4GKUA

Crystal structure of beta lactamase in pet-15b
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Crystal structure of beta lactamase in PET-15B
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4gkuA00
3C4PA 1DJBA 5E2GA 1FOFA 2JE5A 5M18A 4PPRA 3Q81A 2P74A 2J9PA 3PBOA 4L0LA 4GNUA 3UE1A 4KZ4A 2IWCA 3V5MA 5F83A 1VM1A 3W8KA 1GA0A 4JKTA 4X6TA 4M3KA 3WS4A 1LI0A 3FKVA 5GLAA 1FR1A 4KENB 2Y2NA 3E2KA 5EE8A 5GHYA 4N1XA 2Y2KA 1MPLA 2EX9A 1W8YA 3BFDA 3HLBA 5EVIB 2ZC3B 3HLEA 2XFTA 4K0WA 4GZBA 5CRFA 1K25A 1IYSA 2DCFA 3C7UA 4MEZA 4X56A 2XQZA 1KGGA 2WGWB 4RX2A 5HARA 1IKGA 1L0DA 2UWXA 2Q9MA 2BLSA 3I7JA 1BLHA 4JXGA 2WZXA 5DVAA 3OPLA 3GRJA 3ITAA 3O87A 5FI2A 3GSGA 3WWXA 1DJAA 4HESA 4GD8A 4R3JA 3PBNA 3GQZA 2WGWA 3PTEA 5E43A 3G34A 3Q07A 2ZLYA 2R9WA 2WKHA 3UN7A 4IEDA 4R1GA 4WBGA 1NXYA 1RP5A 1XGJA 2ZM0A 3VP4A 4E3JA 1K4FA 4JXWA 4JF5A 1LHYA 3OPHA 4JXSA 5I94A 5FAPA 4S2NC 1NZUA 4OPYA 2Y2OA 5FQ9A 4KZBA 3DW0A 4LV3A 5E2HA 2A3UA 1K38A 5KSCA 4UAAA 5JYPA 1E25A 2HDQA 2R9XA 2WUQA 2G2UA 2BG1A 3SOIA 3SS3A 2Y2IA 5CHUA 4B88A 1Z6FA 4DF6A 1PZPA 3UDIA 5DF9A 5CTNA 2ZD8A 1KE4A 3M6BA 2P9VB 3UDXA 4OVDA 1O07A 2EXBA 1K57C 4EBPA 4ZAMA 2Y91A 3DTMA 1ZKJA 4QU3A 1YT4A 1PI5A 1KGFA 1HZOA 4D2OA 4PM7A 3BLSA 2ZC5B 5EPHA 1PWCA 4E3MA 4OQGA 1FCMA 4X55A 4BL2A 4S2MA 2X71A 3BEBA 4R4RA 4OH0A 2GDNA 4N92A 1NY0A 1ZG4A 1CK3A 4WMCD 4PM5A 4RA7A 1L0GA 1EWZA 4BD1A 1G6AA 3M6HA 3W4OA 2XH9A 1JTDA 3W4PA 3C4OA 3FKWA 4GB7A 3SS4A 1JTGA 1JWPA 3M2JA 2WGVA 1K4EA 3A3DA 4JLFA 3Q82A 5F1GA 2PU4A 3ZVTA 3BFEA 4OQHA 2EX2A 5D3OA 3ZCZA 3C5AA 4EQIA 1ERQA 5M19A 3IWQA 3WS0A 1SDEA 1E3UA 2H0TA 1M6KA 2WADA 1BSGA 3FWLA 2JBFA 1DJCA 4PMAA 3UPNA 5EVLA 3VOYA 4KQRA 1G68A 3CG5A 4B4XA 2XEPA 5FASA 4C75A 1FCNA 3A3FA 3IF6C 4OP8A 2OLUA 1ZC2A 3GR2A 1W7FA 2RL3A 3N7WA 4R3BA 1M40A 3OPPA 2PBYA 4YFMA 4FH2A 1N9BA 5A92A 5KMWA 4C3QA 2Y2HA 5HW3A 5DF8A 3FV7A 1K6RA 3OZHA 1MWSA 3NDEA 1KVMA 3V3SA 4EBLA 2Y2JA 3TSGA 2ZC4B 4DE3A 3WS2A 1NYYA 4P87A 1WYCA 1NRFA 3B3XA 4GKUA 4MBFA 1SHVA 1BULA 4JF6A 4WYYA 4OLGA 1PW1A 4N9LA 4WM9A 5GL9A 4MNRA 1YM1A 1K55C 4YINA 4UA6A 1ONHA 1MBLA 1W8QA 5F82A 4DKIA 5EUAA 4CPKA 1IYQA 2ZM8A 4XUZA 3HLDA 5F1FA 2G2WA 4DE1A 4LV0A 1ESIA 4LV1A 1RGZA 1PW8A 1HVBA 1ES2A 4GN2A 4KZ7A 2OV5A 5FQJA 1IELA 1W5DA 4LCMA 2H0YA 3RXXA 1ONGA 1CI8A 1IEMA 1MWTA 2J8YA 4N9KA 4DDYA 5GHXA 2EFUA 2RCXA 5JYOA 2OLVA 4QHCA 1BTLA 4BLMA 1FSWA 1BT5A 5FI7A 2V2FF 2XLNA 3GMWA 3SS5A 3PAEA 4X68A 4U0TA 4DRTA 1XXMA 4LCLA 4S2IA 2DNSA 5EVIA 4DE0A 1XA1A 4GD6A 3UE0A 3ZG0A 1K56D 1H8ZA 3IXHA 1K6SA 4MBKA 1KE0A 3QHYA 1XKZA 2X01A 5TGFA 4CJNA 2HP5A 4NETA 4ZDXA 4BJPA 2ZM2A 1BLSA 2PU2A 3PBRA 3VFFA 5HAQA 2XF3A 2WGIA 1ERMA 3VP0A 3WRTA 1LL5A 1K54A 4WEKA 4HBUA 1JVJA 2Z2LB 2HP9A 2Y4AA 3JYIA 4RYEA 3ZDJA 3UPOA 5CHMA 1IYPA 3IF6B 4LV2A 3QNCA 4ZTKA 3FZCA 4PM6A 5DTSA 4R23A 1MWUA 4R4SA 2I72A 2Q9NA 1C3BA 3BFGA 5G18A 4KZ8A 4QB8A 3O88A 3G2YA 4EUZA 3NIAA 1FCOA 1YMXA 3TOIA 3HLGA 4P6BA 1PIOA 2ZC6B 1J9MA 2ZQ8A 2HPBA 2XFSA 3UPPA 1I5QA 4IVIA 2ZQDA 5FA7A 2XD1A 5FATA 1YLWA 3ZHHA 2XDMA 5AQ7A 3VMAA 3DWZA 4UA7A 4EV4A 1H5XA 4DXBA 2P9VA 1HD8A 3HVFA 4OONA 1O7EA 4WELA 4KZAA 2HDSA 3HUOA 3VSKA 1CEGA 4ZJ2A 5EECA 4DDSA 3IWIA 3EQUA 3P98A 4HEFA 3MXRA 3HREA 3BFCA 4WZ5A 1BUEA 4IVKA 3IHBA 3GTCA 2V20A 4GDBA 4E6XA 4BD0A 4OKPA 2E8IA 2XD5A 1PWDA 4Y7PA 4BL3A 1H8YA 5IHVA 1ES3A 4K0XA 4OPQA 3MFDA 4MBHA 1NYMA 2J9OA 3C7VA 3PBSA 3A3EA 5TFQA 3ZG7B 3UY6A 3ISGA 3ITBA 1NZOA 4GOGA 3BYDA 1YQSA 2HDUA 4JF4A 3O86A 4Z9QA 3FYZA 2A49A 2OSUA 1GA9A 5FAOA 1MWRA 1N4OA 1Y54A 4U0XA 1MY8A 5E2EA 3V3RA 4OLDA 2XGNA 3NCKA 1XGIA 2Y2MA 3NDGA 5GLCA 3LO7A 1QMEA 4P0MA 3Q7VB 1ES5A 4E3LA 5BOHA 3V50A 5J8XA 4OOLA 5AQBA 3S22A 4KG6A 4U3TA 1SKFA 2EXAA 5CEDA 3M2KA 4FD8A 1GHMA 1L0EA 2WYXA 4OQ0A 4WMCA 1OMEA 3Q7VA 2ZQ9A 3IXGA 4EBNA 3MZDA 2X02A 1PZOA 1GHIA 2HDRA 1VQQA 4F94A 1WE4A 3E2LA 3LY3A 5CGSA 3G32A 4X69A 3BLMA 3ZNYA 3ZG5A 3ZG8B 3EQVA 4S2PA 3BFFA 3MKFA 4OP5A 3RJUA 3DWKA 4S2NA 1FR6A 1KDSA 2C6WB 3S1YA 3VP1A 1BLPA 1TDGA 4S2OA 5FSRA 1Q2PA 1XPBA 4O7DA 4A5RA 3VP2A 3WRZA 2EX8A 3LEZA 4LENA 1LL9A 5TR7A 1TEMA 5HX9A 3LCEA 3G4PA 3N8RA 4KG2A 1K57A 4S2LA 1YLZA 3SH9A 1CI9A 3IXBA 4IBXA 3LY4A 5FQKA 4X53A 3UDFA 1SDNA 4EWFA 3ZNTA 5L2FA 3G35A 3Q1FA 1GCEA 4DE2A 1MKIA 1MXOA 2V1ZA 3HL9A 3VP3A 3AGFA 3CMZA 3N8SA 5AQ9A 3AGDA 4WZ5C 1BLCA 1XA7A 2ZJ9A 3MZEA 3NI9A 4JPMA 4FSFA 5U47A 4E3OA 2QMIA 3VFHA 1PYYA 4B4ZA 2EFXA 2ZMAA 5KZHA 1YMSA 3OCLA 3ZGAB 5HAPA 1CEFA 3OPRA 3WS5A 1QMFA 3PBQA 4QJGA 4KQQA 4WEJA 4RVAA 1BZAA 1XX2A 2QZ6A 3OCNA 3A3IA 1RGYA 2ZQAA 2QPNA 1EROA 3A3JA 2H5SA 3GV9A 2EX6A 2Z2MB 4UA9A 4C6YA 3RXWA 2IWBA 3UO9A 4BQMA 1GHPA 4WZ4A 1W79A 5EOOA 1LLBA 3G30A 3N4IA 4PM8A 2DRWA 4QY5A 4E3IA 2WAEA 5AQAA 3V39A 3AGEA 4KZ6A 1PWGA 4OQIA 4E6WA 3IF6A 3QNBA 3HLWA 4KZ5A 1KGEA 5A91A 3HBRA 3PAGA 4S2JA 5FAQA 5FQQA 4R0QA 4BENA 4OPRA 4RX3A 1YLPA 3VOZA 2ZC7A 1TVFA 3BECA 3CJMA 4UHUA 3GVBA 4FH4A 5CHJA 4QD4A 3IT9A 4ID4A 1K56A 3SH8A 3NBLA 4E3KA 5HL1A 2WZZA 1JWVA 3O3VA 1EI5A 1ZG6A 3HUMA 3W4QA 4Y0TA 3HLFA 3IWOA 1ESUA 3S4XA 3D4FA 1L0FA 3IH8A 4HBTA 2C5WB 1YLJA 1RCJA 2JC7A 3IHAA 3IQAA 4OPZA 4OOMA 5HAIA 5M1AA 4GDNA 1K55A 1NJ4A 1L2SA 2WKIA 1E3UD 2Y2LA 4N1HA 2XR0A 4E3NA 3ZVWA 1KDWA 4ZJ3A 1I2SA 2FFYA 4JBFA 5E2FA 5CERA 5A93A 1KVLA 3G31A 4S2KA 3HUNA 5EOEA 5CECA 1ES4A 3IXDA 5CTMA 3UNWA 5GHZA 4JXVA 5DTKA 1YLYA 2WKEA 2Y2PA 1HTZA 3UE3A 2Y59A 1IKIA 5CXWA 5DF7A 1YLTA 1KE3A 3Q7ZA 1AXBA 1WYBA 3NC8A 4ZJ1A 3ZG9B 1I2WA 3SH7A 3IH9A 2FFFB 5EVIC 3ZFZA 2WAFA 4Q8IA 2VGJA 1XP4A 3BRMA 4KQOA 2Y2GA 5HFOA 1E4DA 2JCHA 2WK0A 4KZ9A 3HLCA 1ALQA 4XUXA 1LI9A 3MXSA 4KG5A 4XXRA 1SCWA 2CC1A 5GLDA 4MLLA 1K54C 3PBTA 4DXCA 1DY6A 2B5RA 4OOYA 2XK1A 5FQIA 2H10A 1FSYA 1Q2QA 5FDHA 1FQGA 3WS1A 3TG9A 5FI6A 4H8RA 2VGKA 3MKEA 1PI4A 3P09A 3MZFA 5CGXA 4KZ3A 1TDLA 5KSHA 3OC2A 5A90A 4P85A 1IYOA 4FCFA 1JWZA 1U60A 1S0WA 4QY6A 3G2ZA 2J7VA 3MBZA 4Y0UA 3N6IA 4K91A 4NK3A 3CZDA 5CEBA 3IF5A 2IWDA 4IBRA 1S6RA 4ZBEA 4Y0OA 5GLBA 4PM9A 3N8LA 3VSLA 2Y55A 2Y2QA 2ZQ7A 2ZQCA 5EVID 3BM6A 3NY4A 5DTTA 5FQMA 2HP6A 5CGWA
chains in the Genus database with same CATH superfamily
3QP5A 4L0LA 2GNXA 3V5MA 5MC7A 3W8KA 1GA0A 4HP4A 1LI0A 3FKVA 3E2KA 2QJ7A 4N1XA 4H6JA 1W8YA 3LGOA 5HD3A 3HLBA 1T1BA 2XFTA 4GZBA 2DCFA 1IYSA 3LI8A 3D72A 1F5MA 3C7UA 1Y4OA 1KGGA 2WGWB 1UWNX 4Y15A 1IKGA 2BLSA 5DVAA 3VE3A 5E43A 3Q07A 2R9WA 4R1GA 4WBGA 5J4EA 3UB8A 1VHMA 4JF5A 4UQIM 1OTAA 2Y2OA 5FQ9A 4KZBA 2J3TD 4B88A 1Z6FA 1PZPA 2ZD8A 5IU1A 4OVDA 1O07A 1K57C 4ZAMA 2Y91A 1PI5A 1HZOA 4D2OA 4Q0JA 1PWCA 3BY9A 4N92A 1CK3A 2V8FA 2XH9A 1JTDA 3C4OA 1AWIA 4LPZA 3M2JA 2WGVA 1K4EA 4NG2A 1ERQA 2KOIA 2G7UA 3WS0A 1M6KA 2JBFA 3CG5A 4B4XA 4Z1WA 4C75A 3HCYA 2VJWA 1NLYA 3N7WA 4GHIA 3NULA 5HW3A 5DF8A 4D60A 3OZHA 4EETB 1KVMA 3V3SA 2PR6A 3LR3A 2B95A 3WS2A 1NRFA 2W1RA 4OLGA 1YAXA 1DRMA 2VGLS 4MNRA 3RH8B 1XFNA 4YINA 1W8QA 3CWFA 1YSPA 2G2WA 4ESPA 1ESIA 5LBRA 4LV1A 4GN2A 5FQJA 2H0YA 3DTEA 1P9WA 1CI8A 2J8YA 4EQ1A 4BLMA 1FSWA 3PAEA 4S2IA 2DNSA 4HJ6A 1K56D 3LIAA 4CJNA 4MN6A 4EXOA 1BLSA 2PU2A 1ERMA 3NOPC 1K54A 1XJ4A 2R78A 4ZTKA 3H7WB 2I72A 1F98A 3MXQA 4X25A 1YMXA 1PIOA 2ZC6B 2ZQ8A 2HPBA 3UPPA 5FA7A 2XD1A 3ZHHA 4UA7A 4NXEA 2HDSA 3VSKA 2XA7M 4DDSA 4I3IA 4NXBA 3DBAA 3EQUA 4HEFA 5G4ZA 4WZ5A 4GDBA 2VA0A 4BD0A 1F9IA 3CUEC 1F2KA 4K0XA 4MBHA 3H82B 3ZG7B 3ITBA 1L3LA 1YSQA 2P7JA 4HIAA 1N4OA 1Y54A 5E2EA 1CQAA 3LO7A 4QWOA 4P0MA 1PRQA 2WKPA 3V50A 4OOLA 4U3TA 2WYXA 4OQ0A 1GSWA 3P7NA 2HDRA 4F94A 3E2LA 2BTFP 4X69A 1IOUA 3EQVA 4S2PA 3OBFA 4Y13A 2K31A 2PHYA 3T4LA 3G4PA 2EWWA 3N8RA 5EV0A 1CI9A 4X53A 3ZNTA 4DE2A 2V1ZA 3TW8A 4WZ5C 2JKRI 3KX0X 4JPMA 4FSFA 4E3OA 2QMIA 5HL6A 1SZVA 3QP1A 4ME4A 3UMEA 3VOLA 3F1PB 4Y3IA 3OPRA 2JHEA 2KLIA 3MSHA 2PT7A 3A3IA 2QPNA 1EROA 3LFVA 4C6YA 3T4QA 4PM8A 5AQAA 1H3QA 4E6WA 4G3KA 3QNBA 3HLWA 4S2JA 5FAQA 4R0QA 4IJGA 5HD5A 3BECA 4FH4A 1V9ZA 4QD4A 2PDRA 3IS2B 3IT9A 1EI5A 1ZG6A 4Y0TA 3T4JA 3D4FA 1G6OA 1RCJA 5HAIA 5FEGA 1K55A 1L2SA 3S7PA 2V1BA 2XR0A 4ZJ3A 2FFYA 3EGDC 5CTMA 3UNWA 1ODVA 5GHZA 4JXVA 3UE3A 2WKEA 2Y2PA 3NC8A 3IH9A 1S1ZA 4Q8IA 2VGJA 2Y2GA 4KZ9A 1ALQA 4LRYC 2JKTM 1DY6A 2L0WA 2H10A 1P0ZA 2HGVA 2A24B 4LLOB 4H8RA 2VGKA 3MKEA 1Y28A 1PI4A 5FL3A 4IHQA 1TDLA 3KSIA 4P85A 1IYOA 4FCFA 4Y0UA 1OTBA 4P6ZM 4K91A 4NK3A 4KQDA 1S6RA 3OOVA 3GECA 3VSLA 3IBRA 2ZQ7A 1MC0A 5CGWA 5E2GA 5M18A 2VEAA 3TE8A 2P74A 3PBOA 3UB7A 2CMNA 5J3WA 4GNUA 1VB6A 2IWCA 2VV6A 2W3DA 4H6JB 5F83A 1H0MA 5HDSA 4JKTA 4M3KA 3WS4A 3B47A 4KENB 2Y2NA 2L4RA 1PNEA 5EE8A 2O0YA 2M7VA 3EWKA 1W63M 5CRFA 1K25A 4RX2A 2UWXA 1MZUA 2Q9MA 3I7JA 4JXGA 3G6OA 3OPLA 1DP6A 3DAVA 3GRJA 3GSGA 5I5LA 3WWXA 2XSSA 3T1QB 3PTEA 3G34A 2ZLYA 3KSHA 3UN7A 1RP5A 1XGJA 2OOLA 1K4FA 3MQ0A 5KIZA 3LI9A 1LHYA 4S2NC 4I3AA 4LV3A 5E2HA 1K38A 4CLCC 1E25A 2HDQA 2HZ5A 2R9XA 2G2UA 3SOIA 3LYXA 2Y2IA 5CHUA 2GX5A 5EFWA 3UDIA 3SZTA 3DTKA 1TS6A 1YT4A 1OT9A 1DP9A 2ZC5B 4OQGA 2WKQA 4OH0A 1NY0A 5DFXA 1WA9A 2QJ5A 1EWZA 1G6AA 3W4PA 5HWWA 3LEQA 3T1XA 1W63Q 1JWPA 2B18A 2W1TB 5F1GA 5D3OA 2EX2A 4I39A 3C5AA 4BBVA 4CLCD 5M19A 1SDEA 1E3UA 1BSGA 2H0TA 3E98A 3FWLA 1JNUA 3UPNA 3ZQ5A 4GHIB 4KQRA 2PAVP 1NLZA 2A24A 3A3FA 3IF6C 5DJTA 2RL3A 3KYQA 4YFMA 4EEUA 4C3QA 3NDEA 1VEUB 4MN5A 3IX4A 3SW1A 1KOUA 3E4PA 3MF0A 4P87A 1PFLA 4MBFA 1SHVA 1BULA 4JF6A 5HZHA 4WYYA 1FIKA 1PW1A 4N9LA 5GL9A 4MDZA 1ONHA 4HH2A 4UA6A 5F82A 1IYQA 4XUZA 5F1FA 4LV0A 1PW8A 4KZ7A 2OV5A 1W5DA 3RXXA 2O99A 3MJQA 1ONGA 1IEMA 3C2WA 4BMWA 2EFUA 2RCXA 5JYOA 2XLNA 4X68A 4U0TA 4II7A 1S1YA 4HP9A 3LR5A 3UE0A 2X01A 2INWA 1XKZA 2HP5A 3PBRA 4F3LA 2WGIA 5IS1A 1DP8A 4PAUA 4HBUA 2Z2LB 2HP9A 4EESA 3ZDJA 3LUQA 3UPOA 4UQIS 2NUTC 4LV2A 4PM6A 5DTSA 1YKDA 4KZ8A 3G2YA 4EUZA 2PR5A 2JN7A 3LIFA 4PHTA 2XFSA 1I5QA 4IVIA 1YLWA 3VMAA 1SKOB 4WELA 4KZAA 3HUOA 3JVUA 3IWIA 3P98A 3HREA 3BFCA 3IHBA 2V20A 4E6XA 4Y7PA 4BL3A 5L07A 1ES3A 3A0VA 4OPQA 3MFDA 3A3EA 1NZOA 1YQSA 4JF4A 3K2NA 2P04A 2OSUA 1S4SA 2W1TA 1MWRA 3V67A 3V3RA 1A0KA 2XGNA 1XGIA 3NCKA 4DMZA 4EUVA 2Y2MA 2GZAA 1QMEA 4E3LA 1BYWA 5AQBA 3S22A 4KG6A 4JGPA 2EXAA 4WMCA 3Q7VA 2ZQ9A 4EW7A 3UB9A 3KYEA 5DKLA 3LY3A 3T4KA 3G32A 1TF1A 3ZG5A 4OP5A 3MKFA 2W3FA 3S1YA 5FSRA 4KUKA 2PYRA 2YKHA 1VEUA 4LENA 4BWIA 5TR7A 4WUJA 3LIBA 4B9OA 3LCEA 4EERA 4KG2A 3JVVA 4R3AA 3SH9A 1YLZA 4O01A 4EWFA 5L2FA 3G35A 3Q1FA 1MXOA 3HL9A 3N8SA 2VGLM 2ZJ9A 3BQAA 3MZEA 2FH5A 2Q0OA 3NI9A 5F68A 4B4ZA 1LT0A 1ZHHB 2D02A 1TS0A 4KQQA 4WEJA 4RVAA 1BZAA 2QZ6A 1RGYA 2YKFA 2H5SA 3GV9A 3HJKA 4K08A 1Z09A 4UA9A 3T1RA 3RXWA 3UO9A 4BQMA 4G3VA 4QY5A 2WAEA 2EA9A 3V39A 4KZ6A 4OQIA 4KZ5A 5A91A 2VX8A 3HBRA 4BENA 4LGWA 4OPRA 4RX3A 2V1AA 3QP4A 1TVFA 1T1CA 3CJMA 3GVBA 1G28A 4E3KA 2JKFA 2WZZA 4NXFA 2V8CA 1ESUA 3UB5P 2PBDP 2C5WB 1YLJA 1SKOA 2JC7A 2QHKA 1NJ4A 2WKIA 4E3NA 4CQHA 3ZVWA 1KDWA 3UB6A 1KVLA 3G31A 4LRXC 1ES4A 2ZBBA 4DJ2A 5DTKA 2Y59A 4I38A 4X1LA 3PHYA 4R70A 5CXWA 4ZJ1A 4PKYA 3B33A 2FFFB 2ZMVA 5HFOA 2JCHA 3JPUA 1SCWA 2CC1A 5GLDA 3IX3A 4MLLA 1K54C 4LRZE 3PBTA 5A8BA 2V0WA 5FQIA 1Q2QA 5FDHA 1FQGA 3WS1A 3ICYA 4MCWA 2PD8A 4M4XA 2NUPC 5CGXA 1NRJA 4KZ3A 5A90A 1YPRA 5EECA 3G2ZA 2J7VA 3KO6A 3QP6A 2IWDA 4Y0OA 1N9OA 2Y2QA 2QKPA 3BM6A 5FQMA 3BW6A 2HP6A 3C4PA 4L9EA 2JE5A 3VE4A 4PPRA 4YNRA 3Q81A 3UE1A 3DTIA 4HJ3A 3F1NB 1FR1A 4EEPA 5GHYA 3BFDA 3L9KA 3CITA 5EVIB 4K0WA 4X56A 2XQZA 1XJ3A 1BLHA 2Z6CA 5FI2A 4HESA 3TJZC 4IEDA 2W27A 3VP4A 2VV7A 3OPHA 3KSGA 2XROA 3DW0A 2A3UA 5KSCA 4X1MA 5JYPA 2WUQA 2BG1A 3F1OB 3SS3A 5HPFA 5CTNA 3UDXA 2P9VB 2VK3A 2EXBA 4EBPA 3DTMA 4ARZB 1KGFA 3CAXA 2D01A 4JGRA 2KDKA 4PM7A 3BLSA 5EPHA 4X55A 4IUHA 2X71A 2O9AA 2GDNA 1ZG4A 4RA7A 2E8JA 1L0GA 1OTIA 3M6HA 3W4OA 4GB7A 4R6LA 4CLCE 3BFEA 4OQHA 3ZCZA 1OTEA 3IWQA 5DJUA 3K3DA 1DJCA 4PMAA 5EVEA 2XEPA 1FCNA 3C30A 4OP8A 3GR2A 3OPPA 2PBYA 1OJ5A 4FH2A 3CI6A 5A92A 2Y2HA 3PYPA 3S7OA 2OWHA 3D3OA 4Y5FA 1NWZA 4EBLA 3TSGA 2ZC4B 4DE3A 1WYCA 4GKUA 4L9GA 4Y2FA 1UGUA 1YM1A 1K55C 5EUAA 4CPKA 3LIEA 3MFXA 3E0YA 1CJFA 3HLDA 2J3WA 2B02A 4DE1A 1S4RA 1IELA 3KSFA 3F1NA 4NEED 2ZL1B 5GHXA 1BTLA 4Y17A 3SS5A 3GMWA 4F3LB 4LCLA 3UMDA 5EVIA 1OTDA 5L10A 1H8ZA 3IXHA 5HPIA 3EEAA 4NETA 4ZDXA 3U2AA 4BJPA 2ZM2A 5HAQA 3VFFA 3IBJA 4JGQA 3WRTA 1LSVA 1LL5A 1XJ6A 1P9RA 4RYEA 1IYPA 3QNCA 3FZCA 4HH3A 4R23A 1MWUA 1T18A 2Q9NA 2K2NA 3BFGA 4QB8A 3O88A 3NIAA 1FCOA 4Q0IA 3HLGA 3BQ8A 4P6BA 1J9MA 3MR0A 2ZQDA 2XRNA 5FATA 3F1OA 5AQ7A 2O9BA 3DWZA 4BBUA 3PXPA 4EV4A 1H5XA 1HD8A 2P9VA 4ZJ2A 1IFQA 5L8MA 2AVXA 3MXRA 4ARZA 3TRCA 1BUEA 3GTCA 2GJ3A 1PWDA 1H8YA 2JKGA 5IHVA 3GDIA 3T4TA 2J9OA 3PBSA 4GOGA 3BYDA 2HDUA 3FG8A 2A49A 4U0XA 1FILA 3EEHA 4OLDA 2HJEA 3NDGA 5GLCA 3Q7VB 2J80A 1ES5A 5BOHA 5F6AA 3T4OA 4ETXA 2EWVA 3M2KA 2FZ0A 2BASA 1GHMA 1OMEA 3NECA 3IXGA 2X02A 1PZOA 1VQQA 5CGSA 3BLMA 3ZG8B 2WKRA 3BFFA 3DWKA 1KDSA 3C8CA 1BLPA 3T12B 4S2OA 1Q2PA 1X0OA 4FTXA 3VP2A 3WRZA 3LEZA 3RTYA 4L9FA 5HX9A 1K57A 3IX8A 4UEYA 5FQKA 3LY4A 3UDFA 1LSXA 4R38A 1MKMA 2JKRM 1MKIA 4GLQA 1H8MA 1D7EA 5AQ9A 2EFXA 1D1JA 1YMSA 2ACGA 2ZL1A 2J3TC 3LIDA 3ZGAB 4G3WA 3NOTC 3T50A 3WS5A 1QMFA 1T1AA 3PBQA 1GSXA 4MN7A 3FPVA 2ZQAA 2Z2MB 2IWBA 1GHPA 4WZ4A 1W79A 5EOOA 3G30A 3N4IA 4GS9A 1PWGA 3MQOA 4HNBA 1XJ2A 3VOZA 5FEFA 5CHJA 4ID4A 1K56A 5C5KA 5HL1A 3IWOA 3R7WB 5L09A 3S4XA 2KX6A 2HJ9C 3UE6A 3IH8A 4HBTA 5M1AA 3IHAA 2OAP1 1E3UD 2Y2LA 4PKYG 3EGXC 5HDCA 5HDDA 5CERA 3IXDA 1N9LA 4Q0HA 1IKIA 5DF7A 1KE3A 3Q7ZA 3CLOA 1I2WA 2WAFA 4HHDA 2PYPA 4HQAA 1XP4A 4WLAA 5EM0A 2WK0A 3HLCA 4XUXA 3FC7A 4XXRA 3H9WA 1OT6A 4OOYA 3R4KA 2XK1A 4WF0A 1FSYA 5IT5A 2JKTI 2H28A 4IUKA 3MZFA 2V0UA 5HWVA 1VETB 3U4LP 1JWZA 4QY6A 3MBZA 3N6IA 5CEBA 1OPXA 3IF5A 4IBRA 5GLBA 4PM9A 2ZOHA 2W3EA 2ZQCA 1DJBA 1FOFA 3A0RA 4HOIA 2VLGA 2Z6DA 3E4QA 2J9PA 3EOIA 3CPTA 3CHWP 4KZ4A 1K0KA 2PRFA 1VM1A 4X6TA 5F69A 1HLUP 3RFBA 5GLAA 5TBMB 3CUEA 2Y2KA 1MPLA 2EX9A 5F5YA 2VV8A 2ZC3B 3HLEA 3L7HA 5AVEA 3C38A 4MEZA 4HY8A 5HARA 1L0DA 3ULFA 2WZXA 2PD7A 3ITAA 3O87A 1DJAA 4GD8A 4R3JA 3PBNA 3GQZA 2WGWA 2UV0E 2WKHA 2M7UA 2MJ6A 1NXYA 2ZM0A 4E3JA 4JXWA 4JXSA 3QP8A 5I94A 5FAPA 1NZUA 4OPYA 1N9NA 2XA7S 4O8GA 4UAAA 2Y8HA 4DF6A 5DF9A 1KE4A 3M6BA 4WL9A 5TJJA 3R7WA 1ZKJA 4QU3A 4BBTA 3FPWA 3ZYTA 5AJGA 4E3MA 1FCMA 4BL2A 4S2MA 3BEBA 4R4RA 4DJ3A 4WMCD 4PM5A 1GSVA 1S66L 4BD1A 4LFUA 3FKWA 3SS4A 1JTGA 2I9VA 3BWLA 2QWSA 3A3DA 2V9AA 4JLFA 3Q82A 2PU4A 3ZVTA 3S7NA 4EQIA 3NJAA 2WADA 4I5SA 4NXGA 5EVLA 3VOYA 1G68A 4YWZA 5FASA 2OLUA 1ZC2A 1W7FA 3MQQA 4R3BA 1M40A 1N9BA 5KMWA 5CX7A 1VETA 3FV7A 1K6RA 4CLCB 1MWSA 3A0SA 2A2LA 2Y2JA 5HWTA 1NYYA 3B3XA 1ZTUA 4WM9A 1MBLA 4DKIA 2ZM8A 1D06A 4I3JA 1RGZA 4O0PA 1HVBA 1ES2A 4B93A 2ZMFA 3MMHA 4LCMA 3QP2A 5TBMA 1MWTA 4N9KA 4YOFA 4DDYA 2OLVA 4QHCA 5FI7A 1BT5A 2V2FF 2M1CA 4DRTA 1XXMA 4DE0A 1XA1A 4GD6A 3ZG0A 1K6SA 4MBKA 1KE0A 3QHYA 5TGFA 2VKSA 2XF3A 3VP0A 4WEKA 1JVJA 4GCZA 2Y4AA 3JYIA 3NHQA 4E04A 5CHMA 1P97A 3IF6B 1UWPX 4R4SA 1C3BA 5G18A 3TOIA 4WN5A 1T19A 3H7WA 3VV4A 5EM1A 4HJ4A 3T1SA 2XDMA 5K5BA 4FOFA 4DXBA 1CF0A 4OONA 3HVFA 1O7EA 1CEGA 2K7SA 5DFYA 2LB5A 3E4OA 4HI4A 4IVKA 3T4SA 3D9YA 5DKKA 4OKPA 2E8IA 2XD5A 2W3GA 3O5YA 4ETZA 2O9CA 1NYMA 3C7VA 3HJIA 4GW9A 5TFQA 3LR4A 3UY6A 3ISGA 1LL8A 3O86A 4Z9QA 3FYZA 4FUWA 4XT2B 2L1MA 1GA9A 5FAOA 3H82A 1MY8A 5J8XA 4P6ZS 4EU0A 2OAQ1 1SKFA 5CEDA 1G5UA 3PR6A 4FD8A 1L0EA 4EBNA 3MZDA 1GHIA 1WE4A 3ZNYA 3K3CA 3RJUA 4S2NA 4QPRA 1FR6A 2C6WB 3VP1A 2QYBA 3W2ZA 1TDGA 1XPBA 4O7DA 4A5RA 4CLCA 2EX8A 1LL9A 1TEMA 3B42A 4S2LA 3IXBA 4IBXA 1SDNA 1GCEA 3VP3A 3AGFA 3CMZA 3AGDA 1BLCA 1XA7A 3LICA 5U47A 1TS7A 4JGOA 3VFHA 1PYYA 2ZMAA 1TS8A 5KZHA 3S7QA 5AVFA 2IA2A 3OCLA 5HAPA 1CEFA 1XFQA 2HV1A 4MMNA 3KYZA 2ZOIA 4QJGA 2VZWA 1XX2A 4GS9B 3OCNA 3F1PA 1S67L 2OWJA 3OLOA 3A3JA 1TD5A 2EX6A 3MS6A 5J7EA 1LLBA 4E3IA 2DRWA 3AGEA 5G4YA 3IF6A 3P01A 1KGEA 3PAGA 5FQQA 1YLPA 3BJNA 2ZC7A 1J3WA 4UHUA 2LB9A 3SH8A 3NBLA 1JWVA 3O3VA 3W4QA 3HUMA 3HLFA 1LSWA 1V9YA 1L0FA 3IS2A 3IQAA 4OPZA 4OOMA 4GDNA 4N1HA 3BY8A 1I2SA 4JBFA 5E2FA 5A93A 4RQ9A 4S2KA 3HUNA 5EOEA 5CECA 1ACFA 1YLYA 1HTZA 1YLTA 5HSQA 1AXBA 1WYBA 3ZG9B 4DN0A 3SH7A 5EVIC 3ZFZA 2Y79A 3BRMA 4KQOA 2HF6A 1E4DA 4XT2A 4KUOA 1LI9A 3MXSA 4KG5A 5FDSA 4DXCA 2B5RA 2P08A 3TG9A 5FI6A 2W0NA 2W3HA 4GJ4A 3P09A 1STZA 1OJGA 5KSHA 1EW0A 4ZRRA 3OC2A 4NKPA 1U60A 1S0WA 3LR0A 3CZDA 3NOUC 4ZBEA 2DMWA 3N8LA 2Y55A 3CPTB 5EVID 3NY4A 5DTTA 4AFIA
chains in the Genus database with same CATH topology
3C4PA 1DJBA 5E2GA 1FOFA 2JE5A 5M18A 4PPRA 3Q81A 2P74A 2J9PA 3PBOA 4L0LA 4GNUA 3UE1A 4KZ4A 2IWCA 3V5MA 5F83A 1VM1A 3W8KA 1GA0A 4JKTA 4X6TA 4M3KA 3WS4A 1LI0A 3FKVA 5GLAA 1FR1A 4KENB 2Y2NA 3E2KA 5EE8A 5GHYA 4N1XA 2Y2KA 1MPLA 2EX9A 1W8YA 3BFDA 3HLBA 5EVIB 2ZC3B 3HLEA 2XFTA 4K0WA 4GZBA 5CRFA 1K25A 1IYSA 2DCFA 3C7UA 4MEZA 4X56A 2XQZA 1KGGA 2WGWB 4RX2A 5HARA 1IKGA 1L0DA 2UWXA 2Q9MA 2BLSA 3I7JA 1BLHA 4JXGA 2WZXA 5DVAA 3OPLA 3GRJA 3ITAA 3O87A 5FI2A 3GSGA 3WWXA 1DJAA 4HESA 4GD8A 4R3JA 3PBNA 3GQZA 2WGWA 3PTEA 5E43A 3G34A 3Q07A 2ZLYA 2R9WA 2WKHA 3UN7A 4IEDA 4R1GA 4WBGA 1NXYA 1RP5A 1XGJA 2ZM0A 3VP4A 4E3JA 1K4FA 4JXWA 4JF5A 1LHYA 3OPHA 4JXSA 5I94A 5FAPA 4S2NC 1NZUA 4OPYA 2Y2OA 5FQ9A 4KZBA 3DW0A 4LV3A 5E2HA 2A3UA 1K38A 5KSCA 4UAAA 5JYPA 1E25A 2HDQA 2R9XA 2WUQA 2G2UA 2BG1A 3SOIA 3SS3A 2Y2IA 5CHUA 4B88A 1Z6FA 4DF6A 1PZPA 3UDIA 5DF9A 5CTNA 2ZD8A 1KE4A 3M6BA 2P9VB 3UDXA 4OVDA 1O07A 2EXBA 1K57C 4EBPA 4ZAMA 2Y91A 3DTMA 1ZKJA 4QU3A 1YT4A 1PI5A 1KGFA 1HZOA 4D2OA 4PM7A 3BLSA 2ZC5B 5EPHA 1PWCA 4E3MA 4OQGA 1FCMA 4X55A 4BL2A 4S2MA 2X71A 3BEBA 4R4RA 4OH0A 2GDNA 4N92A 1NY0A 1ZG4A 1CK3A 4WMCD 4PM5A 4RA7A 1L0GA 1EWZA 4BD1A 1G6AA 3M6HA 3W4OA 2XH9A 1JTDA 3W4PA 3C4OA 3FKWA 4GB7A 3SS4A 1JTGA 1JWPA 3M2JA 2WGVA 1K4EA 3A3DA 4JLFA 3Q82A 5F1GA 2PU4A 3ZVTA 3BFEA 4OQHA 2EX2A 5D3OA 3ZCZA 3C5AA 4EQIA 1ERQA 5M19A 3IWQA 3WS0A 1SDEA 1E3UA 2H0TA 1M6KA 2WADA 1BSGA 3FWLA 2JBFA 1DJCA 4PMAA 3UPNA 5EVLA 3VOYA 4KQRA 1G68A 3CG5A 4B4XA 2XEPA 5FASA 4C75A 1FCNA 3A3FA 3IF6C 4OP8A 2OLUA 1ZC2A 3GR2A 1W7FA 2RL3A 3N7WA 4R3BA 1M40A 3OPPA 2PBYA 4YFMA 4FH2A 1N9BA 5A92A 5KMWA 4C3QA 2Y2HA 5HW3A 5DF8A 3FV7A 1K6RA 3OZHA 1MWSA 3NDEA 1KVMA 3V3SA 4EBLA 2Y2JA 3TSGA 2ZC4B 4DE3A 3WS2A 1NYYA 4P87A 1WYCA 1NRFA 3B3XA 4GKUA 4MBFA 1SHVA 1BULA 4JF6A 4WYYA 4OLGA 1PW1A 4N9LA 4WM9A 5GL9A 4MNRA 1YM1A 1K55C 4YINA 4UA6A 1ONHA 1MBLA 1W8QA 5F82A 4DKIA 5EUAA 4CPKA 1IYQA 2ZM8A 4XUZA 3HLDA 5F1FA 2G2WA 4DE1A 4LV0A 1ESIA 4LV1A 1RGZA 1PW8A 1HVBA 1ES2A 4GN2A 4KZ7A 2OV5A 5FQJA 1IELA 1W5DA 4LCMA 2H0YA 3RXXA 1ONGA 1CI8A 1IEMA 1MWTA 2J8YA 4N9KA 4DDYA 5GHXA 2EFUA 2RCXA 5JYOA 2OLVA 4QHCA 1BTLA 4BLMA 1FSWA 1BT5A 5FI7A 2V2FF 2XLNA 3GMWA 3SS5A 3PAEA 4X68A 4U0TA 4DRTA 1XXMA 4LCLA 4S2IA 2DNSA 5EVIA 4DE0A 1XA1A 4GD6A 3UE0A 3ZG0A 1K56D 1H8ZA 3IXHA 1K6SA 4MBKA 1KE0A 3QHYA 1XKZA 2X01A 5TGFA 4CJNA 2HP5A 4NETA 4ZDXA 4BJPA 2ZM2A 1BLSA 2PU2A 3PBRA 3VFFA 5HAQA 2XF3A 2WGIA 1ERMA 3VP0A 3WRTA 1LL5A 1K54A 4WEKA 4HBUA 1JVJA 2Z2LB 2HP9A 2Y4AA 3JYIA 4RYEA 3ZDJA 3UPOA 5CHMA 1IYPA 3IF6B 4LV2A 3QNCA 4ZTKA 3FZCA 4PM6A 5DTSA 4R23A 1MWUA 4R4SA 2I72A 2Q9NA 1C3BA 3BFGA 5G18A 4KZ8A 4QB8A 3O88A 3G2YA 4EUZA 3NIAA 1FCOA 1YMXA 3TOIA 3HLGA 4P6BA 1PIOA 2ZC6B 1J9MA 2ZQ8A 2HPBA 2XFSA 3UPPA 1I5QA 4IVIA 2ZQDA 5FA7A 2XD1A 5FATA 1YLWA 3ZHHA 2XDMA 5AQ7A 3VMAA 3DWZA 4UA7A 4EV4A 1H5XA 4DXBA 2P9VA 1HD8A 3HVFA 4OONA 1O7EA 4WELA 4KZAA 2HDSA 3HUOA 3VSKA 1CEGA 4ZJ2A 5EECA 4DDSA 3IWIA 3EQUA 3P98A 4HEFA 3MXRA 3HREA 3BFCA 4WZ5A 1BUEA 4IVKA 3IHBA 3GTCA 2V20A 4GDBA 4E6XA 4BD0A 4OKPA 2E8IA 2XD5A 1PWDA 4Y7PA 4BL3A 1H8YA 5IHVA 1ES3A 4K0XA 4OPQA 3MFDA 4MBHA 1NYMA 2J9OA 3C7VA 3PBSA 3A3EA 5TFQA 3ZG7B 3UY6A 3ISGA 3ITBA 1NZOA 4GOGA 3BYDA 1YQSA 2HDUA 4JF4A 3O86A 4Z9QA 3FYZA 2A49A 2OSUA 1GA9A 5FAOA 1MWRA 1N4OA 1Y54A 4U0XA 1MY8A 5E2EA 3V3RA 4OLDA 2XGNA 3NCKA 1XGIA 2Y2MA 3NDGA 5GLCA 3LO7A 1QMEA 4P0MA 3Q7VB 1ES5A 4E3LA 5BOHA 3V50A 5J8XA 4OOLA 5AQBA 3S22A 4KG6A 4U3TA 1SKFA 2EXAA 5CEDA 3M2KA 4FD8A 1GHMA 1L0EA 2WYXA 4OQ0A 4WMCA 1OMEA 3Q7VA 2ZQ9A 3IXGA 4EBNA 3MZDA 2X02A 1PZOA 1GHIA 2HDRA 1VQQA 4F94A 1WE4A 3E2LA 3LY3A 5CGSA 3G32A 4X69A 3BLMA 3ZNYA 3ZG5A 3ZG8B 3EQVA 4S2PA 3BFFA 3MKFA 4OP5A 3RJUA 3DWKA 4S2NA 1FR6A 1KDSA 2C6WB 3S1YA 3VP1A 1BLPA 1TDGA 4S2OA 5FSRA 1Q2PA 1XPBA 4O7DA 4A5RA 3VP2A 3WRZA 2EX8A 3LEZA 4LENA 1LL9A 5TR7A 1TEMA 5HX9A 3LCEA 3G4PA 3N8RA 4KG2A 1K57A 4S2LA 1YLZA 3SH9A 1CI9A 3IXBA 4IBXA 3LY4A 5FQKA 4X53A 3UDFA 1SDNA 4EWFA 3ZNTA 5L2FA 3G35A 3Q1FA 1GCEA 4DE2A 1MKIA 1MXOA 2V1ZA 3HL9A 3VP3A 3AGFA 3CMZA 3N8SA 5AQ9A 3AGDA 4WZ5C 1BLCA 1XA7A 2ZJ9A 3MZEA 3NI9A 4JPMA 4FSFA 5U47A 4E3OA 2QMIA 3VFHA 1PYYA 4B4ZA 2EFXA 2ZMAA 5KZHA 1YMSA 3OCLA 3ZGAB 5HAPA 1CEFA 3OPRA 3WS5A 1QMFA 3PBQA 4QJGA 4KQQA 4WEJA 4RVAA 1BZAA 1XX2A 2QZ6A 3OCNA 3A3IA 1RGYA 2ZQAA 2QPNA 1EROA 3A3JA 2H5SA 3GV9A 2EX6A 2Z2MB 4UA9A 4C6YA 3RXWA 2IWBA 3UO9A 4BQMA 1GHPA 4WZ4A 1W79A 5EOOA 1LLBA 3G30A 3N4IA 4PM8A 2DRWA 4QY5A 4E3IA 2WAEA 5AQAA 3V39A 3AGEA 4KZ6A 1PWGA 4OQIA 4E6WA 3IF6A 3QNBA 3HLWA 4KZ5A 1KGEA 5A91A 3HBRA 3PAGA 4S2JA 5FAQA 5FQQA 4R0QA 4BENA 4OPRA 4RX3A 1YLPA 3VOZA 2ZC7A 1TVFA 3BECA 3CJMA 4UHUA 3GVBA 4FH4A 5CHJA 4QD4A 3IT9A 4ID4A 1K56A 3SH8A 3NBLA 4E3KA 5HL1A 2WZZA 1JWVA 3O3VA 1EI5A 1ZG6A 3HUMA 3W4QA 4Y0TA 3HLFA 3IWOA 1ESUA 3S4XA 3D4FA 1L0FA 3IH8A 4HBTA 2C5WB 1YLJA 1RCJA 2JC7A 3IHAA 3IQAA 4OPZA 4OOMA 5HAIA 5M1AA 4GDNA 1K55A 1NJ4A 1L2SA 2WKIA 1E3UD 2Y2LA 4N1HA 2XR0A 4E3NA 3ZVWA 1KDWA 4ZJ3A 1I2SA 2FFYA 4JBFA 5E2FA 5CERA 5A93A 1KVLA 3G31A 4S2KA 3HUNA 5EOEA 5CECA 1ES4A 3IXDA 5CTMA 3UNWA 5GHZA 4JXVA 5DTKA 1YLYA 2WKEA 2Y2PA 1HTZA 3UE3A 2Y59A 1IKIA 5CXWA 5DF7A 1YLTA 1KE3A 3Q7ZA 1AXBA 1WYBA 3NC8A 4ZJ1A 3ZG9B 1I2WA 3SH7A 3IH9A 2FFFB 5EVIC 3ZFZA 2WAFA 4Q8IA 2VGJA 1XP4A 3BRMA 4KQOA 2Y2GA 5HFOA 1E4DA 2JCHA 2WK0A 4KZ9A 3HLCA 1ALQA 4XUXA 1LI9A 3MXSA 4KG5A 4XXRA 1SCWA 2CC1A 5GLDA 4MLLA 1K54C 3PBTA 4DXCA 1DY6A 2B5RA 4OOYA 2XK1A 5FQIA 2H10A 1FSYA 1Q2QA 5FDHA 1FQGA 3WS1A 3TG9A 5FI6A 4H8RA 2VGKA 3MKEA 1PI4A 3P09A 3MZFA 5CGXA 4KZ3A 1TDLA 5KSHA 3OC2A 5A90A 4P85A 1IYOA 4FCFA 1JWZA 1U60A 1S0WA 4QY6A 3G2ZA 2J7VA 3MBZA 4Y0UA 3N6IA 4K91A 4NK3A 3CZDA 5CEBA 3IF5A 2IWDA 4IBRA 1S6RA 4ZBEA 4Y0OA 5GLBA 4PM9A 3N8LA 3VSLA 2Y55A 2Y2QA 2ZQ7A 2ZQCA 5EVID 3BM6A 3NY4A 5DTTA 5FQMA 2HP6A 5CGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4P A;  1DJB A;  5E2G A;  1FOF A;  2JE5 A;  5M18 A;  4PPR A;  3Q81 A;  2P74 A;  2J9P A;  3PBO A;  4L0L A;  4GNU A;  3UE1 A;  4KZ4 A;  2IWC A;  3V5M A;  5F83 A;  1VM1 A;  3W8K A;  1GA0 A;  4JKT A;  4X6T A;  4M3K A;  3WS4 A;  1LI0 A;  3FKV A;  5GLA A;  1FR1 A;  4KEN B;  2Y2N A;  3E2K A;  5EE8 A;  5GHY A;  4N1X A;  2Y2K A;  1MPL A;  2EX9 A;  1W8Y A;  3BFD A;  3HLB A;  5EVI B;  2ZC3 B;  3HLE A;  2XFT A;  4K0W A;  4GZB A;  5CRF A;  1K25 A;  1IYS A;  2DCF A;  3C7U A;  4MEZ A;  4X56 A;  2XQZ A;  1KGG A;  2WGW B;  4RX2 A;  5HAR A;  1IKG A;  1L0D A;  2UWX A;  2Q9M A;  2BLS A;  3I7J A;  1BLH A;  4JXG A;  2WZX A;  5DVA A;  3OPL A;  3GRJ A;  3ITA A;  3O87 A;  5FI2 A;  3GSG A;  3WWX A;  1DJA A;  4HES A;  4GD8 A;  4R3J A;  3PBN A;  3GQZ A;  2WGW A;  3PTE A;  5E43 A;  3G34 A;  3Q07 A;  2ZLY A;  2R9W A;  2WKH A;  3UN7 A;  4IED A;  4R1G A;  4WBG A;  1NXY A;  1RP5 A;  1XGJ A;  2ZM0 A;  3VP4 A;  4E3J A;  1K4F A;  4JXW A;  4JF5 A;  1LHY A;  3OPH A;  4JXS A;  5I94 A;  5FAP A;  4S2N C;  1NZU A;  4OPY A;  2Y2O A;  5FQ9 A;  4KZB A;  3DW0 A;  4LV3 A;  5E2H A;  2A3U A;  1K38 A;  5KSC A;  4UAA A;  5JYP A;  1E25 A;  2HDQ A;  2R9X A;  2WUQ A;  2G2U A;  2BG1 A;  3SOI A;  3SS3 A;  2Y2I A;  5CHU A;  4B88 A;  1Z6F A;  4DF6 A;  1PZP A;  3UDI A;  5DF9 A;  5CTN A;  2ZD8 A;  1KE4 A;  3M6B A;  2P9V B;  3UDX A;  4OVD A;  1O07 A;  2EXB A;  1K57 C;  4EBP A;  4ZAM A;  2Y91 A;  3DTM A;  1ZKJ A;  4QU3 A;  1YT4 A;  1PI5 A;  1KGF A;  1HZO A;  4D2O A;  4PM7 A;  3BLS A;  2ZC5 B;  5EPH A;  1PWC A;  4E3M A;  4OQG A;  1FCM A;  4X55 A;  4BL2 A;  4S2M A;  2X71 A;  3BEB A;  4R4R A;  4OH0 A;  2GDN A;  4N92 A;  1NY0 A;  1ZG4 A;  1CK3 A;  4WMC D;  4PM5 A;  4RA7 A;  1L0G A;  1EWZ A;  4BD1 A;  1G6A A;  3M6H A;  3W4O A;  2XH9 A;  1JTD A;  3W4P A;  3C4O A;  3FKW A;  4GB7 A;  3SS4 A;  1JTG A;  1JWP A;  3M2J A;  2WGV A;  1K4E A;  3A3D A;  4JLF A;  3Q82 A;  5F1G A;  2PU4 A;  3ZVT A;  3BFE A;  4OQH A;  2EX2 A;  5D3O A;  3ZCZ A;  3C5A A;  4EQI A;  1ERQ A;  5M19 A;  3IWQ A;  3WS0 A;  1SDE A;  1E3U A;  2H0T A;  1M6K A;  2WAD A;  1BSG A;  3FWL A;  2JBF A;  1DJC A;  4PMA A;  3UPN A;  5EVL A;  3VOY A;  4KQR A;  1G68 A;  3CG5 A;  4B4X A;  2XEP A;  5FAS A;  4C75 A;  1FCN A;  3A3F A;  3IF6 C;  4OP8 A;  2OLU A;  1ZC2 A;  3GR2 A;  1W7F A;  2RL3 A;  3N7W A;  4R3B A;  1M40 A;  3OPP A;  2PBY A;  4YFM A;  4FH2 A;  1N9B A;  5A92 A;  5KMW A;  4C3Q A;  2Y2H A;  5HW3 A;  5DF8 A;  3FV7 A;  1K6R A;  3OZH A;  1MWS A;  3NDE A;  1KVM A;  3V3S A;  4EBL A;  2Y2J A;  3TSG A;  2ZC4 B;  4DE3 A;  3WS2 A;  1NYY A;  4P87 A;  1WYC A;  1NRF A;  3B3X A;  4GKU A;  4MBF A;  1SHV A;  1BUL A;  4JF6 A;  4WYY A;  4OLG A;  1PW1 A;  4N9L A;  4WM9 A;  5GL9 A;  4MNR A;  1YM1 A;  1K55 C;  4YIN A;  4UA6 A;  1ONH A;  1MBL A;  1W8Q A;  5F82 A;  4DKI A;  5EUA A;  4CPK A;  1IYQ A;  2ZM8 A;  4XUZ A;  3HLD A;  5F1F A;  2G2W A;  4DE1 A;  4LV0 A;  1ESI A;  4LV1 A;  1RGZ A;  1PW8 A;  1HVB A;  1ES2 A;  4GN2 A;  4KZ7 A;  2OV5 A;  5FQJ A;  1IEL A;  1W5D A;  4LCM A;  2H0Y A;  3RXX A;  1ONG A;  1CI8 A;  1IEM A;  1MWT A;  2J8Y A;  4N9K A;  4DDY A;  5GHX A;  2EFU A;  2RCX A;  5JYO A;  2OLV A;  4QHC A;  1BTL A;  4BLM A;  1FSW A;  1BT5 A;  5FI7 A;  2V2F F;  2XLN A;  3GMW A;  3SS5 A;  3PAE A;  4X68 A;  4U0T A;  4DRT A;  1XXM A;  4LCL A;  4S2I A;  2DNS A;  5EVI A;  4DE0 A;  1XA1 A;  4GD6 A;  3UE0 A;  3ZG0 A;  1K56 D;  1H8Z A;  3IXH A;  1K6S A;  4MBK A;  1KE0 A;  3QHY A;  1XKZ A;  2X01 A;  5TGF A;  4CJN A;  2HP5 A;  4NET A;  4ZDX A;  4BJP A;  2ZM2 A;  1BLS A;  2PU2 A;  3PBR A;  3VFF A;  5HAQ A;  2XF3 A;  2WGI A;  1ERM A;  3VP0 A;  3WRT A;  1LL5 A;  1K54 A;  4WEK A;  4HBU A;  1JVJ A;  2Z2L B;  2HP9 A;  2Y4A A;  3JYI A;  4RYE A;  3ZDJ A;  3UPO A;  5CHM A;  1IYP A;  3IF6 B;  4LV2 A;  3QNC A;  4ZTK A;  3FZC A;  4PM6 A;  5DTS A;  4R23 A;  1MWU A;  4R4S A;  2I72 A;  2Q9N A;  1C3B A;  3BFG A;  5G18 A;  4KZ8 A;  4QB8 A;  3O88 A;  3G2Y A;  4EUZ A;  3NIA A;  1FCO A;  1YMX A;  3TOI A;  3HLG A;  4P6B A;  1PIO A;  2ZC6 B;  1J9M A;  2ZQ8 A;  2HPB A;  2XFS A;  3UPP A;  1I5Q A;  4IVI A;  2ZQD A;  5FA7 A;  2XD1 A;  5FAT A;  1YLW A;  3ZHH A;  2XDM A;  5AQ7 A;  3VMA A;  3DWZ A;  4UA7 A;  4EV4 A;  1H5X A;  4DXB A;  2P9V A;  1HD8 A;  3HVF A;  4OON A;  1O7E A;  4WEL A;  4KZA A;  2HDS A;  3HUO A;  3VSK A;  1CEG A;  4ZJ2 A;  5EEC A;  4DDS A;  3IWI A;  3EQU A;  3P98 A;  4HEF A;  3MXR A;  3HRE A;  3BFC A;  4WZ5 A;  1BUE A;  4IVK A;  3IHB A;  3GTC A;  2V20 A;  4GDB A;  4E6X A;  4BD0 A;  4OKP A;  2E8I A;  2XD5 A;  1PWD A;  4Y7P A;  4BL3 A;  1H8Y A;  5IHV A;  1ES3 A;  4K0X A;  4OPQ A;  3MFD A;  4MBH A;  1NYM A;  2J9O A;  3C7V A;  3PBS A;  3A3E A;  5TFQ A;  3ZG7 B;  3UY6 A;  3ISG A;  3ITB A;  1NZO A;  4GOG A;  3BYD A;  1YQS A;  2HDU A;  4JF4 A;  3O86 A;  4Z9Q A;  3FYZ A;  2A49 A;  2OSU A;  1GA9 A;  5FAO A;  1MWR A;  1N4O A;  1Y54 A;  4U0X A;  1MY8 A;  5E2E A;  3V3R A;  4OLD A;  2XGN A;  3NCK A;  1XGI A;  2Y2M A;  3NDG A;  5GLC A;  3LO7 A;  1QME A;  4P0M A;  3Q7V B;  1ES5 A;  4E3L A;  5BOH A;  3V50 A;  5J8X A;  4OOL A;  5AQB A;  3S22 A;  4KG6 A;  4U3T A;  1SKF A;  2EXA A;  5CED A;  3M2K A;  4FD8 A;  1GHM A;  1L0E A;  2WYX A;  4OQ0 A;  4WMC A;  1OME A;  3Q7V A;  2ZQ9 A;  3IXG A;  4EBN A;  3MZD A;  2X02 A;  1PZO A;  1GHI A;  2HDR A;  1VQQ A;  4F94 A;  1WE4 A;  3E2L A;  3LY3 A;  5CGS A;  3G32 A;  4X69 A;  3BLM A;  3ZNY A;  3ZG5 A;  3ZG8 B;  3EQV A;  4S2P A;  3BFF A;  3MKF A;  4OP5 A;  3RJU A;  3DWK A;  4S2N A;  1FR6 A;  1KDS A;  2C6W B;  3S1Y A;  3VP1 A;  1BLP A;  1TDG A;  4S2O A;  5FSR A;  1Q2P A;  1XPB A;  4O7D A;  4A5R A;  3VP2 A;  3WRZ A;  2EX8 A;  3LEZ A;  4LEN A;  1LL9 A;  5TR7 A;  1TEM A;  5HX9 A;  3LCE A;  3G4P A;  3N8R A;  4KG2 A;  1K57 A;  4S2L A;  1YLZ A;  3SH9 A;  1CI9 A;  3IXB A;  4IBX A;  3LY4 A;  5FQK A;  4X53 A;  3UDF A;  1SDN A;  4EWF A;  3ZNT A;  5L2F A;  3G35 A;  3Q1F A;  1GCE A;  4DE2 A;  1MKI A;  1MXO A;  2V1Z A;  3HL9 A;  3VP3 A;  3AGF A;  3CMZ A;  3N8S A;  5AQ9 A;  3AGD A;  4WZ5 C;  1BLC A;  1XA7 A;  2ZJ9 A;  3MZE A;  3NI9 A;  4JPM A;  4FSF A;  5U47 A;  4E3O A;  2QMI A;  3VFH A;  1PYY A;  4B4Z A;  2EFX A;  2ZMA A;  5KZH A;  1YMS A;  3OCL A;  3ZGA B;  5HAP A;  1CEF A;  3OPR A;  3WS5 A;  1QMF A;  3PBQ A;  4QJG A;  4KQQ A;  4WEJ A;  4RVA A;  1BZA A;  1XX2 A;  2QZ6 A;  3OCN A;  3A3I A;  1RGY A;  2ZQA A;  2QPN A;  1ERO A;  3A3J A;  2H5S A;  3GV9 A;  2EX6 A;  2Z2M B;  4UA9 A;  4C6Y A;  3RXW A;  2IWB A;  3UO9 A;  4BQM A;  1GHP A;  4WZ4 A;  1W79 A;  5EOO A;  1LLB A;  3G30 A;  3N4I A;  4PM8 A;  2DRW A;  4QY5 A;  4E3I A;  2WAE A;  5AQA A;  3V39 A;  3AGE A;  4KZ6 A;  1PWG A;  4OQI A;  4E6W A;  3IF6 A;  3QNB A;  3HLW A;  4KZ5 A;  1KGE A;  5A91 A;  3HBR A;  3PAG A;  4S2J A;  5FAQ A;  5FQQ A;  4R0Q A;  4BEN A;  4OPR A;  4RX3 A;  1YLP A;  3VOZ A;  2ZC7 A;  1TVF A;  3BEC A;  3CJM A;  4UHU A;  3GVB A;  4FH4 A;  5CHJ A;  4QD4 A;  3IT9 A;  4ID4 A;  1K56 A;  3SH8 A;  3NBL A;  4E3K A;  5HL1 A;  2WZZ A;  1JWV A;  3O3V A;  1EI5 A;  1ZG6 A;  3HUM A;  3W4Q A;  4Y0T A;  3HLF A;  3IWO A;  1ESU A;  3S4X A;  3D4F A;  1L0F A;  3IH8 A;  4HBT A;  2C5W B;  1YLJ A;  1RCJ A;  2JC7 A;  3IHA A;  3IQA A;  4OPZ A;  4OOM A;  5HAI A;  5M1A A;  4GDN A;  1K55 A;  1NJ4 A;  1L2S A;  2WKI A;  1E3U D;  2Y2L A;  4N1H A;  2XR0 A;  4E3N A;  3ZVW A;  1KDW A;  4ZJ3 A;  1I2S A;  2FFY A;  4JBF A;  5E2F A;  5CER A;  5A93 A;  1KVL A;  3G31 A;  4S2K A;  3HUN A;  5EOE A;  5CEC A;  1ES4 A;  3IXD A;  5CTM A;  3UNW A;  5GHZ A;  4JXV A;  5DTK A;  1YLY A;  2WKE A;  2Y2P A;  1HTZ A;  3UE3 A;  2Y59 A;  1IKI A;  5CXW A;  5DF7 A;  1YLT A;  1KE3 A;  3Q7Z A;  1AXB A;  1WYB A;  3NC8 A;  4ZJ1 A;  3ZG9 B;  1I2W A;  3SH7 A;  3IH9 A;  2FFF B;  5EVI C;  3ZFZ A;  2WAF A;  4Q8I A;  2VGJ A;  1XP4 A;  3BRM A;  4KQO A;  2Y2G A;  5HFO A;  1E4D A;  2JCH A;  2WK0 A;  4KZ9 A;  3HLC A;  1ALQ A;  4XUX A;  1LI9 A;  3MXS A;  4KG5 A;  4XXR A;  1SCW A;  2CC1 A;  5GLD A;  4MLL A;  1K54 C;  3PBT A;  4DXC A;  1DY6 A;  2B5R A;  4OOY A;  2XK1 A;  5FQI A;  2H10 A;  1FSY A;  1Q2Q A;  5FDH A;  1FQG A;  3WS1 A;  3TG9 A;  5FI6 A;  4H8R A;  2VGK A;  3MKE A;  1PI4 A;  3P09 A;  3MZF A;  5CGX A;  4KZ3 A;  1TDL A;  5KSH A;  3OC2 A;  5A90 A;  4P85 A;  1IYO A;  4FCF A;  1JWZ A;  1U60 A;  1S0W A;  4QY6 A;  3G2Z A;  2J7V A;  3MBZ A;  4Y0U A;  3N6I A;  4K91 A;  4NK3 A;  3CZD A;  5CEB A;  3IF5 A;  2IWD A;  4IBR A;  1S6R A;  4ZBE A;  4Y0O A;  5GLB A;  4PM9 A;  3N8L A;  3VSL A;  2Y55 A;  2Y2Q A;  2ZQ7 A;  2ZQC A;  5EVI D;  3BM6 A;  3NY4 A;  5DTT A;  5FQM A;  2HP6 A;  5CGW A; 
#chains in the Genus database with same CATH topology
 3QP5 A;  4L0L A;  2GNX A;  3V5M A;  5MC7 A;  3W8K A;  1GA0 A;  4HP4 A;  1LI0 A;  3FKV A;  3E2K A;  2QJ7 A;  4N1X A;  4H6J A;  1W8Y A;  3LGO A;  5HD3 A;  3HLB A;  1T1B A;  2XFT A;  4GZB A;  2DCF A;  1IYS A;  3LI8 A;  3D72 A;  1F5M A;  3C7U A;  1Y4O A;  1KGG A;  2WGW B;  1UWN X;  4Y15 A;  1IKG A;  2BLS A;  5DVA A;  3VE3 A;  5E43 A;  3Q07 A;  2R9W A;  4R1G A;  4WBG A;  5J4E A;  3UB8 A;  1VHM A;  4JF5 A;  4UQI M;  1OTA A;  2Y2O A;  5FQ9 A;  4KZB A;  2J3T D;  4B88 A;  1Z6F A;  1PZP A;  2ZD8 A;  5IU1 A;  4OVD A;  1O07 A;  1K57 C;  4ZAM A;  2Y91 A;  1PI5 A;  1HZO A;  4D2O A;  4Q0J A;  1PWC A;  3BY9 A;  4N92 A;  1CK3 A;  2V8F A;  2XH9 A;  1JTD A;  3C4O A;  1AWI A;  4LPZ A;  3M2J A;  2WGV A;  1K4E A;  4NG2 A;  1ERQ A;  2KOI A;  2G7U A;  3WS0 A;  1M6K A;  2JBF A;  3CG5 A;  4B4X A;  4Z1W A;  4C75 A;  3HCY A;  2VJW A;  1NLY A;  3N7W A;  4GHI A;  3NUL A;  5HW3 A;  5DF8 A;  4D60 A;  3OZH A;  4EET B;  1KVM A;  3V3S A;  2PR6 A;  3LR3 A;  2B95 A;  3WS2 A;  1NRF A;  2W1R A;  4OLG A;  1YAX A;  1DRM A;  2VGL S;  4MNR A;  3RH8 B;  1XFN A;  4YIN A;  1W8Q A;  3CWF A;  1YSP A;  2G2W A;  4ESP A;  1ESI A;  5LBR A;  4LV1 A;  4GN2 A;  5FQJ A;  2H0Y A;  3DTE A;  1P9W A;  1CI8 A;  2J8Y A;  4EQ1 A;  4BLM A;  1FSW A;  3PAE A;  4S2I A;  2DNS A;  4HJ6 A;  1K56 D;  3LIA A;  4CJN A;  4MN6 A;  4EXO A;  1BLS A;  2PU2 A;  1ERM A;  3NOP C;  1K54 A;  1XJ4 A;  2R78 A;  4ZTK A;  3H7W B;  2I72 A;  1F98 A;  3MXQ A;  4X25 A;  1YMX A;  1PIO A;  2ZC6 B;  2ZQ8 A;  2HPB A;  3UPP A;  5FA7 A;  2XD1 A;  3ZHH A;  4UA7 A;  4NXE A;  2HDS A;  3VSK A;  2XA7 M;  4DDS A;  4I3I A;  4NXB A;  3DBA A;  3EQU A;  4HEF A;  5G4Z A;  4WZ5 A;  4GDB A;  2VA0 A;  4BD0 A;  1F9I A;  3CUE C;  1F2K A;  4K0X A;  4MBH A;  3H82 B;  3ZG7 B;  3ITB A;  1L3L A;  1YSQ A;  2P7J A;  4HIA A;  1N4O A;  1Y54 A;  5E2E A;  1CQA A;  3LO7 A;  4QWO A;  4P0M A;  1PRQ A;  2WKP A;  3V50 A;  4OOL A;  4U3T A;  2WYX A;  4OQ0 A;  1GSW A;  3P7N A;  2HDR A;  4F94 A;  3E2L A;  2BTF P;  4X69 A;  1IOU A;  3EQV A;  4S2P A;  3OBF A;  4Y13 A;  2K31 A;  2PHY A;  3T4L A;  3G4P A;  2EWW A;  3N8R A;  5EV0 A;  1CI9 A;  4X53 A;  3ZNT A;  4DE2 A;  2V1Z A;  3TW8 A;  4WZ5 C;  2JKR I;  3KX0 X;  4JPM A;  4FSF A;  4E3O A;  2QMI A;  5HL6 A;  1SZV A;  3QP1 A;  4ME4 A;  3UME A;  3VOL A;  3F1P B;  4Y3I A;  3OPR A;  2JHE A;  2KLI A;  3MSH A;  2PT7 A;  3A3I A;  2QPN A;  1ERO A;  3LFV A;  4C6Y A;  3T4Q A;  4PM8 A;  5AQA A;  1H3Q A;  4E6W A;  4G3K A;  3QNB A;  3HLW A;  4S2J A;  5FAQ A;  4R0Q A;  4IJG A;  5HD5 A;  3BEC A;  4FH4 A;  1V9Z A;  4QD4 A;  2PDR A;  3IS2 B;  3IT9 A;  1EI5 A;  1ZG6 A;  4Y0T A;  3T4J A;  3D4F A;  1G6O A;  1RCJ A;  5HAI A;  5FEG A;  1K55 A;  1L2S A;  3S7P A;  2V1B A;  2XR0 A;  4ZJ3 A;  2FFY A;  3EGD C;  5CTM A;  3UNW A;  1ODV A;  5GHZ A;  4JXV A;  3UE3 A;  2WKE A;  2Y2P A;  3NC8 A;  3IH9 A;  1S1Z A;  4Q8I A;  2VGJ A;  2Y2G A;  4KZ9 A;  1ALQ A;  4LRY C;  2JKT M;  1DY6 A;  2L0W A;  2H10 A;  1P0Z A;  2HGV A;  2A24 B;  4LLO B;  4H8R A;  2VGK A;  3MKE A;  1Y28 A;  1PI4 A;  5FL3 A;  4IHQ A;  1TDL A;  3KSI A;  4P85 A;  1IYO A;  4FCF A;  4Y0U A;  1OTB A;  4P6Z M;  4K91 A;  4NK3 A;  4KQD A;  1S6R A;  3OOV A;  3GEC A;  3VSL A;  3IBR A;  2ZQ7 A;  1MC0 A;  5CGW A;  5E2G A;  5M18 A;  2VEA A;  3TE8 A;  2P74 A;  3PBO A;  3UB7 A;  2CMN A;  5J3W A;  4GNU A;  1VB6 A;  2IWC A;  2VV6 A;  2W3D A;  4H6J B;  5F83 A;  1H0M A;  5HDS A;  4JKT A;  4M3K A;  3WS4 A;  3B47 A;  4KEN B;  2Y2N A;  2L4R A;  1PNE A;  5EE8 A;  2O0Y A;  2M7V A;  3EWK A;  1W63 M;  5CRF A;  1K25 A;  4RX2 A;  2UWX A;  1MZU A;  2Q9M A;  3I7J A;  4JXG A;  3G6O A;  3OPL A;  1DP6 A;  3DAV A;  3GRJ A;  3GSG A;  5I5L A;  3WWX A;  2XSS A;  3T1Q B;  3PTE A;  3G34 A;  2ZLY A;  3KSH A;  3UN7 A;  1RP5 A;  1XGJ A;  2OOL A;  1K4F A;  3MQ0 A;  5KIZ A;  3LI9 A;  1LHY A;  4S2N C;  4I3A A;  4LV3 A;  5E2H A;  1K38 A;  4CLC C;  1E25 A;  2HDQ A;  2HZ5 A;  2R9X A;  2G2U A;  3SOI A;  3LYX A;  2Y2I A;  5CHU A;  2GX5 A;  5EFW A;  3UDI A;  3SZT A;  3DTK A;  1TS6 A;  1YT4 A;  1OT9 A;  1DP9 A;  2ZC5 B;  4OQG A;  2WKQ A;  4OH0 A;  1NY0 A;  5DFX A;  1WA9 A;  2QJ5 A;  1EWZ A;  1G6A A;  3W4P A;  5HWW A;  3LEQ A;  3T1X A;  1W63 Q;  1JWP A;  2B18 A;  2W1T B;  5F1G A;  5D3O A;  2EX2 A;  4I39 A;  3C5A A;  4BBV A;  4CLC D;  5M19 A;  1SDE A;  1E3U A;  1BSG A;  2H0T A;  3E98 A;  3FWL A;  1JNU A;  3UPN A;  3ZQ5 A;  4GHI B;  4KQR A;  2PAV P;  1NLZ A;  2A24 A;  3A3F A;  3IF6 C;  5DJT A;  2RL3 A;  3KYQ A;  4YFM A;  4EEU A;  4C3Q A;  3NDE A;  1VEU B;  4MN5 A;  3IX4 A;  3SW1 A;  1KOU A;  3E4P A;  3MF0 A;  4P87 A;  1PFL A;  4MBF A;  1SHV A;  1BUL A;  4JF6 A;  5HZH A;  4WYY A;  1FIK A;  1PW1 A;  4N9L A;  5GL9 A;  4MDZ A;  1ONH A;  4HH2 A;  4UA6 A;  5F82 A;  1IYQ A;  4XUZ A;  5F1F A;  4LV0 A;  1PW8 A;  4KZ7 A;  2OV5 A;  1W5D A;  3RXX A;  2O99 A;  3MJQ A;  1ONG A;  1IEM A;  3C2W A;  4BMW A;  2EFU A;  2RCX A;  5JYO A;  2XLN A;  4X68 A;  4U0T A;  4II7 A;  1S1Y A;  4HP9 A;  3LR5 A;  3UE0 A;  2X01 A;  2INW A;  1XKZ A;  2HP5 A;  3PBR A;  4F3L A;  2WGI A;  5IS1 A;  1DP8 A;  4PAU A;  4HBU A;  2Z2L B;  2HP9 A;  4EES A;  3ZDJ A;  3LUQ A;  3UPO A;  4UQI S;  2NUT C;  4LV2 A;  4PM6 A;  5DTS A;  1YKD A;  4KZ8 A;  3G2Y A;  4EUZ A;  2PR5 A;  2JN7 A;  3LIF A;  4PHT A;  2XFS A;  1I5Q A;  4IVI A;  1YLW A;  3VMA A;  1SKO B;  4WEL A;  4KZA A;  3HUO A;  3JVU A;  3IWI A;  3P98 A;  3HRE A;  3BFC A;  3IHB A;  2V20 A;  4E6X A;  4Y7P A;  4BL3 A;  5L07 A;  1ES3 A;  3A0V A;  4OPQ A;  3MFD A;  3A3E A;  1NZO A;  1YQS A;  4JF4 A;  3K2N A;  2P04 A;  2OSU A;  1S4S A;  2W1T A;  1MWR A;  3V67 A;  3V3R A;  1A0K A;  2XGN A;  1XGI A;  3NCK A;  4DMZ A;  4EUV A;  2Y2M A;  2GZA A;  1QME A;  4E3L A;  1BYW A;  5AQB A;  3S22 A;  4KG6 A;  4JGP A;  2EXA A;  4WMC A;  3Q7V A;  2ZQ9 A;  4EW7 A;  3UB9 A;  3KYE A;  5DKL A;  3LY3 A;  3T4K A;  3G32 A;  1TF1 A;  3ZG5 A;  4OP5 A;  3MKF A;  2W3F A;  3S1Y A;  5FSR A;  4KUK A;  2PYR A;  2YKH A;  1VEU A;  4LEN A;  4BWI A;  5TR7 A;  4WUJ A;  3LIB A;  4B9O A;  3LCE A;  4EER A;  4KG2 A;  3JVV A;  4R3A A;  3SH9 A;  1YLZ A;  4O01 A;  4EWF A;  5L2F A;  3G35 A;  3Q1F A;  1MXO A;  3HL9 A;  3N8S A;  2VGL M;  2ZJ9 A;  3BQA A;  3MZE A;  2FH5 A;  2Q0O A;  3NI9 A;  5F68 A;  4B4Z A;  1LT0 A;  1ZHH B;  2D02 A;  1TS0 A;  4KQQ A;  4WEJ A;  4RVA A;  1BZA A;  2QZ6 A;  1RGY A;  2YKF A;  2H5S A;  3GV9 A;  3HJK A;  4K08 A;  1Z09 A;  4UA9 A;  3T1R A;  3RXW A;  3UO9 A;  4BQM A;  4G3V A;  4QY5 A;  2WAE A;  2EA9 A;  3V39 A;  4KZ6 A;  4OQI A;  4KZ5 A;  5A91 A;  2VX8 A;  3HBR A;  4BEN A;  4LGW A;  4OPR A;  4RX3 A;  2V1A A;  3QP4 A;  1TVF A;  1T1C A;  3CJM A;  3GVB A;  1G28 A;  4E3K A;  2JKF A;  2WZZ A;  4NXF A;  2V8C A;  1ESU A;  3UB5 P;  2PBD P;  2C5W B;  1YLJ A;  1SKO A;  2JC7 A;  2QHK A;  1NJ4 A;  2WKI A;  4E3N A;  4CQH A;  3ZVW A;  1KDW A;  3UB6 A;  1KVL A;  3G31 A;  4LRX C;  1ES4 A;  2ZBB A;  4DJ2 A;  5DTK A;  2Y59 A;  4I38 A;  4X1L A;  3PHY A;  4R70 A;  5CXW A;  4ZJ1 A;  4PKY A;  3B33 A;  2FFF B;  2ZMV A;  5HFO A;  2JCH A;  3JPU A;  1SCW A;  2CC1 A;  5GLD A;  3IX3 A;  4MLL A;  1K54 C;  4LRZ E;  3PBT A;  5A8B A;  2V0W A;  5FQI A;  1Q2Q A;  5FDH A;  1FQG A;  3WS1 A;  3ICY A;  4MCW A;  2PD8 A;  4M4X A;  2NUP C;  5CGX A;  1NRJ A;  4KZ3 A;  5A90 A;  1YPR A;  5EEC A;  3G2Z A;  2J7V A;  3KO6 A;  3QP6 A;  2IWD A;  4Y0O A;  1N9O A;  2Y2Q A;  2QKP A;  3BM6 A;  5FQM A;  3BW6 A;  2HP6 A;  3C4P A;  4L9E A;  2JE5 A;  3VE4 A;  4PPR A;  4YNR A;  3Q81 A;  3UE1 A;  3DTI A;  4HJ3 A;  3F1N B;  1FR1 A;  4EEP A;  5GHY A;  3BFD A;  3L9K A;  3CIT A;  5EVI B;  4K0W A;  4X56 A;  2XQZ A;  1XJ3 A;  1BLH A;  2Z6C A;  5FI2 A;  4HES A;  3TJZ C;  4IED A;  2W27 A;  3VP4 A;  2VV7 A;  3OPH A;  3KSG A;  2XRO A;  3DW0 A;  2A3U A;  5KSC A;  4X1M A;  5JYP A;  2WUQ A;  2BG1 A;  3F1O B;  3SS3 A;  5HPF A;  5CTN A;  3UDX A;  2P9V B;  2VK3 A;  2EXB A;  4EBP A;  3DTM A;  4ARZ B;  1KGF A;  3CAX A;  2D01 A;  4JGR A;  2KDK A;  4PM7 A;  3BLS A;  5EPH A;  4X55 A;  4IUH A;  2X71 A;  2O9A A;  2GDN A;  1ZG4 A;  4RA7 A;  2E8J A;  1L0G A;  1OTI A;  3M6H A;  3W4O A;  4GB7 A;  4R6L A;  4CLC E;  3BFE A;  4OQH A;  3ZCZ A;  1OTE A;  3IWQ A;  5DJU A;  3K3D A;  1DJC A;  4PMA A;  5EVE A;  2XEP A;  1FCN A;  3C30 A;  4OP8 A;  3GR2 A;  3OPP A;  2PBY A;  1OJ5 A;  4FH2 A;  3CI6 A;  5A92 A;  2Y2H A;  3PYP A;  3S7O A;  2OWH A;  3D3O A;  4Y5F A;  1NWZ A;  4EBL A;  3TSG A;  2ZC4 B;  4DE3 A;  1WYC A;  4GKU A;  4L9G A;  4Y2F A;  1UGU A;  1YM1 A;  1K55 C;  5EUA A;  4CPK A;  3LIE A;  3MFX A;  3E0Y A;  1CJF A;  3HLD A;  2J3W A;  2B02 A;  4DE1 A;  1S4R A;  1IEL A;  3KSF A;  3F1N A;  4NEE D;  2ZL1 B;  5GHX A;  1BTL A;  4Y17 A;  3SS5 A;  3GMW A;  4F3L B;  4LCL A;  3UMD A;  5EVI A;  1OTD A;  5L10 A;  1H8Z A;  3IXH A;  5HPI A;  3EEA A;  4NET A;  4ZDX A;  3U2A A;  4BJP A;  2ZM2 A;  5HAQ A;  3VFF A;  3IBJ A;  4JGQ A;  3WRT A;  1LSV A;  1LL5 A;  1XJ6 A;  1P9R A;  4RYE A;  1IYP A;  3QNC A;  3FZC A;  4HH3 A;  4R23 A;  1MWU A;  1T18 A;  2Q9N A;  2K2N A;  3BFG A;  4QB8 A;  3O88 A;  3NIA A;  1FCO A;  4Q0I A;  3HLG A;  3BQ8 A;  4P6B A;  1J9M A;  3MR0 A;  2ZQD A;  2XRN A;  5FAT A;  3F1O A;  5AQ7 A;  2O9B A;  3DWZ A;  4BBU A;  3PXP A;  4EV4 A;  1H5X A;  1HD8 A;  2P9V A;  4ZJ2 A;  1IFQ A;  5L8M A;  2AVX A;  3MXR A;  4ARZ A;  3TRC A;  1BUE A;  3GTC A;  2GJ3 A;  1PWD A;  1H8Y A;  2JKG A;  5IHV A;  3GDI A;  3T4T A;  2J9O A;  3PBS A;  4GOG A;  3BYD A;  2HDU A;  3FG8 A;  2A49 A;  4U0X A;  1FIL A;  3EEH A;  4OLD A;  2HJE A;  3NDG A;  5GLC A;  3Q7V B;  2J80 A;  1ES5 A;  5BOH A;  5F6A A;  3T4O A;  4ETX A;  2EWV A;  3M2K A;  2FZ0 A;  2BAS A;  1GHM A;  1OME A;  3NEC A;  3IXG A;  2X02 A;  1PZO A;  1VQQ A;  5CGS A;  3BLM A;  3ZG8 B;  2WKR A;  3BFF A;  3DWK A;  1KDS A;  3C8C A;  1BLP A;  3T12 B;  4S2O A;  1Q2P A;  1X0O A;  4FTX A;  3VP2 A;  3WRZ A;  3LEZ A;  3RTY A;  4L9F A;  5HX9 A;  1K57 A;  3IX8 A;  4UEY A;  5FQK A;  3LY4 A;  3UDF A;  1LSX A;  4R38 A;  1MKM A;  2JKR M;  1MKI A;  4GLQ A;  1H8M A;  1D7E A;  5AQ9 A;  2EFX A;  1D1J A;  1YMS A;  2ACG A;  2ZL1 A;  2J3T C;  3LID A;  3ZGA B;  4G3W A;  3NOT C;  3T50 A;  3WS5 A;  1QMF A;  1T1A A;  3PBQ A;  1GSX A;  4MN7 A;  3FPV A;  2ZQA A;  2Z2M B;  2IWB A;  1GHP A;  4WZ4 A;  1W79 A;  5EOO A;  3G30 A;  3N4I A;  4GS9 A;  1PWG A;  3MQO A;  4HNB A;  1XJ2 A;  3VOZ A;  5FEF A;  5CHJ A;  4ID4 A;  1K56 A;  5C5K A;  5HL1 A;  3IWO A;  3R7W B;  5L09 A;  3S4X A;  2KX6 A;  2HJ9 C;  3UE6 A;  3IH8 A;  4HBT A;  5M1A A;  3IHA A;  2OAP 1;  1E3U D;  2Y2L A;  4PKY G;  3EGX C;  5HDC A;  5HDD A;  5CER A;  3IXD A;  1N9L A;  4Q0H A;  1IKI A;  5DF7 A;  1KE3 A;  3Q7Z A;  3CLO A;  1I2W A;  2WAF A;  4HHD A;  2PYP A;  4HQA A;  1XP4 A;  4WLA A;  5EM0 A;  2WK0 A;  3HLC A;  4XUX A;  3FC7 A;  4XXR A;  3H9W A;  1OT6 A;  4OOY A;  3R4K A;  2XK1 A;  4WF0 A;  1FSY A;  5IT5 A;  2JKT I;  2H28 A;  4IUK A;  3MZF A;  2V0U A;  5HWV A;  1VET B;  3U4L P;  1JWZ A;  4QY6 A;  3MBZ A;  3N6I A;  5CEB A;  1OPX A;  3IF5 A;  4IBR A;  5GLB A;  4PM9 A;  2ZOH A;  2W3E A;  2ZQC A;  1DJB A;  1FOF A;  3A0R A;  4HOI A;  2VLG A;  2Z6D A;  3E4Q A;  2J9P A;  3EOI A;  3CPT A;  3CHW P;  4KZ4 A;  1K0K A;  2PRF A;  1VM1 A;  4X6T A;  5F69 A;  1HLU P;  3RFB A;  5GLA A;  5TBM B;  3CUE A;  2Y2K A;  1MPL A;  2EX9 A;  5F5Y A;  2VV8 A;  2ZC3 B;  3HLE A;  3L7H A;  5AVE A;  3C38 A;  4MEZ A;  4HY8 A;  5HAR A;  1L0D A;  3ULF A;  2WZX A;  2PD7 A;  3ITA A;  3O87 A;  1DJA A;  4GD8 A;  4R3J A;  3PBN A;  3GQZ A;  2WGW A;  2UV0 E;  2WKH A;  2M7U A;  2MJ6 A;  1NXY A;  2ZM0 A;  4E3J A;  4JXW A;  4JXS A;  3QP8 A;  5I94 A;  5FAP A;  1NZU A;  4OPY A;  1N9N A;  2XA7 S;  4O8G A;  4UAA A;  2Y8H A;  4DF6 A;  5DF9 A;  1KE4 A;  3M6B A;  4WL9 A;  5TJJ A;  3R7W A;  1ZKJ A;  4QU3 A;  4BBT A;  3FPW A;  3ZYT A;  5AJG A;  4E3M A;  1FCM A;  4BL2 A;  4S2M A;  3BEB A;  4R4R A;  4DJ3 A;  4WMC D;  4PM5 A;  1GSV A;  1S66 L;  4BD1 A;  4LFU A;  3FKW A;  3SS4 A;  1JTG A;  2I9V A;  3BWL A;  2QWS A;  3A3D A;  2V9A A;  4JLF A;  3Q82 A;  2PU4 A;  3ZVT A;  3S7N A;  4EQI A;  3NJA A;  2WAD A;  4I5S A;  4NXG A;  5EVL A;  3VOY A;  1G68 A;  4YWZ A;  5FAS A;  2OLU A;  1ZC2 A;  1W7F A;  3MQQ A;  4R3B A;  1M40 A;  1N9B A;  5KMW A;  5CX7 A;  1VET A;  3FV7 A;  1K6R A;  4CLC B;  1MWS A;  3A0S A;  2A2L A;  2Y2J A;  5HWT A;  1NYY A;  3B3X A;  1ZTU A;  4WM9 A;  1MBL A;  4DKI A;  2ZM8 A;  1D06 A;  4I3J A;  1RGZ A;  4O0P A;  1HVB A;  1ES2 A;  4B93 A;  2ZMF A;  3MMH A;  4LCM A;  3QP2 A;  5TBM A;  1MWT A;  4N9K A;  4YOF A;  4DDY A;  2OLV A;  4QHC A;  5FI7 A;  1BT5 A;  2V2F F;  2M1C A;  4DRT A;  1XXM A;  4DE0 A;  1XA1 A;  4GD6 A;  3ZG0 A;  1K6S A;  4MBK A;  1KE0 A;  3QHY A;  5TGF A;  2VKS A;  2XF3 A;  3VP0 A;  4WEK A;  1JVJ A;  4GCZ A;  2Y4A A;  3JYI A;  3NHQ A;  4E04 A;  5CHM A;  1P97 A;  3IF6 B;  1UWP X;  4R4S A;  1C3B A;  5G18 A;  3TOI A;  4WN5 A;  1T19 A;  3H7W A;  3VV4 A;  5EM1 A;  4HJ4 A;  3T1S A;  2XDM A;  5K5B A;  4FOF A;  4DXB A;  1CF0 A;  4OON A;  3HVF A;  1O7E A;  1CEG A;  2K7S A;  5DFY A;  2LB5 A;  3E4O A;  4HI4 A;  4IVK A;  3T4S A;  3D9Y A;  5DKK A;  4OKP A;  2E8I A;  2XD5 A;  2W3G A;  3O5Y A;  4ETZ A;  2O9C A;  1NYM A;  3C7V A;  3HJI A;  4GW9 A;  5TFQ A;  3LR4 A;  3UY6 A;  3ISG A;  1LL8 A;  3O86 A;  4Z9Q A;  3FYZ A;  4FUW A;  4XT2 B;  2L1M A;  1GA9 A;  5FAO A;  3H82 A;  1MY8 A;  5J8X A;  4P6Z S;  4EU0 A;  2OAQ 1;  1SKF A;  5CED A;  1G5U A;  3PR6 A;  4FD8 A;  1L0E A;  4EBN A;  3MZD A;  1GHI A;  1WE4 A;  3ZNY A;  3K3C A;  3RJU A;  4S2N A;  4QPR A;  1FR6 A;  2C6W B;  3VP1 A;  2QYB A;  3W2Z A;  1TDG A;  1XPB A;  4O7D A;  4A5R A;  4CLC A;  2EX8 A;  1LL9 A;  1TEM A;  3B42 A;  4S2L A;  3IXB A;  4IBX A;  1SDN A;  1GCE A;  3VP3 A;  3AGF A;  3CMZ A;  3AGD A;  1BLC A;  1XA7 A;  3LIC A;  5U47 A;  1TS7 A;  4JGO A;  3VFH A;  1PYY A;  2ZMA A;  1TS8 A;  5KZH A;  3S7Q A;  5AVF A;  2IA2 A;  3OCL A;  5HAP A;  1CEF A;  1XFQ A;  2HV1 A;  4MMN A;  3KYZ A;  2ZOI A;  4QJG A;  2VZW A;  1XX2 A;  4GS9 B;  3OCN A;  3F1P A;  1S67 L;  2OWJ A;  3OLO A;  3A3J A;  1TD5 A;  2EX6 A;  3MS6 A;  5J7E A;  1LLB A;  4E3I A;  2DRW A;  3AGE A;  5G4Y A;  3IF6 A;  3P01 A;  1KGE A;  3PAG A;  5FQQ A;  1YLP A;  3BJN A;  2ZC7 A;  1J3W A;  4UHU A;  2LB9 A;  3SH8 A;  3NBL A;  1JWV A;  3O3V A;  3W4Q A;  3HUM A;  3HLF A;  1LSW A;  1V9Y A;  1L0F A;  3IS2 A;  3IQA A;  4OPZ A;  4OOM A;  4GDN A;  4N1H A;  3BY8 A;  1I2S A;  4JBF A;  5E2F A;  5A93 A;  4RQ9 A;  4S2K A;  3HUN A;  5EOE A;  5CEC A;  1ACF A;  1YLY A;  1HTZ A;  1YLT A;  5HSQ A;  1AXB A;  1WYB A;  3ZG9 B;  4DN0 A;  3SH7 A;  5EVI C;  3ZFZ A;  2Y79 A;  3BRM A;  4KQO A;  2HF6 A;  1E4D A;  4XT2 A;  4KUO A;  1LI9 A;  3MXS A;  4KG5 A;  5FDS A;  4DXC A;  2B5R A;  2P08 A;  3TG9 A;  5FI6 A;  2W0N A;  2W3H A;  4GJ4 A;  3P09 A;  1STZ A;  1OJG A;  5KSH A;  1EW0 A;  4ZRR A;  3OC2 A;  4NKP A;  1U60 A;  1S0W A;  3LR0 A;  3CZD A;  3NOU C;  4ZBE A;  2DMW A;  3N8L A;  2Y55 A;  3CPT B;  5EVI D;  3NY4 A;  5DTT A;  4AFI A; 
#chains in the Genus database with same CATH homology
 3C4P A;  1DJB A;  5E2G A;  1FOF A;  2JE5 A;  5M18 A;  4PPR A;  3Q81 A;  2P74 A;  2J9P A;  3PBO A;  4L0L A;  4GNU A;  3UE1 A;  4KZ4 A;  2IWC A;  3V5M A;  5F83 A;  1VM1 A;  3W8K A;  1GA0 A;  4JKT A;  4X6T A;  4M3K A;  3WS4 A;  1LI0 A;  3FKV A;  5GLA A;  1FR1 A;  4KEN B;  2Y2N A;  3E2K A;  5EE8 A;  5GHY A;  4N1X A;  2Y2K A;  1MPL A;  2EX9 A;  1W8Y A;  3BFD A;  3HLB A;  5EVI B;  2ZC3 B;  3HLE A;  2XFT A;  4K0W A;  4GZB A;  5CRF A;  1K25 A;  1IYS A;  2DCF A;  3C7U A;  4MEZ A;  4X56 A;  2XQZ A;  1KGG A;  2WGW B;  4RX2 A;  5HAR A;  1IKG A;  1L0D A;  2UWX A;  2Q9M A;  2BLS A;  3I7J A;  1BLH A;  4JXG A;  2WZX A;  5DVA A;  3OPL A;  3GRJ A;  3ITA A;  3O87 A;  5FI2 A;  3GSG A;  3WWX A;  1DJA A;  4HES A;  4GD8 A;  4R3J A;  3PBN A;  3GQZ A;  2WGW A;  3PTE A;  5E43 A;  3G34 A;  3Q07 A;  2ZLY A;  2R9W A;  2WKH A;  3UN7 A;  4IED A;  4R1G A;  4WBG A;  1NXY A;  1RP5 A;  1XGJ A;  2ZM0 A;  3VP4 A;  4E3J A;  1K4F A;  4JXW A;  4JF5 A;  1LHY A;  3OPH A;  4JXS A;  5I94 A;  5FAP A;  4S2N C;  1NZU A;  4OPY A;  2Y2O A;  5FQ9 A;  4KZB A;  3DW0 A;  4LV3 A;  5E2H A;  2A3U A;  1K38 A;  5KSC A;  4UAA A;  5JYP A;  1E25 A;  2HDQ A;  2R9X A;  2WUQ A;  2G2U A;  2BG1 A;  3SOI A;  3SS3 A;  2Y2I A;  5CHU A;  4B88 A;  1Z6F A;  4DF6 A;  1PZP A;  3UDI A;  5DF9 A;  5CTN A;  2ZD8 A;  1KE4 A;  3M6B A;  2P9V B;  3UDX A;  4OVD A;  1O07 A;  2EXB A;  1K57 C;  4EBP A;  4ZAM A;  2Y91 A;  3DTM A;  1ZKJ A;  4QU3 A;  1YT4 A;  1PI5 A;  1KGF A;  1HZO A;  4D2O A;  4PM7 A;  3BLS A;  2ZC5 B;  5EPH A;  1PWC A;  4E3M A;  4OQG A;  1FCM A;  4X55 A;  4BL2 A;  4S2M A;  2X71 A;  3BEB A;  4R4R A;  4OH0 A;  2GDN A;  4N92 A;  1NY0 A;  1ZG4 A;  1CK3 A;  4WMC D;  4PM5 A;  4RA7 A;  1L0G A;  1EWZ A;  4BD1 A;  1G6A A;  3M6H A;  3W4O A;  2XH9 A;  1JTD A;  3W4P A;  3C4O A;  3FKW A;  4GB7 A;  3SS4 A;  1JTG A;  1JWP A;  3M2J A;  2WGV A;  1K4E A;  3A3D A;  4JLF A;  3Q82 A;  5F1G A;  2PU4 A;  3ZVT A;  3BFE A;  4OQH A;  2EX2 A;  5D3O A;  3ZCZ A;  3C5A A;  4EQI A;  1ERQ A;  5M19 A;  3IWQ A;  3WS0 A;  1SDE A;  1E3U A;  2H0T A;  1M6K A;  2WAD A;  1BSG A;  3FWL A;  2JBF A;  1DJC A;  4PMA A;  3UPN A;  5EVL A;  3VOY A;  4KQR A;  1G68 A;  3CG5 A;  4B4X A;  2XEP A;  5FAS A;  4C75 A;  1FCN A;  3A3F A;  3IF6 C;  4OP8 A;  2OLU A;  1ZC2 A;  3GR2 A;  1W7F A;  2RL3 A;  3N7W A;  4R3B A;  1M40 A;  3OPP A;  2PBY A;  4YFM A;  4FH2 A;  1N9B A;  5A92 A;  5KMW A;  4C3Q A;  2Y2H A;  5HW3 A;  5DF8 A;  3FV7 A;  1K6R A;  3OZH A;  1MWS A;  3NDE A;  1KVM A;  3V3S A;  4EBL A;  2Y2J A;  3TSG A;  2ZC4 B;  4DE3 A;  3WS2 A;  1NYY A;  4P87 A;  1WYC A;  1NRF A;  3B3X A;  4GKU A;  4MBF A;  1SHV A;  1BUL A;  4JF6 A;  4WYY A;  4OLG A;  1PW1 A;  4N9L A;  4WM9 A;  5GL9 A;  4MNR A;  1YM1 A;  1K55 C;  4YIN A;  4UA6 A;  1ONH A;  1MBL A;  1W8Q A;  5F82 A;  4DKI A;  5EUA A;  4CPK A;  1IYQ A;  2ZM8 A;  4XUZ A;  3HLD A;  5F1F A;  2G2W A;  4DE1 A;  4LV0 A;  1ESI A;  4LV1 A;  1RGZ A;  1PW8 A;  1HVB A;  1ES2 A;  4GN2 A;  4KZ7 A;  2OV5 A;  5FQJ A;  1IEL A;  1W5D A;  4LCM A;  2H0Y A;  3RXX A;  1ONG A;  1CI8 A;  1IEM A;  1MWT A;  2J8Y A;  4N9K A;  4DDY A;  5GHX A;  2EFU A;  2RCX A;  5JYO A;  2OLV A;  4QHC A;  1BTL A;  4BLM A;  1FSW A;  1BT5 A;  5FI7 A;  2V2F F;  2XLN A;  3GMW A;  3SS5 A;  3PAE A;  4X68 A;  4U0T A;  4DRT A;  1XXM A;  4LCL A;  4S2I A;  2DNS A;  5EVI A;  4DE0 A;  1XA1 A;  4GD6 A;  3UE0 A;  3ZG0 A;  1K56 D;  1H8Z A;  3IXH A;  1K6S A;  4MBK A;  1KE0 A;  3QHY A;  1XKZ A;  2X01 A;  5TGF A;  4CJN A;  2HP5 A;  4NET A;  4ZDX A;  4BJP A;  2ZM2 A;  1BLS A;  2PU2 A;  3PBR A;  3VFF A;  5HAQ A;  2XF3 A;  2WGI A;  1ERM A;  3VP0 A;  3WRT A;  1LL5 A;  1K54 A;  4WEK A;  4HBU A;  1JVJ A;  2Z2L B;  2HP9 A;  2Y4A A;  3JYI A;  4RYE A;  3ZDJ A;  3UPO A;  5CHM A;  1IYP A;  3IF6 B;  4LV2 A;  3QNC A;  4ZTK A;  3FZC A;  4PM6 A;  5DTS A;  4R23 A;  1MWU A;  4R4S A;  2I72 A;  2Q9N A;  1C3B A;  3BFG A;  5G18 A;  4KZ8 A;  4QB8 A;  3O88 A;  3G2Y A;  4EUZ A;  3NIA A;  1FCO A;  1YMX A;  3TOI A;  3HLG A;  4P6B A;  1PIO A;  2ZC6 B;  1J9M A;  2ZQ8 A;  2HPB A;  2XFS A;  3UPP A;  1I5Q A;  4IVI A;  2ZQD A;  5FA7 A;  2XD1 A;  5FAT A;  1YLW A;  3ZHH A;  2XDM A;  5AQ7 A;  3VMA A;  3DWZ A;  4UA7 A;  4EV4 A;  1H5X A;  4DXB A;  2P9V A;  1HD8 A;  3HVF A;  4OON A;  1O7E A;  4WEL A;  4KZA A;  2HDS A;  3HUO A;  3VSK A;  1CEG A;  4ZJ2 A;  5EEC A;  4DDS A;  3IWI A;  3EQU A;  3P98 A;  4HEF A;  3MXR A;  3HRE A;  3BFC A;  4WZ5 A;  1BUE A;  4IVK A;  3IHB A;  3GTC A;  2V20 A;  4GDB A;  4E6X A;  4BD0 A;  4OKP A;  2E8I A;  2XD5 A;  1PWD A;  4Y7P A;  4BL3 A;  1H8Y A;  5IHV A;  1ES3 A;  4K0X A;  4OPQ A;  3MFD A;  4MBH A;  1NYM A;  2J9O A;  3C7V A;  3PBS A;  3A3E A;  5TFQ A;  3ZG7 B;  3UY6 A;  3ISG A;  3ITB A;  1NZO A;  4GOG A;  3BYD A;  1YQS A;  2HDU A;  4JF4 A;  3O86 A;  4Z9Q A;  3FYZ A;  2A49 A;  2OSU A;  1GA9 A;  5FAO A;  1MWR A;  1N4O A;  1Y54 A;  4U0X A;  1MY8 A;  5E2E A;  3V3R A;  4OLD A;  2XGN A;  3NCK A;  1XGI A;  2Y2M A;  3NDG A;  5GLC A;  3LO7 A;  1QME A;  4P0M A;  3Q7V B;  1ES5 A;  4E3L A;  5BOH A;  3V50 A;  5J8X A;  4OOL A;  5AQB A;  3S22 A;  4KG6 A;  4U3T A;  1SKF A;  2EXA A;  5CED A;  3M2K A;  4FD8 A;  1GHM A;  1L0E A;  2WYX A;  4OQ0 A;  4WMC A;  1OME A;  3Q7V A;  2ZQ9 A;  3IXG A;  4EBN A;  3MZD A;  2X02 A;  1PZO A;  1GHI A;  2HDR A;  1VQQ A;  4F94 A;  1WE4 A;  3E2L A;  3LY3 A;  5CGS A;  3G32 A;  4X69 A;  3BLM A;  3ZNY A;  3ZG5 A;  3ZG8 B;  3EQV A;  4S2P A;  3BFF A;  3MKF A;  4OP5 A;  3RJU A;  3DWK A;  4S2N A;  1FR6 A;  1KDS A;  2C6W B;  3S1Y A;  3VP1 A;  1BLP A;  1TDG A;  4S2O A;  5FSR A;  1Q2P A;  1XPB A;  4O7D A;  4A5R A;  3VP2 A;  3WRZ A;  2EX8 A;  3LEZ A;  4LEN A;  1LL9 A;  5TR7 A;  1TEM A;  5HX9 A;  3LCE A;  3G4P A;  3N8R A;  4KG2 A;  1K57 A;  4S2L A;  1YLZ A;  3SH9 A;  1CI9 A;  3IXB A;  4IBX A;  3LY4 A;  5FQK A;  4X53 A;  3UDF A;  1SDN A;  4EWF A;  3ZNT A;  5L2F A;  3G35 A;  3Q1F A;  1GCE A;  4DE2 A;  1MKI A;  1MXO A;  2V1Z A;  3HL9 A;  3VP3 A;  3AGF A;  3CMZ A;  3N8S A;  5AQ9 A;  3AGD A;  4WZ5 C;  1BLC A;  1XA7 A;  2ZJ9 A;  3MZE A;  3NI9 A;  4JPM A;  4FSF A;  5U47 A;  4E3O A;  2QMI A;  3VFH A;  1PYY A;  4B4Z A;  2EFX A;  2ZMA A;  5KZH A;  1YMS A;  3OCL A;  3ZGA B;  5HAP A;  1CEF A;  3OPR A;  3WS5 A;  1QMF A;  3PBQ A;  4QJG A;  4KQQ A;  4WEJ A;  4RVA A;  1BZA A;  1XX2 A;  2QZ6 A;  3OCN A;  3A3I A;  1RGY A;  2ZQA A;  2QPN A;  1ERO A;  3A3J A;  2H5S A;  3GV9 A;  2EX6 A;  2Z2M B;  4UA9 A;  4C6Y A;  3RXW A;  2IWB A;  3UO9 A;  4BQM A;  1GHP A;  4WZ4 A;  1W79 A;  5EOO A;  1LLB A;  3G30 A;  3N4I A;  4PM8 A;  2DRW A;  4QY5 A;  4E3I A;  2WAE A;  5AQA A;  3V39 A;  3AGE A;  4KZ6 A;  1PWG A;  4OQI A;  4E6W A;  3IF6 A;  3QNB A;  3HLW A;  4KZ5 A;  1KGE A;  5A91 A;  3HBR A;  3PAG A;  4S2J A;  5FAQ A;  5FQQ A;  4R0Q A;  4BEN A;  4OPR A;  4RX3 A;  1YLP A;  3VOZ A;  2ZC7 A;  1TVF A;  3BEC A;  3CJM A;  4UHU A;  3GVB A;  4FH4 A;  5CHJ A;  4QD4 A;  3IT9 A;  4ID4 A;  1K56 A;  3SH8 A;  3NBL A;  4E3K A;  5HL1 A;  2WZZ A;  1JWV A;  3O3V A;  1EI5 A;  1ZG6 A;  3HUM A;  3W4Q A;  4Y0T A;  3HLF A;  3IWO A;  1ESU A;  3S4X A;  3D4F A;  1L0F A;  3IH8 A;  4HBT A;  2C5W B;  1YLJ A;  1RCJ A;  2JC7 A;  3IHA A;  3IQA A;  4OPZ A;  4OOM A;  5HAI A;  5M1A A;  4GDN A;  1K55 A;  1NJ4 A;  1L2S A;  2WKI A;  1E3U D;  2Y2L A;  4N1H A;  2XR0 A;  4E3N A;  3ZVW A;  1KDW A;  4ZJ3 A;  1I2S A;  2FFY A;  4JBF A;  5E2F A;  5CER A;  5A93 A;  1KVL A;  3G31 A;  4S2K A;  3HUN A;  5EOE A;  5CEC A;  1ES4 A;  3IXD A;  5CTM A;  3UNW A;  5GHZ A;  4JXV A;  5DTK A;  1YLY A;  2WKE A;  2Y2P A;  1HTZ A;  3UE3 A;  2Y59 A;  1IKI A;  5CXW A;  5DF7 A;  1YLT A;  1KE3 A;  3Q7Z A;  1AXB A;  1WYB A;  3NC8 A;  4ZJ1 A;  3ZG9 B;  1I2W A;  3SH7 A;  3IH9 A;  2FFF B;  5EVI C;  3ZFZ A;  2WAF A;  4Q8I A;  2VGJ A;  1XP4 A;  3BRM A;  4KQO A;  2Y2G A;  5HFO A;  1E4D A;  2JCH A;  2WK0 A;  4KZ9 A;  3HLC A;  1ALQ A;  4XUX A;  1LI9 A;  3MXS A;  4KG5 A;  4XXR A;  1SCW A;  2CC1 A;  5GLD A;  4MLL A;  1K54 C;  3PBT A;  4DXC A;  1DY6 A;  2B5R A;  4OOY A;  2XK1 A;  5FQI A;  2H10 A;  1FSY A;  1Q2Q A;  5FDH A;  1FQG A;  3WS1 A;  3TG9 A;  5FI6 A;  4H8R A;  2VGK A;  3MKE A;  1PI4 A;  3P09 A;  3MZF A;  5CGX A;  4KZ3 A;  1TDL A;  5KSH A;  3OC2 A;  5A90 A;  4P85 A;  1IYO A;  4FCF A;  1JWZ A;  1U60 A;  1S0W A;  4QY6 A;  3G2Z A;  2J7V A;  3MBZ A;  4Y0U A;  3N6I A;  4K91 A;  4NK3 A;  3CZD A;  5CEB A;  3IF5 A;  2IWD A;  4IBR A;  1S6R A;  4ZBE A;  4Y0O A;  5GLB A;  4PM9 A;  3N8L A;  3VSL A;  2Y55 A;  2Y2Q A;  2ZQ7 A;  2ZQC A;  5EVI D;  3BM6 A;  3NY4 A;  5DTT A;  5FQM A;  2HP6 A;  5CGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...