4GKXA

Crystal structure of a carbohydrate-binding domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
230
structure length
230
Chain Sequence
LPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Carbohydrate Binding by LMAN1 Protein Provides New Insight into the Endoplasmic Reticulum Export of Factors V (FV) and VIII (FVIII).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein ERGIC-53
total genus 47
structure length 230
sequence length 230
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gkxA00
5T50A 2DUQA 4K21A 2P2KA 2LTNA 4M01A 3R05A 1LHUA 1QOSA 2ZGMA 3ENRA 5DUUA 2D43A 3LSEA 4UW6A 4XDQA 2DTYA 3SH3A 1MS5A 1BYHA 3B00A 1SCSA 1CESA 1N1TA 1LJ7A 4PF5A 1S0CA 4FP3A 5EYYA 5GLVA 2JJ6A 4AGVA 5GZEA 4XBNA 4UW3A 1UZZA 2NZ9A 4H55A 4XJ8A 1KRIA 1HQWA 1AJKA 3VKOA 4DQAA 4Q8LA 5DUVA 4Y24A 3OY8A 1FYUA 1ULDA 2A5ZA 3OYWA 2W39A 2ZKNA 4YM0A 4XJZA 5GZGA 4Q26A 5LK5A 4ATEA 3JU9A 2DUPA 4UW5A 3RMYA 4XJAA 3NV1A 4WVWA 1Q8SA 1MVEA 1ULCA 4PBPA 4OZXA 4XBQA 1ENSA 2ES3A 2VH9A 2EXHA 2BQPA 4FPEA 1FV3A 1JN2P 3O0VA 1R1ZA 4BPZA 1UPSA 4AGGA 3ZXJA 2UWBA 1N3QA 2R49A 4AVSA 3AP5A 2A6WA 2GNDA 2P34A 3A4UA 1LHVA 1PZ8A 3ILNA 4FPLA 1SBDA 3NWKA 2P37A 3OJBA 3VKFC 1ULEA 2P3JA 4FPCA 1LOFA 3SITA 1ULGA 2R1DA 2WLQA 4MYEA 4BM8A 1SLCA 1C1LA 4DRRA 5T55A 1S1AA 1VALA 1J1TA 1LGCA 1LENA 1QDOA 4YW2A 3RSJA 4L8QA 2H0BA 5GALA 2YROA 4D69A 5JDBA 1JHNA 2D6MA 2OW4A 5GM0A 1N1VA 2GMEA 2ZGRA 3O5SA 3W59A 3WVJA 3QCWA 1BJQA 3ILRA 5T54A 1AX0A 1LHNA 3C2UA 5AVAA 4FOWA 3FFZA 1DQ0A 2WNEA 3MW4A 4PQ9A 1ENQA 1MVQA 2ENRA 3AZYA 2UWAA 4FPKA 3ZSJA 1SLBA 1LOFC 2VUAA 4ZKTB 3ZPYA 1AF9A 3MEPA 1MZ6A 1DIWA 3RG0A 4BOWA 2D6KA 4FPOB 4BQ1A 1JYCA 2E6VA 2PHRA 3WG1A 3N36A 1N3OA 4YGEA 2PHUA 4XTMA 4XZPA 2E7QA 5EYXA 5GZCA 1W6QA 1WLCA 4RA0A 1AXKA 1B09A 1CIWA 4TYSA 4Q1PA 1FATA 1YYNA 4U2AA 3WDWA 3KM5A 1BZWA 2EIGA 2A3XA 3HR9A 1DHKB 2Q5TA 5FRAA 5T5JA 1MS0A 2R1BA 1KDMA 3GALA 3AYCA 1GZWA 1LHOA 2R16A 4Y1VA 3AZXA 4FPJA 4JCKA 4ATFA 3B01A 3O0WA 5CBLA 5KXCA 2OUHA 4P9WA 1AXZA 1JYIA 4YW4A 4Y20A 5JOWA 3WOGA 2W08A 2A6YA 4RL7A 2GALA 4ITCA 2DYCA 4U36A 4XJWA 1A3KA 3FBYA 1I3HA 2GN7A 2VY0A 3CNAA 2AENA 1O4YA 3INAA 2WQZC 3USUB 3WCRA 3WDTA 3ZXKA 5DUXA 3T1LA 2ZGNA 1CN1A 1MS9A 2ZMNA 3ILFA 3AK0A 3OGGA 4FPYA 3WG3A 3V0BA 1GNZA 1W6OB 3AP4A 4AYUA 4XXPA 2WT1A 4UW4A 1V6KA 3ASIA 4R9CA 1N1YA 1YXWA 2D6NA 2ERFA 5DUWA 2D6OX 3ZSMA 3IKWA 3AZVA 5IK8A 2VW2A 1LOAA 1DYPA 4YZ1A 1MR5A 5IT6A 5CNAA 3T2TA 1FAYA 3UK9A 5F9TA 3AXEA 5E8AA 1HDKA 1V6IA 2A3YA 4YZ4A 2GMPA 1AX2A 1G8WA 1FNZA 2ZGPA 4M3CB 4M3CF 2YXSA 3AYEA 1FNYA 3AJYA 1GV9A 1WBLA 2YV8A 1WW6A 3L2YA 3N7MA 1WBFA 3V65A 5CAZA 1DBNA 1NLSA 1V6MA 1YIFA 2PHXA 1KQRA 2ZGSA 4LBQD 4YW3A 1HQLA 4W65A 3R4UA 4FQ4A 4M00A 2ZGLA 3Q9OA 1JOJA 2HYKA 3VKMA 1UN1A 3BOPA 1WLDA 2ZA9A 5H9QA 1SACA 2ARBA 2R0HA 2VXRA 2UU8A 4LBLA 1C57A 1WW7A 3IMNA 4GWNA 5DZFA 5GJ6A 2AH2A 3UJQA 3MW3A 4CZSA 1DQ4A 4YGBA 4GALA 1IS4A 2FHRA 2YY1A 4FP2A 4Y1XA 1PZ9A 4DPNA 5CA6A 3TAYA 4CTEA 4GA9A 1AVBA 1Q8QA 4R9AA 1DQ5A 1F5FA 1S0GA 1D2SA 1WW5A 2DU1A 2VW1A 2A6XA 2YMZA 3HMYA 4ISRA 2GNMA 2UURA 2DVGA 3ATGA 4FPFA 1OFSA 3ZVXA 3AYAA 3M3CA 4LBOA 3WG2A 3IPVB 1LULA 4XHBA 1G9DA 5KXEA 3WCSA 4Y1YA 1MS8A 4LBMA 4PCRA 2ZACA 3OYWB 2Z42A 4DS0A 3AYDA 1N1SA 1Q56A 4YGCA 3OY8B 4YGDA 2JE9A 4ASMB 4Q1RA 3N7LA 3FLPA 4K1YA 4XMIA 2ZMLA 3AP6A 1LOCA 3WUCA 5JLVA 1SCRA 1VLNA 4PBOA 4NOTA 3M2MA 1SBEA 3WG4A 1JBCA 5HCAA 2D3PA 1MACA 2JDZA 2A71A 1SLIA 2A75A 3RQ0A 1CJPA 3WZ1A 2D7FA 1WD4A 2AGSA 4AGRA 4Q27A 2NM1A 4TZDA 2ZHLA 1W6MB 1Z0HA 2EXJA 4WVVA 5GZFA 4YG3A 3WDXA 4BMBA 1GZWB 1VIWB 1HKDA 2GNBA 4AVVA 2E7TA 4YM2A 1QF3A 1S0DA 2ZBJA 3DUIA 3IPVA 3WHTA 1I1EA 1GNHA 4Q8KA 1G9CA 1UKGA 3M3EA 2B7YA 1W6OA 2WT0A 1GBGA 2WSUA 3N3HA 4XMAA 3HN1A 4LBQA 1UMZA 1S0BA 1N47A 1W0OA 1YI7A 1MS3A 3POWA 4XTPA 5BYNA 1UX6A 1CPMA 3AZWA 3USUA 1LEMA 1QDCA 5EWSA 5HCFA 1S0EA 3I4IA 1W0PA 3SLIA 5F5QA 3N7KA 4CRQA 1A8DA 3WLUA 2ZHKA 2WKKA 3FUQA 4R9DA 5JOZA 1JUIA 2KM2A 2DVBA 1SLTA 4Y1ZA 2XB6C 3M1HA 2ZGQA 3ZXLA 2CNAA 1IOAA 1FV2A 2E51A 3WUDA 2C9AA 1GZCA 3B69A 3AP9A 5EXOA 3D4KA 1SLAA 1G9FA 1V6OA 1W6PB 2GN3A 2ZABA 4YLZA 3AP7A 2NMOA 4P9XA 1C1FA 4XIOA 1ENRA 3NV4A 3R4SA 4YG6A 4YW5A 2ZGTA 4BMEA 3TB0A 1DZQA 3FLRA 1V00A 2DVAA 5E89A 2DV9A 4C1WA 2NN8A 3FUOA 3NV2A 4YM3A 4YZ5A 1F31A 1U0AA 1QU0A 1YRZA 1UL9A 1V6NA 3WHUA 4FOYA 5JMCA 5JOYA 3U4XA 1GLHA 4K1ZA 2UWCA 4R9BA 4YFZA 1LOBA 1DGLA 2JE7A 4F83A 1DLLA 4YFWA 2A6ZA 1PZ7A 1W6NB 4HL0A 1CR7A 1SBFA 2V73A 3A0NA 3VV1A 1F9KA 1AXYA 2YZ4A 3B3QE 4YW1A 3MW2A 4BLIA 2A70A 4WZFA 1WUVA 2W52A 1KDKA 2CY6A 2DWRA 2PHTA 1KJRA 2CTVA 3UJOA 1IKQA 1MS1A 1JXNA 1Z78A 4DFSA 3W58A 2EXIA 1GYKA 1CONA 1UZYA 2ZGOA 2JKBA 4P9YA 4FOVA 3ZSLA 3VUOA 1DFQA 1DQ6A 4XJUA 4GWMA 1LECA 4NO4A 4YG0A 1URXA 4I30A 1Q8OA 3OPZA 5GLTA 1MS4A 2ZHNA 1KITA 1DQ2A 5GZDA 5DXDA 2PHFA 1YO8A 4ZXKA 3PVOA 1S0JA 3NV3A 5H9SA 1QGLA 5H9PA 4GKXA 1G9BA 1NXD1 5HCBA 1QKQA 1VAMA 3M3OA 1CVNA 3O12A 2WSVA 4XJ9A 5H9RA 5DG1A 3APBA 4WV8A 2EXKA 4JRAA 1S0IA 3PMEA 3GNEA 1QNWA 2ZMKA 1CPNA 1WD3A 1G86A 4FQZA 1IS6A 2AREA 4XYXA 2D3RA 3RMXA 4BLJA 1WCSA 2DUOA 2SLIA 3SH5A 2D6PA 3O0XA 1UAIA 5T5OA 4P14A 1CQ9A 4FOQA 1GZ9A 2ZGUA 4XHXA 3SH4A 4Y20B 2V5YA 2VW0A 1AX1A 1LOGA 1RINA 3D6EA 2DVFA 4FPHA 3ZSKA 2DURA 3PVNA 1Q8VA 5SV8A 4FVVA 2WJSA 3IM0A 1A78A 3WDVA 2A3WA 5KXBA 4KBBA 3OBRA 5IUQA 1KJLA 3N7JA 5CB7A 1LESA 2E53A 3V0AB 3A0KA 5GLWA 1GICA 2NP0A 1LGBA 3FLTA 5IK5A 1GKBA 1V6LA 4M3CA 2JECA 1V6JA 4JC1A 1BKZA 2ZAAA 2FMDA 4Y26A 1W6QB 3LCPA 4LBQB 4XBLA 1S0FA 1ONAA 1APNA 2AR6A 5E88A 1N3PA 1QOTA 1JW6A 2D6LX 3IN9A 2W68A 4Y22A 5T5PA 3JUUA 2P3IA 4YZ2A 1LHWA 1D0HA 1O4ZA 3PJQA 4HANA 5JOXA 5GLUA 4ISQA 5JVVA 3V0BB 1IKPA 1LGNA 3WDUA 1EPWA 1MZ5A 3N35A 2CL2A 1LOEA 2GNTA 2JD4A 2LALA 1IS5A 1Y7BA 2TEPA 2ZHMA 2OUJA 5L73A 1BQPA 3I8TA 2GDFA 1H9PA 2R0FA 2CWMA 3BTAA 1OQ1A 4YZ3A 3RS6A 5KXDA 3POYA 3DGTA 1WW4A 2D3SA 1QMJA 2C5DA 2XG3A 3WNXA 2EAKA 1LU1A 2G4IA 3D5OA 3H0OA 3BIWE 5IK7A 3M3QA 1H9WA 5GLZA 4GKYA 1SLLA 4LBKA 5IK4A 2VU9A 1GANA 4K20A 2AUYA 4FPGA 5DZEA 4M3CE 2CYFA 1ZM1A 3T1MA 3ZXFA 5T52A 3B9CA 1OKQA 1WLWA 2WT2A 2DTWA 2ZZJA 2CWSA 2PHWA 3PVEA 3QLQA 4Z8BA 2I2SA 1LU2A 1QOOA 1SFYA 4IQPA 4XIKA 1DQ1A 1W6MA 2AYHA 2OVUA 1QNYA 1X50A 4XE9A 1W6NA 3ZYPA 4SLIA 1ZA4A 3MPPG 3WV6A 1RIRA 1AJOA 2DVDA 2ZGKA 4Y22B 3AJZA 1LTEA 2A6VA 2P3KA 3AXDA 1BXHA 3OBTA 3V64A 3ZYRA 1GSLA 4YM1A 1VAVA 3VKLA 3WDYA 2EALA 2EF6A 2A7AA 1HLCA 4LBJA 1RITA 3UL2A 2D44A 3ZXEA 4Q2FA 3POSA 1Q8PA 1W6PA 4LBNA 3AX4A 1AZDA 3V0AA 4AWDA 3VKNA 4AVTA 1G7YA 1ULFA 3KQRA 1LODA 4XILA 1G9AA 1LEDA 5DZGA 3LSDA 2DU0A 1TEIA 1H30A 3BODA 4XOGA 4C1XA 5DG2A 2ARXA 2RHPA 4DRVA 3SISA 1C4RA 2NMNA 3AFKA 5FREA 1LCLA 2PELA 4XXAA 5T5LA 1FX5A 1XQNA 3SNMA 2GMMA 2SBAA 1IS3A 2NYYA 4GXLA 3RRDA 3AZZA 1DYKA 4Y1UA
chains in the Genus database with same CATH superfamily
5A3OA 4U36A 2Y60A 4CDXA 1TVGA 1HN0A 1QOSA 4KMQA 4K9SA 5LRSA 4CCJA 3LSEA 1BHGA 1RUF1 1Q3EA 1MS5A 1SCSA 1UZVA 1ODNA 4ZS2A 5JIAA 4WM7A 3HT2A 1N1TA 1OC1A 1BK0A 1RUD2 5A33B 1W28A 2QZ2A 4MGTA 3H3LA 1I5PA 4XJ8A 4H55A 4AHZA 5C8WA 1OPOA 2JDYA 5F7UA 1U12A 1DGRN 1FYUA 4I0WB 3IB3A 4JKMA 3TN92 4AAPA 2Z4FA 2W39A 5GZGA 1VRBA 2XL9A 1R091 3GJBA 1H8TB 2JWPA 4R4XA 1RUH3 4QHBA 1MVEA 3SCFA 2O1QA 3KB5A 5B2GB 1ENSA 2FCVA 1EV12 2HWE1 2JB8A 4JTOA 2BQPA 1EY2A 2DFBA 1FV3A 3NRUA 4E27A 4P9IA 2CSGA 3K3OA 3DN7A 3VDAA 1FMD2 1ODMA 3MFCA 5F3IA 5C9AA 4QXBA 1EPZA 1PZ8A 4FPLA 3I2OA 3NWKA 1OI6A 2P37A 3QH6A 1R1A2 5SV5A 4CDWA 2HWC2 2EA7A 2R1DA 2WLQA 4MYEA 4IGOA 3RI8A 5FUNA 4KGGA 4IE6A 3LAGA 4QQ2A 2HWC3 4N9HA 4KWUA 2JKXA 2UYAA 5F5AA 5FYIA 3ACGA 3RSJA 4L8QA 4N53B 5F3GA 3RWNA 4NAOA 5ACA1 3ZYBA 3OUJA 4OMDA 4QXHA 5KHJA 4I02A 4HFSA 5FV3A 2GMEA 5FBJA 2VMIA 3GJAA 1UO9A 1UYXA 2VG9A 5A33A 2ZPXA 3K46A 3KT7A 1DLCA 1PX4A 4ES9A 1AR72 1ND3B 3MW4A 4CCNA 4PQ9A 2VTXA 5CYYA 4BWOA 4JDOA 4ZZ5A 2ENRA 2XKPA 1KGYA 3RZHA 2W5FA 1LOFC 1VAKA 2VUAA 3OPTA 5LA2A 1AR81 3S0MA 4FPOB 2XVGA 2PHRA 1VE0A 4MGYE 1CZSA 3WG1A 1QXPA 1N3OA 1STMA 2LRPA 2G1MA 4BDVB 5LK7B 5CKNA 4YGEA 2XQXA 2QE3A 2DCTA 3VBOB 5BNNC 1W6QA 1WLCA 1AXKA 1B09A 1CIWA 1EAH3 1FATA 1YYNA 5FZDA 4COVA 3KM5A 2BGPA 5F5IA 3WG2A 1W06A 3QBQA 2EIGA 4IETA 1F2NA 3HR9A 2ID4A 4QU2A 5J48A 1KFXL 5BV6A 1OLRA 4JGYA 4E4SA 5FRAA 3R0RA 2I45A 3DL3A 1IPJA 1Y4WA 3UGFA 2R1BA 3GCXA 1GOFA 3AYCA 1GZWA 1V70A 1W99A 1W9FA 1LHOA 3BU7A 4HLTA 4DEVA 4FPJA 4JCKA 5KXCA 2WZR1 2OUHA 3BGAA 3M7AA 3MF6A 1YFXA 4HSJA 4P9WA 5FKBA 1IQAA 4YW4A 3LE0A 1EAH1 4OUSA 4W6YA 4XUQA 2W08A 4D8MA 3BUCA 5F2WA 4FXKB 4RL7A 4Q0QA 2GALA 4ITCA 5C8CC 1YIPA 2JD9A 2R32A 4SBVA 1I3HA 2Q4SA 4CXWA 3CNAA 3MZHA 1RC6A 1O4YA 3USUB 5JXIA 2QFEA 5DUXA 2HEVF 2ZMNA 2ZX3A 3IAQA 3WG3A 3T08A 2XLAA 4IEYA 3K4AA 4OQ8A 2YUEA 3AP4A 1JMUB 2R041 2RS51 4AYUA 4CCMA 3UESA 2P6HA 4UW4A 3ASIA 1N1YA 1HRI1 1XE7A 1YXWA 2OPWA 3JCIA 1ZZCA 5D21A 1PO13 3AZVA 1QJY1 1U5XA 3UGGA 4TLGA 1DYPA 2X5IB 1QQP3 1MR5A 3OGJA 5A80A 5IT6A 5F37A 5F9TA 3AXEA 2GMPA 1F4AA 1OA2A 3F2ZA 4N43C 3EJKA 2K0GA 2I07B 2WWJA 2XWJB 3V65A 2YV8A 4NIIA 5CAZA 1WBFA 4BXSV 3PDQA 5K0UA 3WR0A 4TSVA 3AC0A 2XJVA 3SKJE 4W65A 3R4UA 1ZX5A 4M0NA 1PO11 3Q9OA 4DXTA 4PLNA 4FTSA 4IL7A 3VN4A 1JU4A 5FYVA 2MEV1 1JYXA 3G7DA 1UXZA 4DUXA 2ARBA 3M4FA 5L36A 1R081 3J26N 3IMNA 1H4HA 1VBA2 4XZUG 4AQ2A 4CP0A 3T4VA 5DN2A 2RDNA 1RXFA 2DCJA 1IS4A 4Y1XA 3Q8AA 5F3CA 1JYTA 2WIIB 2XMLA 1OH3A 1AVBA 1Q8QA 5LA9A 2ZXQA 2WUHA 1DQ5A 1WCUA 3ACLA 1S0GA 3KCYA 1D2SA 4ISRA 2HWB1 3PUSA 5LEKA 2B8MA 3IDBB 2VVEA 4FFIA 3AYAA 4FPFA 3J8F3 3M3CA 1RHI2 4MXWA 3FJSA 1LULA 4XHBA 4IGQA 2VCCA 2FZ2A 1PGL1 3TN93 3BTYA 4LE4A 5C4WA 1SG3A 3M70A 2ZACA 1WKYA 2Z42A 3WEZA 4AVCA 2WINB 5K4LA 4AVAA 3FL7A 3Q8EA 5C33A 2VO5A 2JE9A 3N7LA 4HKOA 1EV13 3WNKA 4LA3A 1LOCA 5LY1A 1VLNA 1PMIA 1ASJ1 1HRI2 5DDJ3 2EIBA 2B4KA 4CCCA 2D3PA 1SPPB 4QX0A 2P5BA 3POEA 2VZRA 2P1BA 1SLIA 4AI2A 4BQ2A 2IXKA 1QHDA 2ZEXA 4KG8A 5F5CA 1O91A 3EO6A 5FYUA 1OOPC 1CJPA 1UD1A 1MZEA 1ZZ7A 3VBSA 4AGRA 1UOFA 2JDHA 5LA1A 1Z0HA 4WVVA 2EXJA 2QQUA 4BMBA 4A4AA 3KGLA 2LM3A 3I2GA 2WNUC 4FCAA 4Q4Y2 2Q8CA 4A42A 1EV11 2R6QA 5FZBA 1QF3A 1S0DA 3DUIA 4O7XA 5EV7A 3RYRA 3WHTA 4I01A 1GNHA 4YYOA 4NIAA 1UKGA 4HSLA 2B7YA 3MUZ1 4I0AA 4XUOA 2WSUA 4CXXA 4LKSA 1REDA 3KCCA 3ZDSA 1AR73 4A3ZA 2IXCA 4A41A 2HWB3 4HMZA 2ZKLA 1W90A 3NVCA 1FPN2 2RS12 5F5QA 3S5AA 5AFBA 3J7HA 2IFRA 3H3UA 5LWBA 2HWB2 3H42B 5AVPA 1JZ8A 2IVIB 4P9LA 2GAUA 5FLIA 3ZFEB 2DVBA 1CAXA 1HB2A 1TG7A 2JDMA 2XL7A 3M1HA 1RUI3 5I8YA 3DYPA 3KV9A 2FDKA 1GWMA 2E51A 1BEV3 1GZCA 2C9AA 2RR11 4AFAA 4I3PA 4KU7A 2FD8A 5EXOA 4FFHA 4RQPC 5FY0A 3AM2A 5JSOA 3AP7A 1W2TA 2QQKA 4A7ZA 5IFTA 1C1FA 4AQSA 4G4FA 2XUMA 3R4SA 4BIFA 4ZXEA 3TB0A 1DZQA 5K0UC 4Q4V1 4CDUA 1WMXA 1DGWA 3DXUA 4M4RA 4RSUA 4C1WA 4Z1VA 2NN8A 3TEXA 1JZ5A 3NV2A 4YZ5A 2DCYA 1U0AA 4DEQA 1BBT3 1UL9A 2XBO3 3WHUA 5JMCA 3VHOA 1CAWA 5HXMA 1AUYA 2NQYA 4F83A 2VNOA 1D4M2 1RMU1 2XBO2 4H7MA 4PDWA 4UFKA 1KD7A 4ZU5A 5C3PA 3O1RA 1XE8A 4N9IA 4YW1A 1QJU2 5IFPA 3ZKYA 2PTMA 4WZFA 4OI4A 5C7GA 1KDKA 3C3VA 4A44A 2PHTA 1XRUA 3KQ4B 4COWA 5C5UA 2CTVA 2DFCA 3RVHA 3MIEA 1H4GA 5FYZA 2EXIA 5J98B 1GYKA 1CONA 3SEEA 3T0AA 4P9JA 3ZFFA 5G05L 5FYHA 2ARAA 4MHUA 1UYZA 4TTGA 2HWD2 4XJUA 4GWMA 4NO4A 2HWE3 4NAMA 3VDDB 3VD5A 4DO0A 5C4WC 5GZDA 1CAXB 4NHYA 2VNVA 5FFOC 4GWIA 3E6BA 2W91A 3T2QA 3VHRA 3VL8A 3U75A 1W8ZA 5A3UA 2WZR3 1QKQA 3M3OA 1JYVA 3EQEA 2WSVA 4LEJA 2BBVA 3CJIA 5FZ0A 3KMHA 4XCAA 4ASLA 2LW8A 1SFNA 4CEWA 4HKWA 1IS6A 1HV1A 1UU4A 2D3RA 2IUWA 2VNGA 4QPWA 3RMXA 2DUOA 1R1A1 3J4UH 4P5YA 4L92A 1H8TC 1UAIA 2ZEYA 4XFFA 1J84A 4LOSA 1CQ9A 2WO7A 5IAXA 2V4VA 3NSTA 5FZ6A 2C1FA 1LOGA 1WMEA 3AKTA 1F15A 2DVFA 4GD4A 2WJSA 4E4HA 3IM0A 3HEIA 5FLJA 5KXBA 1QJFA 4G3YC 3H8OA 2W1WA 5A6QA 4Y5Z0 3PIJA 4B4PA 3RZLA 3A0KA 5GLWA 5C8CB 1GICA 2VZ1A 1YWKA 1RHI3 2WAAA 3HJRA 4N53A 4C8DA 3KD4A 4BCUA 1V6JA 2ZAAA 4JHTA 4IEWA 4YVWA 2XWBB 4LBQB 3AKSA 4XW3A 2RV9A 3EMRA 1ZRDA 1APNA 4UOJA 4QDRA 1JZ6A 5J3UA 5E88A 2B9UA 3DYOA 5FMOL 2VOVA 3C7GA 1RUD1 2D6LX 3IN9A 1UX7A 3MO4A 5T5PA 2Q8OA 3KT4A 2Q8EA 5J09A 4KGQA 4RR3A 5IVFA 5JOXA 4CUGA 1J3QA 4AEDA 3N9LA 4AR2A 2OS2A 1RMU3 1EPWA 1MZ5A 5EP9A 2LALA 2W95A 1GOGA 2JD4A 4XPVA 5EFUA 1IS5A 2TEPA 3IMMA 2K46A 1D2QA 5EJ1B 3TRSB 3GXUA 4L0PA 1NA1A 2HEWF 1L7RA 4XAEA 4MX3A 1S4CA 2YGMA 1WW4A 1QMJA 2C5DA 4OCTA 2WNOA 1MQTA 5LB6A 2EAKA 5FXXA 2JIGA 2YPJA 1AR63 1JODA 3W9AA 1HIXA 4COUA 1AYM3 3KCXA 3BIWE 3MIFA 4HT1T 5GLZA 2AEYA 1VJ2A 1NCQB 4GKYA 1RB8G 1SLLA 3H9AA 1E5RA 4MVTA 3WF3A 3DXTA 3VZLA 4CDWB 2LUWA 2AUYA 2D98A 1GQPA 3AMMA 2WBKA 1ZM1A 1X8MA 1OKQA 1WLWA 2O14A 2WT2A 2ZZJA 2CWSA 2PHWA 3I3DA 3PURA 3KV5A 4NHKA 4RS5C 1W6MA 2AYHA 1JZ3A 1X50A 1NLRA 3D0JA 3DECA 1P8JA 1JYWA 3OBAA 1QJX1 1RIRA 2W9XA 4LO8A 4YSFA 2YYOA 4NN0A 2XVKA 5FMDA 1BEV2 1BVP1 2B42B 3I59A 3AL5A 1BXHA 1HRV3 3OBTA 4WBBA 3ZYRA 4AL9A 1XNKA 5HPOA 3ACFA 5JPNB 4CUCA 2JXAA 4LT5A 2CGPA 1JZ2A 2A7AA 1WMDA 1HLCA 1XNTA 3UL2A 1ZBE1 2E9QA 2QVSB 4R8HA 4AQ6A 1WCKA 2JB4A 1RVF3 5JIUA 2ORXA 1Q8PA 4AF9A 1RUC3 2DCKA 1RGSA 4MV2A 1AZDA 4N90A 4WM7C 4AVTA 5C3SA 4IEUA 4P02B 2YGLA 3ACIA 3KQRA 1LODA 4XUPA 3S57A 1OT5A 1IQDC 1LEDA 2VBBA 4IE7A 2OKXA 3ZN4A 1HQNA 3FHAA 3KVBA 3S7EA 2JG9B 2NLRA 1QWRA 4XOGA 5AFEA 1E5SA 3NQHA 1X9PA 4DRVA 2AZ5A 1ULOA 2BZDA 4H2AA 3KZ4C 4AOCA 4I2OA 1C28A 2GMMA 2J1RA 3RRDA 2X8KA 5L19A 1H1IA 1BMV1 4UFMA 5FUIA 5GLTA 1OHFA 1L3JA 5BNQA 2C26A 2LTNA 2HWD3 3R05A 1CIYA 1JU3A 1QY4A 2ZGMA 4UF0B 2D43A 1NY71 2FDJA 3N9OA 4UW6A 4XDQA 5D1IA 2W3JA 2C9KA 2VUJA 5B4XA 4AEKA 4PF5A 2QUOA 2VZPA 2YC4A 4HZFA 2JJ6A 3EXUA 1REFA 4XBNA 4XUTA 4AGVA 4HXCA 2NZ9A 1UU6A 2BJSA 2RM21 1KRIA 1Y3TA 3ZFEC 2V09A 4Q4W2 1QH6A 1A8MA 4Y24A 2X53S 3OY8A 1UZ0A 1O6UA 1ULDA 1ZZ6A 1T6BX 4P5HA 5FZMA 1WWYA 1SMVA 1YLLA 4KBZA 3FBMA 3NNLA 4ARXA 2JE8A 2WR9A 2MEV3 2YU1A 3RMYA 4XFAA 1V9U1 4WVWA 1HXS3 1Q8SA 1ULCA 2KA3A 4RGGA 3UV9A 2A73B 2YHJA 5J96B 1JH5A 3IDAA 1UY2A 5EJZB 5DAWA 2EXHA 3VDCA 4IV3C 3O0VA 2J42A 3VBRA 3E1F1 3CLPA 5FWEA 3ZXJA 1WGPA 1M06G 3PTRB 4QPGB 1N3QA 2WFPA 5ACA3 4AVSA 1NCRB 2GNDA 3A4UA 1UNBA 1DGWX 1LHVA 1PGSA 1RYYA 3U07A 1QJY2 3VKFC 3WINE 4GB31 2AEZA 4N8MA 2HWC1 1KXGA 3WT3A 5A3MA 1LOFA 4XQWA 1ULGA 4KG0A 3RFRA 4IEQA 1QQP1 2V4AA 2JDPA 1QJY3 1MZFA 1ZNPA 2JENA 5FTTC 4Q5OA 1C1LA 5F3EA 1O7FA 4CCOA 3MV11 2PFWA 2W1QA 1IPKA 1VALA 4FTEA 1J1TA 3OTFA 1LENA 1QDOA 4OMCA 1NUKA 2XJQA 5APAA 5EHDA 4Y3OA 4YW2A 5FZOA 4D69A 5JDBA 2BPA2 1JHNA 2D6MA 5FZHA 2E31A 3ZXDA 1UMIA 5FO8B 2BFUS 2K2SA 5BNOC 5IAVA 5A7NA 1U5ZA 2HKXA 4ZHNA 1BJQA 3JQXA 1DGRA 2FCTA 3WW1A 4JGZC 3FMGA 2XVLA 2WNEA 2ETEA 4KQ7A 1RUH1 1ENQA 4XQ4A 1RUD3 4XF9A 4D7SA 2PN5A 1D4M1 1RMU2 5ISLA 4AEDB 4NIDA 3AZYA 4FPKA 2EICA 3WNNA 5FQ0A 4F3JA 3DKWA 1PVXA 5BPXA 4BK4A 2D6KA 2ET7A 2YFUA 3N36A 4IW3A 1RHI1 2B45X 1AL21 2KD7A 4LKDA 4QM8A 4ES8A 4FFFA 4LE3A 4HONA 1B35C 1NE4A 1QJZA 5GZCA 3OSDA 1AR62 1RUH2 2WZ8A 1NT0A 4RA0A 1H1AA 5JMOA 2CU5A 2MHFA 4U2AA 1AYM2 1YQ6A 1W8WA 4Q29A 1BZWA 2I74A 1W03A 3LWCA 1VRH3 2A3XA 2ET1A 4XQDA 1DHKB 3DPRA 4ZPIA 5F39A 4QXKA 4NRMA 4QKNA 2P17A 1MS0A 2W92A 3CQOA 4OYUA 2BDRA 1FXZA 3LA3A 1VRH2 3RGBA 4BQXA 1UU5A 3CJXA 4B4RA 5CBLA 3AZXA 1QEXA 2QJVA 1IG0A 2WS93 4IE4A 3CL1A 5FP3A 2YB7A 2QQOA 1AXZA 1JYIA 1OUXA 5KHHA 2E26A 5CZKA 2A6YA 3HNYM 2JX9A 5JAXA 1PO21 3CBNA 4DOUA 2VY0A 4O61A 3ORJA 2J1UA 3THPA 2AENA 4AI0A 2Y6JA 2WQZC 2OYZA 3WCRA 3WDTA 4JV4A 3ZXKA 3OG2A 1CN1A 1C8M2 1MS9A 2WWSA 3ILFA 2WRAA 3LDBA 4PHZA 4DXRA 2Z69A 4EWAA 3V0BA 4QX3A 5FY7A 3I2FA 5IHRA 4BQ5A 4R9CA 3HQXA 3PUQA 5DUWA 4AEMA 5DAQA 4O65A 4ZU7A 1PVC2 2VECA 2BOIA 4YZ1A 4ET7A 1H6YA 3UK9A 1FAYA 1O5LA 2P3YA 2A3YA 4N7UA 2XKOA 1XU2A 3R4DB 1G8WA 2VPVA 1PVC3 4DMIA 2VTFA 4IE0A 3WF4A 2ZGPA 4DXZA 4M3CB 2Y26A 2F4PA 4MXVA 4NRPA 3AYEA 5JR2A 1WW6A 4LOTA 3ZFGC 1H8TA 1DBNA 1NLSA 1V6MA 2PHXA 3PIGA 1ASJ2 4LBQD 4D6QA 5D8AA 5LZ6A 1EAH2 2DDUA 3KHCA 3VKMA 2YC0A 1UN1A 3NAPB 2ARCA 3H1WA 1WA4A 2XONA 2VBDA 2ZA9A 5BXXA 1W9YA 1SACA 1W0NA 2Z5WA 4E2SA 4LBLA 4CDWC 1PGL2 4S2HA 2EIEA 4GALA 1H1MA 2FHRA 4Q4V3 1DZRA 4XETA 1H6XA 1JOBA 4N53C 5CG8A 1FOD1 4R9AA 4XC9A 3U37A 1PO23 2VE1A 2HLEA 2YMZA 2DU1A 2ADDA 1GNYA 2VW1A 4Q4V2 4RS5B 3VBSC 4QKDA 3WSOA 2DVGA 4P9GA 3LA7A 2Y34A 4AFCA 4Q4W3 2E7AA 5L7OB 4QM9A 1G9DA 3H1MA 3HQRA 1S2EA 4LR4A 1BK1A 1RXGA 2R061 3DKQA 3OYWB 4AEDC 4DS0A 1N1SA 1AYN2 1Q56A 5FZFA 5KR7A 2VR4A 3OY8B 1ND3A 2B9VA 4MO3M 4YGCA 4LO4B 2ILMA 4AQTA 1FOD2 4BXFA 4CP2A 3BIEA 1JOPA 3ZDVA 1PO12 5JLVA 2V72A 2X09A 3AFGA 4PBOA 4AHWA 1QIQA 4NHLA 1RUG2 2BVBA 4UFLA 3ZKUA 3PL0A 3BCWA 4CU7A 5HCAA 4WM7B 2IWGB 2WO2A 4DB5A 1OMIA 2Q1MA 3C8XA 2NM1A 4TZDA 3ZPOA 4D3WA 4YG3A 3WDXA 4LO6B 4K40A 4KWKA 4MZUA 2RJKA 2PLV2 3ES4A 1VIWB 2GNBA 2IXIA 3JBG3 2ZX1A 5LCWL 4JDNA 4QDSA 2E7TA 2VULA 4YM2A 1NQJA 1S2KA 1HX6A 2PLV3 3HOBA 3IPVA 2WC2A 3C7EA 3ALQA 3WNMA 1W6OA 3MHZA 2CV6A 5FJKA 1YFUA 1AL0G 3HN1A 4TXWA 1UMZA 5CKQA 5BYNA 4D6RA 3MIDA 3MIBA 3POWA 4HVRA 4NUBA 1CPMA 5HBAA 2ZEZA 1LEMA 2XGXA 4AE2A 2FCUA 4X6QB 1U5YA 5DAVA 2WO1A 4Q0SA 1YQCA 3VL9A 3SLIA 5AC92 1HJFA 1H2NA 2RDSA 1W8HA 4CRQA 3WLUA 2RMU3 1ZZBA 4NROA 3TWIA 5LY2A 4QX2A 4Y1ZA 1YHFA 3TN91 1OA3A 3GBWA 3ZXLA 2CNAA 2XBO1 3JD72 1IOAA 2VQUA 4CU6A 2L9LA 5ERLA 3WQ7A 4GZ9A 1ZRRA 3O1MA 3D4KA 2GC1A 2YG0A 3MGUA 4QB2A 4HETA 2NMOA 2Y0IA 4LHKA 4P9XA 4PI2A 1ACCA 4XIOA 1ENRA 4H7LA 1AYN1 4IV3B 2XHNA 4CDXC 3TEZA 4CE8A 1R64A 4S2GA 5DDJ2 1YRZA 1V6NA 2BWAA 3U4XA 1CD3G 2HWF1 3OGVA 1GLHA 2UWCA 2JG8C 2VOTA 5JXGA 3TEYA 1DGLA 1I5ZA 4LIUA 1CAWB 1VB4A 4YFWA 1VMFA 1W6NB 4AZZA 1CAUB 4KWJA 4UFHA 3OEAA 4J6GA 1NY72 4AHXA 3VV1A 4BISA 1O4TA 1AXYA 1TME1 4HK9A 4NPLA 3ZX7A 4BLIA 2DWRA 3SCGA 1KJRA 1XNAA 1IKQA 4XUNA 1JXNA 4KI5M 5FZ7A 1RUJ1 1UZYA 2ZX4A 2Q1ZB 4JKKA 2FBEA 5CKMA 3EHKA 2XOMA 3ZSLA 1H8VA 1L7QA 2DBNA 4YG0A 1URXA 3OPZA 4HOOA 1MS4A 3SQOA 1SQ4A 1DQ2A 1YUDA 1ZVFA 4KNCA 5DXDA 1XB9A 1HXS1 4ZXKA 3PU8A 4XF4A 5C9AC 4UBHA 5CFCB 1C5IA 4F8AA 2C6SA 1OPMA 1ZBA2 4IERA 1NXD1 5HCBA 5FIXA 2ZTNA 4MHRA 5H9RA 4XJ9A 5DG1A 1FMD1 2EXKA 1F5JA 3F95A 2CHHA 1LB2A 4BB3A 3IT8A 5KBFA 4E4DX 3RZMA 1WLTA 1ASJ3 2IZWA 2PAKA 3GNEA 5A1FA 1RUOA 3CMGA 4BJ0A 2WWUA 1WD3A 2X5IA 3BPSA 4XDOA 4L97A 4V2WA 2WZEA 4ASKA 3TYJA 1WCSA 2D6PA 4CSWA 3ZIXA 5A6YA 4P14A 4HVOA 3VBFB 2GP3A 3SH4A 2ZGUA 4XHXA 2WNUB 3JXSA 5A1LA 3D6EA 3HT1A 4RR3C 3ZSKA 4BQWA 3RYKA 1Q8VA 5SV8A 3QH7A 2VCMA 5E6HA 1YQ5A 4Q0UA 4QQPA 4XEZA 4A2UA 2XJRA 3AKPA 3OBRA 4AI3A 4RD7A 4CCLA 4IGPA 5JXJA 5JXHA 1D4M3 4Q4X3 1LESA 5CB7A 2E53A 3KGZA 1NCRC 3LGRA 4JQTA 3V0AB 2XLFA 5FY1A 5FXVA 3FZ3A 5DQ0A 1KEXA 2XPJA 3VBHC 1LGBA 1SZBA 4Q4X2 1RUF2 4EV0A 1GKBA 5IK5A 2J1VA 1JUHA 2VZQA 3ZYJB 1MQTC 3H8XA 2GP5A 3U11A 3LCPA 1OVSA 3I3BA 3MI8A 5FP7A 5A1AA 4XFHA 1XE0A 1PK6A 2Q1FA 4CDQA 4EWDA 4TN7A 2W68A 5F1RA 2X05A 2P3IA 3VHPA 4YZ2A 4CPBD 5BNOB 1LHWA 1TME3 4AFDA 4MXWB 3PJQA 4LJHA 2HWF2 3ZXGA 3V0BB 1IKPA 3P5BA 1HRV1 2OPKA 3RWKX 3N35A 4JGZB 2F6BA 4O9GA 2ZHMA 2WNVA 4BK5A 4EE2A 5CEHA 1BMV2 3T3YA 2Z79A 4RQPA 1QQP2 1PGW1 3FX3A 3I8TA 2IFWA 4QKBA 2GDFA 1HB1A 4CU9A 2CWMA 4YZ3A 3RS6A 3DGTA 5IATA 3POBA 3ZYHA 5FPXA 2ZS6B 1XJAA 3BU0A 1J3RA 1LU1A 4AG4A 3D5OA 2XDVA 2W0XA 1NA1B 3IZOA 4MGQA 3C7HA 3H0OA 3BYWA 3HVDA 1DG6A 3VZMA 4ZU4A 2PAEA 4BQ4A 3CO2A 1MQTB 1OSGA 1W39A 1OOPB 1W8FA 1Q43A 3QACA 1GANA 3ZYIB 4B1LA 5I0SA 5DZEA 3IWZA 4OHWA 3T0BA 3THCA 2CYFA 3ZXFA 5KWRA 1D0GA 2RMU1 5T52A 1K3IA 3N9QA 2DTWA 1TNFA 1HN1A 2I2SA 1LU2A 1QOOA 2GU9A 4L2NA 3THTA 1DQ1A 1RUE2 1UOGA 2OVUA 2RMU2 1IG3A 2RR13 4PDWB 1BEV1 4CEWC 4SLIA 1ZA4A 3MPBA 3JD73 2DVDA 2ZGKA 1PVC1 3POIA 1YNAA 3J8F2 3AJZA 1X8EA 4ZONA 3K75B 2PMWB 4AK3A 4E8CA 2X10A 5K8SA 2Y6KA 5CFCA 1W04A 3NNJA 1PHMA 3HAGA 4E2QA 1ZYBA 1VAVA 1VBE1 2EALA 5C3RA 3E6DA 2WN2A 2ZEWA 2RS33 2D44A 3ZXEA 1O3TA 3CIHA 4LKFA 4GH4B 1US3A 3ZFFC 5A7SA 1NLQA 4GH4A 2IXJA 4AWDA 4QHOA 1G7YA 1VMHA 1ULFA 4BHPA 3GCWA 4YW7A 3AVSA 1G9AA 4RQPB 4WVZA 1VBD1 4XFCA 3ZFEA 3GZAA 1XNBA 1J83A 3VB9A 3ZYFA 5C70A 2RJLA 1A34A 1QH7A 1DU3D 2DU0A 2KR2A 2B39A 3BODA 4RR3B 3RI9A 4NR1A 3DF0A 1POQA 5FPZA 5A6ZA 4MG2A 1UIKA 3FWEA 4QQLA 1NCRA 3CJIC 1SEFA 3OBZA 1CX4A 5FO7B 3AZZA 3BTZA 1DYKA 4XABA 1COV1 3B9IA 5T50A 2DUQA 4K21A 4LHLA 4CDUB 5DUUA 4FO9A 5J36A 2D5FA 3KF5A 4UI9L 4C91A 3SH3A 4CEYC 1BYHA 3B00A 4QAWA 2CAUA 5GLVA 1S0CA 5EYYA 5KHKA 3GBGA 5GZEA 2RDRA 4UW3A 2OA2A 3MFAA 5IYYA 3LZZA 3ZXAC 1ZBA3 3FE5A 1FPN3 1NZCA 3VKOA 5I0RA 4Q8LA 5DUVA 4YW6A 4PIZA 3CF6E 1Y43B 2VTXJ 2A5ZA 3OUHA 3OYWA 1UY3A 2ZKNA 3J8F1 4YM0A 3UGHA 2BP6A 4Q0PA 5LK5A 3VDDC 1GZTA 3CEWA 2DUPA 1GU3A 3JU9A 3PU3A 4WM8B 2BV4A 3UETA 4IUGA 4AFBA 5KHIA 3NV1A 2EIDA 4PBPA 4MLOA 1Y9GA 4OZXA 3S7IA 4XBQA 4EN6B 2VH9A 4YNIA 1CZTA 4Q4Y1 5FO9B 4CDXB 4QX1A 4FPEA 1RUC2 4JGZA 4BPZA 1UPSA 3CJIB 2FDIA 4PIYA 2R49A 3AP5A 2HH9A 3ILNA 2P6CA 4LLOA 4DZGA 2QDNA 2P3JA 3KT1A 4FPCA 2BGCA 3SITA 1LAJA 4BM8A 5FWJA 3Q8BA 4PT6A 3D0SA 4E8DA 1SLCA 4OUMA 1C8M1 1RUF3 2D93A 5T55A 1LGCA 3S5QA 2QDRA 4Z07A 2H0BA 2YROA 1COV3 1MPXA 2OW4A 1EP0A 5GM0A 1N1VA 2WFF1 2ZGRA 4CVUA 1RUG1 5DAPA 3DPRC 2VM9A 1COV2 5T54A 3ILRA 4UBGA 2PAMA 1AX0A 5AVAA 3UYJA 3I2DA 1UXXX 1DQ0A 3FFZA 5JSRA 4OHXA 5FP9A 3LFIA 5CFCC 3B5LB 1HV0A 5LA0A 1MVQA 2R062 2YPDA 4IEZA 2Z2SB 4YWAA 3PUHA 1SLBA 3MV01 4E2GA 2WABA 3ZPYA 1AF9A 1WA6X 3MEPA 1MZ6A 1DIWA 1Q5OA 2BNOA 3IIIA 4P00B 2QCSB 3RG0A 1JYCA 1UQXA 2H6CA 2OIIA 3O1UA 2VC9A 1RTVA 4X8PA 4S2DA 4GH4C 5DDJ1 3QD6A 1IZ3A 2YBKA 3A21A 2PHUA 4XTMA 2MEV2 1NX9A 1S2BA 3ZO0B 4FT8A 5FZ4A 5FPAA 2J7MA 4TYSA 5IVCA 3MUY1 3WDWA 4K8RB 3ZFGA 2VBPA 2G9FA 4JQRA 3VBFC 3OF1A 3T09A 3AKRA 3CU7A 3RNSA 3ST7A 1I9RA 5FZ1A 1NYWA 5DABA 1XBFA 2R16A 2J1EA 3GBFA 5ACA2 3ZM8A 4Y1VA 1T2XA 3O0WA 4BYYA 3X29B 2D97A 4HK8A 1VB2A 3NJYA 4AAXA 5JZGC 4DIQA 2GSYA 1RUE3 3WF0A 3WNPA 4XJWA 1A3KA 1UZWA 4LHSA 1JZ7A 5CG9A 3K48A 5G04L 5D8AC 3INAA 1GP6A 3LIHA 2WYFA 1BLZA 3FC0A 3D8CA 3GF6A 3VBRC 3AK0A 4FPYA 5JSPA 1Y9QA 4IEPA 1RUC1 1GNZA 1W6OB 4XXPA 2PYTA 2VJXA 2VMHA 4JGYB 1YC61 4YVSB 1ZBE3 1MEC1 3ZSMA 2O0OA 2ERFA 2D6NA 2RS32 1VP6A 3IKWA 1XNCA 2YBPA 3LOIA 3ETPA 2VW2A 2TNFA 3NL1A 4GULA 1J1LA 3BOWA 5CNAA 5E8AA 4QPIC 1HDKA 2R30A 4YZ4A 3C7OA 4GB33 1AX2A 1ND3C 3EYPA 4NWVA 4XFIA 3ZIWA 1ULPA 1AR91 5CIRA 5BUVA 4QB6A 2IXLA 4M3CF 1PNFA 2YXSA 1FNYA 3AJYA 3P1IA 5DMYA 2H6BA 3KVAA 4RHV1 1T6GC 1YIFA 1MEC2 1OLMA 2ZGSA 1KQRA 2FDHA 1HQLA 1OLME 4M00A 3LEIA 2ZGLA 1JOJA 1H2LA 5IVBA 3VD4A 4BQYA 1MEC3 4UFJA 3BOPA 3NAPC 1GFF2 3OUIA 4B8EA 2WNVB 4LA2A 5IVJA 1WLDA 3JB4C 5H9QA 1VBC3 2R0HA 4LTAA 4GQ7A 2UU8A 3I59B 1C57A 4GAZA 4E4ZA 5DZFA 4L99A 3UJQA 3MW3A 1DQ4A 1J58A 1VBC2 5CA6A 4DPNA 1PZ9A 3RZKA 2JG9C 2RM23 1VBB1 4GA9A 3PHMA 4ZS3A 1VPHA 1WW5A 4RYDA 3M3IA 2A6XA 1O3SA 2GNMA 1CJDA 2UURA 1C5HA 3ZVXA 3JQWA 1AR71 4FFGA 3LF7A 2GC3A 5F8PA 2ORZA 2LROA 4C0HA 1W2UA 3WCSA 3LDKA 1LKNA 3SEPA 3CZUA 2XJTA 5LBFA 1K5MB 3ABZA 3RDIA 3I3QA 2BRTA 3UKTA 1XC6A 5JWPA 2VOKA 4C90A 3RPQA 3BALA 3WF2A 5LBBA 1UF2C 1OQEA 1VBB2 4Q1RA 4YGDA 4K1YA 1U5IA 5HCHA 3K3NA 3OEBA 1SCRA 1JTZX 1POV3 1ZA7A 2UY9A 2BWCA 5TSWA 3ZFFB 2VD7A 3M2MA 1SBEA 3QOPA 4WM8A 2ZAHA 3WG4A 2JDZA 1MACA 3H8RA 4NMIA 2A71A 1E5HA 5FZ9A 3DEMA 3E6CC 3RQ0A 4F7ZA 4D6SA 2OXBA 1AR83 5CISA 1WD4A 1YQ8A 2AGSA 4Q27A 4OI0A 4JVAA 2ZHLA 3AB0A 5GZFA 3HN3A 4QGNA 4URAA 3CKHA 3L2HA 4A45A 4N43B 5DAXA 4UXAA 4JTNA 5CFDC 4QGMA 4AVVA 3AMHA 1KS5A 2ZBJA 2Y33A 1OD5A 1W9SA 3HPNA 1A6CA 3LIGA 1I1EA 4Q8KA 1IHMA 2GZWA 2J1TA 3AKQA 4QPGC 2KXLA 3UT0A 2WT0A 3DV8A 2QQMA 3N3HA 4XMAA 3MLJA 4XTPA 4HPKB 3VBOA 1S0BA 4OFGA 1W0OA 1MS3A 3L9JT 1ZZ9A 4I3GA 2RVAA 2Y6LA 1W8TA 2O8QA 1OXCA 3AZWA 4MSVA 3ZSEA 1QDCA 4OLLA 5C5TA 3KSCA 2ADEA 5HCFA 1S0EA 2MNGA 2QNKA 2VUCA 3I4IA 5D8AB 1W0PA 4Z82A 1VBE3 3AMNA 2G19A 3N7KA 4IE5A 5FYSA 1W3XA 1A8DA 4KU8A 1C3HA 4CP9B 2ZHKA 2WKKA 3FUQA 4GJZA 4R9DA 5JOZA 1ENXA 3NJZA 4MOAA 4R4ZA 4B4QA 5KC5A 5FPBA 4META 2XB6C 3BPZA 2IVJA 2ZGQA 1GR3A 1FV2A 2HYXA 2QZ3A 4QPIA 3VBUA 1JS9A 4PIXA 3B69A 2MPFA 4LKEA 3WUDA 4HVQA 5ABJB 5F32A 5A6XA 1SLAA 1G9FA 1K42A 1GQGA 4DY5A 1AYN3 2XJSA 2GN3A 4YLZA 1AYM1 1ND2C 5A3LA 1US2A 4JAAA 1FOD3 4YG6A 4I09A 1PK6B 4RGAA 4CDQB 4BMEA 3FLRA 5FKCA 3ZN5A 1V00A 4IV1A 4EN0A 5HV4A 4P08A 5A7OA 1RUG3 5E89A 2G9GA 4QQHA 3FUOA 2W87A 1F31A 2VMDA 4FOYA 3VD9A 4R9BA 4YFZA 1LOBA 3I2JA 2E63A 3JB8A 3MICA 5T3NA 3VZNA 2JE7A 5JI7A 1DLLA 2VGDA 2A6ZA 1PZ7A 5FZCA 3A0NA 3SHRA 4LO5B 1OD3A 3E97A 2Y0OA 3PUAA 4CCDA 1ZRCA 5E16A 1OA4A 3MW2A 4S2FA 1PGW2 1UW8A 2R7EB 2W52A 2CY6A 4EQVA 2H0VA 3UJOA 4Z92B 2BOJA 3MBWA 1YJLA 3POFA 1YFWA 1S55A 3D82A 3LKJA 3ON7A 4EJRA 2ZGOA 1UY0A 3DPRB 2JKBA 4P9YA 5I8SA 4FOVA 2RDQA 2YBSA 3W21A 4H3WA 4I30A 5L7OC 4KWLA 3NJXA 1RUE1 4NPMA 3Q8CA 4JKLA 1YO8A 2R073 4AI1A 3ECQA 1PK6C 2ZZQA 4CDQC 2XUEA 4RHV2 5H9SA 5FZAA 4GKXA 1G9BA 2R072 1VAMA 3ELNA 1CVNA 1TMF3 1K45A 1PM7A 2VCAA 4K6BA 5JPMB 1GQHA 1UWWA 2HJIA 1Y9MA 1XXNA 2AACA 1JI6A 2XQRA 4WV8A 4JRAA 1S0IA 3PMEA 2BGOA 1IGOA 4AHYA 1IPSA 2ZMKA 1Z7S1 4YARA 4FTBA 1G86A 1WCDJ 4FQZA 2BERA 4XYXA 4BLJA 4CCKA 5BNOA 2OQ7A 4LK6A 1RUNA 1NOVA 5T5OA 1PMHX 4O9EA 3O7OA 3NKTA 4FOQA 3THDA 3K77A 4Y20B 5JCTA 1RINA 4FPHA 3PVNA 2JICA 5A7PA 4LITA 3WDVA 3IDCB 2ZJCA 4Q4W1 3AL6A 2C0ZA 2IC1A 3I7DA 4BQ3A 2XJUA 2VZUA 4MGSA 3PLQA 3GM8A 1OFNA 5IVEA 3FLTA 3VBHB 4LQRA 3VZOA 1V6LA 3NO8A 4JC1A 1LR5A 2JIJA 1W6QB 4CPBA 4MGZE 3VBRB 4DUVA 1S0FA 2VZSA 1ONAA 3T2OA 4WVMB 1POV1 1N3PA 1NG0A 2IXHA 1QOTA 2WO3A 4Y22A 1XYNA 1C8M3 2D40A 3GZEA 3JUUA 4PJYA 4B29A 2WL1A 3WW3A 2ZCWA 4D94A 1D0HA 1O4ZA 5GLUA 4X6RB 4ISQA 5JVVA 1LGNA 4OI2A 3VBUB 1ND2A 1LOEA 2GNTA 4QPYA 1Y7BA 2OUJA 3B93A 2DF7A 1BQPA 1W2OA 4H14A 4MGKE 5FY9A 5A7WB 1AR82 1OURA 3HBZA 3JZVA 4EN9B 5C71A 2R0FA 4MADA 3BTAA 4NIGA 3LQCA 5KXDA 4E9KA 2VVFA 3IIAA 1O8PA 3PJYA 5E1RA 4QDQA 5FLHA 3NMBA 5FBZA 3G6JB 5I93A 3GHNA 4AI9A 1R082 4FAGA 5FOBB 5A7QA 5IK7A 3M3QA 1VBA3 1H9WA 3VZKA 4YRDA 4FSJA 2JDUA 2JG8A 3WW2A 3GZUC 4OVEA 5C6CA 2VQAA 3OD4A 3ES1A 2GH8A 2VU9A 1R083 4K20A 1W8NA 4FI9A 4QB1A 4ONUA 4M3CE 3MDPA 4AVBA 4EROA 3O1TA 3O1OA 2W94A 3I2HA 4EN7B 2VZOA 3POJA 2VQTA 3HBKA 4IQPA 1SFYA 4BE3A 1QNYA 4UAPA 1PO22 1VR3A 1W6NA 1X33A 2N7GA 2X5IC 2W1SA 3P3PA 5FY5A 3T2PA 5BNPC 1O3RA 3MPPG 1AJOA 2A1XA 2VMEA 4Y22B 5HI0A 1GP4A 4IDZA 3LPGA 5C9AB 5FZ8A 4B7KA 5J1XA 2EAAA 2A6VA 2V5DA 2RE9A 3V64A 4UT5A 4LO7A 1W8OA 3WW4A 1NCQA 3N9PA 3NJVA 1VRH1 2RS52 4YM1A 4L11A 2LS6A 3VKLA 3WDYA 1SDDB 2EF6A 2K9ZA 1HRI3 3UNPA 2VXJA 1EYBA 5FYCA 4B7EA 2G9ZA 2YFZA 4IEXA 3T4HB 2RS53 3A23A 2VZ3A 5FZGA 3AX4A 4V2VA 2Y64A 4LK7A 5C3OA 3VKNA 1SFPA 4Z2AA 4X8NA 5GKAC 2VZTA 3ZLIA 4XILA 4GWJA 5F6LB 3WX5A 5FZKA 2GC2A 5EPAA 3D3AA 5DZGA 4BIOA 3LSDA 3LB9A 1QJU1 2VUDA 1TEIA 3K4ZA 3GYDA 4K3UA 3J7MA 3FN9A 1W2NA 4LHNA 5DG2A 2RHPA 5LBCA 1GWKA 5A3TA 3SISA 2NPIA 3AFKA 4YPJA 2PELA 3JBG2 4RGKA 4XDPA 1FX5A 1X9TA 5T5LA 2VNRA 3KLSA 5BNPB 5CADA 1IS3A 2NYYA 4GXLA 1BCXA 3WNOA 2QQIA 4UYBA 3A22A 2JG8B 1XOYA 4LUKA 4Y1UA 3JD71 3ZN6A 2WNVC 2P2KA 4M01A 4CDUC 4L9BA 1LHUA 3ENRA 1PIV1 4DNYA 2DTYA 3VBHA 1F35A 2QTWB 2VOXA 3ROUA 3WQ1A 3ZYGA 1SDWA 1CESA 1LJ7A 4GIQA 4FP3A 4J25A 2CDOA 4LUMA 2B5HA 1UZZA 4W8JA 2WYSA 3W20A 3TNPB 1HQWA 1AJKA 3P3NA 4DQAA 1VMJA 5AC93 1E5IA 3NNFA 3GGLA 2YDEA 4GMP0 4HG6B 4V1PA 2VCBA 1RJ7A 4XJZA 4Q26A 1CAUA 4ATEA 4HKLA 4UW5A 1ZRIA 4XJAA 4WM8C 4QX5A 3WD5A 2PXJA 2RS11 5FPVA 4LPLA 2ES3A 4DUWA 3T30A 1JN2P 3MLKA 3RJ2X 3I97A 1R1ZA 3WQ0A 2PA7A 4AGGA 1OQDA 2UWBA 3DYMA 3LEGA 3VD7A 2A6WA 3U0ZA 2P34A 5ANNA 1SBDA 3OJBA 1ULEA 4D7TA 4D0QA 1J3PA 1XNDA 2PQSA 1CGPA 1EUUA 4XF0A 1KFUL 4QWNA 4IV1B 3V56A 1H2MA 3OD0A 4DRRA 2UYBA 1S1AA 1YFYA 2J1AA 4FAHA 4TWTA 3HIFA 1WMFA 1W8UA 5GALA 1XU1A 4CYDA 1RL3A 1NKGA 1OF4A 4Y4RA 4BA6A 5I8TA 4W50A 2FZ1A 3O5SA 4RN5A 4QD2A 1RJ8A 3VGIA 3GHMA 3W59A 3WVJA 3K51A 3QCWA 4Y33A 1J59A 4NWWA 2WA4A 3NW4A 4N7IA 1LHNA 3C2UA 1ZZ8A 3URFA 4FOWA 3R6SA 1CX1A 2Q30A 4Q4X1 3UKNA 2UWAA 3NKGA 5K0UB 1K5MA 2VOWA 3E5QA 3LDRA 3PUIA 5IVYA 3ZSJA 4ZKTB 4LORA 5FYTA 2JDKA 4BOWA 3NNMA 3WF1A 4BQ1A 2BNNA 2E6VA 2GC0A 3K4DA 5FY4A 2W46A 3DCQA 2VVDA 1POV0 4QQOA 4Z2WA 1F4HA 2Y38A 3HD8B 2E7QA 2P4EA 4RFRB 4XZPA 1PX3A 5EYXA 1RVF1 4OHYA 2TUNA 1F8VA 3WP4A 3N4MA 4Q1PA 5CU1A 4EYUA 4OQ9A 2PQQA 2XH6A 4K7JA 2Q5TA 3C7FA 4CUAA 5T5JA 5CVRA 1KDMA 3GALA 3Q8FA 4PLMA 3OGRA 3WY6A 3GZTB 4YVWB 3J7NA 2JDNA 4INDA 4ATFA 3B01A 5B4NA 1CAVA 4Y20A 5JOWA 3WOGA 1NA1C 5C4WB 5FYYA 4HN1A 5L9RA 4XURA 3BTXA 4B3NA 2DYCA 3MLLA 3FBYA 4DXSA 2GN7A 3I2KA 4IXLA 1HB3A 5JR7B 5LEJA 2BEOA 2J1SA 2YU2A 2WFF3 1AR92 3T1LA 2ZGNA 4CEYA 3OGGA 3T0DA 4XAAA 2WNUA 1XYOA 1PMJX 3PMSA 4UWDA 2WT1A 2B46X 4AFMA 1I6XA 1UYPA 4JGYC 3TEWA 2BVVA 2RS31 1V6KA 4COZA 3O1VA 1PM4A 5IK8A 2D6OX 4YVSA 2C24A 1X7NA 4XFGA 1YI9A 1D4VB 1LOAA 1M4WA 4PDWC 4CEWB 2R063 3T2TA 2JG9A 1V6IA 4QPIB 1DDLA 1O59A 1TME2 2PHLA 3H50A 1W05A 5FP4A 2HWF3 1FNZA 5L9BA 1UPIA 2PHDA 5EJ3A 3J9SA 4LIVA 4M0HA 1GV9A 1WBLA 3L2YA 3N7MA 1SHWB 5C8CA 3O1PA 4NRQA 5FZIA 4EZ4A 1K5JA 2QQVA 3LEMA 4XF3A 2O8OA 4Q4Y3 3OGSA 4YW3A 4A7KA 5ABJA 1V0AA 3GDBA 4FQ4A 2CDPA 4Y5TA 5FOJB 2HYKA 1W9TA 3H3ZA 3HWJA 4HBNA 3U78A 5A3NA 1GOHA 3LOBA 3O1SA 2DCZA 3VD3A 2Y6GA 5CFDA 2VXRA 4A6SA 5I91A 1DF0A 1WW7A 5GJ6A 5FXWA 4GWNA 2AH2A 2Q0AA 4CZSA 4YGBA 2HEYF 3PVBB 1DP0A 4BZ4A 1V9U2 2YY1A 4FP2A 3TAYA 4NE9A 3KV4A 5F2SA 4CA9A 4CTEA 5IW0A 2RS13 1F5FA 3HMYA 4N43A 3ZN6B 1V9U3 3W5NA 1NE6A 1CWPA 5LRRA 1QXRA 3ATGA 1OFSA 2VMCA 3P6BA 5M0TA 1CZVA 2Y6HA 1H2KA 3H7JA 3FHQA 4LBOA 1H0BA 2VAUA 2W47A 3IPVB 3CZJA 4XFBA 5A3WA 1HRV2 4JX0A 1RUI2 2QQNA 3BN6A 4Y1YA 3A7QA 5KXEA 1C8NA 3SKVA 4R52A 2RR12 1JYNA 1MS8A 1K5MC 4WVMA 4LBMA 1ALYA 4PCRA 4QHZA 3AYDA 4QX8A 4CEYB 4XCBA 4C0BA 3MIHA 4QGLA 1ZBE2 3OPWA 4ASMB 2XR4A 3FLPA 4XMIA 2ZMLA 2VMFA 3AP6A 5I0UA 3WUCA 2TBVA 1Z7S3 4NOTA 4QKFA 2HBUA 1SPPA 2BNMA 5A32B 3SXWA 3RZGA 4Q0VA 1JBCA 1VBD3 3B7MA 5FUPA 4GB32 1O3QA 1X36A 1BBT2 1Z7S2 1FT9A 2A75A 2WN3A 1YEWA 5HXVA 2D7FA 4TLFA 3WZ1A 1XSRA 1W6MB 3VHNA 4NHXA 1GZWB 2BFUL 1QJU3 2R071 1HKDA 4MGIE 2YC2A 3WP6A 3ZR5A 4MH0E 3VZJA 1DZTA 2QKDA 3ZFGB 4CU8A 4QU1A 2C4XA 1G9CA 2R042 3M3EA 4WZCA 3PTYA 2Q8DA 1GBGA 3BVCA 3FFQA 4KH9A 4LBQA 1N47A 1YI7A 2HBTA 3ZMNA 3HNBM 1E57A 4GJYA 1UX6A 2JDAA 4IV3A 5FCCA 3RZZA 3USUA 2HWE2 4G9SB 5JZGA 2OQ6A 5EWSA 1W9WA 4NVPA 2VQ0A 1UYYA 2Y6FA 3WNLA 1JZ4A 3UKVA 1OOPA 3CDZB 2WZR2 5FMCA 2WAOA 3POGA 1JUIA 4LMFA 1XPWA 1KS4A 2KM2A 1SLTA 4IEOA 4LULA 4YVSC 5FYBA 4NHMA 3NAPA 3VBSB 3ZR6A 2UY8A 3KV6A 1BBT1 1QJX3 2FQPA 2GH2A 4EZHA 1HXS2 2QBXA 4NIHA 5C3QA 3BKZA 3LD8A 1UOBA 3LFMA 2RG4A 3AP9A 3K2OA 1V6OA 1W6PB 2VZVA 5A32A 3OOXA 1TE1B 3TBDA 3B94A 2ZABA 1UY1A 4JZRA 5FZLA 5FK8A 3H7YA 5FMBA 1VBB3 3NV4A 4LLFA 4YW5A 1O8SA 2ZGTA 5A7WA 2DVAA 5BNNA 5FPUA 2DV9A 4FXGB 5I0TA 5K9YA 4YM3A 1RUJ3 2XLGA 1QU0A 1WZXA 2CGOA 4BU2A 1RUI1 1WCQA 2FMYA 3MF9A 4K1ZA 1OVPA 1REEA 5FP8A 5JOYA 1VBA1 3HNMA 4B1MA 1NAEA 1JHJA 2FDGA 4ORFA 4HL0A 1CR7A 1SBFA 2V73A 1CAVB 3U1XA 5BY5A 1F9KA 1GP5A 2YZ4A 2ZX2A 3B3QE 5KHGA 5LW9A 2A70A 3N9NA 1WUVA 3KHBA 4NPRA 4EWEA 3AVRA 2CAVA 3SMHA 3RYPA 2XHKA 3I3EA 1DCSA 2Y8KA 3IDEA 5FJHA 1MS1A 3VDDA 4PLOA 3WP5A 4A6OA 3ITQA 1Z78A 2WFF2 4DFSA 1AR93 2OX0A 3W58A 4URTA 2E32A 3CHXA 2FDFA 1L7LA 1QXJA 1OF3A 5FZ3A 3U10A 3VUOA 1DFQA 1DQ6A 2F4LA 1LECA 4OZOA 1Q8OA 4IEVA 2ZHNA 4MUVA 1KITA 4CCEA 3E5UA 3I54A 5JZGB 2PHFA 3PVOA 1S0JA 1VBE2 2BW8A 3I49A 2WQ8A 3N9MA 3NV3A 1QGLA 2WS91 5H9PA 5JI9A 2QQWA 3O12A 2WLPA 4XF1A 4GMP1 2OT7A 4ZZ8A 2VMGA 3APBA 3AMQA 3U14A 3VDBA 1W3VA 5EQUA 4OI1A 4A7YA 2F17A 4RS5A 4HN0A 1QNWA 3HQUA 3VBOC 5BNNB 1CPNA 1HW5A 3LEKA 3BI3A 1UY4A 4QT6A 1ST8A 2AREA 4PQQA 1TZOA 3SH5A 2SLIA 3I2IA 1X82A 3O0XA 2QQJA 1UIJA 1AL23 2DBIA 1DYOA 1GZ9A 2WQ4A 1HJGA 3NNGA 2WS92 2V5YA 2VW0A 1FMD3 1AX1A 4OULA 4COYA 5F6KA 5CFDB 5FZOB 4GMP3 5IVVA 2DURA 3S30A 3BB6A 4FVVA 1AL22 1A78A 2A3WA 3WP3A 2WDBA 3EB7A 4KBBA 1O5UA 3U4SA 5IUQA 1KJLA 1R1A3 3N7JA 4BH9A 5A3PA 1BVVA 2ZOEB 3EBRA 3JBG1 1ZREA 3M8LA 1OLQA 3H1YA 1GWLA 2NP0A 4CXYA 4W6XA 4A3XA 4M3CA 2JECA 4J1WA 1OBNA 5KC6A 1BKZA 5I0DA 1YQ2A 2BTVC 2FMDA 4Y26A 3TOJA 3RJRA 3S6PA 1TQ5A 4IV1C 4HPKA 5L9VA 4XBLA 1UMHA 4J1XA 3SCHA 4AI8A 1VBC1 5HV0A 5J7MA 2AR6A 5IJRA 2J22A 5BNPA 5LATA 5K7PA 5A70A 4CUBA 3VBFA 3H8UA 1JW6A 3MIGA 3AMPA 5FR3A 1PNGA 1NZIA 3PNAA 1AR61 1G6NA 1RVF2 4HANA 3ZOIA 4QPGA 1LRHA 2AC1A 3OCPA 3WDUA 5D2AA 1VBD2 2CL2A 3VBUC 4I0BA 4RFT0 4RHV3 3I3MA 5LBEA 1D7PM 5FAXA 5L73A 1TMF2 1XYPA 3E5XA 4OHVA 3TNQA 3KF3A 1H9PA 4CP9A 5ANQA 1OQ1A 1OKOA 3POYA 5DPNA 4AW7A 5IWFA 2QQLA 5FZEA 4AEJA 2D3SA 3B02A 5LASA 4OHZA 2XG3A 3WNXA 4QX7A 2X29A 3J7LA 4LNVA 2G4IA 3ME2A 3ACHA 2BU9A 3O14A 2XJPA 4UF0A 1AHSA 2ZX0A 2E33A 3IAPA 4QXCA 1NCQC 2R043 5FY8A 2D5HA 1LNSA 2RJ2A 4LBKA 5IK4A 4W6WA 1EUTA 4NJ4A 3RZJA 2BUKA 4DINB 4FPGA 5FDBA 4PI0A 5AC91 1NQDA 3T1MA 2VL4A 2BYVE 3B9CA 5J37A 4Z8BA 3PVEA 3QLQA 4YVWC 1HB4A 4JDMA 4XIKA 2RM22 1R093 4Y4YA 1OH4A 4XE9A 3FHIB 1PIV3 3ZYPA 1OUSA 2HWD1 1W2AX 3WV6A 3WXPA 1UCXA 1R092 3W5MA 1QJX2 2OZ6A 4KL1A 1QJEA 1PIV2 1FPN1 1LTEA 3USSA 1GMMA 2P3KA 4DY3A 3AXDA 1ZBA1 3ZMOA 4QMAA 3SC7X 4AXOA 2BBAA 2EVXA 2PLV1 4JHZA 1YCIA 3WQBA 1GSLA 2WZPP 4FBFA 1UKRA 4XACA 3VLBB 1TNRA 3MYXA 3ETQA 1RITA 1NXMA 4LBJA 4Q2FA 3POSA 4W4ZA 1B35A 5FPLA 1W6PA 3KS7A 1XSQA 4LBNA 3V0AA 4IESA 1RUJ2 4EN8B 1B35B 3OB8A 5FXZA 4Y5SA 2W1UA 4JRLA 5L7OA 5ABJC 1TMF1 1YJKA 4LXLA 3KWVA 2QQPA 5FMOS 1K12A 4M4PA 2WA3A 1ND2B 1GUIA 1ZRFA 5FYMA 3IBMA 5EZWA 1H30A 2JEMA 4C1XA 3LA2A 3LPFA 1FI2A 2W2IA 2ARXA 5EIYB 2ATFA 4D7YA 4CP1A 1C4RA 2NMNA 4XVHA 5FREA 1LCLA 4XXAA 5FQ0B 2OZJA 4K8FA 1XQNA 4PF1A 2SBAA 1UOJA 3SNMA 5FK7A 4ZY9A 2XXZA 2CGNA 4UFIA 4ARYA 5JUVA 4OUEA
chains in the Genus database with same CATH topology
4U36A 4CDXA 5LRSA 1QOSA 4K9SA 3LSEA 1RUF1 1Q3EA 1MS5A 1SCSA 5JIAA 4WM7A 3HT2A 1N1TA 5A33B 1RUD2 2QZ2A 4XJ8A 4H55A 4AHZA 5C8WA 1OPOA 1U12A 1DGRN 1FYUA 4I0WB 3TN92 2W39A 5GZGA 2XL9A 1R091 1H8TB 4R4XA 1RUH3 4QHBA 1MVEA 3SCFA 2O1QA 3KB5A 5B2GB 1ENSA 1EV12 2HWE1 4JTOA 2BQPA 1EY2A 2DFBA 1FV3A 4E27A 4P9IA 3DN7A 1FMD2 3MFCA 5C9AA 1EPZA 1PZ8A 4FPLA 3NWKA 1OI6A 2P37A 3QH6A 1R1A2 5SV5A 4CDWA 2HWC2 2EA7A 2R1DA 2WLQA 4MYEA 3RI8A 4KGGA 3LAGA 4QQ2A 2HWC3 4N9HA 2UYAA 3RSJA 4L8QA 4N53B 3RWNA 5ACA1 5KHJA 4I02A 4HFSA 2GMEA 2VMIA 5A33A 2VG9A 2ZPXA 3KT7A 4ES9A 1AR72 1ND3B 3MW4A 4PQ9A 4BWOA 4JDOA 2ENRA 2XKPA 1LOFC 1VAKA 2VUAA 1AR81 3S0MA 4FPOB 2XVGA 2PHRA 4MGYE 3WG1A 1QXPA 1N3OA 5LK7B 4YGEA 2QE3A 2DCTA 3VBOB 5BNNC 1W6QA 1WLCA 1AXKA 1B09A 1CIWA 1EAH3 1FATA 1YYNA 4COVA 3KM5A 3QBQA 4IETA 2EIGA 5J48A 1F2NA 3HR9A 4QU2A 1KFXL 5BV6A 1OLRA 4JGYA 4E4SA 5FRAA 3R0RA 2I45A 3DL3A 1IPJA 2R1BA 3AYCA 1GZWA 1V70A 1LHOA 3BU7A 4HLTA 4FPJA 4JCKA 5KXCA 2WZR1 2OUHA 3MF6A 3M7AA 4HSJA 1YFXA 4P9WA 1IQAA 4YW4A 1EAH1 4OUSA 4W6YA 2W08A 4FXKB 4RL7A 4Q0QA 2GALA 4ITCA 5C8CC 1YIPA 2R32A 4SBVA 1I3HA 2Q4SA 3MZHA 3CNAA 1RC6A 1O4YA 3USUB 2QFEA 5DUXA 2HEVF 2ZMNA 2ZX3A 3WG3A 2XLAA 4IEYA 2YUEA 3AP4A 2RS51 2R041 4AYUA 4UW4A 3ASIA 1N1YA 1HRI1 1XE7A 1YXWA 3JCIA 1ZZCA 1PO13 3AZVA 1QJY1 1U5XA 1DYPA 2X5IB 1QQP3 1MR5A 3OGJA 5IT6A 5F9TA 3AXEA 2GMPA 1OA2A 4N43C 3EJKA 2K0GA 2I07B 2XWJB 3V65A 2YV8A 5CAZA 1WBFA 3WR0A 5K0UA 4TSVA 2XJVA 4W65A 3R4UA 1ZX5A 4M0NA 1PO11 3Q9OA 4PLNA 4FTSA 4IL7A 3VN4A 2MEV1 3G7DA 2ARBA 3M4FA 5L36A 1R081 3J26N 3IMNA 1H4HA 1VBA2 4AQ2A 4CP0A 2DCJA 1IS4A 4Y1XA 2WIIB 1AVBA 1Q8QA 1DQ5A 3KCYA 3ACLA 1S0GA 1D2SA 4ISRA 2HWB1 5LEKA 2B8MA 3IDBB 2VVEA 4FPFA 3AYAA 3J8F3 3M3CA 1RHI2 4MXWA 3FJSA 1LULA 4XHBA 2FZ2A 1PGL1 3TN93 4LE4A 5C4WA 3M70A 2ZACA 2Z42A 4AVCA 2WINB 4AVAA 5C33A 2JE9A 3N7LA 4HKOA 1EV13 4LA3A 1LOCA 1VLNA 1PMIA 1ASJ1 1HRI2 5DDJ3 2D3PA 1SLIA 4AI2A 2IXKA 1QHDA 3ZSEA 4KG8A 1O91A 3EO6A 1OOPC 1CJPA 1UD1A 1MZEA 1ZZ7A 3VBSA 4AGRA 1Z0HA 4WVVA 2EXJA 4BMBA 3KGLA 2LM3A 2WNUC 4FCAA 4Q4Y2 1EV11 2R6QA 1QF3A 1S0DA 3DUIA 5EV7A 3RYRA 3WHTA 4I01A 1GNHA 4YYOA 1UKGA 4HSLA 2B7YA 4I0AA 2WSUA 1REDA 3KCCA 3ZDSA 1AR73 2IXCA 2HWB3 4HMZA 2ZKLA 3NVCA 1FPN2 2RS12 5F5QA 5AFBA 2IFRA 3H3UA 2HWB2 5AVPA 4P9LA 2GAUA 5FLIA 3ZFEB 2DVBA 1CAXA 2XL7A 3M1HA 1RUI3 5I8YA 2E51A 1BEV3 1GZCA 2C9AA 2RR11 4AFAA 4I3PA 4KU7A 5EXOA 4RQPC 3AM2A 5JSOA 3AP7A 4A7ZA 1C1FA 4AQSA 4G4FA 2XUMA 3R4SA 4BIFA 3TB0A 1DZQA 5K0UC 4Q4V1 4CDUA 4RSUA 1DGWA 4C1WA 4Z1VA 2NN8A 3NV2A 4YZ5A 2DCYA 1U0AA 1BBT3 1UL9A 2XBO3 3WHUA 5JMCA 3VHOA 1CAWA 1AUYA 2NQYA 4F83A 2VNOA 1D4M2 1RMU1 2XBO2 4H7MA 4PDWA 1KD7A 4ZU5A 1XE8A 4N9IA 4YW1A 1QJU2 2PTMA 4WZFA 4OI4A 1KDKA 3C3VA 4COWA 2PHTA 1XRUA 2CTVA 2DFCA 3MIEA 1H4GA 2EXIA 5J98B 1GYKA 1CONA 4P9JA 3ZFFA 2HWD2 4XJUA 4GWMA 4NO4A 2HWE3 3VDDB 5C4WC 5GZDA 1CAXB 5FFOC 3E6BA 3VL8A 3VHRA 2WZR3 1QKQA 3M3OA 3EQEA 2WSVA 4LEJA 2BBVA 3CJIA 3KMHA 4ASLA 1SFNA 4CEWA 4HKWA 1IS6A 1HV1A 1UU4A 2D3RA 3RMXA 2VNGA 2DUOA 1R1A1 3J4UH 4L92A 1H8TC 1UAIA 4XFFA 1CQ9A 3NSTA 2C1FA 1LOGA 1WMEA 3AKTA 2DVFA 2WJSA 3IM0A 5FLJA 5KXBA 4G3YC 4Y5Z0 4B4PA 3A0KA 5GLWA 5C8CB 1GICA 1YWKA 1RHI3 4N53A 3KD4A 4BCUA 1V6JA 2ZAAA 4IEWA 4YVWA 2XWBB 4LBQB 3AKSA 4XW3A 1ZRDA 1APNA 5J3UA 5E88A 2B9UA 5FMOL 2VOVA 3IN9A 1RUD1 2D6LX 5T5PA 2Q8OA 3KT4A 5J09A 4KGQA 4RR3A 5JOXA 1J3QA 4AEDA 1RMU3 1EPWA 1MZ5A 2LALA 4XPVA 2JD4A 5EFUA 1IS5A 2TEPA 1D2QA 3TRSB 1NA1A 2HEWF 4MX3A 2YGMA 1WW4A 1QMJA 2C5DA 1MQTA 2EAKA 2YPJA 1AR63 3W9AA 1HIXA 4COUA 1AYM3 3KCXA 3BIWE 3MIFA 4HT1T 5GLZA 1VJ2A 1NCQB 4GKYA 1RB8G 1SLLA 3H9AA 4MVTA 3VZLA 4CDWB 2LUWA 2AUYA 2D98A 3AMMA 1ZM1A 1X8MA 1OKQA 1WLWA 2WT2A 2ZZJA 2CWSA 2PHWA 4NHKA 4RS5C 1W6MA 2AYHA 1X50A 1NLRA 3D0JA 1QJX1 1RIRA 4LO8A 4YSFA 2YYOA 4NN0A 2XVKA 1BEV2 1BVP1 2B42B 3I59A 1BXHA 1HRV3 3OBTA 4WBBA 3ZYRA 1XNKA 4LT5A 5JPNB 2JXAA 2CGPA 2A7AA 1WMDA 1HLCA 3UL2A 1ZBE1 2E9QA 2QVSB 4R8HA 4AQ6A 1WCKA 5JIUA 1RVF3 1Q8PA 4AF9A 1RUC3 2DCKA 1RGSA 4MV2A 1AZDA 4N90A 4WM7C 4AVTA 4IEUA 2YGLA 3KQRA 1LODA 1LEDA 3ZN4A 1HQNA 3S7EA 2JG9B 2NLRA 1QWRA 4XOGA 5AFEA 4DRVA 2AZ5A 3KZ4C 4I2OA 1C28A 2GMMA 3RRDA 2X8KA 1H1IA 1BMV1 5BNQA 5GLTA 1OHFA 1L3JA 2LTNA 2HWD3 3R05A 1QY4A 2ZGMA 2D43A 1NY71 4UW6A 4XDQA 5D1IA 2VUJA 4AEKA 4PF5A 2QUOA 4HZFA 2JJ6A 3EXUA 1REFA 4XBNA 4AGVA 2NZ9A 1UU6A 2RM21 1KRIA 1Y3TA 3ZFEC 2V09A 4Q4W2 1QH6A 1A8MA 4Y24A 2X53S 3OY8A 1ULDA 1ZZ6A 4P5HA 1SMVA 1YLLA 3FBMA 2MEV3 3RMYA 4XFAA 1V9U1 4WVWA 1HXS3 1Q8SA 1ULCA 2KA3A 4RGGA 3UV9A 2A73B 2YHJA 5J96B 1JH5A 2EXHA 4IV3C 3O0VA 3VBRA 3CLPA 3ZXJA 1WGPA 1M06G 4QPGB 1N3QA 2WFPA 5ACA3 4AVSA 1NCRB 2GNDA 3A4UA 1DGWX 1LHVA 1PGSA 3U07A 3VKFC 1QJY2 3WINE 4GB31 5A3MA 2HWC1 1KXGA 3WT3A 1LOFA 4XQWA 1ULGA 4KG0A 4IEQA 1QQP1 1QJY3 1MZFA 1ZNPA 2JENA 5FTTC 1C1LA 1O7FA 2PFWA 1IPKA 1VALA 4FTEA 1J1TA 3OTFA 1LENA 1QDOA 4YW2A 4D69A 2XJQA 5JDBA 2BPA2 1JHNA 2D6MA 3ZXDA 5FO8B 2BFUS 2K2SA 5BNOC 1U5ZA 2HKXA 1BJQA 3JQXA 1DGRA 3WW1A 4JGZC 3FMGA 2XVLA 2WNEA 2ETEA 4KQ7A 1RUH1 1ENQA 4XQ4A 1RUD3 4XF9A 4D7SA 2PN5A 1D4M1 1RMU2 4AEDB 3AZYA 4FPKA 5FQ0A 4F3JA 3DKWA 1PVXA 5BPXA 2D6KA 2ET7A 3N36A 1RHI1 2B45X 1AL21 4QM8A 4ES8A 4LE3A 5GZCA 1B35C 1NE4A 1QJZA 1AR62 1RUH2 4RA0A 1H1AA 2MHFA 4U2AA 1AYM2 4Q29A 1BZWA 2I74A 3SXWA 3LWCA 1VRH3 2A3XA 2ET1A 4XQDA 1DHKB 3DPRA 4QXKA 2P17A 1MS0A 1FXZA 3LA3A 1VRH2 1UU5A 3CJXA 4B4RA 5CBLA 3AZXA 2QJVA 2WS93 3CL1A 1AXZA 1JYIA 5KHHA 2A6YA 2JX9A 5JAXA 1PO21 4DOUA 2VY0A 3THPA 2AENA 4AI0A 2OYZA 2WQZC 3WCRA 3WDTA 4JV4A 3ZXKA 1CN1A 1C8M2 1MS9A 2WWSA 3ILFA 4EWAA 2Z69A 3V0BA 4R9CA 3HQXA 5DUWA 4AEMA 4ZU7A 1PVC2 2VECA 4YZ1A 3UK9A 1FAYA 1O5LA 4N7UA 2A3YA 2XKOA 1XU2A 3R4DB 1G8WA 2VPVA 1PVC3 4DMIA 2ZGPA 4DXZA 4M3CB 2Y26A 2F4PA 4MXVA 3AYEA 1WW6A 3ZFGC 1H8TA 1DBNA 1NLSA 1V6MA 2PHXA 4LBQD 1ASJ2 5D8AA 1EAH2 3VKMA 2YC0A 1UN1A 3NAPB 3H1WA 1WA4A 2ZA9A 5BXXA 4E2SA 1SACA 2Z5WA 4LBLA 4CDWC 1PGL2 4S2HA 4GALA 1H1MA 2FHRA 4Q4V3 1DZRA 4XETA 4N53C 5CG8A 1FOD1 4R9AA 1PO23 2YMZA 2DU1A 2VW1A 4Q4V2 4RS5B 3VBSC 2DVGA 4P9GA 3LA7A 4AFCA 4Q4W3 2E7AA 5L7OB 4QM9A 1G9DA 3H1MA 4LR4A 1BK1A 2R061 3OYWB 4AEDC 4DS0A 1N1SA 1AYN2 1Q56A 4YGCA 3OY8B 1ND3A 4AQTA 4LO4B 2ILMA 4CP2A 1FOD2 1PO12 5JLVA 3AFGA 4PBOA 4AHWA 4NHLA 1RUG2 2BVBA 3BCWA 5HCAA 4WM7B 2IWGB 1OMIA 2Q1MA 2NM1A 4TZDA 4D3WA 4YG3A 3WDXA 4LO6B 4K40A 4KWKA 4MZUA 2RJKA 2PLV2 3ES4A 1VIWB 2GNBA 2IXIA 3JBG3 2ZX1A 4JDNA 2E7TA 2VULA 4YM2A 1NQJA 1S2KA 1HX6A 2PLV3 3IPVA 2WC2A 3ALQA 1W6OA 2CV6A 1YFUA 1AL0G 3HN1A 1UMZA 5BYNA 3MIDA 3MIBA 3POWA 4HVRA 1CPMA 5HBAA 1LEMA 2XGXA 4AE2A 4X6QB 1U5YA 4Q0SA 3VL9A 3SLIA 5AC92 1H2NA 4CRQA 3WLUA 2RMU3 1ZZBA 3TWIA 4Y1ZA 1YHFA 3TN91 1OA3A 3GBWA 3ZXLA 2CNAA 2XBO1 3JD72 1IOAA 3WQ7A 1ZRRA 3D4KA 2GC1A 3MGUA 4HETA 2NMOA 2Y0IA 4LHKA 4P9XA 4XIOA 1ENRA 4H7LA 1AYN1 4IV3B 4CDXC 4S2GA 5DDJ2 1YRZA 1V6NA 2BWAA 3U4XA 1CD3G 2HWF1 1GLHA 2UWCA 2JG8C 1DGLA 1I5ZA 1CAWB 1VB4A 4YFWA 1W6NB 1CAUB 4KWJA 4J6GA 1NY72 4AHXA 3VV1A 1O4TA 1AXYA 1TME1 4HK9A 3ZX7A 4BLIA 2DWRA 3SCGA 1KJRA 1IKQA 1JXNA 1RUJ1 1UZYA 2ZX4A 2Q1ZB 2FBEA 3EHKA 3ZSLA 1H8VA 4YG0A 1URXA 3OPZA 1MS4A 1SQ4A 1DQ2A 1YUDA 1ZVFA 4KNCA 5DXDA 1HXS1 4ZXKA 4XF4A 5C9AC 4UBHA 5CFCB 1C5IA 4F8AA 1OPMA 1ZBA2 4IERA 1NXD1 5HCBA 2ZTNA 5H9RA 4XJ9A 5DG1A 1FMD1 2EXKA 1F5JA 1LB2A 3IT8A 5KBFA 4E4DX 1RUOA 1WLTA 1ASJ3 2IZWA 2PAKA 3GNEA 1WD3A 2X5IA 4L97A 3TYJA 1WCSA 2D6PA 3ZIXA 4P14A 4HVOA 3VBFB 3SH4A 2ZGUA 4XHXA 2WNUB 3D6EA 3HT1A 4RR3C 3ZSKA 3RYKA 1Q8VA 5SV8A 3QH7A 4BHPA 4QQPA 4Q0UA 4XEZA 4A2UA 2XJRA 3AKPA 3OBRA 4AI3A 4RD7A 1D4M3 4Q4X3 1LESA 5CB7A 2E53A 3KGZA 1NCRC 3LGRA 3V0AB 2XLFA 3FZ3A 2XPJA 3VBHC 1LGBA 4Q4X2 4EV0A 1RUF2 5IK5A 1GKBA 1JUHA 3ZYJB 1MQTC 3U11A 3LCPA 3MI8A 4XFHA 1PK6A 4CDQA 4EWDA 2W68A 5F1RA 5BNOB 2P3IA