7AS 4QNRA 3GLGA 3GPYA 4FD2A 5EP3A 1L2DA 1GLNA 3BOSA 1DGHA 4DV3M 2ZBKB 4LY6A 3UK6A 2DWNA 2FOIC 3A42A 1KFVA 3FTFA 3ZC7B 4BBAA 2HCBA 4I5SA 4X62M 5E26A 4JI3M 4DR3M 5EP4A 3EIEA 3FUTA 3HU2A 3HJQA 4QHSA 4M0DA 2F5OA 3GO8A 4MM3B 1NHGC 5DYGA 3VFDA 4FWGA 3M6AA 4B7HA 2A5YB 2QPAA 4RNAA 3RGPA 5IWAM 1I94M 3L25A 3FTCA 4MGZE 4JI1M 2Z4RA 4X64M 5EXPA 2RGOA 2Y21A 1T3TA 3LVWA 1YUBA 1R2YA 2YNMD 1IBLM 4AI6A 3CF2A 1KYIA 3KOZE 4IBBA 2ZAOA 1IBKM 1DO0A 1SXJE 4Z6YA 1E32A 3T1HM 3RFWA 2XZUA 3AOEC 3LMMA 1QZMA 2ERCA 3L27A 3UMMA 2DWLA 2CV0A 1DGBA 1IY1A 4LF5M 2JA2A 4DR5M 5ITQA 5DNYA 3GQ4A 2V1CA 4QHTA 4DV5M 1E9SA 4R7GA 4JV5M 3SAVA 4AG5A 1FNNA 5EP1A 4AQYM 1NVMA 3KVWA 4L78A 4NSRA 5ITYA 3T38A 2F5SA 4REZA 3K1JA 4WW0A 4LJAA 2KW0A 1IN5A 1HR0M 3M0EA 1IXRC 3ILKA 1D2NA 1TDHA 3U5ZB 3U6MA 4A3VB 1IN7A 1QAOA 1W5SA 2R4JA 3U6SA 4PDIA 2D7HA 4ZPXA 2XLJA 1QVRA 4PD2A 4GC5A 2KEBA 4NOOB 3KOWE 7CATA 3SASA 4AKHA 2KRUA 2Y20A 4YHHM 4GHLA 3VDUA 3Q8XA 3GP1A 1J5EM 3M7GA 4AZFA 4WURA 2M5ZA 2Q2EB 1QYRA 2R4EA 1OFHA 1NY5A 4GHAA 3FYDA 3UJNA 3FUUA 1R2ZA 5KQDA 4TUWA 4D81A 2VIIA 4Z8XA 4HL4A 4DUZM 3D8BA 3IG8A 5A2QS 1VDDA 5EQTA 3W0FA 1IBMM 1XHBA 4I4LA 4ITQA 4RF0A 2XEPA 3TE6A 1ZQ9A 2R45A 4B7GA 2FFJA 1L1ZA 1MU5A 4NXNM 4IBDA 2YFQA 4DV6M 4NRVA 4X66M 3KP0E 3LQRA 4G6ZA 5EP2A 4DV4M 1TH3A 2FNAA 4LJ7A 4M9ZA 1G3IA 2DVWB 3U6OA 3HJ8A 3GLFA 5ITXE 4QNMA 1HNXM 4LFCM 1LV7A 2I7PA 1HNZM 3LVVA 4DV7M 5KPTA 3JR5A 1XXHA 3AV0A 3E9SA 2HKJA 1SXJD 4FCTA 5ITRA 5C1BA 1IN8A 4MGHA 3U60B 1SXJB 2CHQA 1PJIA 3A98B 2DHRA 2Z3XA 4LGYA 3K8ZA 3KP1E 3SHFA 3U6PA 1G8PA 3HU3A 2L7IA 3R8FA 3GQ3A 2L6OA 4GH9A 2R46A 1IY2A 3HWSA 3MJ5A 2XFTA 3U60A 2KXEA 2QP9X 1SXJA 1N32M 2CEAA 3SATA 2V1UA 4LJ5A 3SYKA 4LRSA 4FW9A 3AFHA 4M9XA 3THGA 2VQEM 1G59A 2CV2A 1I4WA 2Z4SA 3TWKA 1K3WA 3J27B 2EUCA 4K0KM 5FTJA 3GRRA 5ITTA 3FYCA 3VLFB 3KDSE 4JN6A 4JYAM 3TL4X 1XNRM 4JI7M 3I4YA 3HU1A 1MX0A 2XF3A 2BJVA 1IN4A 4W5WA 4PDGA 2I7NA 5GKNA 1IM2A 4II7A 2OQ4A 1Z5AA 1WXQA 4X65M 3UGJA 1ORYB 1N77A 3I4VA 2UUBM 2QBYB 1OFIA 4GRIA 3WHLA 4QOZC 4IIWA 1JR3D 1NY6A 3U6LA 4G4QA 2X8AA 2KZSA 4JXJA 4LF9M 4GIPA 3A46A 3I51A 2VQFM 4IJEA 5E6JA 3TPZA 3VK7A 4B3RM 4JI6M 2Z7JA 1TDZA 1FJGM 3T1YM 1IXZA 2UXBM 2UXDM 2K47A 3SARA 2QBYA 4JI5M 3J80S 1KSFX 4IJFA 2QZ4A 4L4UA 1K3XA 2P5TA 3T15A 4LJ9A 1DGGA 2UUCM 4LF7M 2RGHA 3U6EA 2G5GX 3SBJA 4B3MM 2F5PA 5JI3E 1J09A 3HGIA 8CATA 3LQQA 5FTNA 1JR3A 2XFSA 5F3WA 4R3DA 1Z59A 4DUYM 2HL7A 3U5ZA 2NQ8C 3U6DA 3QWLA 1HQCA 3GRYA 3DZDA 3TWLA 2HHHM 2CV1A 3U6QA 3HJSA 2C96A 3WHKA 1C1KA 4DV0M 4BLCA 2AHMA 3PNYA 5BPVA 3FTEA 4FWDA 1GL6A 3SC3A 2KRKA 2H1RA 3FTDA 3OTOM 1NNJA 2Y0QA 3FUWA 3HHWA 3HHXA 4LG2A 1SXJC 5FLXS 3SHGB 2XH9A 5LMUM 3NWLA 3GLIB 5H37D 5ITXA 3QAUA 3L26A 1H6UA 4L16A 4LF8M 3KXEC 4LFAM 3JR4A 2O5RA 4FVMA 4JI4M 4GC9A 1HT1E 4JI2M 4FWHA 2W82A 3GQ5A 3DOAA 2Y0TA 1N33M 4LCBA 4IBFA 3L2AA 2J7OA 1HQYE 5DYIA 3GPPA 4IBCA 3KFUG 5EJCA 2ZM6M 5KPRA 2QCUA 1TGUA 2OPFA 2C5RA 4CGYB 2FE8A 4MGIE 4GKKM 5IZ7D 5LMNM 1XWIA 3KOXE 3RGSA 2RKOA 4I81A 1NJGA 4JI8M 5KO3A 3J81S 4IBIA 3HHZA 2KA6B 3W0LB 1PJJA 3TQSA 3HKPA 5FTLA 4G4RA 4DR2M 2ZAMA 2F4VM 2L7HA 4HLQA 4YY3M 1Z6TA 4G4NA 1G41A 5EXSA 5EXXA 2KZUA 4LJ8A 2ZANA 2LXEA 3AL0C 2LNHC 3SMPA 4MGYE 4LZJA 3K2LA 1QQWA 1J7KA 1HT2E 2EO2A 2V6ZM 4NRWA 4FCVA 2CHVA 5JI2E 2R62A 5EXTA 4AG6A 1N36M 4AW4A 1G4AE 2DWZB 2EA0A 2E5LM 2UUAM 4BB9A 1PM5A 1X37A 4S12A 3SAUA 4B7FA 2C99A 4LF6M 3C58A 4OX9M 3FD9A 1L2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q39 A;  5A2Q S;  3GPU A;  4JI5 M;  3J80 S;  3J7A S;  1Q3C A;  3W0F A;  1XMQ M;  1IBM M;  4ITQ A;  4G4O A;  1K3X A;  4LF7 M;  3GPY A;  2UUC M;  4LF4 M;  1Q3B A;  3U6E A;  3SBJ A;  4B3M M;  2UU9 M;  2F5P A;  1L1Z A;  1MU5 A;  4MB7 A;  4NXN M;  1L2D A;  4LFB M;  2F5Q A;  4DV6 M;  4DV3 M;  2ZBK B;  4NRV A;  4JI0 M;  4X66 M;  1Z59 A;  4DV4 M;  3A42 A;  4DUY M;  1KFV A;  3U6D A;  4NXM M;  3TWL A;  4X62 M;  2HHH M;  3U6O A;  4JI3 M;  4DR3 M;  3U6Q A;  4B3S M;  5ITX E;  4DV0 M;  1HNX M;  4LFC M;  1HNZ M;  2F5O A;  3GO8 A;  1L1T A;  4DV7 M;  1I94 M;  3OTO M;  5IWA M;  1NNJ A;  3JR5 A;  4KHP M;  2HKJ A;  5BR8 M;  5FLX S;  5ITR A;  4JI1 M;  5LMU M;  4X64 M;  1Z5B A;  5ITX A;  4B3T M;  1R2Y A;  4LF8 M;  1IBL M;  4LFA M;  3JR4 A;  1N34 M;  1PJI A;  1IBK M;  4JI4 M;  3T1H M;  4JI2 M;  4DR6 M;  2XZU A;  3GQ5 A;  3DOA A;  4PCZ A;  3U6P A;  1N33 M;  4DV2 M;  1Z5C A;  4LF5 M;  3GPP A;  3A45 A;  3GQ3 A;  5ITQ A;  4DR5 M;  1K82 A;  1XMO M;  3GQ4 A;  4CIS A;  2ZM6 M;  4DV5 M;  4JV5 M;  5ITU A;  2OPF A;  3SAV A;  1N32 M;  3SAT A;  4AQY M;  4GKK M;  2UXC M;  2VQE M;  5LMN M;  3TWK A;  1K3W A;  4K0K M;  4DR7 M;  3U6C A;  5ITT A;  5ITY A;  3GPX A;  4JYA M;  4JI8 M;  1XNR M;  2F5S A;  4JI7 M;  3J81 S;  1HR0 M;  1XNQ M;  1HNW M;  1MX0 A;  1PJJ A;  4DR1 M;  1TDH A;  4PDG A;  3U6M A;  4G4R A;  4DR2 M;  1XC8 A;  2F4V M;  2OQ4 A;  4YY3 M;  1Z5A A;  3U6S A;  4PDI A;  4X65 M;  4G4N A;  4DV1 M;  4PD2 A;  2UUB M;  2F5N A;  4DR4 M;  5IT9 S;  2XZF A;  3SAW A;  3SAS A;  3TWM A;  4YHH M;  4NRW A;  3GP1 A;  1J5E M;  3U6L A;  4G4Q A;  1N36 M;  2EA0 A;  2E5L M;  2UUA M;  3A46 A;  4LF9 M;  2Q2E B;  1PM5 A;  2VQF M;  4B3R M;  3VK7 A;  1EE8 A;  3SAU A;  4JI6 M;  1TDZ A;  1L2B A;  4GKJ M;  1R2Z A;  1FJG M;  3JAM S;  3T1Y M;  3VK8 A;  4LF6 M;  3C58 A;  4OX9 M;  2UXB M;  2UXD M;  4DUZ M;  3SAR A;  1L2C A; 
#chains in the Genus database with same CATH topology
 2DZN B;  3K92 A;  1Q39 A;  2BJW A;  3H4M A;  4NL4 H;  1XMQ M;  3EIH A;  2D7G A;  3KW6 A;  4G4O A;  3SYL A;  5FSW A;  2J7N A;  3CGW A;  3E21 A;  4M0W A;  4LF4 M;  1Q3B A;  3J2P B;  4UN2 B;  3MK6 A;  2UU9 M;  1N75 A;  3I04 M;  2FH0 A;  4MB7 A;  3SMS A;  3FKE A;  5FTM A;  3T6P A;  2CP8 A;  2JUJ A;  4LRT A;  4LFB M;  2F5Q A;  3KS8 A;  3AOG A;  2XSZ D;  4FCW A;  1QUT A;  4JI0 M;  2C9C A;  4IBG A;  3VKG A;  3PNV A;  2WSE F;  3PXG A;  3GLH B;  4NXM M;  3FUX A;  3J7B A;  1DO2 A;  2X4A A;  2DEN A;  3LW5 F;  3QYB A;  4KOD A;  3ZH9 B;  2QEN A;  3VKH A;  4KLN A;  5IRE B;  4B3S M;  1DGF A;  3BBZ A;  1QAQ A;  1OQY A;  2QSF X;  4MH0 E;  2K6B A;  3CTW B;  3AJI B;  4LJ4 A;  2DXI A;  3GRV A;  1L1T A;  4QOS A;  2CE7 A;  1IQP A;  2R65 A;  4IBE A;  2CFO A;  3KSX A;  4KHP M;  4OW0 A;  1GJS A;  2LVO C;  5KPZ A;  1NV9 A;  3MHV C;  5BR8 M;  3AKZ A;  2C9O A;  4AKG A;  4L15 A;  3C3D A;  4D82 A;  4GMQ A;  3GLH A;  1Z5B A;  2APL A;  3RE8 A;  2XGN A;  4B3T M;  3ZCB B;  4P16 A;  2XSZ A;  1N34 M;  4L8R C;  3FUV A;  1OIP A;  1R6B X;  4OU7 A;  1OTR A;  3W67 A;  1W5T A;  1S3S A;  5KQ8 A;  3KOY E;  4DR6 M;  1VEG A;  1WR1 B;  1E9R A;  3D8L A;  4PCZ A;  4IBJ A;  4XGI A;  3U61 B;  4DV2 M;  1Z5C A;  2GNO A;  1NV8 A;  1GVN A;  2KDL A;  1TH4 A;  5FTK A;  3A45 A;  2YQZ A;  1K82 A;  1XMO M;  4KO8 A;  4GIT A;  3CF6 E;  2L09 A;  1QAN A;  3I01 M;  3KSJ A;  1TF0 B;  3HHY A;  4CIS A;  1GO5 A;  1JQJ C;  1UM8 A;  3UZU A;  4CHT B;  1E94 E;  1GL7 A;  5ITU A;  4IBK A;  5C18 A;  3KS4 A;  3B74 A;  3L28 A;  4LZZ A;  2UXC M;  4XK8 F;  4LGM A;  4M9S A;  2JY7 A;  2M60 A;  2DI0 A;  1N78 A;  1CUK A;  4DR7 M;  3B9P A;  3SFZ A;  1NHW C;  1VG5 A;  3U6C A;  3CF0 A;  2LH0 A;  1PGY A;  1XB2 B;  3DFZ A;  3GPX A;  2DWM A;  4AKI A;  3U61 A;  4OVZ B;  4F2L A;  2X49 A;  3DA1 A;  3ZQJ A;  3PFI A;  1A5T A;  1WGL A;  2DZO B;  1NSF A;  1XNQ M;  4I8O A;  3R9X B;  3AOE A;  3HX3 A;  1YLA A;  4PT5 A;  1HNW M;  2D7E A;  1GKI A;  4DR1 M;  4RF1 A;  1TH2 A;  1XC8 A;  1L8Q A;  2LTU A;  3IG5 A;  3GLF B;  1ZAE A;  1QDR A;  1V92 A;  4NSO B;  2H5X A;  3E4R A;  1R7R A;  3GLI A;  4DV1 M;  1IN6 A;  1NJF A;  2F5N A;  1YE9 A;  4DR4 M;  4OVZ A;  5IT9 S;  2XZF A;  3SAW A;  2B3T A;  2LWX A;  3TWM A;  1QUS A;  1XXH B;  1NNU C;  3L29 A;  3GLG B;  2JZ0 A;  1D0M A;  2G8L A;  2FS1 A;  4GEW A;  2DKL A;  1RU3 A;  3IEC A;  4EIW A;  2YR0 A;  1OJL A;  1IY0 A;  4MGK E;  2C98 A;  1IXS B;  4LJ6 A;  2JXN A;  2BNK A;  3NBI A;  1DGH B;  1EE8 A;  1WJ7 A;  2CUZ A;  1L2B A;  4GKJ M;  1MJG M;  2CHG A;  3VDP A;  4D80 A;  1BVS A;  1YSY A;  3JAM S;  3VK8 A;  3PVS A;  4R71 A;  3GRU A;  2R18 A;  1QAM A;  3GPU A;  2KNA A;  4XBO A;  4B08 A;  1Q3C A;  3J7A S;  4QNR A;  3GLG A;  3GLF E;  2LVA A;  2CWB A;  3GPY A;  1P3Q Q;  1IXS A;  4FD2 A;  1WIV A;  5EP3 A;  1L2D A;  1GLN A;  3BOS A;  1DGH A;  4DV3 M;  2ZBK B;  4LY6 A;  3UK6 A;  2DWN A;  2MJ5 B;  2FOI C;  3A42 A;  1KFV A;  3FTF A;  3ZC7 B;  4BBA A;  2HCB A;  2QHO B;  4I5S A;  4X62 M;  5E26 A;  3K9O A;  4JI3 M;  4DR3 M;  5EP4 A;  3EIE A;  3FUT A;  1V34 A;  2QNJ A;  3HU2 A;  3HJQ A;  1ZMV A;  4QHS A;  4M0D A;  2F5O A;  3GO8 A;  1WGN A;  4MM3 B;  1NHG C;  5DYG A;  3VFD A;  4FWG A;  3M6A A;  4B7H A;  2A5Y B;  2MH8 A;  2QPA A;  4RNA A;  3RGP A;  5IWA M;  1I94 M;  3L25 A;  3FTC A;  3C3E A;  4MGZ E;  4JI1 M;  2Z4R A;  5L8R F;  5EXP A;  4X64 M;  2RGO A;  2Y21 A;  1T3T A;  3LVW A;  1YUB A;  1R2Y A;  2YNM D;  2MR9 A;  1IBL M;  3CF2 A;  4AI6 A;  1QDT A;  1KYI A;  3KOZ E;  4IBB A;  2ZAO A;  1IBK M;  1DO0 A;  1SXJ E;  4Z6Y A;  1E32 A;  3T1H M;  1AIP C;  3RFW A;  2XZU A;  3AOE C;  3LMM A;  1QZM A;  2ERC A;  3L27 A;  3UMM A;  2DWL A;  2CV0 A;  2O01 F;  1DGB A;  1IY1 A;  5DFL A;  4DBG B;  2ZTC A;  4LF5 M;  2KNV A;  2JA2 A;  3FE3 A;  4DR5 M;  5ITQ A;  5DNY A;  3GQ4 A;  2JY6 B;  2V1C A;  4QHT A;  1TR8 A;  4DV5 M;  1E9S A;  4R7G A;  4JV5 M;  3SAV A;  4AG5 A;  1FNN A;  5EP1 A;  4AQY M;  2DAK A;  1NVM A;  1D0L A;  3KVW A;  2K0B X;  4L78 A;  2KHH A;  4NSR A;  5ITY A;  1VEJ A;  3T38 A;  2DZL A;  2F5S A;  2DAE A;  4REZ A;  3K1J A;  4G3O A;  2VF7 A;  4LJA A;  2KW0 A;  1IN5 A;  4WW0 A;  1HR0 M;  3M0E A;  3FRH A;  1IXR C;  3ILK A;  1D2N A;  1TDH A;  3U5Z B;  3F92 A;  3U6M A;  4A3V B;  1IN7 A;  1QAO A;  1W5S A;  2R4J A;  3U6S A;  4PDI A;  4L6V 6;  3K9P A;  2D7H A;  2MRO B;  4ZPX A;  2XLJ A;  1T6O A;  1QVR A;  4PD2 A;  1VQ1 A;  2KEB A;  4GC5 A;  1PJS A;  2L4E A;  4NOO B;  2CRU A;  3KOW E;  7CAT A;  2LBC A;  3SAS A;  4AKH A;  2KRU A;  2Y20 A;  4YHH M;  1PJT A;  4GHL A;  3VDU A;  3Q8X A;  3GP1 A;  1J5E M;  3M7G A;  4AZF A;  4WUR A;  2M5Z A;  2Q2E B;  1QYR A;  2R4E A;  1OFH A;  1NY5 A;  4GHA A;  3FYD A;  3UJN A;  3FUU A;  1R2Z A;  2OO9 A;  5KQD A;  4TUW A;  4D81 A;  1JR3 E;  1UFZ A;  2VII A;  4Z8X A;  1ZMW A;  4HL4 A;  4DUZ M;  2JY8 A;  3D8B A;  3IG8 A;  1NO1 A;  3B89 A;  5A2Q S;  1VDD A;  4NC6 A;  5EQT A;  3W0F A;  1IBM M;  1XHB A;  4I4L A;  4ITQ A;  4RF0 A;  2VF8 A;  2XEP A;  3TE6 A;  2MGW A;  4F1I A;  1ZQ9 A;  1PRB A;  2HAK A;  2R45 A;  4B7G A;  2FFJ A;  3HZJ A;  1L1Z A;  4CIZ A;  1MU5 A;  4NXN M;  4IBD A;  2YFQ A;  4DV6 M;  1C7Y A;  4NRV A;  4X66 M;  3KP0 E;  3LQR A;  4G6Z A;  4WP2 A;  5EP2 A;  4DV4 M;  1GAB A;  1TH3 A;  2FNA A;  4LJ7 A;  3FRI A;  4M9Z A;  1OAI A;  1G3I A;  2DVW B;  3U6O A;  3HJ8 A;  3GLF A;  3LCU A;  5ITX E;  4QNM A;  1HNX M;  4LFC M;  1LV7 A;  2I7P A;  1HNZ M;  3LVV A;  4DV7 M;  2DAG A;  2L4F A;  5KPT A;  3JR5 A;  1XXH A;  3AV0 A;  3E9S A;  2HKJ A;  4KT0 F;  1SXJ D;  4FCT A;  5ITR A;  3C9P A;  3NBX X;  1IN8 A;  5C1B A;  4MGH A;  2G3Q A;  3U60 B;  3GLI E;  1SXJ B;  2LVN C;  2R44 A;  2CHQ A;  1PJI A;  3A98 B;  2DHR A;  1R4G A;  1HJP A;  2Z3X A;  4LGY A;  3K8Z A;  3KP1 E;  3SHF A;  3H4J A;  3U6P A;  1G8P A;  3HU3 A;  1VDL A;  2L7I A;  3R8F A;  1LTM A;  1Q02 A;  2L6O A;  4GH9 A;  2R46 A;  1IY2 A;  3HWS A;  3MJ5 A;  2J5Y A;  3GQ3 A;  2XFT A;  3U60 A;  2KXE A;  2QP9 X;  1SXJ A;  1N32 M;  2CEA A;  2JP7 A;  2N35 A;  3SAT A;  2V1U A;  4LJ5 A;  3SYK A;  4LRS A;  4FW9 A;  3AFH A;  2DHY A;  4M9X A;  3THG A;  4ANR A;  2VQE M;  1I4W A;  2Z4S A;  3TWK A;  1K3W A;  3J27 B;  2EUC A;  2CV2 A;  4K0K M;  5FTJ A;  3GRR A;  3QYE A;  5ITT A;  3FYC A;  3VLF B;  3KDS E;  4JN6 A;  4JYA M;  3TL4 X;  1XNR M;  4JI7 M;  3I4Y A;  1TTE A;  3HU1 A;  2GQF A;  3V76 A;  1MX0 A;  2XF3 A;  2BJV A;  1IN4 A;  4W5W A;  4PDG A;  2I7N A;  2LVQ D;  5GKN A;  1IM2 A;  4II7 A;  2JWS A;  1Z5A A;  1WXQ A;  2OQ4 A;  4X65 M;  2R0I A;  3UGJ A;  1IFY A;  2DAM A;  1ORY B;  1N77 A;  3I4V A;  2UUB M;  2BWB A;  2QBY B;  2EKF A;  1OFI A;  4GRI A;  3W68 A;  3WHL A;  4QOZ C;  4IIW A;  1AUA A;  1JR3 D;  1OIZ A;  1NY6 A;  2O25 A;  4G4Q A;  3U6L A;  1V33 A;  2KZS A;  2X8A A;  4JXJ A;  4GIP A;  3A46 A;  4LF9 M;  3I51 A;  3E46 A;  2JZ1 A;  2VQF M;  4IJE A;  5E6J A;  3TPZ A;  3VK7 A;  4B3R M;  4JI6 M;  2Z7J A;  2EKK A;  2Z8Y M;  1TDZ A;  1FJG M;  3T1Y M;  2WZJ A;  1IXZ A;  2UXB M;  2UXD M;  2K47 A;  3SAR A;  2QBY A;  1ZMU A;  4JI5 M;  3J80 S;  2LHG A;  1KSF X;  4IJF A;  2QZ4 A;  4L4U A;  3Q8G A;  1K3X A;  2P5T A;  3T15 A;  2JNH A;  1DGG A;  4LJ9 A;  1VEK A;  2UUC M;  1T43 A;  2RGH A;  2L2D A;  4P17 A;  3U6E A;  2G5G X;  3SBJ A;  4B3M M;  2F5P A;  5JI3 E;  1J09 A;  3HGI A;  8CAT A;  2LHC A;  3LQQ A;  5FTN A;  3BXW A;  1JR3 A;  2XFS A;  5F3W A;  4R3D A;  2WSF F;  1Z59 A;  1SG9 A;  4DUY M;  2HL7 A;  3U5Z A;  4HEO A;  2NQ8 C;  3U6D A;  3QWL A;  1HQC A;  3GRY A;  3DZD A;  3TWL A;  2HHH M;  2QQ8 A;  2CV1 A;  2K9D A;  3GLH E;  3HJS A;  2C96 A;  3B7Q A;  2OOB A;  3WHK A;  3U6Q A;  1C1K A;  4DV0 M;  4BLC A;  1WHC A;  2AHM A;  2R6F A;  3PNY A;  5BPV A;  3FTE A;  4FWD A;  1GL6 A;  3SC3 A;  2KRK A;  2KNZ A;  2H1R A;  3LCV B;  3FTD A;  3OTO M;  1NNJ A;  2Y0Q A;  3FUW A;  3HHW A;  3HHX A;  4LG2 A;  1SXJ C;  5FLX S;  3SHG B;  2XH9 A;  5LMU M;  3NWL A;  2RRU A;  3GLI B;  5H37 D;  5ITX A;  3QAU A;  3L26 A;  1H6U A;  4L16 A;  4LF8 M;  3KXE C;  4LFA M;  3JR4 A;  2O5R A;  4FVM A;  4JI4 M;  2LVP C;  3IHP A;  1JB0 F;  1EFU B;  1HT1 E;  4GC9 A;  4CJ6 A;  4JI2 M;  4FWH A;  2W82 A;  3GQ5 A;  1PJQ A;  1EIJ A;  3DOA A;  2Y0T A;  1N33 M;  4LCB A;  4IBF A;  1QZE A;  4RKU F;  2JY5 A;  3L2A A;  2J7O A;  1HQY E;  4Q7J A;  5DYI A;  3GPP A;  1G59 A;  4IBC A;  3KFU G;  5EJC A;  2ZM6 M;  5KPR A;  2QCU A;  1TGU A;  2VDB B;  2OPF A;  2C5R A;  4CGY B;  4Y28 F;  2FE8 A;  4MGI E;  4GKK M;  5IZ7 D;  5LMN M;  1XWI A;  2HWJ A;  3KOX E;  3RGS A;  2RKO A;  4I81 A;  1NJG A;  1ZV1 A;  3B7Z A;  2DAI A;  4JI8 M;  5KO3 A;  3J81 S;  4IBI A;  3HHZ A;  2KA6 B;  3W0L B;  1PJJ A;  3TQS A;  3HKP A;  5FTL A;  1G71 A;  4G4R A;  2ZAM A;  4DR2 M;  2F4V M;  2L7H A;  4HLQ A;  1MN3 A;  1F4I A;  4YY3 M;  2OOA A;  1Z6T A;  4G4N A;  1G41 A;  3MMP A;  5EXS A;  2KZU A;  4LJ8 A;  5EXX A;  2ZAN A;  2LXE A;  3AL0 C;  2LNH C;  3SMP A;  2DNA A;  4MGY E;  4LZJ A;  3K2L A;  1DV0 A;  1QQW A;  1GJT A;  1J7K A;  1HT2 E;  2ZTD A;  1R5L A;  2EO2 A;  2V6Z M;  4NRW A;  4FCV A;  2CHV A;  5JI2 E;  1OKS A;  2R62 A;  5EXT A;  4AG6 A;  1XXH E;  1N36 M;  4AW4 A;  3B7N A;  3GLG E;  1G4A E;  2DWZ B;  2EA0 A;  1OAO C;  1Y8G A;  2EJS A;  2E5L M;  2UUA M;  4BB9 A;  1PM5 A;  2BWE A;  1X37 A;  4S12 A;  3SAU A;  4LF7 M;  4B7F A;  2C99 A;  2WSC F;  4LF6 M;  3C58 A;  1D0K A;  3HY5 A;  4OX9 M;  3FD9 A;  1L2C A; 
#chains in the Genus database with same CATH homology
 2DZN B;  3K92 A;  1Q39 A;  2BJW A;  3H4M A;  4NL4 H;  1XMQ M;  3EIH A;  2D7G A;  3KW6 A;  4G4O A;  3SYL A;  5FSW A;  2J7N A;  4M0W A;  4LF4 M;  1Q3B A;  3J2P B;  2UU9 M;  3MK6 A;  1N75 A;  4MB7 A;  3SMS A;  3FKE A;  5FTM A;  4LRT A;  4LFB M;  2F5Q A;  3KS8 A;  3AOG A;  2XSZ D;  4FCW A;  4JI0 M;  2C9C A;  4IBG A;  3VKG A;  3PNV A;  3PXG A;  3GLH B;  4NXM M;  3FUX A;  3J7B A;  1DO2 A;  2X4A A;  4KOD A;  3VKH A;  3ZH9 B;  2QEN A;  4KLN A;  5IRE B;  4B3S M;  1DGF A;  1QAQ A;  4MH0 E;  3CTW B;  3AJI B;  4LJ4 A;  2DXI A;  3GRV A;  1L1T A;  4QOS A;  2CE7 A;  1IQP A;  2R65 A;  4IBE A;  2CFO A;  3KSX A;  4KHP M;  4OW0 A;  5KPZ A;  3MHV C;  5BR8 M;  3AKZ A;  2C9O A;  4AKG A;  4L15 A;  4D82 A;  4GMQ A;  3GLH A;  1Z5B A;  3RE8 A;  2XGN A;  4B3T M;  3ZCB B;  4P16 A;  2XSZ A;  1N34 M;  4L8R C;  3FUV A;  1R6B X;  4OU7 A;  1W5T A;  1S3S A;  5KQ8 A;  3KOY E;  4DR6 M;  1E9R A;  3D8L A;  4PCZ A;  4IBJ A;  4XGI A;  3U61 B;  4DV2 M;  1Z5C A;  1GVN A;  1TH4 A;  5FTK A;  3A45 A;  2YQZ A;  1K82 A;  1XMO M;  4KO8 A;  4GIT A;  3CF6 E;  2L09 A;  1QAN A;  3KSJ A;  3HHY A;  4CIS A;  1JQJ C;  1UM8 A;  3UZU A;  4CHT B;  1E94 E;  1GL7 A;  5ITU A;  4IBK A;  5C18 A;  3KS4 A;  3L28 A;  4LZZ A;  2UXC M;  4LGM A;  4M9S A;  2M60 A;  1N78 A;  4DR7 M;  3B9P A;  3SFZ A;  1NHW C;  3U6C A;  2DWM A;  3CF0 A;  2LH0 A;  3GPX A;  3DFZ A;  4AKI A;  3U61 A;  4OVZ B;  2X49 A;  3DA1 A;  3PFI A;  2DZO B;  1NSF A;  1XNQ M;  4I8O A;  3R9X B;  3AOE A;  1HNW M;  4PT5 A;  2D7E A;  1GKI A;  4DR1 M;  4RF1 A;  1TH2 A;  1XC8 A;  1L8Q A;  3IG5 A;  3GLF B;  1ZAE A;  4NSO B;  3E4R A;  3GLI A;  1R7R A;  4DV1 M;  1IN6 A;  1NJF A;  2F5N A;  1YE9 A;  4DR4 M;  4OVZ A;  5IT9 S;  2XZF A;  3SAW A;  2LWX A;  3TWM A;  1XXH B;  1NNU C;  3L29 A;  3GLG B;  2G8L A;  4EIW A;  2YR0 A;  1OJL A;  1IY0 A;  4MGK E;  2C98 A;  1IXS B;  4LJ6 A;  2BNK A;  3NBI A;  1DGH B;  1EE8 A;  1L2B A;  2CUZ A;  4GKJ M;  2CHG A;  3VDP A;  4D80 A;  1YSY A;  3JAM S;  3VK8 A;  3PVS A;  3GRU A;  2R18 A;  1QAM A;  3GPU A;  4XBO A;  4B08 A;  1Q3C A;  3J7A S;  4QNR A;  3GLG A;  3GPY A;  4FD2 A;  5EP3 A;  1L2D A;  1GLN A;  3BOS A;  1DGH A;  4DV3 M;  2ZBK B;  4LY6 A;  3UK6 A;  2DWN A;  2FOI C;  3A42 A;  1KFV A;  3FTF A;  3ZC7 B;  4BBA A;  2HCB A;  4I5S A;  4X62 M;  5E26 A;  4JI3 M;  4DR3 M;  5EP4 A;  3EIE A;  3FUT A;  3HU2 A;  3HJQ A;  4QHS A;  4M0D A;  2F5O A;  3GO8 A;  4MM3 B;  1NHG C;  5DYG A;  3VFD A;  4FWG A;  3M6A A;  4B7H A;  2A5Y B;  2QPA A;  4RNA A;  3RGP A;  5IWA M;  1I94 M;  3L25 A;  3FTC A;  4MGZ E;  4JI1 M;  2Z4R A;  4X64 M;  5EXP A;  2RGO A;  2Y21 A;  1T3T A;  3LVW A;  1YUB A;  1R2Y A;  2YNM D;  1IBL M;  4AI6 A;  3CF2 A;  1KYI A;  3KOZ E;  4IBB A;  2ZAO A;  1IBK M;  1DO0 A;  1SXJ E;  4Z6Y A;  1E32 A;  3T1H M;  3RFW A;  2XZU A;  3AOE C;  3LMM A;  1QZM A;  2ERC A;  3L27 A;  3UMM A;  2DWL A;  2CV0 A;  1DGB A;  1IY1 A;  4LF5 M;  2JA2 A;  4DR5 M;  5ITQ A;  5DNY A;  3GQ4 A;  2V1C A;  4QHT A;  4DV5 M;  1E9S A;  4R7G A;  4JV5 M;  3SAV A;  4AG5 A;  1FNN A;  5EP1 A;  4AQY M;  1NVM A;  3KVW A;  4L78 A;  4NSR A;  5ITY A;  3T38 A;  2F5S A;  4REZ A;  3K1J A;  4WW0 A;  4LJA A;  2KW0 A;  1IN5 A;  1HR0 M;  3M0E A;  1IXR C;  3ILK A;  1D2N A;  1TDH A;  3U5Z B;  3U6M A;  4A3V B;  1IN7 A;  1QAO A;  1W5S A;  2R4J A;  3U6S A;  4PDI A;  2D7H A;  4ZPX A;  2XLJ A;  1QVR A;  4PD2 A;  4GC5 A;  2KEB A;  4NOO B;  3KOW E;  7CAT A;  3SAS A;  4AKH A;  2KRU A;  2Y20 A;  4YHH M;  4GHL A;  3VDU A;  3Q8X A;  3GP1 A;  1J5E M;  3M7G A;  4AZF A;  4WUR A;  2M5Z A;  2Q2E B;  1QYR A;  2R4E A;  1OFH A;  1NY5 A;  4GHA A;  3FYD A;  3UJN A;  3FUU A;  1R2Z A;  5KQD A;  4TUW A;  4D81 A;  2VII A;  4Z8X A;  4HL4 A;  4DUZ M;  3D8B A;  3IG8 A;  5A2Q S;  1VDD A;  5EQT A;  3W0F A;  1IBM M;  1XHB A;  4I4L A;  4ITQ A;  4RF0 A;  2XEP A;  3TE6 A;  1ZQ9 A;  2R45 A;  4B7G A;  2FFJ A;  1L1Z A;  1MU5 A;  4NXN M;  4IBD A;  2YFQ A;  4DV6 M;  4NRV A;  4X66 M;  3KP0 E;  3LQR A;  4G6Z A;  5EP2 A;  4DV4 M;  1TH3 A;  2FNA A;  4LJ7 A;  4M9Z A;  1G3I A;  2DVW B;  3U6O A;  3HJ8 A;  3GLF A;  5ITX E;  4QNM A;  1HNX M;  4LFC M;  1LV7 A;  2I7P A;  1HNZ M;  3LVV A;  4DV7 M;  5KPT A;  3JR5 A;  1XXH A;  3AV0 A;  3E9S A;  2HKJ A;  1SXJ D;  4FCT A;  5ITR A;  5C1B A;  1IN8 A;  4MGH A;  3U60 B;  1SXJ B;  2CHQ A;  1PJI A;  3A98 B;  2DHR A;  2Z3X A;  4LGY A;  3K8Z A;  3KP1 E;  3SHF A;  3U6P A;  1G8P A;  3HU3 A;  2L7I A;  3R8F A;  3GQ3 A;  2L6O A;  4GH9 A;  2R46 A;  1IY2 A;  3HWS A;  3MJ5 A;  2XFT A;  3U60 A;  2KXE A;  2QP9 X;  1SXJ A;  1N32 M;  2CEA A;  3SAT A;  2V1U A;  4LJ5 A;  3SYK A;  4LRS A;  4FW9 A;  3AFH A;  4M9X A;  3THG A;  2VQE M;  1G59 A;  2CV2 A;  1I4W A;  2Z4S A;  3TWK A;  1K3W A;  3J27 B;  2EUC A;  4K0K M;  5FTJ A;  3GRR A;  5ITT A;  3FYC A;  3VLF B;  3KDS E;  4JN6 A;  4JYA M;  3TL4 X;  1XNR M;  4JI7 M;  3I4Y A;  3HU1 A;  1MX0 A;  2XF3 A;  2BJV A;  1IN4 A;  4W5W A;  4PDG A;  2I7N A;  5GKN A;  1IM2 A;  4II7 A;  2OQ4 A;  1Z5A A;  1WXQ A;  4X65 M;  3UGJ A;  1ORY B;  1N77 A;  3I4V A;  2UUB M;  2QBY B;  1OFI A;  4GRI A;  3WHL A;  4QOZ C;  4IIW A;  1JR3 D;  1NY6 A;  3U6L A;  4G4Q A;  2X8A A;  2KZS A;  4JXJ A;  4LF9 M;  4GIP A;  3A46 A;  3I51 A;  2VQF M;  4IJE A;  5E6J A;  3TPZ A;  3VK7 A;  4B3R M;  4JI6 M;  2Z7J A;  1TDZ A;  1FJG M;  3T1Y M;  1IXZ A;  2UXB M;  2UXD M;  2K47 A;  3SAR A;  2QBY A;  4JI5 M;  3J80 S;  1KSF X;  4IJF A;  2QZ4 A;  4L4U A;  1K3X A;  2P5T A;  3T15 A;  4LJ9 A;  1DGG A;  2UUC M;  4LF7 M;  2RGH A;  3U6E A;  2G5G X;  3SBJ A;  4B3M M;  2F5P A;  5JI3 E;  1J09 A;  3HGI A;  8CAT A;  3LQQ A;  5FTN A;  1JR3 A;  2XFS A;  5F3W A;  4R3D A;  1Z59 A;  4DUY M;  2HL7 A;  3U5Z A;  2NQ8 C;  3U6D A;  3QWL A;  1HQC A;  3GRY A;  3DZD A;  3TWL A;  2HHH M;  2CV1 A;  3U6Q A;  3HJS A;  2C96 A;  3WHK A;  1C1K A;  4DV0 M;  4BLC A;  2AHM A;  3PNY A;  5BPV A;  3FTE A;  4FWD A;  1GL6 A;  3SC3 A;  2KRK A;  2H1R A;  3FTD A;  3OTO M;  1NNJ A;  2Y0Q A;  3FUW A;  3HHW A;  3HHX A;  4LG2 A;  1SXJ C;  5FLX S;  3SHG B;  2XH9 A;  5LMU M;  3NWL A;  3GLI B;  5H37 D;  5ITX A;  3QAU A;  3L26 A;  1H6U A;  4L16 A;  4LF8 M;  3KXE C;  4LFA M;  3JR4 A;  2O5R A;  4FVM A;  4JI4 M;  4GC9 A;  1HT1 E;  4JI2 M;  4FWH A;  2W82 A;  3GQ5 A;  3DOA A;  2Y0T A;  1N33 M;  4LCB A;  4IBF A;  3L2A A;  2J7O A;  1HQY E;  5DYI A;  3GPP A;  4IBC A;  3KFU G;  5EJC A;  2ZM6 M;  5KPR A;  2QCU A;  1TGU A;  2OPF A;  2C5R A;  4CGY B;  2FE8 A;  4MGI E;  4GKK M;  5IZ7 D;  5LMN M;  1XWI A;  3KOX E;  3RGS A;  2RKO A;  4I81 A;  1NJG A;  4JI8 M;  5KO3 A;  3J81 S;  4IBI A;  3HHZ A;  2KA6 B;  3W0L B;  1PJJ A;  3TQS A;  3HKP A;  5FTL A;  4G4R A;  4DR2 M;  2ZAM A;  2F4V M;  2L7H A;  4HLQ A;  4YY3 M;  1Z6T A;  4G4N A;  1G41 A;  5EXS A;  5EXX A;  2KZU A;  4LJ8 A;  2ZAN A;  2LXE A;  3AL0 C;  2LNH C;  3SMP A;  4MGY E;  4LZJ A;  3K2L A;  1QQW A;  1J7K A;  1HT2 E;  2EO2 A;  2V6Z M;  4NRW A;  4FCV A;  2CHV A;  5JI2 E;  2R62 A;  5EXT A;  4AG6 A;  1N36 M;  4AW4 A;  1G4A E;  2DWZ B;  2EA0 A;  2E5L M;  2UUA M;  4BB9 A;  1PM5 A;  1X37 A;  4S12 A;  3SAU A;  4B7F A;  2C99 A;  4LF6 M;  3C58 A;  4OX9 M;  3FD9 A;  1L2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...