4GKUA

Crystal structure of beta lactamase in pet-15b
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of beta lactamase in PET-15B
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4gkuA00
2WAEA 5HAQA 3A3JA 4K0XA 1ZG6A 3LEZA 5HW3A 5FI2A 3SH9A 1FSWA 1YMXA 2Q9MA 1IYQA 2P9VB 1OMEA 3HLFA 2H0TA 1PZOA 4KZ5A 3QNCA 1BTLA 1FR1A 4Y0UA 4ZAMA 5GHZA 1RP5A 4KQQA 5E2FA 4MBFA 4N1HA 5FAOA 2Y2OA 2PBYA 3OPLA 1K4EA 3UE0A 2VGJA 2ZC7A 1XX2A 3PBNA 1HTZA 1PIOA 5TGFA 1MY8A 5EVLA 1PI4A 3FV7A 4OQGA 1VM1A 2XF3A 4Y0OA 4MLLA 1PI5A 2WUQA 3G34A 1CI9A 1RGZA 5HAPA 4C75A 1SKFA 2WKEA 3DWZA 5FQ9A 4LV2A 3G4PA 5FI6A 1FSYA 1JTDA 2IWCA 1GCEA 1YM1A 3M2KA 3O3VA 4QHCA 3DTMA 2IWBA 4A5RA 4E6WA 1PW8A 3C4PA 3PBSA 1ONGA 3WRTA 3BLSA 5JYPA 4X69A 3NI9A 5DF7A 3IH8A 4BD0A 2Y2LA 2Y59A 2E8IA 3M6BA 2ZD8A 3RXWA 1LHYA 4KZ6A 3OPRA 4FD8A 3D4FA 3HLWA 4OLDA 2JE5A 3M2JA 3B3XA 2Y2PA 4KG6A 4OOMA 3NIAA 3Q1FA 2FFYA 3ZFZA 5F1FA 1MWSA 2XH9A 3FZCA 2WYXA 4JBFA 2OLUA 3IWQA 1I2SA 1HD8A 1FCNA 2XD1A 3C5AA 1S6RA 1QMFA 4OLGA 2ZQ8A 2Y55A 2ZC6B 2V2FF 5CXWA 3GTCA 3NBLA 4S2NA 1S0WA 5GLDA 1L0FA 3JYIA 4XUXA 1K56D 3IXHA 4X6TA 1MXOA 5G18A 2Y4AA 4GN2A 2V1ZA 1W8QA 2HDRA 1K56A 3IQAA 3WS2A 5GHYA 3SH7A 1MBLA 4Y7PA 4R1GA 1KE3A 4GDBA 2Y2NA 3ZG5A 3G35A 2ZM2A 1FCOA 3OCLA 4IBXA 4IEDA 4YFMA 5KZHA 3FKWA 2ZQAA 2HP9A 1KGEA 3PBOA 3Q7ZA 3UY6A 5AQ7A 5AQAA 4B88A 1J9MA 1ERMA 3IHAA 5CGXA 3LO7A 5M19A 3S4XA 1XA7A 3A3DA 3OPHA 5A93A 4KZAA 4QD4A 1LL9A 3CJMA 3G32A 4OOYA 4EWFA 5AQBA 3N7WA 3WRZA 4DE2A 4EBPA 3PBTA 1YMSA 3MKFA 3BEBA 4GZBA 1BULA 4KG5A 4OPYA 5EOOA 3SH8A 2Y2IA 3SOIA 2WZZA 5U47A 4UA9A 1W7FA 5DF8A 5A90A 4OPQA 1H8YA 1PWDA 4KG2A 3FYZA 2ZM0A 3ZG8B 3GV9A 4S2PA 4WZ5C 4Q8IA 3PBRA 3GR2A 3IWIA 2Y2GA 4OONA 4OP5A 5EPHA 3VP2A 4JXSA 5EE8A 2XD5A 4PM5A 4X68A 4PM6A 4GD6A 2WADA 1DJAA 5AQ9A 2H0YA 4R4SA 4WELA 1YLWA 1K6SA 2X71A 1CK3A 4LENA 4ZTKA 1GHPA 5GLCA 2JCHA 1C3BA 4GKUA 4WYYA 4X56A 1Z6FA 3WWXA 3BECA 2WGWB 4RX3A 1M6KA 3W8KA 3DWKA 3MFDA 4ZJ1A 4DKIA 4UA6A 1XA1A 4QU3A 2EXBA 4S2NC 1ES2A 4PMAA 2ZQ9A 1KGFA 5F1GA 1LI0A 4ZBEA 3W4QA 2WKIA 4JPMA 1WYCA 3G31A 4FCFA 5EOEA 4BLMA 1MKIA 2WAFA 3IXBA 1L2SA 5EECA 1BLSA 4N9KA 3IH9A 4QB8A 4KENB 4JXWA 1NYYA 1TDGA 2Y2JA 1GA9A 4X53A 5CTNA 3VP3A 1KDSA 3HLBA 5CGSA 1ZG4A 2BG1A 1XXMA 2ZQ7A 1SDEA 4C6YA 2HDSA 1RCJA 1PW1A 3Q7VA 2CC1A 3N8SA 3BLMA 2WGIA 3NC8A 1WYBA 4BENA 3MZEA 3BFCA 1FCMA 1WE4A 3TOIA 5A92A 2ZLYA 3W4PA 3ZHHA 5CEBA 4PM8A 3V5MA 5FASA 3OPPA 4FH4A 1E3UA 4E3JA 4ZDXA 4WMCD 1G68A 3N8LA 3UPNA 2HPBA 3BRMA 4LCLA 4OQHA 3C4OA 5FQMA 4BL3A 4DXCA 1M40A 5DTKA 3A3IA 3S1YA 2BLSA 1MWUA 4R0QA 2X01A 2R9XA 4GOGA 3SS4A 3V50A 4XUZA 1BLPA 3FWLA 4R4RA 1YLYA 4P85A 5EVID 1YT4A 2A49A 4S2JA 4N9LA 3UDIA 1ES3A 2DNSA 2Z2LB 1BLHA 1O07A 4BJPA 2Y91A 5M1AA 2XLNA 2XFSA 1SDNA 3SS5A 1TEMA 1PZPA 3Q81A 5GL9A 4R3BA 1K54A 2JBFA 2H10A 4S2MA 3VSLA 1CI8A 4PM7A 1ZC2A 3RJUA 1MPLA 5E2GA 4KZ4A 1IYPA 1IYOA 4MEZA 4LCMA 2Y2MA 5FQJA 4F94A 4JF5A 3GRJA 1ALQA 4GB7A 3I7JA 4S2IA 3VMAA 1MWRA 1ONHA 5GLBA 4GDNA 3UDFA 3GQZA 1Q2QA 1I5QA 3PAEA 3O86A 4FSFA 4WBGA 1PWCA 2X02A 2DCFA 1N9BA 2HP6A 3HVFA 5FQIA 4PPRA 4UAAA 4JLFA 1H5XA 1ES5A 4IVKA 3BFEA 4NK3A 4BQMA 3MKEA 5FI7A 1BUEA 3C7VA 2HDQA 4E3MA 1YLTA 5BOHA 1RGYA 2XFTA 4EBLA 2PU2A 3QHYA 2RL3A 4OH0A 1O7EA 4O7DA 4KZ8A 4N92A 2PU4A 3LY3A 1VQQA 1NZUA 2XEPA 1GHIA 1IEMA 3AGEA 4KZ7A 1NRFA 3AGFA 4KZ9A 3ZG0A 4EQIA 2Y2HA 2JC7A 5M18A 2Y2KA 4RYEA 3UDXA 4Z9QA 5F83A 3W4OA 4MBHA 2ZQCA 2EX9A 5FATA 3WS4A 3LY4A 4U0XA 4BD1A 4WMCA 3IF6B 2V20A 3IF5A 2RCXA 4DXBA 1W79A 4JXVA 2ZMAA 4M3KA 4OQ0A 3ZNYA 3N8RA 1BT5A 3HREA 4E3NA 2OSUA 3IWOA 1IKIA 5E2HA 2G2WA 1XGJA 5EUAA 5F82A 2WGVA 1K4FA 3LCEA 1PWGA 1SHVA 5FQKA 5EVIB 4ZJ2A 1HZOA 5CRFA 5EVIA 3A3FA 3E2LA 1SCWA 3N6IA 5CGWA 3Q82A 1DJBA 4HESA 4P87A 4H8RA 3PBQA 4MNRA 3MZDA 2ZC3B 3PAGA 3AGDA 4OPZA 2GDNA 1YLJA 4KZ3A 1DJCA 2HDUA 1KE0A 5GHXA 2ZJ9A 5GLAA 3UE1A 4E3OA 2H5SA 3O87A 1W8YA 1ZKJA 4HBUA 4X55A 5A91A 1K54C 1L0DA 2EX6A 3M6HA 1E4DA 3O88A 1K6RA 1XGIA 1LLBA 1KVLA 2QMIA 3GVBA 3HUNA 4KQRA 1HVBA 4DE0A 3GSGA 4R3JA 3ZVTA 1ESIA 1IELA 3CMZA 3G2ZA 5JYOA 4B4ZA 4LV1A 2WZXA 3HUMA 4HBTA 2EXAA 1NXYA 5FAQA 3NDGA 4JF6A 4R23A 5DTTA 2XGNA 1TVFA 4LV3A 3RXXA 1K57C 2XR0A 1YLPA 3WS0A 3IF6C 5HAIA 1W5DA 4E6XA 4WZ5A 4DDSA 1MWTA 3P09A 4FH2A 4OVDA 1E3UD 1LI9A 1K55A 1JWPA 3EQUA 1JVJA 3HLCA 4UA7A 5HX9A 3NY4A 1U60A 3ZGAB 3BFFA 5FSRA 4U3TA 3MXRA 4S2LA 3UO9A 5CERA 1KVMA 3E2KA 3ZNTA 3VFFA 1FOFA 4OOLA 2IWDA 4KZBA 4RVAA 5CHMA 5CTMA 3V39A 3ZG9B 3ZCZA 1ES4A 3P98A 1AXBA 3PTEA 2ZC4B 1CEFA 3IT9A 3C7UA 3OZHA 1Q2PA 2VGKA 4YINA 2OLVA 2EX2A 2QPNA 3OCNA 3HBRA 2G2UA 4JF4A 4P0MA 1KE4A 3BM6A 2EFUA 3EQVA 3CG5A 5CHUA 2OV5A 3MZFA 4N1XA 1L0EA 1LL5A 3ZDJA 1QMEA 4DDYA 5CHJA 1FQGA 3GMWA 5E43A 4BL2A 3HLGA 2WGWA 3HL9A 1I2WA 4L0LA 2XQZA 1Y54A 5TR7A 4EV4A 3IF6A 3ITAA 4GD8A 4DE3A 3Q7VB 3G30A 1ERQA 4OKPA 5FDHA 2ZQDA 3ISGA 3HLDA 5DF9A 1BZAA 4KQOA 3VP0A 4EUZA 1JWVA 1XPBA 3DW0A 4K0WA 4RA7A 4RX2A 3Q07A 3BYDA 3VOZA 3NCKA 2I72A 3UNWA 3BFDA 3UN7A 2Z2MB 4S2OA 2WKHA 4DF6A 5L2FA 1JWZA 4GNUA 1CEGA 1XP4A 3V3RA 2A3UA 3WS1A 4D2OA 3UE3A 4QJGA 1KGGA 3UPPA 2B5RA 5IHVA 3VSKA 5KSHA 1N4OA 4MBKA 2FFFB 4E3IA 3A3EA 4E3KA 4IBRA 4WM9A 3SS3A 3UPOA 1PYYA 4OQIA 3HUOA 1NJ4A 4NETA 4U0TA 5D3OA 2R9WA 3NDEA 1IKGA 3WS5A 1TDLA 5KSCA 1NZOA 5HARA 1K25A 2J9PA 5DVAA 4P6BA 5KMWA 3QNBA 3HLEA 1EI5A 3ZG7B 4XXRA 1E25A 5HL1A 4CJNA 5FQQA 5TFQA 4JXGA 3BFGA 1L0GA 2EFXA 3TG9A 4OPRA 2QZ6A 2ZM8A 1K55C 3MXSA 1H8ZA 1BLCA 4C3QA 2UWXA 2J9OA 2ZC5B 3IXGA 4OP8A 2P9VA 1YQSA 4LV0A 3VP1A 1GA0A 1YLZA 3CZDA 1K38A 2XDMA 3VP4A 1EWZA 4CPKA 3G2YA 4IVIA 3OC2A 4B4XA 3MBZA 4QY6A 2J7VA 3N4IA 1FR6A 2C6WB 1DY6A 1XKZA 5DTSA 5CEDA 1K57A 1G6AA 4WZ4A 2XK1A 3ITBA 2DRWA 4ID4A 4PM9A 3VOYA 4DE1A 2HP5A 2Y2QA 4HEFA 4UHUA 5I94A 4JKTA 4WEKA 2WK0A 4EBNA 2C5WB 1IYSA 5J8XA 5FA7A 4ZJ3A 5FAPA 1BSGA 1ESUA 3IXDA 3VFHA 2EX8A 1NY0A 2Q9NA 4QY5A 2P74A 1KDWA 4K91A 4Y0TA 3TSGA 3FKVA 2J8YA 3ZVWA 4S2KA 3V3SA 5E2EA 4DRTA 1EROA 3IHBA 1JTGA 5EVIC 5CECA 3S22A 5HFOA 1NYMA 4WEJA 4E3LA 1GHMA
chains in the Genus database with same CATH superfamily
5HAQA 4I3JA 3P7NA 5FI2A 4B93A 2PBDP 1OTAA 2PHYA 2Q9MA 3RFBA 3T4QA 3A0SA 1FR1A 4Y0UA 3IX8A 4KQQA 5L8MA 5FAOA 1H3QA 2Y2OA 3OPLA 3S7NA 3CAXA 1PI4A 2WUQA 1RGZA 3ZYTA 2V1BA 3DWZA 2GX5A 4ARZA 1FSYA 1JTDA 3M2KA 4A5RA 3U4LP 4HHDA 2Y2LA 2E8IA 3MR0A 4GHIB 3OPRA 1T1BA 2JE5A 4PKYG 4KG6A 4OOMA 2FFYA 3FZCA 1TF1A 4EUVA 1V9ZA 3MSHA 4BBTA 2XD1A 4YWZA 3JYIA 4XUXA 5HL6A 3LIBA 3RTYA 4X6TA 1MXOA 4EU0A 1T1AA 3LGOA 2HDRA 2ZOHA 1XJ3A 2B02A 4GDBA 2G7UA 5KZHA 3FG8A 4BWIA 5HPFA 3UY6A 3MS6A 3OPHA 4OOYA 3N7WA 3SOIA 5U47A 3GV9A 1A0KA 4I39A 4S2PA 1ODVA 3PBRA 1OTBA 1LL8A 1FIKA 4OP5A 4JXSA 2XD5A 4PM6A 4GD6A 2H0YA 4LLOB 2O9CA 1CK3A 2LB5A 4HY8A 4GKUA 2WKRA 3BECA 4ZJ1A 1LSVA 3NOPC 2EXBA 3NOTC 1ES2A 4PMAA 2JHEA 2XSSA 1MKIA 5TJJA 5F69A 1T1CA 4JXWA 1NYYA 4X53A 5CTNA 3R7WB 5CGSA 2BG1A 2HDSA 5HDCA 3JVUA 2PAVP 2XA7M 3NC8A 4BENA 1EW0A 4NKPA 1FCMA 2GNXA 1Z09A 1S4SA 4E3JA 3DBAA 3N8LA 3IS2B 3BRMA 1NLZA 5FQMA 4II7A 1M40A 1PNEA 2X01A 3V50A 4GOGA 2VV8A 4R4RA 1YT4A 4S2JA 3UDIA 2Z2LB 4R38A 2W1TA 1TEMA 5GL9A 4S2MA 1ZC2A 3D9YA 4KZ4A 1IYPA 4MEZA 2Y2MA 5I5LA 5FQJA 4JF5A 3S7PA 3GRJA 3I7JA 2ZL1A 1MWRA 5GLBA 3UDFA 3F1OA 1N9BA 2HP6A 4UAAA 3ICYA 4JLFA 4X1LA 1H5XA 3FPVA 5FI7A 2M7VA 2HDQA 5BOHA 1RGYA 4EBLA 3MJQA 2PD7A 1XFQA 1DP8A 3LR5A 4EQIA 1YKDA 2EX9A 3WS4A 3LY4A 3IF5A 4DXBA 1W79A 2JKFA 2L4RA 3L9KA 3CLOA 3N8RA 2OSUA 3IWOA 2G2WA 5EUAA 5F82A 1K4FA 2K7SA 1HZOA 1DJBA 2EWVA 4H8RA 3PAGA 2ZC3B 5FEGA 4E3OA 5HDSA 3M6HA 1K6RA 1XGIA 3HUNA 3GVBA 1HVBA 2ZMFA 4P6ZS 1IELA 3E4OA 1GSWA 5KIZA 2WZXA 1TVFA 1YLPA 4WZ5A 3T4SA 3B42A 4HQAA 1LI9A 3EQUA 5HX9A 3HLCA 4PKYA 4UA7A 2FH5A 2JKTI 3UO9A 5CERA 3ZNTA 5CTMA 1ES4A 3P98A 1AXBA 1CF0A 2INWA 3IT9A 2JKRM 3OZHA 4YINA 4QPRA 2OLVA 2QPNA 2G2UA 4JF4A 4P0MA 2PRFA 1KOUA 3ZDJA 4WLAA 4DDYA 1FQGA 3GMWA 4EW7A 2WGWA 2DMWA 4XT2A 1I2WA 4EV4A 3Q7VB 3G30A 3ISGA 3HLDA 4KQOA 4RX2A 1YSPA 3DW0A 4K0WA 4RA7A 1T18A 3UNWA 4S2OA 4GNUA 3F1PB 4D2OA 1ZHHB 4F3LA 4E3KA 1W63M 4U0TA 3WS5A 1TDLA 2J3TC 4P6BA 4ARZB 4LRZE 5HL1A 3TG9A 2EFXA 5HZHA 4OPRA 2ZM8A 1K55C 2UWXA 2ZC5B 1S4RA 2P9VA 3MFXA 1YQSA 1GA0A 3CZDA 2XDMA 4GCZA 1EWZA 3G2YA 4JGOA 4QY6A 4HH3A 3CITA 5DTSA 2EWWA 1K57A 2Z6DA 2DRWA 2Y2QA 4L9FA 1YAXA 2XROA 4L9GA 5HSQA 5J8XA 5FAPA 1ESUA 3VFHA 2EX8A 3H7WA 4QY5A 4JGQA 3FKVA 4LGWA 3ZVWA 3V3SA 3IHBA 2QJ7A 3VE3A 3KSIA 4CLCB 2WAEA 1ZG6A 5HW3A 3D72A 2A24B 1IYQA 2P9VB 2R78A 2VLGA 3LIEA 5GHZA 5E2FA 5L09A 2VGJA 2ZC7A 1SKOB 1XX2A 2ZOIA 1X0OA 5TGFA 3K3CA 4MLLA 3G34A 3CPTB 1GCEA 3O3VA 2IWBA 1PW8A 3C4PA 1ONGA 1OPXA 2Y8HA 4X69A 3C38A 3IH8A 4UEYA 4BD0A 2ZBBA 4Y2FA 2Y59A 2ZD8A 3RXWA 4FD8A 3HLWA 4OLDA 2FZ0A 3B3XA 3NIAA 3ZFZA 5F1FA 1MWSA 2XH9A 2OLUA 3IWQA 1I2SA 3C5AA 4OLGA 2V2FF 2OAQ1 3IXHA 2Y4AA 2V1ZA 1GSXA 1F5MA 3SH7A 1L3LA 1KE3A 3G35A 3FKWA 2HP9A 2B95A 3Q7ZA 2Z6CA 4B88A 5AQ7A 5AQAA 1J9MA 1ERMA 5CGXA 3UMEA 3A3DA 4KZAA 1LL9A 3WRZA 4DE2A 3PBTA 2EA9A 3IBRA 4GZBA 4OPYA 5EOOA 3SH8A 4Y17A 2Y2IA 2WZZA 3T1RA 3D3OA 4OPQA 4FTXA 4KG2A 2ZM0A 2KDKA 3GR2A 3QP1A 3IWIA 2Y2GA 5EE8A 2V1AA 1N9LA 1F2KA 2WADA 1DJAA 1YPRA 5AQ9A 2QHKA 4WELA 3K3DA 2W3HA 4D60A 1OTIA 1K6SA 4EEUA 1S67L 4ZTKA 4Y13A 1GHPA 2JCHA 1OTEA 3MQ0A 4O8GA 4WYYA 2YKFA 3UB8A 4EESA 4UA6A 4QU3A 4S2NC 2V8FA 3W4QA 2WKIA 3T4JA 1XJ2A 4BMWA 3KSGA 3IXBA 5EECA 1BLSA 5DFXA 4KENB 3QP5A 1GA9A 3VP3A 5AJGA 3OOVA 3QP2A 3Q7VA 2K31A 2CC1A 3N8SA 2NUPC 3KYQA 2WGIA 3T1SA 4HI4A 3MZEA 5CEBA 3TOIA 3W4PA 2VK3A 3HJIA 3ZHHA 2KOIA 3OPPA 4ZDXA 1G68A 3T4KA 1S1ZA 1P0ZA 4OQHA 2CMNA 4CLCE 3F1NB 2QJ5A 4MN7A 3G6OA 1BLPA 3FWLA 4P85A 2A49A 2DNSA 1O07A 4BJPA 2XLNA 3SS5A 2H10A 3UB6A 1CI8A 3RJUA 1MPLA 2W3EA 4LCMA 3KX0X 1YSQA 4F94A 4S2IA 2IA2A 3LIFA 4GDNA 1F98A 1S1YA 1I5QA 3PAEA 4YNRA 3O86A 5L07A 4FSFA 2DCFA 4HNBA 4IVKA 3RH8B 1BUEA 3C7VA 2PU2A 4OH0A 1O7EA 4EERA 4KZ8A 4N92A 3LY3A 1VQQA 4KZ7A 3KYEA 4NG2A 3ZG0A 2YKHA 2Y2KA 4RYEA 2P08A 3UDXA 4H6JA 4ETXA 3W4OA 2ZQCA 3VOLA 2M1CA 4WUJA 2V20A 3VV4A 4M3KA 3H82B 5L10A 3ZNYA 4CLCD 4E3NA 5E2HA 2WGVA 3TE8A 3LCEA 3EWKA 1SHVA 5EVIB 2NUTC 4WF0A 4HESA 4KUKA 4R6LA 3MZDA 3AGDA 1IFQA 3EEHA 4KZ3A 1KE0A 5GHXA 2H5SA 1W8YA 1ZKJA 4HBUA 2WKQA 2EX6A 1E4DA 1TS6A 4KQRA 4HJ3A 3FPWA 3GSGA 4R3JA 1VEUA 5JYOA 4B4ZA 4HBTA 2EXAA 5FAQA 3NDGA 2XGNA 3RXXA 3WS0A 4NXBA 2D01A 3IF6C 5HAIA 4E6XA 2OWHA 4FH2A 3BJNA 1K55A 3HCYA 3IBJA 2W1RA 4QWOA 3E2KA 3B33A 1FOFA 1MZUA 3V39A 5HWWA 3V67A 3F1PA 2ZC4B 5TBMB 3C7UA 4UQIS 3OBFA 1Q2PA 5LBRA 2P7JA 4LRXC 3BM6A 2A24A 3EQVA 2K2NA 3CG5A 1VHMA 5F6AA 1QMEA 1LSWA 4L0LA 3LR4A 4GLQA 1Y54A 3CUEA 3IF6A 3ITAA 4GD8A 4OKPA 3LR0A 5DF9A 4HJ6A 2UV0E 4GHIA 3VP0A 4EUZA 1JWVA 2I72A 2XRNA 2WKHA 1FILA 1XP4A 2A3UA 2PD8A 2W27A 4QJGA 1P9WA 1KGGA 3UPPA 1MC0A 3VSKA 5IHVA 4MBKA 4KUOA 4WM9A 3HUOA 5D3OA 3EGDC 2R9WA 3NDEA 5A8BA 3A0RA 1K25A 1G5UA 4XXRA 5K5BA 5FQQA 5TFQA 3BFGA 2QZ6A 2PDRA 1H8ZA 2L0WA 4C3QA 2J9OA 1TD5A 4LV0A 3VP1A 4CPKA 3N4IA 1FR6A 1DY6A 5CEDA 1G6AA 3VOYA 4DE1A 4HEFA 4JKTA 2WK0A 4EBNA 2C5WB 1IYSA 5FA7A 4R70A 1Y28A 2P74A 4K91A 3TSGA 4S2KA 5E2EA 1EROA 1TS8A 1JTGA 4Q0JA 5CECA 5HD3A 1NYMA 4WEJA 4E3LA 3SH9A 1FSWA 2XA7S 2H0TA 1PZOA 4LPZA 1OJ5A 3QNCA 5EM1A 3TW8A 4ZAMA 1RP5A 2QKPA 4MBFA 3F1OB 3SZTA 3C2WA 5J4EA 1UGUA 5F68A 3PBNA 4O0PA 5HD5A 4OQGA 1VM1A 2XF3A 4Y0OA 1PI5A 5MC7A 2W3DA 5HAPA 1P9RA 4M4XA 5FI6A 1OTDA 1YM1A 5EVEA 3BLSA 5JYPA 5DF7A 2AVXA 1LHYA 4KZ6A 1BYWA 3MMHA 1N9OA 2WYXA 4JBFA 1HD8A 1FCNA 1S6RA 2ZQ8A 2Y55A 1TS0A 1XJ6A 3GTCA 4S2NA 1S0WA 1L0FA 1P97A 5F5YA 3T4OA 5G18A 4GN2A 1K56A 3WS2A 3H7WB 3R7WA 4R1GA 3P01A 3ZG5A 2ZM2A 3OCLA 4ETZA 4IBXA 5EM0A 2ZQAA 3PBOA 1ACFA 3EOIA 3LO7A 5M19A 3CJMA 2H28A 4EWFA 5AQBA 3QP4A 2Q0OA 1Y4OA 3MKFA 3BEBA 2V9AA 1DP9A 1BULA 4KG5A 1STZA 5A90A 2PYRA 3L7HA 1H8YA 3ZG8B 3MQQA 2P04A 4OONA 3S7OA 5EPHA 4PM5A 4X68A 4HP4A 2X71A 4LENA 1HLUP 4X56A 3WWXA 4RX3A 3W8KA 1VEUB 3MFDA 1VETA 5FDSA 5J7EA 4DJ3A 1XA1A 4NXGA 5F1GA 4RQ9A 4ZBEA 3K2NA 4R3AA 4JPMA 3G31A 4BLMA 2WAFA 1L2SA 3U2AA 2W0NA 3PR6A 3IH9A 4N9KA 5TBMA 2Y2JA 1KDSA 3HLBA 1ZG4A 2ZQ7A 4HOIA 4HIAA 1RCJA 1PW1A 2JKRI 3BLMA 4EQ1A 3BFCA 1WE4A 2ZLYA 5FASA 4FH4A 4WMCD 2HPBA 2OAP1 4DXCA 5DTKA 2QYBA 2BLSA 4PHTA 4R0QA 2R9XA 4XUZA 2KLIA 4I3IA 2HV1A 2HZ5A 3BW6A 1ES3A 5DJUA 1BLHA 5EFWA 1SDNA 3Q81A 1CQAA 1PZPA 4R3BA 3VSLA 4PM7A 2V0WA 4LRYC 4FOFA 2HJ9C 3PYPA 1ALQA 2D02A 2VGLS 4GB7A 3VMAA 4CQHA 3PXPA 5FQIA 3HVFA 4PPRA 4GW9A 1ES5A 4NK3A 4BQMA 3MKEA 2ACGA 1XFNA 4E3MA 1YLTA 3T12B 2XFTA 3QHYA 1DP6A 5G4YA 5IT5A 1GHIA 1IEMA 2Y2HA 5M18A 5FATA 2PYPA 4WL9A 4U0XA 4BD1A 4WMCA 3IF6B 4JXVA 2JKGA 4OQ0A 5AVFA 1T19A 2BTFP 2BASA 5FQKA 1PWGA 4G3VA 4ZJ2A 2VGLM 1LSXA 3A3FA 3E2LA 1SCWA 3N6IA 3Q82A 4GS9B 4MNRA 2GDNA 1YLJA 1DJCA 1MKMA 3S7QA 5GLAA 3UE1A 4IUKA 1G28A 2VX8A 4X55A 5A91A 1K54C 1L0DA 2JN7A 3O88A 4DE0A 4JGRA 1SKOA 3EGXC 1NXYA 1H8MA 3SW1A 4JF6A 4R23A 2XR0A 5IS1A 3MF0A 1W5DA 1MWTA 4OVDA 2J3TD 3R4KA 1JVJA 3NY4A 1U60A 3BFFA 4U3TA 4S2LA 1KVMA 3VFFA 4RVAA 4OOLA 2IWDA 3IS2A 3KO6A 1CEFA 2GZAA 4P6ZM 2VGKA 3OCNA 3LICA 1D7EA 1KE4A 4Q0HA 1L0EA 1LL5A 5E43A 3HLGA 4JGPA 5TR7A 4CLCA 2VV6A 1ERQA 4BBUA 1XPBA 1W63Q 3UMDA 3BYDA 3BFDA 3UN7A 1JWZA 4IJGA 5KSHA 1N4OA 4E3IA 2VJWA 3A3EA 3SS3A 3UPOA 1NJ4A 4NETA 1IKGA 3KSFA 5HARA 4DMZA 5DVAA 1EI5A 3ZG7B 1VB6A 1E25A 3LI9A 4CJNA 1L0GA 3OLOA 3MXSA 1BLCA 3CWFA 3IXGA 3BQAA 5HWVA 1YLZA 3VP4A 4IVIA 3FC7A 3CPTA 2J7VA 4O01A 1XKZA 2B18A 2KX6A 3E98A 3ITBA 4ID4A 4PM9A 3F1NA 5I94A 2GJ3A 2HP5A 1UWPX 4FUWA 4UHUA 2LB9A 1PFLA 2OOLA 3E4QA 4MN5A 5FL3A 4ZJ3A 2Q9NA 1KDWA 2J8YA 2L1MA 4DRTA 3DTKA 5EVIC 3LFVA 1GHMA 5AVEA 2VEAA 4XT2B 3A3JA 4K0XA 3LEZA 1YMXA 2J3WA 1OMEA 3HLFA 2PT7A 4KZ5A 3JPUA 1BTLA 4KQDA 4N1HA 3H9WA 3ZQ5A 4ME4A 2PBYA 1K4EA 1PRQA 3UE0A 4CLCC 5J3WA 1HTZA 1PIOA 2I9VA 1MY8A 5EVLA 3FV7A 1CI9A 4C75A 1SKFA 2WKEA 5FQ9A 4LV2A 4LFUA 3G4PA 2IWCA 4QHCA 4MDZA 3DTMA 4E6WA 1H0MA 3PBSA 4HH2A 3WRTA 3NI9A 1ZTUA 3M6BA 1NLYA 3DTIA 3D4FA 3M2JA 2Y2PA 3Q1FA 4L9EA 5DJTA 5DKLA 1WA9A 2VKSA 1QMFA 3A0VA 2ZC6B 5CXWA 3NBLA 4ZRRA 5GLDA 1K56D 4HP9A 1W8QA 3DTEA 4B9OA 3IQAA 4GJ4A 5GHYA 1MBLA 4Y7PA 1TS7A 2Y2NA 1J3WA 1FCOA 4YFMA 4IEDA 3VE4A 2Y79A 1KGEA 2J80A 3IHAA 4K08A 3MXQA 3S4XA 1XA7A 5A93A 3LIDA 4QD4A 3G32A 4DN0A 2VZWA 4MMNA 1YMSA 4UA9A 1W7FA 5DF8A 2W3GA 5EV0A 1PWDA 3FYZA 4Q8IA 4WZ5C 3NULA 4PAUA 1VETB 2HF6A 3VP2A 3UB9A 4R4SA 1YLWA 2WKPA 3T1XA 2O99A 5GLCA 3C8CA 1C3BA 5DKKA 1Z6FA 3LIAA 2WGWB 1M6KA 3DWKA 3NECA 4DKIA 4EETB 3IX3A 3E4PA 2HJEA 2ZQ9A 1KGFA 1LI0A 1WYCA 3HJKA 4FCFA 2A2LA 5EOEA 4Q0IA 3NHQA 4Z1WA 2VA0A 4QB8A 3T4LA 1TDGA 3T50A 1XXMA 1NWZA 1SDEA 4C6YA 3O5YA 2HGVA 2MJ6A 1UWNX 1WYBA 4DJ2A 5A92A 4PM8A 3V5MA 3DAVA 1E3UA 3LR3A 3UPNA 4LCLA 3C4OA 4BL3A 5DFYA 3A3IA 3S1YA 3SS4A 1MWUA 1YLYA 5IU1A 5EVID 4N9LA 5FEFA 3NOUC 2Y91A 4I3AA 5M1AA 2XFSA 1K54A 2JBFA 4NXFA 5E2GA 1IYOA 3UB7A 4UQIM 4G3WA 2ZL1B 1ONHA 4I5SA 3GQZA 2VV7A 1Q2QA 4WN5A 1DRMA 4WBGA 1PWCA 2X02A 3BFEA 2RL3A 4F3LB 4O7DA 2PU4A 1NZUA 2XEPA 3AGEA 1NRFA 3AGFA 4KZ9A 1SZVA 2JC7A 3BY8A 3B47A 4Z9QA 5F83A 4GS9A 4MBHA 5C5KA 3LEQA 2QWSA 3CUEC 4E04A 2RCXA 2ZMAA 1G6OA 1K0KA 3QP6A 3C30A 5HDDA 1BT5A 3HREA 3BWLA 1IKIA 1XGJA 4AFIA 3KYZA 5CRFA 3KSHA 5EVIA 5CGWA 3MQOA 4P87A 3TRCA 3PBQA 4Y3IA 4OPZA 2HDUA 3CI6A 2ZJ9A 2ZMVA 1S66L 3O87A 1OT9A 2O0YA 3GDIA 4H6JB 1GSVA 2E8JA 1LLBA 1KVLA 2QMIA 1CJFA 1LT0A 3ZVTA 1ESIA 3CMZA 3G2ZA 4LV1A 3HUMA 3JVVA 5DTTA 4NXEA 3PHYA 4LV3A 1K57C 3TJZC 4DDSA 3P09A 1E3UD 1JWPA 3ZGAB 4MN6A 4IUHA 5FSRA 3EEAA 3MXRA 1OT6A 3IX4A 4KZBA 3E0YA 5CHMA 3ZG9B 3ZCZA 3ULFA 1IOUA 3PTEA 1N9NA 1XJ4A 4Y15A 4EEPA 3H82A 2EX2A 3HBRA 4HJ4A 2EFUA 5CX7A 2OV5A 5CHUA 3MZFA 4N1XA 2PR6A 5CHJA 3LI8A 4BL2A 3UB5P 4ESPA 3QP8A 3HL9A 2XQZA 4DE3A 1NRJA 5FDHA 2ZQDA 1BZAA 3LYXA 1JNUA 2JKTM 3Q07A 3VOZA 4G3KA 3NCKA 5L2FA 4DF6A 2Z2MB 1OJGA 3UE6A 1CEGA 2O9AA 3V3RA 3WS1A 3UE3A 2B5RA 3LUQA 3BY9A 2FFFB 4NEED 2M7UA 4IBRA 1PYYA 4OQIA 3T1QB 5KSCA 4MCWA 1NZOA 2J9PA 5KMWA 2O9BA 3QNBA 3HLEA 3W2ZA 1D06A 4JXGA 5HWTA 4I38A 1V9YA 4BBVA 4OP8A 2V8CA 4YOFA 1K38A 2W1TB 4X1MA 5G4ZA 4IHQA 4B4XA 3OC2A 3GECA 3MBZA 2OWJA 2C6WB 4Y5FA 1F9IA 4WZ4A 2XK1A 3CHWP 2V0UA 3T4TA 4WEKA 3BQ8A 2W3FA 1D1JA 1BSGA 3IXDA 1NY0A 3NJAA 4Y0TA 5HPIA 4X25A 4EXOA 3S22A 2PR5A 5HFOA 1AWIA 4EBPA
chains in the Genus database with same CATH topology
2WAEA 5HAQA 3A3JA 4K0XA 1ZG6A 3LEZA 5HW3A 5FI2A 3SH9A 1FSWA 1YMXA 2Q9MA 1IYQA 2P9VB 1OMEA 3HLFA 2H0TA 1PZOA 4KZ5A 3QNCA 1BTLA 1FR1A 4Y0UA 4ZAMA 5GHZA 1RP5A 4KQQA 5E2FA 4MBFA 4N1HA 5FAOA 2Y2OA 2PBYA 3OPLA 1K4EA 3UE0A 2VGJA 2ZC7A 1XX2A 3PBNA 1HTZA 1PIOA 5TGFA 1MY8A 5EVLA 1PI4A 3FV7A 4OQGA 1VM1A 2XF3A 4Y0OA 4MLLA 1PI5A 2WUQA 3G34A 1CI9A 1RGZA 5HAPA 4C75A 1SKFA 2WKEA 3DWZA 5FQ9A 4LV2A 3G4PA 5FI6A 1FSYA 1JTDA 2IWCA 1GCEA 1YM1A 3M2KA 3O3VA 4QHCA 3DTMA 2IWBA 4A5RA 4E6WA 1PW8A 3C4PA 3PBSA 1ONGA 3WRTA 3BLSA 5JYPA 4X69A 3NI9A 5DF7A 3IH8A 4BD0A 2Y2LA 2Y59A 2E8IA 3M6BA 2ZD8A 3RXWA 1LHYA 4KZ6A 3OPRA 4FD8A 3D4FA 3HLWA 4OLDA 2JE5A 3M2JA 3B3XA 2Y2PA 4KG6A 4OOMA 3NIAA 3Q1FA 2FFYA 3ZFZA 5F1FA 1MWSA 2XH9A 3FZCA 2WYXA 4JBFA 2OLUA 3IWQA 1I2SA 1HD8A 1FCNA 2XD1A 3C5AA 1S6RA 1QMFA 4OLGA 2ZQ8A 2Y55A 2ZC6B 2V2FF 5CXWA 3GTCA 3NBLA 4S2NA 1S0WA 5GLDA 1L0FA 3JYIA 4XUXA 1K56D 3IXHA 4X6TA 1MXOA 5G18A 2Y4AA 4GN2A 2V1ZA 1W8QA 2HDRA 1K56A 3IQAA 3WS2A 5GHYA 3SH7A 1MBLA 4Y7PA 4R1GA 1KE3A 4GDBA 2Y2NA 3ZG5A 3G35A 2ZM2A 1FCOA 3OCLA 4IBXA 4IEDA 4YFMA 5KZHA 3FKWA 2ZQAA 2HP9A 1KGEA 3PBOA 3Q7ZA 3UY6A 5AQ7A 5AQAA 4B88A 1J9MA 1ERMA 3IHAA 5CGXA 3LO7A 5M19A 3S4XA 1XA7A 3A3DA 3OPHA 5A93A 4KZAA 4QD4A 1LL9A 3CJMA 3G32A 4OOYA 4EWFA 5AQBA 3N7WA 3WRZA 4DE2A 4EBPA 3PBTA 1YMSA 3MKFA 3BEBA 4GZBA 1BULA 4KG5A 4OPYA 5EOOA 3SH8A 2Y2IA 3SOIA 2WZZA 5U47A 4UA9A 1W7FA 5DF8A 5A90A 4OPQA 1H8YA 1PWDA 4KG2A 3FYZA 2ZM0A 3ZG8B 3GV9A 4S2PA 4WZ5C 4Q8IA 3PBRA 3GR2A 3IWIA 2Y2GA 4OONA 4OP5A 5EPHA 3VP2A 4JXSA 5EE8A 2XD5A 4PM5A 4X68A 4PM6A 4GD6A 2WADA 1DJAA 5AQ9A 2H0YA 4R4SA 4WELA 1YLWA 1K6SA 2X71A 1CK3A 4LENA 4ZTKA 1GHPA 5GLCA 2JCHA 1C3BA 4GKUA 4WYYA 4X56A 1Z6FA 3WWXA 3BECA 2WGWB 4RX3A 1M6KA 3W8KA 3DWKA 3MFDA 4ZJ1A 4DKIA 4UA6A 1XA1A 4QU3A 2EXBA 4S2NC 1ES2A 4PMAA 2ZQ9A 1KGFA 5F1GA 1LI0A 4ZBEA 3W4QA 2WKIA 4JPMA 1WYCA 3G31A 4FCFA 5EOEA 4BLMA 1MKIA 2WAFA 3IXBA 1L2SA 5EECA 1BLSA 4N9KA 3IH9A 4QB8A 4KENB 4JXWA 1NYYA 1TDGA 2Y2JA 1GA9A 4X53A 5CTNA 3VP3A 1KDSA 3HLBA 5CGSA 1ZG4A 2BG1A 1XXMA 2ZQ7A 1SDEA 4C6YA 2HDSA 1RCJA 1PW1A 3Q7VA 2CC1A 3N8SA 3BLMA 2WGIA 3NC8A 1WYBA 4BENA 3MZEA 3BFCA 1FCMA 1WE4A 3TOIA 5A92A 2ZLYA 3W4PA 3ZHHA 5CEBA 4PM8A 3V5MA 5FASA 3OPPA 4FH4A 1E3UA 4E3JA 4ZDXA 4WMCD 1G68A 3N8LA 3UPNA 2HPBA 3BRMA 4LCLA 4OQHA 3C4OA 5FQMA 4BL3A 4DXCA 1M40A 5DTKA 3A3IA 3S1YA 2BLSA 1MWUA 4R0QA 2X01A 2R9XA 4GOGA 3SS4A 3V50A 4XUZA 1BLPA 3FWLA 4R4RA 1YLYA 4P85A 5EVID 1YT4A 2A49A 4S2JA 4N9LA 3UDIA 1ES3A 2DNSA 2Z2LB 1BLHA 1O07A 4BJPA 2Y91A 5M1AA 2XLNA 2XFSA 1SDNA 3SS5A 1TEMA 1PZPA 3Q81A 5GL9A 4R3BA 1K54A 2JBFA 2H10A 4S2MA 3VSLA 1CI8A 4PM7A 1ZC2A 3RJUA 1MPLA 5E2GA 4KZ4A 1IYPA 1IYOA 4MEZA 4LCMA 2Y2MA 5FQJA 4F94A 4JF5A 3GRJA 1ALQA 4GB7A 3I7JA 4S2IA 3VMAA 1MWRA 1ONHA 5GLBA 4GDNA 3UDFA 3GQZA 1Q2QA 1I5QA 3PAEA 3O86A 4FSFA 4WBGA 1PWCA 2X02A 2DCFA 1N9BA 2HP6A 3HVFA 5FQIA 4PPRA 4UAAA 4JLFA 1H5XA 1ES5A 4IVKA 3BFEA 4NK3A 4BQMA 3MKEA 5FI7A 1BUEA 3C7VA 2HDQA 4E3MA 1YLTA 5BOHA 1RGYA 2XFTA 4EBLA 2PU2A 3QHYA 2RL3A 4OH0A 1O7EA 4O7DA 4KZ8A 4N92A 2PU4A 3LY3A 1VQQA 1NZUA 2XEPA 1GHIA 1IEMA 3AGEA 4KZ7A 1NRFA 3AGFA 4KZ9A 3ZG0A 4EQIA 2Y2HA 2JC7A 5M18A 2Y2KA 4RYEA 3UDXA 4Z9QA 5F83A 3W4OA 4MBHA 2ZQCA 2EX9A 5FATA 3WS4A 3LY4A 4U0XA 4BD1A 4WMCA 3IF6B 2V20A 3IF5A 2RCXA 4DXBA 1W79A 4JXVA 2ZMAA 4M3KA 4OQ0A 3ZNYA 3N8RA 1BT5A 3HREA 4E3NA 2OSUA 3IWOA 1IKIA 5E2HA 2G2WA 1XGJA 5EUAA 5F82A 2WGVA 1K4FA 3LCEA 1PWGA 1SHVA 5FQKA 5EVIB 4ZJ2A 1HZOA 5CRFA 5EVIA 3A3FA 3E2LA 1SCWA 3N6IA 5CGWA 3Q82A 1DJBA 4HESA 4P87A 4H8RA 3PBQA 4MNRA 3MZDA 2ZC3B 3PAGA 3AGDA 4OPZA 2GDNA 1YLJA 4KZ3A 1DJCA 2HDUA 1KE0A 5GHXA 2ZJ9A 5GLAA 3UE1A 4E3OA 2H5SA 3O87A 1W8YA 1ZKJA 4HBUA 4X55A 5A91A 1K54C 1L0DA 2EX6A 3M6HA 1E4DA 3O88A 1K6RA 1XGIA 1LLBA 1KVLA 2QMIA 3GVBA 3HUNA 4KQRA 1HVBA 4DE0A 3GSGA 4R3JA 3ZVTA 1ESIA 1IELA 3CMZA 3G2ZA 5JYOA 4B4ZA 4LV1A 2WZXA 3HUMA 4HBTA 2EXAA 1NXYA 5FAQA 3NDGA 4JF6A 4R23A 5DTTA 2XGNA 1TVFA 4LV3A 3RXXA 1K57C 2XR0A 1YLPA 3WS0A 3IF6C 5HAIA 1W5DA 4E6XA 4WZ5A 4DDSA 1MWTA 3P09A 4FH2A 4OVDA 1E3UD 1LI9A 1K55A 1JWPA 3EQUA 1JVJA 3HLCA 4UA7A 5HX9A 3NY4A 1U60A 3ZGAB 3BFFA 5FSRA 4U3TA 3MXRA 4S2LA 3UO9A 5CERA 1KVMA 3E2KA 3ZNTA 3VFFA 1FOFA 4OOLA 2IWDA 4KZBA 4RVAA 5CHMA 5CTMA 3V39A 3ZG9B 3ZCZA 1ES4A 3P98A 1AXBA 3PTEA 2ZC4B 1CEFA 3IT9A 3C7UA 3OZHA 1Q2PA 2VGKA 4YINA 2OLVA 2EX2A 2QPNA 3OCNA 3HBRA 2G2UA 4JF4A 4P0MA 1KE4A 3BM6A 2EFUA 3EQVA 3CG5A 5CHUA 2OV5A 3MZFA 4N1XA 1L0EA 1LL5A 3ZDJA 1QMEA 4DDYA 5CHJA 1FQGA 3GMWA 5E43A 4BL2A 3HLGA 2WGWA 3HL9A 1I2WA 4L0LA 2XQZA 1Y54A 5TR7A 4EV4A 3IF6A 3ITAA 4GD8A 4DE3A 3Q7VB 3G30A 1ERQA 4OKPA 5FDHA 2ZQDA 3ISGA 3HLDA 5DF9A 1BZAA 4KQOA 3VP0A 4EUZA 1JWVA 1XPBA 3DW0A 4K0WA 4RA7A 4RX2A 3Q07A 3BYDA 3VOZA 3NCKA 2I72A 3UNWA 3BFDA 3UN7A 2Z2MB 4S2OA 2WKHA 4DF6A 5L2FA 1JWZA 4GNUA 1CEGA 1XP4A 3V3RA 2A3UA 3WS1A 4D2OA 3UE3A 4QJGA 1KGGA 3UPPA 2B5RA 5IHVA 3VSKA 5KSHA 1N4OA 4MBKA 2FFFB 4E3IA 3A3EA 4E3KA 4IBRA 4WM9A 3SS3A 3UPOA 1PYYA 4OQIA 3HUOA 1NJ4A 4NETA 4U0TA 5D3OA 2R9WA 3NDEA 1IKGA 3WS5A 1TDLA 5KSCA 1NZOA 5HARA 1K25A 2J9PA 5DVAA 4P6BA 5KMWA 3QNBA 3HLEA 1EI5A 3ZG7B 4XXRA 1E25A 5HL1A 4CJNA 5FQQA 5TFQA 4JXGA 3BFGA 1L0GA 2EFXA 3TG9A 4OPRA 2QZ6A 2ZM8A 1K55C 3MXSA 1H8ZA 1BLCA 4C3QA 2UWXA 2J9OA 2ZC5B 3IXGA 4OP8A 2P9VA 1YQSA 4LV0A 3VP1A 1GA0A 1YLZA 3CZDA 1K38A 2XDMA 3VP4A 1EWZA 4CPKA 3G2YA 4IVIA 3OC2A 4B4XA 3MBZA 4QY6A 2J7VA 3N4IA 1FR6A 2C6WB 1DY6A 1XKZA 5DTSA 5CEDA 1K57A 1G6AA 4WZ4A 2XK1A 3ITBA 2DRWA 4ID4A 4PM9A 3VOYA 4DE1A 2HP5A 2Y2QA 4HEFA 4UHUA 5I94A 4JKTA 4WEKA 2WK0A 4EBNA 2C5WB 1IYSA 5J8XA 5FA7A 4ZJ3A 5FAPA 1BSGA 1ESUA 3IXDA 3VFHA 2EX8A 1NY0A 2Q9NA 4QY5A 2P74A 1KDWA 4K91A 4Y0TA 3TSGA 3FKVA 2J8YA 3ZVWA 4S2KA 3V3SA 5E2EA 4DRTA 1EROA 3IHBA 1JTGA 5EVIC 5CECA 3S22A 5HFOA 1NYMA 4WEJA 4E3LA 1GHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAE A;  5HAQ A;  3A3J A;  4K0X A;  1ZG6 A;  3LEZ A;  5HW3 A;  5FI2 A;  3SH9 A;  1FSW A;  1YMX A;  2Q9M A;  1IYQ A;  2P9V B;  1OME A;  3HLF A;  2H0T A;  1PZO A;  4KZ5 A;  3QNC A;  1BTL A;  1FR1 A;  4Y0U A;  4ZAM A;  5GHZ A;  1RP5 A;  4KQQ A;  5E2F A;  4MBF A;  4N1H A;  5FAO A;  2Y2O A;  2PBY A;  3OPL A;  1K4E A;  3UE0 A;  2VGJ A;  2ZC7 A;  1XX2 A;  3PBN A;  1HTZ A;  1PIO A;  5TGF A;  1MY8 A;  5EVL A;  1PI4 A;  3FV7 A;  4OQG A;  1VM1 A;  2XF3 A;  4Y0O A;  4MLL A;  1PI5 A;  2WUQ A;  3G34 A;  1CI9 A;  1RGZ A;  5HAP A;  4C75 A;  1SKF A;  2WKE A;  3DWZ A;  5FQ9 A;  4LV2 A;  3G4P A;  5FI6 A;  1FSY A;  1JTD A;  2IWC A;  1GCE A;  1YM1 A;  3M2K A;  3O3V A;  4QHC A;  3DTM A;  2IWB A;  4A5R A;  4E6W A;  1PW8 A;  3C4P A;  3PBS A;  1ONG A;  3WRT A;  3BLS A;  5JYP A;  4X69 A;  3NI9 A;  5DF7 A;  3IH8 A;  4BD0 A;  2Y2L A;  2Y59 A;  2E8I A;  3M6B A;  2ZD8 A;  3RXW A;  1LHY A;  4KZ6 A;  3OPR A;  4FD8 A;  3D4F A;  3HLW A;  4OLD A;  2JE5 A;  3M2J A;  3B3X A;  2Y2P A;  4KG6 A;  4OOM A;  3NIA A;  3Q1F A;  2FFY A;  3ZFZ A;  5F1F A;  1MWS A;  2XH9 A;  3FZC A;  2WYX A;  4JBF A;  2OLU A;  3IWQ A;  1I2S A;  1HD8 A;  1FCN A;  2XD1 A;  3C5A A;  1S6R A;  1QMF A;  4OLG A;  2ZQ8 A;  2Y55 A;  2ZC6 B;  2V2F F;  5CXW A;  3GTC A;  3NBL A;  4S2N A;  1S0W A;  5GLD A;  1L0F A;  3JYI A;  4XUX A;  1K56 D;  3IXH A;  4X6T A;  1MXO A;  5G18 A;  2Y4A A;  4GN2 A;  2V1Z A;  1W8Q A;  2HDR A;  1K56 A;  3IQA A;  3WS2 A;  5GHY A;  3SH7 A;  1MBL A;  4Y7P A;  4R1G A;  1KE3 A;  4GDB A;  2Y2N A;  3ZG5 A;  3G35 A;  2ZM2 A;  1FCO A;  3OCL A;  4IBX A;  4IED A;  4YFM A;  5KZH A;  3FKW A;  2ZQA A;  2HP9 A;  1KGE A;  3PBO A;  3Q7Z A;  3UY6 A;  5AQ7 A;  5AQA A;  4B88 A;  1J9M A;  1ERM A;  3IHA A;  5CGX A;  3LO7 A;  5M19 A;  3S4X A;  1XA7 A;  3A3D A;  3OPH A;  5A93 A;  4KZA A;  4QD4 A;  1LL9 A;  3CJM A;  3G32 A;  4OOY A;  4EWF A;  5AQB A;  3N7W A;  3WRZ A;  4DE2 A;  4EBP A;  3PBT A;  1YMS A;  3MKF A;  3BEB A;  4GZB A;  1BUL A;  4KG5 A;  4OPY A;  5EOO A;  3SH8 A;  2Y2I A;  3SOI A;  2WZZ A;  5U47 A;  4UA9 A;  1W7F A;  5DF8 A;  5A90 A;  4OPQ A;  1H8Y A;  1PWD A;  4KG2 A;  3FYZ A;  2ZM0 A;  3ZG8 B;  3GV9 A;  4S2P A;  4WZ5 C;  4Q8I A;  3PBR A;  3GR2 A;  3IWI A;  2Y2G A;  4OON A;  4OP5 A;  5EPH A;  3VP2 A;  4JXS A;  5EE8 A;  2XD5 A;  4PM5 A;  4X68 A;  4PM6 A;  4GD6 A;  2WAD A;  1DJA A;  5AQ9 A;  2H0Y A;  4R4S A;  4WEL A;  1YLW A;  1K6S A;  2X71 A;  1CK3 A;  4LEN A;  4ZTK A;  1GHP A;  5GLC A;  2JCH A;  1C3B A;  4GKU A;  4WYY A;  4X56 A;  1Z6F A;  3WWX A;  3BEC A;  2WGW B;  4RX3 A;  1M6K A;  3W8K A;  3DWK A;  3MFD A;  4ZJ1 A;  4DKI A;  4UA6 A;  1XA1 A;  4QU3 A;  2EXB A;  4S2N C;  1ES2 A;  4PMA A;  2ZQ9 A;  1KGF A;  5F1G A;  1LI0 A;  4ZBE A;  3W4Q A;  2WKI A;  4JPM A;  1WYC A;  3G31 A;  4FCF A;  5EOE A;  4BLM A;  1MKI A;  2WAF A;  3IXB A;  1L2S A;  5EEC A;  1BLS A;  4N9K A;  3IH9 A;  4QB8 A;  4KEN B;  4JXW A;  1NYY A;  1TDG A;  2Y2J A;  1GA9 A;  4X53 A;  5CTN A;  3VP3 A;  1KDS A;  3HLB A;  5CGS A;  1ZG4 A;  2BG1 A;  1XXM A;  2ZQ7 A;  1SDE A;  4C6Y A;  2HDS A;  1RCJ A;  1PW1 A;  3Q7V A;  2CC1 A;  3N8S A;  3BLM A;  2WGI A;  3NC8 A;  1WYB A;  4BEN A;  3MZE A;  3BFC A;  1FCM A;  1WE4 A;  3TOI A;  5A92 A;  2ZLY A;  3W4P A;  3ZHH A;  5CEB A;  4PM8 A;  3V5M A;  5FAS A;  3OPP A;  4FH4 A;  1E3U A;  4E3J A;  4ZDX A;  4WMC D;  1G68 A;  3N8L A;  3UPN A;  2HPB A;  3BRM A;  4LCL A;  4OQH A;  3C4O A;  5FQM A;  4BL3 A;  4DXC A;  1M40 A;  5DTK A;  3A3I A;  3S1Y A;  2BLS A;  1MWU A;  4R0Q A;  2X01 A;  2R9X A;  4GOG A;  3SS4 A;  3V50 A;  4XUZ A;  1BLP A;  3FWL A;  4R4R A;  1YLY A;  4P85 A;  5EVI D;  1YT4 A;  2A49 A;  4S2J A;  4N9L A;  3UDI A;  1ES3 A;  2DNS A;  2Z2L B;  1BLH A;  1O07 A;  4BJP A;  2Y91 A;  5M1A A;  2XLN A;  2XFS A;  1SDN A;  3SS5 A;  1TEM A;  1PZP A;  3Q81 A;  5GL9 A;  4R3B A;  1K54 A;  2JBF A;  2H10 A;  4S2M A;  3VSL A;  1CI8 A;  4PM7 A;  1ZC2 A;  3RJU A;  1MPL A;  5E2G A;  4KZ4 A;  1IYP A;  1IYO A;  4MEZ A;  4LCM A;  2Y2M A;  5FQJ A;  4F94 A;  4JF5 A;  3GRJ A;  1ALQ A;  4GB7 A;  3I7J A;  4S2I A;  3VMA A;  1MWR A;  1ONH A;  5GLB A;  4GDN A;  3UDF A;  3GQZ A;  1Q2Q A;  1I5Q A;  3PAE A;  3O86 A;  4FSF A;  4WBG A;  1PWC A;  2X02 A;  2DCF A;  1N9B A;  2HP6 A;  3HVF A;  5FQI A;  4PPR A;  4UAA A;  4JLF A;  1H5X A;  1ES5 A;  4IVK A;  3BFE A;  4NK3 A;  4BQM A;  3MKE A;  5FI7 A;  1BUE A;  3C7V A;  2HDQ A;  4E3M A;  1YLT A;  5BOH A;  1RGY A;  2XFT A;  4EBL A;  2PU2 A;  3QHY A;  2RL3 A;  4OH0 A;  1O7E A;  4O7D A;  4KZ8 A;  4N92 A;  2PU4 A;  3LY3 A;  1VQQ A;  1NZU A;  2XEP A;  1GHI A;  1IEM A;  3AGE A;  4KZ7 A;  1NRF A;  3AGF A;  4KZ9 A;  3ZG0 A;  4EQI A;  2Y2H A;  2JC7 A;  5M18 A;  2Y2K A;  4RYE A;  3UDX A;  4Z9Q A;  5F83 A;  3W4O A;  4MBH A;  2ZQC A;  2EX9 A;  5FAT A;  3WS4 A;  3LY4 A;  4U0X A;  4BD1 A;  4WMC A;  3IF6 B;  2V20 A;  3IF5 A;  2RCX A;  4DXB A;  1W79 A;  4JXV A;  2ZMA A;  4M3K A;  4OQ0 A;  3ZNY A;  3N8R A;  1BT5 A;  3HRE A;  4E3N A;  2OSU A;  3IWO A;  1IKI A;  5E2H A;  2G2W A;  1XGJ A;  5EUA A;  5F82 A;  2WGV A;  1K4F A;  3LCE A;  1PWG A;  1SHV A;  5FQK A;  5EVI B;  4ZJ2 A;  1HZO A;  5CRF A;  5EVI A;  3A3F A;  3E2L A;  1SCW A;  3N6I A;  5CGW A;  3Q82 A;  1DJB A;  4HES A;  4P87 A;  4H8R A;  3PBQ A;  4MNR A;  3MZD A;  2ZC3 B;  3PAG A;  3AGD A;  4OPZ A;  2GDN A;  1YLJ A;  4KZ3 A;  1DJC A;  2HDU A;  1KE0 A;  5GHX A;  2ZJ9 A;  5GLA A;  3UE1 A;  4E3O A;  2H5S A;  3O87 A;  1W8Y A;  1ZKJ A;  4HBU A;  4X55 A;  5A91 A;  1K54 C;  1L0D A;  2EX6 A;  3M6H A;  1E4D A;  3O88 A;  1K6R A;  1XGI A;  1LLB A;  1KVL A;  2QMI A;  3GVB A;  3HUN A;  4KQR A;  1HVB A;  4DE0 A;  3GSG A;  4R3J A;  3ZVT A;  1ESI A;  1IEL A;  3CMZ A;  3G2Z A;  5JYO A;  4B4Z A;  4LV1 A;  2WZX A;  3HUM A;  4HBT A;  2EXA A;  1NXY A;  5FAQ A;  3NDG A;  4JF6 A;  4R23 A;  5DTT A;  2XGN A;  1TVF A;  4LV3 A;  3RXX A;  1K57 C;  2XR0 A;  1YLP A;  3WS0 A;  3IF6 C;  5HAI A;  1W5D A;  4E6X A;  4WZ5 A;  4DDS A;  1MWT A;  3P09 A;  4FH2 A;  4OVD A;  1E3U D;  1LI9 A;  1K55 A;  1JWP A;  3EQU A;  1JVJ A;  3HLC A;  4UA7 A;  5HX9 A;  3NY4 A;  1U60 A;  3ZGA B;  3BFF A;  5FSR A;  4U3T A;  3MXR A;  4S2L A;  3UO9 A;  5CER A;  1KVM A;  3E2K A;  3ZNT A;  3VFF A;  1FOF A;  4OOL A;  2IWD A;  4KZB A;  4RVA A;  5CHM A;  5CTM A;  3V39 A;  3ZG9 B;  3ZCZ A;  1ES4 A;  3P98 A;  1AXB A;  3PTE A;  2ZC4 B;  1CEF A;  3IT9 A;  3C7U A;  3OZH A;  1Q2P A;  2VGK A;  4YIN A;  2OLV A;  2EX2 A;  2QPN A;  3OCN A;  3HBR A;  2G2U A;  4JF4 A;  4P0M A;  1KE4 A;  3BM6 A;  2EFU A;  3EQV A;  3CG5 A;  5CHU A;  2OV5 A;  3MZF A;  4N1X A;  1L0E A;  1LL5 A;  3ZDJ A;  1QME A;  4DDY A;  5CHJ A;  1FQG A;  3GMW A;  5E43 A;  4BL2 A;  3HLG A;  2WGW A;  3HL9 A;  1I2W A;  4L0L A;  2XQZ A;  1Y54 A;  5TR7 A;  4EV4 A;  3IF6 A;  3ITA A;  4GD8 A;  4DE3 A;  3Q7V B;  3G30 A;  1ERQ A;  4OKP A;  5FDH A;  2ZQD A;  3ISG A;  3HLD A;  5DF9 A;  1BZA A;  4KQO A;  3VP0 A;  4EUZ A;  1JWV A;  1XPB A;  3DW0 A;  4K0W A;  4RA7 A;  4RX2 A;  3Q07 A;  3BYD A;  3VOZ A;  3NCK A;  2I72 A;  3UNW A;  3BFD A;  3UN7 A;  2Z2M B;  4S2O A;  2WKH A;  4DF6 A;  5L2F A;  1JWZ A;  4GNU A;  1CEG A;  1XP4 A;  3V3R A;  2A3U A;  3WS1 A;  4D2O A;  3UE3 A;  4QJG A;  1KGG A;  3UPP A;  2B5R A;  5IHV A;  3VSK A;  5KSH A;  1N4O A;  4MBK A;  2FFF B;  4E3I A;  3A3E A;  4E3K A;  4IBR A;  4WM9 A;  3SS3 A;  3UPO A;  1PYY A;  4OQI A;  3HUO A;  1NJ4 A;  4NET A;  4U0T A;  5D3O A;  2R9W A;  3NDE A;  1IKG A;  3WS5 A;  1TDL A;  5KSC A;  1NZO A;  5HAR A;  1K25 A;  2J9P A;  5DVA A;  4P6B A;  5KMW A;  3QNB A;  3HLE A;  1EI5 A;  3ZG7 B;  4XXR A;  1E25 A;  5HL1 A;  4CJN A;  5FQQ A;  5TFQ A;  4JXG A;  3BFG A;  1L0G A;  2EFX A;  3TG9 A;  4OPR A;  2QZ6 A;  2ZM8 A;  1K55 C;  3MXS A;  1H8Z A;  1BLC A;  4C3Q A;  2UWX A;  2J9O A;  2ZC5 B;  3IXG A;  4OP8 A;  2P9V A;  1YQS A;  4LV0 A;  3VP1 A;  1GA0 A;  1YLZ A;  3CZD A;  1K38 A;  2XDM A;  3VP4 A;  1EWZ A;  4CPK A;  3G2Y A;  4IVI A;  3OC2 A;  4B4X A;  3MBZ A;  4QY6 A;  2J7V A;  3N4I A;  1FR6 A;  2C6W B;  1DY6 A;  1XKZ A;  5DTS A;  5CED A;  1K57 A;  1G6A A;  4WZ4 A;  2XK1 A;  3ITB A;  2DRW A;  4ID4 A;  4PM9 A;  3VOY A;  4DE1 A;  2HP5 A;  2Y2Q A;  4HEF A;  4UHU A;  5I94 A;  4JKT A;  4WEK A;  2WK0 A;  4EBN A;  2C5W B;  1IYS A;  5J8X A;  5FA7 A;  4ZJ3 A;  5FAP A;  1BSG A;  1ESU A;  3IXD A;  3VFH A;  2EX8 A;  1NY0 A;  2Q9N A;  4QY5 A;  2P74 A;  1KDW A;  4K91 A;  4Y0T A;  3TSG A;  3FKV A;  2J8Y A;  3ZVW A;  4S2K A;  3V3S A;  5E2E A;  4DRT A;  1ERO A;  3IHB A;  1JTG A;  5EVI C;  5CEC A;  3S22 A;  5HFO A;  1NYM A;  4WEJ A;  4E3L A;  1GHM A; 
#chains in the Genus database with same CATH topology
 5HAQ A;  4I3J A;  3P7N A;  5FI2 A;  4B93 A;  2PBD P;  1OTA A;  2PHY A;  2Q9M A;  3RFB A;  3T4Q A;  3A0S A;  1FR1 A;  4Y0U A;  3IX8 A;  4KQQ A;  5L8M A;  5FAO A;  1H3Q A;  2Y2O A;  3OPL A;  3S7N A;  3CAX A;  1PI4 A;  2WUQ A;  1RGZ A;  3ZYT A;  2V1B A;  3DWZ A;  2GX5 A;  4ARZ A;  1FSY A;  1JTD A;  3M2K A;  4A5R A;  3U4L P;  4HHD A;  2Y2L A;  2E8I A;  3MR0 A;  4GHI B;  3OPR A;  1T1B A;  2JE5 A;  4PKY G;  4KG6 A;  4OOM A;  2FFY A;  3FZC A;  1TF1 A;  4EUV A;  1V9Z A;  3MSH A;  4BBT A;  2XD1 A;  4YWZ A;  3JYI A;  4XUX A;  5HL6 A;  3LIB A;  3RTY A;  4X6T A;  1MXO A;  4EU0 A;  1T1A A;  3LGO A;  2HDR A;  2ZOH A;  1XJ3 A;  2B02 A;  4GDB A;  2G7U A;  5KZH A;  3FG8 A;  4BWI A;  5HPF A;  3UY6 A;  3MS6 A;  3OPH A;  4OOY A;  3N7W A;  3SOI A;  5U47 A;  3GV9 A;  1A0K A;  4I39 A;  4S2P A;  1ODV A;  3PBR A;  1OTB A;  1LL8 A;  1FIK A;  4OP5 A;  4JXS A;  2XD5 A;  4PM6 A;  4GD6 A;  2H0Y A;  4LLO B;  2O9C A;  1CK3 A;  2LB5 A;  4HY8 A;  4GKU A;  2WKR A;  3BEC A;  4ZJ1 A;  1LSV A;  3NOP C;  2EXB A;  3NOT C;  1ES2 A;  4PMA A;  2JHE A;  2XSS A;  1MKI A;  5TJJ A;  5F69 A;  1T1C A;  4JXW A;  1NYY A;  4X53 A;  5CTN A;  3R7W B;  5CGS A;  2BG1 A;  2HDS A;  5HDC A;  3JVU A;  2PAV P;  2XA7 M;  3NC8 A;  4BEN A;  1EW0 A;  4NKP A;  1FCM A;  2GNX A;  1Z09 A;  1S4S A;  4E3J A;  3DBA A;  3N8L A;  3IS2 B;  3BRM A;  1NLZ A;  5FQM A;  4II7 A;  1M40 A;  1PNE A;  2X01 A;  3V50 A;  4GOG A;  2VV8 A;  4R4R A;  1YT4 A;  4S2J A;  3UDI A;  2Z2L B;  4R38 A;  2W1T A;  1TEM A;  5GL9 A;  4S2M A;  1ZC2 A;  3D9Y A;  4KZ4 A;  1IYP A;  4MEZ A;  2Y2M A;  5I5L A;  5FQJ A;  4JF5 A;  3S7P A;  3GRJ A;  3I7J A;  2ZL1 A;  1MWR A;  5GLB A;  3UDF A;  3F1O A;  1N9B A;  2HP6 A;  4UAA A;  3ICY A;  4JLF A;  4X1L A;  1H5X A;  3FPV A;  5FI7 A;  2M7V A;  2HDQ A;  5BOH A;  1RGY A;  4EBL A;  3MJQ A;  2PD7 A;  1XFQ A;  1DP8 A;  3LR5 A;  4EQI A;  1YKD A;  2EX9 A;  3WS4 A;  3LY4 A;  3IF5 A;  4DXB A;  1W79 A;  2JKF A;  2L4R A;  3L9K A;  3CLO A;  3N8R A;  2OSU A;  3IWO A;  2G2W A;  5EUA A;  5F82 A;  1K4F A;  2K7S A;  1HZO A;  1DJB A;  2EWV A;  4H8R A;  3PAG A;  2ZC3 B;  5FEG A;  4E3O A;  5HDS A;  3M6H A;  1K6R A;  1XGI A;  3HUN A;  3GVB A;  1HVB A;  2ZMF A;  4P6Z S;  1IEL A;  3E4O A;  1GSW A;  5KIZ A;  2WZX A;  1TVF A;  1YLP A;  4WZ5 A;  3T4S A;  3B42 A;  4HQA A;  1LI9 A;  3EQU A;  5HX9 A;  3HLC A;  4PKY A;  4UA7 A;  2FH5 A;  2JKT I;  3UO9 A;  5CER A;  3ZNT A;  5CTM A;  1ES4 A;  3P98 A;  1AXB A;  1CF0 A;  2INW A;  3IT9 A;  2JKR M;  3OZH A;  4YIN A;  4QPR A;  2OLV A;  2QPN A;  2G2U A;  4JF4 A;  4P0M A;  2PRF A;  1KOU A;  3ZDJ A;  4WLA A;  4DDY A;  1FQG A;  3GMW A;  4EW7 A;  2WGW A;  2DMW A;  4XT2 A;  1I2W A;  4EV4 A;  3Q7V B;  3G30 A;  3ISG A;  3HLD A;  4KQO A;  4RX2 A;  1YSP A;  3DW0 A;  4K0W A;  4RA7 A;  1T18 A;  3UNW A;  4S2O A;  4GNU A;  3F1P B;  4D2O A;  1ZHH B;  4F3L A;  4E3K A;  1W63 M;  4U0T A;  3WS5 A;  1TDL A;  2J3T C;  4P6B A;  4ARZ B;  4LRZ E;  5HL1 A;  3TG9 A;  2EFX A;  5HZH A;  4OPR A;  2ZM8 A;  1K55 C;  2UWX A;  2ZC5 B;  1S4R A;  2P9V A;  3MFX A;  1YQS A;  1GA0 A;  3CZD A;  2XDM A;  4GCZ A;  1EWZ A;  3G2Y A;  4JGO A;  4QY6 A;  4HH3 A;  3CIT A;  5DTS A;  2EWW A;  1K57 A;  2Z6D A;  2DRW A;  2Y2Q A;  4L9F A;  1YAX A;  2XRO A;  4L9G A;  5HSQ A;  5J8X A;  5FAP A;  1ESU A;  3VFH A;  2EX8 A;  3H7W A;  4QY5 A;  4JGQ A;  3FKV A;  4LGW A;  3ZVW A;  3V3S A;  3IHB A;  2QJ7 A;  3VE3 A;  3KSI A;  4CLC B;  2WAE A;  1ZG6 A;  5HW3 A;  3D72 A;  2A24 B;  1IYQ A;  2P9V B;  2R78 A;  2VLG A;  3LIE A;  5GHZ A;  5E2F A;  5L09 A;  2VGJ A;  2ZC7 A;  1SKO B;  1XX2 A;  2ZOI A;  1X0O A;  5TGF A;  3K3C A;  4MLL A;  3G34 A;  3CPT B;  1GCE A;  3O3V A;  2IWB A;  1PW8 A;  3C4P A;  1ONG A;  1OPX A;  2Y8H A;  4X69 A;  3C38 A;  3IH8 A;  4UEY A;  4BD0 A;  2ZBB A;  4Y2F A;  2Y59 A;  2ZD8 A;  3RXW A;  4FD8 A;  3HLW A;  4OLD A;  2FZ0 A;  3B3X A;  3NIA A;  3ZFZ A;  5F1F A;  1MWS A;  2XH9 A;  2OLU A;  3IWQ A;  1I2S A;  3C5A A;  4OLG A;  2V2F F;  2OAQ 1;  3IXH A;  2Y4A A;  2V1Z A;  1GSX A;  1F5M A;  3SH7 A;  1L3L A;  1KE3 A;  3G35 A;  3FKW A;  2HP9 A;  2B95 A;  3Q7Z A;  2Z6C A;  4B88 A;  5AQ7 A;  5AQA A;  1J9M A;  1ERM A;  5CGX A;  3UME A;  3A3D A;  4KZA A;  1LL9 A;  3WRZ A;  4DE2 A;  3PBT A;  2EA9 A;  3IBR A;  4GZB A;  4OPY A;  5EOO A;  3SH8 A;  4Y17 A;  2Y2I A;  2WZZ A;  3T1R A;  3D3O A;  4OPQ A;  4FTX A;  4KG2 A;  2ZM0 A;  2KDK A;  3GR2 A;  3QP1 A;  3IWI A;  2Y2G A;  5EE8 A;  2V1A A;  1N9L A;  1F2K A;  2WAD A;  1DJA A;  1YPR A;  5AQ9 A;  2QHK A;  4WEL A;  3K3D A;  2W3H A;  4D60 A;  1OTI A;  1K6S A;  4EEU A;  1S67 L;  4ZTK A;  4Y13 A;  1GHP A;  2JCH A;  1OTE A;  3MQ0 A;  4O8G A;  4WYY A;  2YKF A;  3UB8 A;  4EES A;  4UA6 A;  4QU3 A;  4S2N C;  2V8F A;  3W4Q A;  2WKI A;  3T4J A;  1XJ2 A;  4BMW A;  3KSG A;  3IXB A;  5EEC A;  1BLS A;  5DFX A;  4KEN B;  3QP5 A;  1GA9 A;  3VP3 A;  5AJG A;  3OOV A;  3QP2 A;  3Q7V A;  2K31 A;  2CC1 A;  3N8S A;  2NUP C;  3KYQ A;  2WGI A;  3T1S A;  4HI4 A;  3MZE A;  5CEB A;  3TOI A;  3W4P A;  2VK3 A;  3HJI A;  3ZHH A;  2KOI A;  3OPP A;  4ZDX A;  1G68 A;  3T4K A;  1S1Z A;  1P0Z A;  4OQH A;  2CMN A;  4CLC E;  3F1N B;  2QJ5 A;  4MN7 A;  3G6O A;  1BLP A;  3FWL A;  4P85 A;  2A49 A;  2DNS A;  1O07 A;  4BJP A;  2XLN A;  3SS5 A;  2H10 A;  3UB6 A;  1CI8 A;  3RJU A;  1MPL A;  2W3E A;  4LCM A;  3KX0 X;  1YSQ A;  4F94 A;  4S2I A;  2IA2 A;  3LIF A;  4GDN A;  1F98 A;  1S1Y A;  1I5Q A;  3PAE A;  4YNR A;  3O86 A;  5L07 A;  4FSF A;  2DCF A;  4HNB A;  4IVK A;  3RH8 B;  1BUE A;  3C7V A;  2PU2 A;  4OH0 A;  1O7E A;  4EER A;  4KZ8 A;  4N92 A;  3LY3 A;  1VQQ A;  4KZ7 A;  3KYE A;  4NG2 A;  3ZG0 A;  2YKH A;  2Y2K A;  4RYE A;  2P08 A;  3UDX A;  4H6J A;  4ETX A;  3W4O A;  2ZQC A;  3VOL A;  2M1C A;  4WUJ A;  2V20 A;  3VV4 A;  4M3K A;  3H82 B;  5L10 A;  3ZNY A;  4CLC D;  4E3N A;  5E2H A;  2WGV A;  3TE8 A;  3LCE A;  3EWK A;  1SHV A;  5EVI B;  2NUT C;  4WF0 A;  4HES A;  4KUK A;  4R6L A;  3MZD A;  3AGD A;  1IFQ A;  3EEH A;  4KZ3 A;  1KE0 A;  5GHX A;  2H5S A;  1W8Y A;  1ZKJ A;  4HBU A;  2WKQ A;  2EX6 A;  1E4D A;  1TS6 A;  4KQR A;  4HJ3 A;  3FPW A;  3GSG A;  4R3J A;  1VEU A;  5JYO A;  4B4Z A;  4HBT A;  2EXA A;  5FAQ A;  3NDG A;  2XGN A;  3RXX A;  3WS0 A;  4NXB A;  2D01 A;  3IF6 C;  5HAI A;  4E6X A;  2OWH A;  4FH2 A;  3BJN A;  1K55 A;  3HCY A;  3IBJ A;  2W1R A;  4QWO A;  3E2K A;  3B33 A;  1FOF A;  1MZU A;  3V39 A;  5HWW A;  3V67 A;  3F1P A;  2ZC4 B;  5TBM B;  3C7U A;  4UQI S;  3OBF A;  1Q2P A;  5LBR A;  2P7J A;  4LRX C;  3BM6 A;  2A24 A;  3EQV A;  2K2N A;  3CG5 A;  1VHM A;  5F6A A;  1QME A;  1LSW A;  4L0L A;  3LR4 A;  4GLQ A;  1Y54 A;  3CUE A;  3IF6 A;  3ITA A;  4GD8 A;  4OKP A;  3LR0 A;  5DF9 A;  4HJ6 A;  2UV0 E;  4GHI A;  3VP0 A;  4EUZ A;  1JWV A;  2I72 A;  2XRN A;  2WKH A;  1FIL A;  1XP4 A;  2A3U A;  2PD8 A;  2W27 A;  4QJG A;  1P9W A;  1KGG A;  3UPP A;  1MC0 A;  3VSK A;  5IHV A;  4MBK A;  4KUO A;  4WM9 A;  3HUO A;  5D3O A;  3EGD C;  2R9W A;  3NDE A;  5A8B A;  3A0R A;  1K25 A;  1G5U A;  4XXR A;  5K5B A;  5FQQ A;  5TFQ A;  3BFG A;  2QZ6 A;  2PDR A;  1H8Z A;  2L0W A;  4C3Q A;  2J9O A;  1TD5 A;  4LV0 A;  3VP1 A;  4CPK A;  3N4I A;  1FR6 A;  1DY6 A;  5CED A;  1G6A A;  3VOY A;  4DE1 A;  4HEF A;  4JKT A;  2WK0 A;  4EBN A;  2C5W B;  1IYS A;  5FA7 A;  4R70 A;  1Y28 A;  2P74 A;  4K91 A;  3TSG A;  4S2K A;  5E2E A;  1ERO A;  1TS8 A;  1JTG A;  4Q0J A;  5CEC A;  5HD3 A;  1NYM A;  4WEJ A;  4E3L A;  3SH9 A;  1FSW A;  2XA7 S;  2H0T A;  1PZO A;  4LPZ A;  1OJ5 A;  3QNC A;  5EM1 A;  3TW8 A;  4ZAM A;  1RP5 A;  2QKP A;  4MBF A;  3F1O B;  3SZT A;  3C2W A;  5J4E A;  1UGU A;  5F68 A;  3PBN A;  4O0P A;  5HD5 A;  4OQG A;  1VM1 A;  2XF3 A;  4Y0O A;  1PI5 A;  5MC7 A;  2W3D A;  5HAP A;  1P9R A;  4M4X A;  5FI6 A;  1OTD A;  1YM1 A;  5EVE A;  3BLS A;  5JYP A;  5DF7 A;  2AVX A;  1LHY A;  4KZ6 A;  1BYW A;  3MMH A;  1N9O A;  2WYX A;  4JBF A;  1HD8 A;  1FCN A;  1S6R A;  2ZQ8 A;  2Y55 A;  1TS0 A;  1XJ6 A;  3GTC A;  4S2N A;  1S0W A;  1L0F A;  1P97 A;  5F5Y A;  3T4O A;  5G18 A;  4GN2 A;  1K56 A;  3WS2 A;  3H7W B;  3R7W A;  4R1G A;  3P01 A;  3ZG5 A;  2ZM2 A;  3OCL A;  4ETZ A;  4IBX A;  5EM0 A;  2ZQA A;  3PBO A;  1ACF A;  3EOI A;  3LO7 A;  5M19 A;  3CJM A;  2H28 A;  4EWF A;  5AQB A;  3QP4 A;  2Q0O A;  1Y4O A;  3MKF A;  3BEB A;  2V9A A;  1DP9 A;  1BUL A;  4KG5 A;  1STZ A;  5A90 A;  2PYR A;  3L7H A;  1H8Y A;  3ZG8 B;  3MQQ A;  2P04 A;  4OON A;  3S7O A;  5EPH A;  4PM5 A;  4X68 A;  4HP4 A;  2X71 A;  4LEN A;  1HLU P;  4X56 A;  3WWX A;  4RX3 A;  3W8K A;  1VEU B;  3MFD A;  1VET A;  5FDS A;  5J7E A;  4DJ3 A;  1XA1 A;  4NXG A;  5F1G A;  4RQ9 A;  4ZBE A;  3K2N A;  4R3A A;  4JPM A;  3G31 A;  4BLM A;  2WAF A;  1L2S A;  3U2A A;  2W0N A;  3PR6 A;  3IH9 A;  4N9K A;  5TBM A;  2Y2J A;  1KDS A;  3HLB A;  1ZG4 A;  2ZQ7 A;  4HOI A;  4HIA A;  1RCJ A;  1PW1 A;  2JKR I;  3BLM A;  4EQ1 A;  3BFC A;  1WE4 A;  2ZLY A;  5FAS A;  4FH4 A;  4WMC D;  2HPB A;  2OAP 1;  4DXC A;  5DTK A;  2QYB A;  2BLS A;  4PHT A;  4R0Q A;  2R9X A;  4XUZ A;  2KLI A;  4I3I A;  2HV1 A;  2HZ5 A;  3BW6 A;  1ES3 A;  5DJU A;  1BLH A;  5EFW A;  1SDN A;  3Q81 A;  1CQA A;  1PZP A;  4R3B A;  3VSL A;  4PM7 A;  2V0W A;  4LRY C;  4FOF A;  2HJ9 C;  3PYP A;  1ALQ A;  2D02 A;  2VGL S;  4GB7 A;  3VMA A;  4CQH A;  3PXP A;  5FQI A;  3HVF A;  4PPR A;  4GW9 A;  1ES5 A;  4NK3 A;  4BQM A;  3MKE A;  2ACG A;  1XFN A;  4E3M A;  1YLT A;  3T12 B;  2XFT A;  3QHY A;  1DP6 A;  5G4Y A;  5IT5 A;  1GHI A;  1IEM A;  2Y2H A;  5M18 A;  5FAT A;  2PYP A;  4WL9 A;  4U0X A;  4BD1 A;  4WMC A;  3IF6 B;  4JXV A;  2JKG A;  4OQ0 A;  5AVF A;  1T19 A;  2BTF P;  2BAS A;  5FQK A;  1PWG A;  4G3V A;  4ZJ2 A;  2VGL M;  1LSX A;  3A3F A;  3E2L A;  1SCW A;  3N6I A;  3Q82 A;  4GS9 B;  4MNR A;  2GDN A;  1YLJ A;  1DJC A;  1MKM A;  3S7Q A;  5GLA A;  3UE1 A;  4IUK A;  1G28 A;  2VX8 A;  4X55 A;  5A91 A;  1K54 C;  1L0D A;  2JN7 A;  3O88 A;  4DE0 A;  4JGR A;  1SKO A;  3EGX C;  1NXY A;  1H8M A;  3SW1 A;  4JF6 A;  4R23 A;  2XR0 A;  5IS1 A;  3MF0 A;  1W5D A;  1MWT A;  4OVD A;  2J3T D;  3R4K A;  1JVJ A;  3NY4 A;  1U60 A;  3BFF A;  4U3T A;  4S2L A;  1KVM A;  3VFF A;  4RVA A;  4OOL A;  2IWD A;  3IS2 A;  3KO6 A;  1CEF A;  2GZA A;  4P6Z M;  2VGK A;  3OCN A;  3LIC A;  1D7E A;  1KE4 A;  4Q0H A;  1L0E A;  1LL5 A;  5E43 A;  3HLG A;  4JGP A;  5TR7 A;  4CLC A;  2VV6 A;  1ERQ A;  4BBU A;  1XPB A;  1W63 Q;  3UMD A;  3BYD A;  3BFD A;  3UN7 A;  1JWZ A;  4IJG A;  5KSH A;  1N4O A;  4E3I A;  2VJW A;  3A3E A;  3SS3 A;  3UPO A;  1NJ4 A;  4NET A;  1IKG A;  3KSF A;  5HAR A;  4DMZ A;  5DVA A;  1EI5 A;  3ZG7 B;  1VB6 A;  1E25 A;  3LI9 A;  4CJN A;  1L0G A;  3OLO A;  3MXS A;  1BLC A;  3CWF A;  3IXG A;  3BQA A;  5HWV A;  1YLZ A;  3VP4 A;  4IVI A;  3FC7 A;  3CPT A;  2J7V A;  4O01 A;  1XKZ A;  2B18 A;  2KX6 A;  3E98 A;  3ITB A;  4ID4 A;  4PM9 A;  3F1N A;  5I94 A;  2GJ3 A;  2HP5 A;  1UWP X;  4FUW A;  4UHU A;  2LB9 A;  1PFL A;  2OOL A;  3E4Q A;  4MN5 A;  5FL3 A;  4ZJ3 A;  2Q9N A;  1KDW A;  2J8Y A;  2L1M A;  4DRT A;  3DTK A;  5EVI C;  3LFV A;  1GHM A;  5AVE A;  2VEA A;  4XT2 B;  3A3J A;  4K0X A;  3LEZ A;  1YMX A;  2J3W A;  1OME A;  3HLF A;  2PT7 A;  4KZ5 A;  3JPU A;  1BTL A;  4KQD A;  4N1H A;  3H9W A;  3ZQ5 A;  4ME4 A;  2PBY A;  1K4E A;  1PRQ A;  3UE0 A;  4CLC C;  5J3W A;  1HTZ A;  1PIO A;  2I9V A;  1MY8 A;  5EVL A;  3FV7 A;  1CI9 A;  4C75 A;  1SKF A;  2WKE A;  5FQ9 A;  4LV2 A;  4LFU A;  3G4P A;  2IWC A;  4QHC A;  4MDZ A;  3DTM A;  4E6W A;  1H0M A;  3PBS A;  4HH2 A;  3WRT A;  3NI9 A;  1ZTU A;  3M6B A;  1NLY A;  3DTI A;  3D4F A;  3M2J A;  2Y2P A;  3Q1F A;  4L9E A;  5DJT A;  5DKL A;  1WA9 A;  2VKS A;  1QMF A;  3A0V A;  2ZC6 B;  5CXW A;  3NBL A;  4ZRR A;  5GLD A;  1K56 D;  4HP9 A;  1W8Q A;  3DTE A;  4B9O A;  3IQA A;  4GJ4 A;  5GHY A;  1MBL A;  4Y7P A;  1TS7 A;  2Y2N A;  1J3W A;  1FCO A;  4YFM A;  4IED A;  3VE4 A;  2Y79 A;  1KGE A;  2J80 A;  3IHA A;  4K08 A;  3MXQ A;  3S4X A;  1XA7 A;  5A93 A;  3LID A;  4QD4 A;  3G32 A;  4DN0 A;  2VZW A;  4MMN A;  1YMS A;  4UA9 A;  1W7F A;  5DF8 A;  2W3G A;  5EV0 A;  1PWD A;  3FYZ A;  4Q8I A;  4WZ5 C;  3NUL A;  4PAU A;  1VET B;  2HF6 A;  3VP2 A;  3UB9 A;  4R4S A;  1YLW A;  2WKP A;  3T1X A;  2O99 A;  5GLC A;  3C8C A;  1C3B A;  5DKK A;  1Z6F A;  3LIA A;  2WGW B;  1M6K A;  3DWK A;  3NEC A;  4DKI A;  4EET B;  3IX3 A;  3E4P A;  2HJE A;  2ZQ9 A;  1KGF A;  1LI0 A;  1WYC A;  3HJK A;  4FCF A;  2A2L A;  5EOE A;  4Q0I A;  3NHQ A;  4Z1W A;  2VA0 A;  4QB8 A;  3T4L A;  1TDG A;  3T50 A;  1XXM A;  1NWZ A;  1SDE A;  4C6Y A;  3O5Y A;  2HGV A;  2MJ6 A;  1UWN X;  1WYB A;  4DJ2 A;  5A92 A;  4PM8 A;  3V5M A;  3DAV A;  1E3U A;  3LR3 A;  3UPN A;  4LCL A;  3C4O A;  4BL3 A;  5DFY A;  3A3I A;  3S1Y A;  3SS4 A;  1MWU A;  1YLY A;  5IU1 A;  5EVI D;  4N9L A;  5FEF A;  3NOU C;  2Y91 A;  4I3A A;  5M1A A;  2XFS A;  1K54 A;  2JBF A;  4NXF A;  5E2G A;  1IYO A;  3UB7 A;  4UQI M;  4G3W A;  2ZL1 B;  1ONH A;  4I5S A;  3GQZ A;  2VV7 A;  1Q2Q A;  4WN5 A;  1DRM A;  4WBG A;  1PWC A;  2X02 A;  3BFE A;  2RL3 A;  4F3L B;  4O7D A;  2PU4 A;  1NZU A;  2XEP A;  3AGE A;  1NRF A;  3AGF A;  4KZ9 A;  1SZV A;  2JC7 A;  3BY8 A;  3B47 A;  4Z9Q A;  5F83 A;  4GS9 A;  4MBH A;  5C5K A;  3LEQ A;  2QWS A;  3CUE C;  4E04 A;  2RCX A;  2ZMA A;  1G6O A;  1K0K A;  3QP6 A;  3C30 A;  5HDD A;  1BT5 A;  3HRE A;  3BWL A;  1IKI A;  1XGJ A;  4AFI A;  3KYZ A;  5CRF A;  3KSH A;  5EVI A;  5CGW A;  3MQO A;  4P87 A;  3TRC A;  3PBQ A;  4Y3I A;  4OPZ A;  2HDU A;  3CI6 A;  2ZJ9 A;  2ZMV A;  1S66 L;  3O87 A;  1OT9 A;  2O0Y A;  3GDI A;  4H6J B;  1GSV A;  2E8J A;  1LLB A;  1KVL A;  2QMI A;  1CJF A;  1LT0 A;  3ZVT A;  1ESI A;  3CMZ A;  3G2Z A;  4LV1 A;  3HUM A;  3JVV A;  5DTT A;  4NXE A;  3PHY A;  4LV3 A;  1K57 C;  3TJZ C;  4DDS A;  3P09 A;  1E3U D;  1JWP A;  3ZGA B;  4MN6 A;  4IUH A;  5FSR A;  3EEA A;  3MXR A;  1OT6 A;  3IX4 A;  4KZB A;  3E0Y A;  5CHM A;  3ZG9 B;  3ZCZ A;  3ULF A;  1IOU A;  3PTE A;  1N9N A;  1XJ4 A;  4Y15 A;  4EEP A;  3H82 A;  2EX2 A;  3HBR A;  4HJ4 A;  2EFU A;  5CX7 A;  2OV5 A;  5CHU A;  3MZF A;  4N1X A;  2PR6 A;  5CHJ A;  3LI8 A;  4BL2 A;  3UB5 P;  4ESP A;  3QP8 A;  3HL9 A;  2XQZ A;  4DE3 A;  1NRJ A;  5FDH A;  2ZQD A;  1BZA A;  3LYX A;  1JNU A;  2JKT M;  3Q07 A;  3VOZ A;  4G3K A;  3NCK A;  5L2F A;  4DF6 A;  2Z2M B;  1OJG A;  3UE6 A;  1CEG A;  2O9A A;  3V3R A;  3WS1 A;  3UE3 A;  2B5R A;  3LUQ A;  3BY9 A;  2FFF B;  4NEE D;  2M7U A;  4IBR A;  1PYY A;  4OQI A;  3T1Q B;  5KSC A;  4MCW A;  1NZO A;  2J9P A;  5KMW A;  2O9B A;  3QNB A;  3HLE A;  3W2Z A;  1D06 A;  4JXG A;  5HWT A;  4I38 A;  1V9Y A;  4BBV A;  4OP8 A;  2V8C A;  4YOF A;  1K38 A;  2W1T B;  4X1M A;  5G4Z A;  4IHQ A;  4B4X A;  3OC2 A;  3GEC A;  3MBZ A;  2OWJ A;  2C6W B;  4Y5F A;  1F9I A;  4WZ4 A;  2XK1 A;  3CHW P;  2V0U A;  3T4T A;  4WEK A;  3BQ8 A;  2W3F A;  1D1J A;  1BSG A;  3IXD A;  1NY0 A;  3NJA A;  4Y0T A;  5HPI A;  4X25 A;  4EXO A;  3S22 A;  2PR5 A;  5HFO A;  1AWI A;  4EBP A; 
#chains in the Genus database with same CATH homology
 2WAE A;  5HAQ A;  3A3J A;  4K0X A;  1ZG6 A;  3LEZ A;  5HW3 A;  5FI2 A;  3SH9 A;  1FSW A;  1YMX A;  2Q9M A;  1IYQ A;  2P9V B;  1OME A;  3HLF A;  2H0T A;  1PZO A;  4KZ5 A;  3QNC A;  1BTL A;  1FR1 A;  4Y0U A;  4ZAM A;  5GHZ A;  1RP5 A;  4KQQ A;  5E2F A;  4MBF A;  4N1H A;  5FAO A;  2Y2O A;  2PBY A;  3OPL A;  1K4E A;  3UE0 A;  2VGJ A;  2ZC7 A;  1XX2 A;  3PBN A;  1HTZ A;  1PIO A;  5TGF A;  1MY8 A;  5EVL A;  1PI4 A;  3FV7 A;  4OQG A;  1VM1 A;  2XF3 A;  4Y0O A;  4MLL A;  1PI5 A;  2WUQ A;  3G34 A;  1CI9 A;  1RGZ A;  5HAP A;  4C75 A;  1SKF A;  2WKE A;  3DWZ A;  5FQ9 A;  4LV2 A;  3G4P A;  5FI6 A;  1FSY A;  1JTD A;  2IWC A;  1GCE A;  1YM1 A;  3M2K A;  3O3V A;  4QHC A;  3DTM A;  2IWB A;  4A5R A;  4E6W A;  1PW8 A;  3C4P A;  3PBS A;  1ONG A;  3WRT A;  3BLS A;  5JYP A;  4X69 A;  3NI9 A;  5DF7 A;  3IH8 A;  4BD0 A;  2Y2L A;  2Y59 A;  2E8I A;  3M6B A;  2ZD8 A;  3RXW A;  1LHY A;  4KZ6 A;  3OPR A;  4FD8 A;  3D4F A;  3HLW A;  4OLD A;  2JE5 A;  3M2J A;  3B3X A;  2Y2P A;  4KG6 A;  4OOM A;  3NIA A;  3Q1F A;  2FFY A;  3ZFZ A;  5F1F A;  1MWS A;  2XH9 A;  3FZC A;  2WYX A;  4JBF A;  2OLU A;  3IWQ A;  1I2S A;  1HD8 A;  1FCN A;  2XD1 A;  3C5A A;  1S6R A;  1QMF A;  4OLG A;  2ZQ8 A;  2Y55 A;  2ZC6 B;  2V2F F;  5CXW A;  3GTC A;  3NBL A;  4S2N A;  1S0W A;  5GLD A;  1L0F A;  3JYI A;  4XUX A;  1K56 D;  3IXH A;  4X6T A;  1MXO A;  5G18 A;  2Y4A A;  4GN2 A;  2V1Z A;  1W8Q A;  2HDR A;  1K56 A;  3IQA A;  3WS2 A;  5GHY A;  3SH7 A;  1MBL A;  4Y7P A;  4R1G A;  1KE3 A;  4GDB A;  2Y2N A;  3ZG5 A;  3G35 A;  2ZM2 A;  1FCO A;  3OCL A;  4IBX A;  4IED A;  4YFM A;  5KZH A;  3FKW A;  2ZQA A;  2HP9 A;  1KGE A;  3PBO A;  3Q7Z A;  3UY6 A;  5AQ7 A;  5AQA A;  4B88 A;  1J9M A;  1ERM A;  3IHA A;  5CGX A;  3LO7 A;  5M19 A;  3S4X A;  1XA7 A;  3A3D A;  3OPH A;  5A93 A;  4KZA A;  4QD4 A;  1LL9 A;  3CJM A;  3G32 A;  4OOY A;  4EWF A;  5AQB A;  3N7W A;  3WRZ A;  4DE2 A;  4EBP A;  3PBT A;  1YMS A;  3MKF A;  3BEB A;  4GZB A;  1BUL A;  4KG5 A;  4OPY A;  5EOO A;  3SH8 A;  2Y2I A;  3SOI A;  2WZZ A;  5U47 A;  4UA9 A;  1W7F A;  5DF8 A;  5A90 A;  4OPQ A;  1H8Y A;  1PWD A;  4KG2 A;  3FYZ A;  2ZM0 A;  3ZG8 B;  3GV9 A;  4S2P A;  4WZ5 C;  4Q8I A;  3PBR A;  3GR2 A;  3IWI A;  2Y2G A;  4OON A;  4OP5 A;  5EPH A;  3VP2 A;  4JXS A;  5EE8 A;  2XD5 A;  4PM5 A;  4X68 A;  4PM6 A;  4GD6 A;  2WAD A;  1DJA A;  5AQ9 A;  2H0Y A;  4R4S A;  4WEL A;  1YLW A;  1K6S A;  2X71 A;  1CK3 A;  4LEN A;  4ZTK A;  1GHP A;  5GLC A;  2JCH A;  1C3B A;  4GKU A;  4WYY A;  4X56 A;  1Z6F A;  3WWX A;  3BEC A;  2WGW B;  4RX3 A;  1M6K A;  3W8K A;  3DWK A;  3MFD A;  4ZJ1 A;  4DKI A;  4UA6 A;  1XA1 A;  4QU3 A;  2EXB A;  4S2N C;  1ES2 A;  4PMA A;  2ZQ9 A;  1KGF A;  5F1G A;  1LI0 A;  4ZBE A;  3W4Q A;  2WKI A;  4JPM A;  1WYC A;  3G31 A;  4FCF A;  5EOE A;  4BLM A;  1MKI A;  2WAF A;  3IXB A;  1L2S A;  5EEC A;  1BLS A;  4N9K A;  3IH9 A;  4QB8 A;  4KEN B;  4JXW A;  1NYY A;  1TDG A;  2Y2J A;  1GA9 A;  4X53 A;  5CTN A;  3VP3 A;  1KDS A;  3HLB A;  5CGS A;  1ZG4 A;  2BG1 A;  1XXM A;  2ZQ7 A;  1SDE A;  4C6Y A;  2HDS A;  1RCJ A;  1PW1 A;  3Q7V A;  2CC1 A;  3N8S A;  3BLM A;  2WGI A;  3NC8 A;  1WYB A;  4BEN A;  3MZE A;  3BFC A;  1FCM A;  1WE4 A;  3TOI A;  5A92 A;  2ZLY A;  3W4P A;  3ZHH A;  5CEB A;  4PM8 A;  3V5M A;  5FAS A;  3OPP A;  4FH4 A;  1E3U A;  4E3J A;  4ZDX A;  4WMC D;  1G68 A;  3N8L A;  3UPN A;  2HPB A;  3BRM A;  4LCL A;  4OQH A;  3C4O A;  5FQM A;  4BL3 A;  4DXC A;  1M40 A;  5DTK A;  3A3I A;  3S1Y A;  2BLS A;  1MWU A;  4R0Q A;  2X01 A;  2R9X A;  4GOG A;  3SS4 A;  3V50 A;  4XUZ A;  1BLP A;  3FWL A;  4R4R A;  1YLY A;  4P85 A;  5EVI D;  1YT4 A;  2A49 A;  4S2J A;  4N9L A;  3UDI A;  1ES3 A;  2DNS A;  2Z2L B;  1BLH A;  1O07 A;  4BJP A;  2Y91 A;  5M1A A;  2XLN A;  2XFS A;  1SDN A;  3SS5 A;  1TEM A;  1PZP A;  3Q81 A;  5GL9 A;  4R3B A;  1K54 A;  2JBF A;  2H10 A;  4S2M A;  3VSL A;  1CI8 A;  4PM7 A;  1ZC2 A;  3RJU A;  1MPL A;  5E2G A;  4KZ4 A;  1IYP A;  1IYO A;  4MEZ A;  4LCM A;  2Y2M A;  5FQJ A;  4F94 A;  4JF5 A;  3GRJ A;  1ALQ A;  4GB7 A;  3I7J A;  4S2I A;  3VMA A;  1MWR A;  1ONH A;  5GLB A;  4GDN A;  3UDF A;  3GQZ A;  1Q2Q A;  1I5Q A;  3PAE A;  3O86 A;  4FSF A;  4WBG A;  1PWC A;  2X02 A;  2DCF A;  1N9B A;  2HP6 A;  3HVF A;  5FQI A;  4PPR A;  4UAA A;  4JLF A;  1H5X A;  1ES5 A;  4IVK A;  3BFE A;  4NK3 A;  4BQM A;  3MKE A;  5FI7 A;  1BUE A;  3C7V A;  2HDQ A;  4E3M A;  1YLT A;  5BOH A;  1RGY A;  2XFT A;  4EBL A;  2PU2 A;  3QHY A;  2RL3 A;  4OH0 A;  1O7E A;  4O7D A;  4KZ8 A;  4N92 A;  2PU4 A;  3LY3 A;  1VQQ A;  1NZU A;  2XEP A;  1GHI A;  1IEM A;  3AGE A;  4KZ7 A;  1NRF A;  3AGF A;  4KZ9 A;  3ZG0 A;  4EQI A;  2Y2H A;  2JC7 A;  5M18 A;  2Y2K A;  4RYE A;  3UDX A;  4Z9Q A;  5F83 A;  3W4O A;  4MBH A;  2ZQC A;  2EX9 A;  5FAT A;  3WS4 A;  3LY4 A;  4U0X A;  4BD1 A;  4WMC A;  3IF6 B;  2V20 A;  3IF5 A;  2RCX A;  4DXB A;  1W79 A;  4JXV A;  2ZMA A;  4M3K A;  4OQ0 A;  3ZNY A;  3N8R A;  1BT5 A;  3HRE A;  4E3N A;  2OSU A;  3IWO A;  1IKI A;  5E2H A;  2G2W A;  1XGJ A;  5EUA A;  5F82 A;  2WGV A;  1K4F A;  3LCE A;  1PWG A;  1SHV A;  5FQK A;  5EVI B;  4ZJ2 A;  1HZO A;  5CRF A;  5EVI A;  3A3F A;  3E2L A;  1SCW A;  3N6I A;  5CGW A;  3Q82 A;  1DJB A;  4HES A;  4P87 A;  4H8R A;  3PBQ A;  4MNR A;  3MZD A;  2ZC3 B;  3PAG A;  3AGD A;  4OPZ A;  2GDN A;  1YLJ A;  4KZ3 A;  1DJC A;  2HDU A;  1KE0 A;  5GHX A;  2ZJ9 A;  5GLA A;  3UE1 A;  4E3O A;  2H5S A;  3O87 A;  1W8Y A;  1ZKJ A;  4HBU A;  4X55 A;  5A91 A;  1K54 C;  1L0D A;  2EX6 A;  3M6H A;  1E4D A;  3O88 A;  1K6R A;  1XGI A;  1LLB A;  1KVL A;  2QMI A;  3GVB A;  3HUN A;  4KQR A;  1HVB A;  4DE0 A;  3GSG A;  4R3J A;  3ZVT A;  1ESI A;  1IEL A;  3CMZ A;  3G2Z A;  5JYO A;  4B4Z A;  4LV1 A;  2WZX A;  3HUM A;  4HBT A;  2EXA A;  1NXY A;  5FAQ A;  3NDG A;  4JF6 A;  4R23 A;  5DTT A;  2XGN A;  1TVF A;  4LV3 A;  3RXX A;  1K57 C;  2XR0 A;  1YLP A;  3WS0 A;  3IF6 C;  5HAI A;  1W5D A;  4E6X A;  4WZ5 A;  4DDS A;  1MWT A;  3P09 A;  4FH2 A;  4OVD A;  1E3U D;  1LI9 A;  1K55 A;  1JWP A;  3EQU A;  1JVJ A;  3HLC A;  4UA7 A;  5HX9 A;  3NY4 A;  1U60 A;  3ZGA B;  3BFF A;  5FSR A;  4U3T A;  3MXR A;  4S2L A;  3UO9 A;  5CER A;  1KVM A;  3E2K A;  3ZNT A;  3VFF A;  1FOF A;  4OOL A;  2IWD A;  4KZB A;  4RVA A;  5CHM A;  5CTM A;  3V39 A;  3ZG9 B;  3ZCZ A;  1ES4 A;  3P98 A;  1AXB A;  3PTE A;  2ZC4 B;  1CEF A;  3IT9 A;  3C7U A;  3OZH A;  1Q2P A;  2VGK A;  4YIN A;  2OLV A;  2EX2 A;  2QPN A;  3OCN A;  3HBR A;  2G2U A;  4JF4 A;  4P0M A;  1KE4 A;  3BM6 A;  2EFU A;  3EQV A;  3CG5 A;  5CHU A;  2OV5 A;  3MZF A;  4N1X A;  1L0E A;  1LL5 A;  3ZDJ A;  1QME A;  4DDY A;  5CHJ A;  1FQG A;  3GMW A;  5E43 A;  4BL2 A;  3HLG A;  2WGW A;  3HL9 A;  1I2W A;  4L0L A;  2XQZ A;  1Y54 A;  5TR7 A;  4EV4 A;  3IF6 A;  3ITA A;  4GD8 A;  4DE3 A;  3Q7V B;  3G30 A;  1ERQ A;  4OKP A;  5FDH A;  2ZQD A;  3ISG A;  3HLD A;  5DF9 A;  1BZA A;  4KQO A;  3VP0 A;  4EUZ A;  1JWV A;  1XPB A;  3DW0 A;  4K0W A;  4RA7 A;  4RX2 A;  3Q07 A;  3BYD A;  3VOZ A;  3NCK A;  2I72 A;  3UNW A;  3BFD A;  3UN7 A;  2Z2M B;  4S2O A;  2WKH A;  4DF6 A;  5L2F A;  1JWZ A;  4GNU A;  1CEG A;  1XP4 A;  3V3R A;  2A3U A;  3WS1 A;  4D2O A;  3UE3 A;  4QJG A;  1KGG A;  3UPP A;  2B5R A;  5IHV A;  3VSK A;  5KSH A;  1N4O A;  4MBK A;  2FFF B;  4E3I A;  3A3E A;  4E3K A;  4IBR A;  4WM9 A;  3SS3 A;  3UPO A;  1PYY A;  4OQI A;  3HUO A;  1NJ4 A;  4NET A;  4U0T A;  5D3O A;  2R9W A;  3NDE A;  1IKG A;  3WS5 A;  1TDL A;  5KSC A;  1NZO A;  5HAR A;  1K25 A;  2J9P A;  5DVA A;  4P6B A;  5KMW A;  3QNB A;  3HLE A;  1EI5 A;  3ZG7 B;  4XXR A;  1E25 A;  5HL1 A;  4CJN A;  5FQQ A;  5TFQ A;  4JXG A;  3BFG A;  1L0G A;  2EFX A;  3TG9 A;  4OPR A;  2QZ6 A;  2ZM8 A;  1K55 C;  3MXS A;  1H8Z A;  1BLC A;  4C3Q A;  2UWX A;  2J9O A;  2ZC5 B;  3IXG A;  4OP8 A;  2P9V A;  1YQS A;  4LV0 A;  3VP1 A;  1GA0 A;  1YLZ A;  3CZD A;  1K38 A;  2XDM A;  3VP4 A;  1EWZ A;  4CPK A;  3G2Y A;  4IVI A;  3OC2 A;  4B4X A;  3MBZ A;  4QY6 A;  2J7V A;  3N4I A;  1FR6 A;  2C6W B;  1DY6 A;  1XKZ A;  5DTS A;  5CED A;  1K57 A;  1G6A A;  4WZ4 A;  2XK1 A;  3ITB A;  2DRW A;  4ID4 A;  4PM9 A;  3VOY A;  4DE1 A;  2HP5 A;  2Y2Q A;  4HEF A;  4UHU A;  5I94 A;  4JKT A;  4WEK A;  2WK0 A;  4EBN A;  2C5W B;  1IYS A;  5J8X A;  5FA7 A;  4ZJ3 A;  5FAP A;  1BSG A;  1ESU A;  3IXD A;  3VFH A;  2EX8 A;  1NY0 A;  2Q9N A;  4QY5 A;  2P74 A;  1KDW A;  4K91 A;  4Y0T A;  3TSG A;  3FKV A;  2J8Y A;  3ZVW A;  4S2K A;  3V3S A;  5E2E A;  4DRT A;  1ERO A;  3IHB A;  1JTG A;  5EVI C;  5CEC A;  3S22 A;  5HFO A;  1NYM A;  4WEJ A;  4E3L A;  1GHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...