4GL6A

Crystal structure of a duf5037 family protein (rumgna_01148) from ruminococcus gnavus atcc 29149 at 2.55 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
EISIKIETYLQEEYGEEFEVLSWNQPKLLPSDNGAIYATCISKNDPKHPFEGSYFNPEEPNSEIEIIYDGYGQRLLAKQMESMIEEAISQAAENYYIQGDIIIPEEWQDIPVEEISQWKNYVDLCNQSNSDYKTLGSAWVYIDASTMKGKTDEEEYQMYEEVYRDKLGGQALLYVYYLDHKSFEKAEKILEIFTSGDEGSNFEDIIEGQPYFGTIMRYGSDKFDDNLEIFKAAKQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (RUMGNA_01148) from Ruminococcus gnavus ATCC 29149 at 2.55 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
total genus 68
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16440 DUF5037 Domain of unknown function (DUF5037)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.80 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4gl6A02
3.10.450.570 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4gl6A01
4GL6A
chains in the Genus database with same CATH superfamily
1EUIC 3MKIA 1T2HA 1K20A 2CFLA 1A2KA 2F5MA 1I2GA 3EB8A 2XF3A 3ROBA 2RGQA 3D5IA 2V1LA 4HZ9B 3WOFB 3EQQB 2FXTA 3S5CA 3OX9A 2XGLA 4HM2B 5M18A 1B2MA 1VQ63 3HIGA 3ECFA 4FR9A 3WR2A 3X42A 2Z6BA 1GY6A 4MMZB 4JF8A 2GBWB 2Z7AA 1LQMB 1EEJA 2ML6A 2KAAA 1YGEA 2KF3A 2W6JH 3A5EA 3F8XA 3FG1A 3CD63 3AGOA 2MF7A 3G7KA 1O7HB 4X2HA 1YJ93 5G1LA 3F9SA 2K0MA 3RGAA 1XUBA 1M1XB 1K28A 1LOVA 1BANA 3SEDA 3D79A 3KZTA 1W7CA 1I0XA 1GY5A 2CC3A 4AKZA 1QAFA 1Q42A 1MOLA 3PYJA 1MWTA 4KFDA 5AIIA 3D5GA 5KP4A 3PS8A 3KFQC 1UUVB 1K8A4 1YJN3 2L1SA 5CK6A 3WHOA 3CCR3 4J9AA 4K90B 2CFKA 1BRSA 3AGNA 3X3XA 3CPOA 1IQ8A 4XBYA 1BNIA 4IT7A 3NQZA 2WOFA 1VZZA 4BTXA 1Q7Y4 2FNQA 5H2GA 2F98A 4H3UA 1LOYA 3GAXA 2GKEA 1GY7A 3HK4A 1UCIA 1IR6A 1OH0A 1UGIA 1L5GB 3VSYA 1WPPA 1EG9B 2E2UA 3K9MC 4GSPA 1B20A 4J5GA 4X2OA 1JKGB 2OCTA 4OA3A 1BRIA 3K7CA 4KVHA 3OWSA 2H0IA 1WTHA 4I5QA 1FZUA 2QB6A 1QYAA 3EN1B 2W9PA 5CF2A 1JV2B 1QY9A 2F99A 1MWRA 1W02A 4WFOA 1M904 4TX4A 1J2BA 1LVNA 4PEJA 5G1KA 3WMDA 4AEQA 1YM5A 3KCHA 1JN5A 1RGHA 2CH9A 3J7Yd 1CH0A 1OF5A 1DMMA 1WQLB 1BUQA 1Q9EA 1IDPA 1RGCA 2AZPA 1BVIA 6STDA 1ROAA 1B3SA 3NV0B 1GMRA 5IENA 1I74A 2ZA4A 3PCRA 2BIRA 2BHMA 2BMQB 1BAOA 1IVXA 3PZWA 1X1YA 3NUVA 1A67A 3MPHA 2D1WA 1ZGXA 3Q90A 4HKVB 2BO9B 4FMBA 3BIRA 1QJGA 1JZOA 4JCIA 2CFGA 1YHQ3 3NQYA 5FGOA 1RMSA 1GQZA 3BB9A 1IT8A 1W00A 1BUJA 3X3ZA 4LGQA 5G2GA 3LOYA 3LTCA 2KW7A 1RNTA 3BNCA 6GSPA 3DH2A 1UDII 1FGMA 1LQGC 1BRHA 1I0VA 1I70A 1EKMA 2YFIB 5IG3A 1SDJA 1AVKA 3EX9A 2IY2A 1U1VA 4ZM8A 3SVAA 2PVZA 4MJDA 1HU9A 3B8LA 3UB1A 1W2B2 3JVCA 2OOVC 2HMMB 3G4S3 2LQVA 4DUNA 4N6V0 5STDA 2GXFA 3CCJ3 2KF4A 4WP5A 2K54A 1MWUA 1QMAA 1U1XA 2GEYA 2OTL3 1O7GB 2QB7A 1BWZA 4IK0A 1BSEA 1RGLA 3CC43 5LC6A 5DRVA 3SLUA 3WOEB 2LT2A 5IEPA 3CPW2 7GSPA 1O7MB 3SYUA 1RN1A 3T0UA 2Q9JA 3AHSA 3EDNA 1UGHI 4RBNA 2ZL8A 1GOYA 1TRPA 2OQEC 4K7XA 5A0OB 1LNIA 3FLJA 1CYVA 3U97A 1M9GA 4RNYA 4O3VA 4NREA 3CCU3 1UCJA 2W0QA 2GKJA 3AMOA 1NDOB 3ZG0A 3G8ZA 1VQM3 3D9RA 2HMOB 1FUWA 1EQKA 3IGHX 3G0KA 3EJXA 2C10A 1RTUA 1E97A 1W6CA 2GSPA 4O8SA 1IVWA 1TP6A 3G6E3 1T5YA 4Q60A 5KP1A 1UCKA 3SX1A 1N5HA 4HM3B 1JRQA 4H61A 1IT7A 2XFSA 2PZVA 4LSOA 1C54A 4XB5A 5I97A 4LEHA 2IW4A 2GU1A 1Z1SA 3LH4A 5HGRA 9RNTA 1V58A 1JBSA 3LTDA 1WMOA 2PW0A 2C11A 1N5PA 4R9LA 5D83A 3CC23 1QAKA 1BSAA 1E3RA 2RCDA 3LT8A 3FG4A 1Q40A 1S723 2WGOA 1B2ZA 4HYZA 1NB5I 1BNJA 1W5ZA 1RNBA 1RHLA 5IERA 3NHXA 2J8XB 3PW9A 3F7XA 1I8VA 5BU4A 3WA2X 1WMPA 3SOAA 1M1K4 2CG0A 4HJLB 8CHOA 3H3HA 2OTNA 1DE3A 2ZXRA 1RCKA 1X1XA 3CCQ3 3CCV3 3DUKA 3X40A 4K61A 4O02B 4DKIA 2STDA 3F14A 1YNVX 1C7HA 2BNGA 2D42A 2YFLB 1ISKA 4EV5A 4OUQA 3DGYA 5M47A 3EE1A 2IUJA 1OHOA 4EXRA 1VQQA 2ML5A 4WYKB 1TU5A 3NBJA 4RZMA 5M1AA 1RCLA 4L8OA 3IJEB 4WHAA 1NU3A 3FSDA 3M8CA 4HM1B 4HM0B 1S7JA 1IV9A 5H2YA 1ZX2A 1LRAA 1WMNA 5BIRA 3EKMA 4RNTA 5AEWB 4KT3B 3CME3 3V92A 1FUTA 3DGNA 2GU3A 1DYUA 3E99A 1FYSA 3FGYA 4IIAA 4MMXB 1TUHA 2CKFB 2Q9HA 2IMJA 3DEVA 3NBRA 2Z76A 2AAEA 3N8BA 4RPAA 3H51A 2H0GA 3Q1CA 3ZG5A 1GMQA 2ZVFA 3SXXA 4HM8B 3N54B 3BNBA 3OV4A 2MC8A 3HIIA 1ZO2A 3DZLA 4K8LA 3NM7A 4EYCA 3CMA3 4FCMA 1FGTA 2P38A 1UUWB 2BT3A 1OHSA 3GWRA 2KF5A 3DM8A 4J8TA 1GS3A 2HMKB 1FGOA 2QA43 1JB2A 3SOYA 1PY3A 3DMCA 5IG4A 1N8R4 2MPBA 1LXEA 1W6GA 3F40A 1YGWA 1B2SA 2CWVA 1DETA 3WDGB 1GD3A 2Q07A 4JD7A 2A15A 1ASKA 2XFTA 4N6OB 1JKGA 1KC84 1HKXA 1IQYA 2AADA 4QWTA 5M19A 1VQ53 4N6TA 2GEXA 5EVHA 1X1UA 1RGEA 3MYTA 1YJW3 3JUNA 5AIHA 4JUUA 2IA7A 1BSCA 1RRLA 1WPMA 2Y73A 1I2EA 4PY9A 4OK0A 1W2ZA 1B2XA 2W56A 5IG0A 1OPYA 2W04A 1Q814 3GZRA 3FVEA 5DREA 3CU3A 3FH1A 1ZS7A 4GHOA 1NJI4 3RDEA 4CPKA 2ZXPA 4Q2HA 3G98A 1JNQA 1Q7HA 3DGLA 3NV0A 5CF1A 1NB3I 1O7WB 2XR8B 5CXOA 1B2UA 4OVMA 3FKAA 1LOXA 2CX1A 4G1MB 4BTWA 1UI8A 1TM0A 7RNTA 2EB0A 3O8YA 2B1XB 1UCLA 1Q864 1PYLA 1SARA 3MG2A 3PGBA 3EJVA 2XRXB 4HOHA 5AYSC 5GSPA 2F4YA 4ILFA 2P0MA 2XSOB 1TTOA 3JUOA 3L0RA 4KFFA 1MGWA 4LZIA 1HZ1A 4R9KA 1MNLA 5D81A 1SJWA 2P0XA 1VQ83 4IPBA 3PTJA 1TFOA 1QVG2 2HMJB 1I3FA 3URPA 3OWUA 3F8HA 1JB5A 1IYYA 3LXUX 1RKYA 2GBXB 2P05A 3D4AA 3MG1A 4MEIA 3GRDA 4J9XA 3FF2A 3PCSA 4ORLA 2QB8A 1RGFA 2M7OA 5AEUB 3D3LA 1OCVA 1RN7A 1RN4A 1V74A 1G02A 3KKGA 2WGQA 3OWYA 4WWUC 1KQS2 4I4KA 6RNTA 4IJZA 2XEPA 3X3YA 7STDA 3WA3A 1Q824 4EV2A 1BRGA 1K41A 3GSPA 1U1WA 3KE7A 2OOVA 3X41A 2R4IA 2SARA 4EW5A 4HAAA 1K734 2CWTA 3MWZA 2B24B 3RNTA 3KIIA 1JBRA 2HMNB 5CLKA 2KPTA 4GL6A 1A2PA 4HBRA 3S67A 1CQSA 2LYXA 3HOHA 2H0HA 3LTBA 3NXJA 3STDA 2XGNA 1N8QA 1OGXA 2KRTA 1Y4KA 1RGAA 1OACA 5AI1A 1GOUA 2OQEA 1KD14 4N6LA 1BRKA 2QGUA 1BSDA 1ULJB 4BU4A 5IF6A 1W6YA 3GZXB 3MSOA 1IK3A 3BLZA 4EBGA 3CNXA 4JRFA 4N6NB 3PXMA 1TIJA 3OXAA 3LMLA 4R1KA 5BXQA 2UGIA 2W2CA 1EA2A 2CHCA 2JQ5A 4LG3A 3K0ZA 3EF8A 1AQZA 1R4CA 4LS9A 3N9HA 3U1WA 1VQ93 2CIUA 3V98A 1SIHA 3GZYB 1OUNA 1BNGA 4L8PA 2XH9A 5AIGA 1QVF2 3AHWA 4NPBA 3IPTA 4STDA 3PVHA 3QRDA 3NBBA 2YMAA 4EC6A 1QALA 4LMIA 2RBIA 1IVUA 1GSPA 3Q3FA 1BNEA 4JBDA 1SPUA 1V57A 1W61A 2O9UX 3EHCA 4XM4A 5ANPA 4CCVA 1VQO3 1RJOA 2CW9A 3B7CA 5KP3A 8RNTA 1GOVA 4K1VA 4RNZA 1MGRA 1RGGA 1UUGB 2L4VA 2XSHB 1RSNA 4HM7B 1VQL3 4K7GB 1BOXA 1US1A 3JUMA 3NX0A 1TFKA 3IMAB 1I3IA 1KSIA 1U8CB 4XDVA 4AKYA 3NM2A 1JBTA 2ZDJA 3FZWA 1X1WA 1K9M4 5BVBA 3CCE3 1AY7A 3KN4A 2JDIH 3LYGA 1T6KA 3DXOA 5D82A 5EEOA 2IYJA 1IU7A 1DMNA 2BMRB 2SBLA 1BGSA 5HOHA 1A90A 5TGNA 1JN5B 1B21A 1F8NA 1BU4A 3CNMA 1MWSA 1LOWA 1OF5B 4FCZA 1VQK3 3UJMA 4BL2A 4LB0A 1SIIA 1IVVA 1U5OA 2OWPA 1AR0A 1T2IA 3UL6A 2CWUA 4BTYA 4CJNA 1JB4A 2UUGC 4WYKA 1AV4A 5JBSA 1RDSA 1CEWI 1GYBA 1ULIB 4R4KA 1O7NB 4Q53A 5EQLA 3T8UA 1AVLA 4XBXA 4O2HA 2HMLB 4R80A 3K63A 3S28A 1BNRA 2F56A 3ALAA 1OHPA 3EBYA 1STFI 2ENXA 2YFJB 2RSXA 1JJ22 1VQ73 5ELJA 1YVSA 1I2FA 2INXA 5ELUA 1W4NA 1NNVA 2FGTA 3LTAA 3I563 4N6UA 3VGNA 1BNFA 2HAWA 1G0TA 1FGRA 1KWIA 3HZPA 3KSED 2Y74A 2CK3H 4XDWA 2W56B 1HYFA 1BSBA 3OW22 2KCDA 2YX9A 4HM4B 2K3DA 5IG5A 4KFEA 1RRHA 1W62A 2W9QA 1BIRA 3HX8A 1YIT3 4HZBB 2OTJ3 5JPUA 1IV7A 2CFWA 2PNCA 1U0KA 1VQ43 2E2VA 4FMDA 4K1UA 1FUSA 4KZ1A 3S27A 2QEX3 1DVDA 1O7PB 1T3BA 5IW9A 3DGOA 1NO3A 1PU4A 3B4OA 3GZBA 3K5TA 1R4YA 1UW1A 1W01A 1ROVA 1IQXA 3G16A 3KSPA 4HM5B 1K23A 3T8NA 1A2VA 5AYRB 1BRNL 2O3OA 4J5KA 4LYLB 5HA4A 4J9WA 2I9WA 3TDGA 4HVNA 3LZAA 3EN8A 3BNDA 2P09A 2W03A 1DMQA 3G713 5RNTA 4U13A 5IEOA 4MMYB 1GD4A 5LC7A 1FA3A 4N6MA 1D6ZA 4FMAA 1TJDA 2WOHA 3ER7A 2CX0A 1VQP3 3JUQA 1JZDA 3MHEA 2CFDA 1UI7A 1XUAA 3AMOB 2RNTA 3LT9A 2QIYA 3BU4A 3ICJA 1BRJA 2IUKA 4N3VA 3W5WA 1VQN3 1D6UA 1YVBI 1LNHA 2KXGA 3CCS3 4FCJA 3A76A 1G96A 2RFRA 1TRQA 3HI7A 1FW7A 3BNEA 3CCM3 2UX0A 1E3VA 3QK9A 4BIRA 1S5AA 2KF6A 1OGZA 2C4BA 2CG1A 1YIJ3 2E2TA 3Q2PA 3I553 3EC9A 3V99A 1BNSA 3CC73 3FG3A 1DVCA 4NHFA 3WQZA 3CCL3 1D6YA 1RGKA 5FW5A 1SQWA 2H9FA 3S29A 1CYUA 3B4PA 4CDLA 1Q40B 1YI23 2F86B 3DGMA 2BU4A 1PFPA 4HM6B 4GB5A 5AIFA 4BL3A 3WODG 3FF0A 3MG3A 2HOHA 3JUPA 4L7KA 4XBTA 1NWWA 2R41A 1RLSA 3I0YA 3DY5A 3ZFZA 4FMCA 2WO0A 1N9JA 3EBTA 2ZXOA 1N9EA 3UNLA 3VF1A 1FGQA 5IWEA 1STDA 2ZHXB 3RGRA 3CXC2 2F5WA 2Z77A 3FCSB 1B27A 3F7SA 1WNHA 2BMOB 3UL5A 5JPPA 1GMPA
chains in the Genus database with same CATH topology
3MKIA 1K20A 2CFLA 1A2KA 3EB8A 2XF3A 3ROBA 2RGQA 4HZ9B 2V1LA 3WOFB 3EQQB 2FXTA 3S5CA 3OX9A 2XGLA 4HM2B 1VQ63 3HIGA 3ECFA 4FR9A 3X42A 2Z6BA 1GY6A 4MMZB 4JF8A 2GBWB 2Z7AA 2ML6A 3F8XA 1YGEA 2W6JH 3FG1A 3CD63 2MF7A 3G7KA 1O7HB 4X2HA 1YJ93 3F9SA 2K0MA 3RGAA 1XUBA 1M1XB 1K28A 3SEDA 3KZTA 1W7CA 2CC3A 1GY5A 4AKZA 1QAFA 1Q42A 1MOLA 3PYJA 4KFDA 5AIIA 5KP4A 3PS8A 3KFQC 1UUVB 1K8A4 1YJN3 5CK6A 3CCR3 4J9AA 4K90B 2CFKA 3X3XA 3CPOA 1IQ8A 4XBYA 1Q7Y4 4IT7A 3NQZA 2WOFA 1VZZA 4BTXA 2FNQA 5H2GA 2F98A 4H3UA 3GAXA 2GKEA 1GY7A 3HK4A 1IR6A 1OH0A 1L5GB 3VSYA 1WPPA 1EG9B 2E2UA 3K9MC 4X2OA 1JKGB 2OCTA 4OA3A 3K7CA 4KVHA 3OWSA 1WTHA 2QB6A 1QYAA 3EN1B 2W9PA 5CF2A 1JV2B 1QY9A 2F99A 1W02A 4WFOA 1M904 4TX4A 1J2BA 1LVNA 4PEJA 3WMDA 4AEQA 1YM5A 1JN5A 2CH9A 3J7Yd 1WQLB 1OF5A 1DMMA 1BUQA 1IDPA 2AZPA 6STDA 1ROAA 3NV0B 5IENA 1I74A 3PCRA 2BHMA 2BMQB 1IVXA 3PZWA 3NUVA 1A67A 3MPHA 2D1WA 3Q90A 4HKVB 2BO9B 4FMBA 1QJGA 4JCIA 2CFGA 1YHQ3 3NQYA 5FGOA 1GQZA 3BB9A 1IT8A 1W00A 3X3ZA 4LGQA 5G2GA 3LOYA 3LTCA 2KW7A 3BNCA 1FGMA 1EKMA 2YFIB 5IG3A 1SDJA 1AVKA 3EX9A 1U1VA 4ZM8A 3SVAA 2PVZA 4MJDA 1HU9A 3B8LA 3UB1A 1W2B2 3JVCA 2OOVC 2HMMB 3G4S3 2LQVA 4DUNA 4N6V0 5STDA 2GXFA 3CCJ3 4WP5A 2K54A 1QMAA 1U1XA 2GEYA 2OTL3 1O7GB 2QB7A 1BWZA 4IK0A 3CC43 5LC6A 5DRVA 3SLUA 3WOEB 2LT2A 5IEPA 3CPW2 1O7MB 3T0UA 2Q9JA 3EDNA 4RBNA 2ZL8A 2OQEC 5A0OB 4K7XA 3FLJA 1CYVA 3U97A 1M9GA 4RNYA 4O3VA 4NREA 3CCU3 2W0QA 2GKJA 3AMOA 1NDOB 3G8ZA 1VQM3 3D9RA 2HMOB 1FUWA 1EQKA 3IGHX 3G0KA 3EJXA 2C10A 1W6CA 1E97A 3G6E3 4O8SA 1IVWA 1TP6A 1T5YA 4Q60A 5KP1A 3SX1A 1N5HA 4HM3B 1JRQA 4H61A 1IT7A 2XFSA 2PZVA 4LSOA 4XB5A 5I97A 4LEHA 2IW4A 2GU1A 1Z1SA 3LH4A 5HGRA 3LTDA 1WMOA 2PW0A 2C11A 1N5PA 4R9LA 5D83A 3CC23 1QAKA 1E3RA 2RCDA 3LT8A 3FG4A 1Q40A 1S723 2WGOA 4HYZA 1NB5I 1W5ZA 5IERA 3NHXA 3PW9A 3F7XA 3WA2X 1WMPA 3SOAA 1M1K4 2CG0A 4HJLB 8CHOA 3H3HA 2OTNA 2ZXRA 3CCQ3 3CCV3 3DUKA 3X40A 4K61A 4O02B 2STDA 3F14A 1C7HA 2BNGA 2D42A 2YFLB 1ISKA 4EV5A 4OUQA 5M47A 3EE1A 2IUJA 1OHOA 4EXRA 2ML5A 4WYKB 1TU5A 3NBJA 4RZMA 4L8OA 3IJEB 4WHAA 1NU3A 3FSDA 3M8CA 4HM1B 4HM0B 1S7JA 1IV9A 5H2YA 1ZX2A 1WMNA 3EKMA 5AEWB 3CME3 3V92A 3DGNA 2GU3A 1DYUA 3E99A 3FGYA 4IIAA 4MMXB 1TUHA 2CKFB 2Q9HA 2IMJA 3DEVA 3NBRA 2Z76A 3N8BA 4RPAA 3H51A 3Q1CA 2ZVFA 3SXXA 4HM8B 3N54B 3BNBA 3OV4A 2MC8A 3HIIA 1ZO2A 3DZLA 4K8LA 3NM7A 4EYCA 3CMA3 4FCMA 1FGTA 2P38A 1UUWB 2BT3A 1OHSA 3GWRA 3DM8A 4J8TA 1GS3A 2HMKB 1FGOA 2QA43 1JB2A 3SOYA 3DMCA 5IG4A 1N8R4 2MPBA 1W6GA 1LXEA 3F40A 2CWVA 3WDGB 1GD3A 2Q07A 2A15A 4JD7A 1ASKA 2XFTA 4N6OB 1JKGA 1KC84 1HKXA 1IQYA 4QWTA 1VQ53 4N6TA 2GEXA 5EVHA 3MYTA 1YJW3 3JUNA 5AIHA 4JUUA 2IA7A 1RRLA 1WPMA 2Y73A 4PY9A 4OK0A 1W2ZA 2W56A 5IG0A 1Q814 1OPYA 2W04A 3GZRA 3FVEA 3CU3A 3FH1A 1NJI4 3RDEA 2ZXPA 4Q2HA 3G98A 1JNQA 3DGLA 5CF1A 3NV0A 1NB3I 1O7WB 2XR8B 5CXOA 4BTWA 4OVMA 3FKAA 1LOXA 4G1MB 1UI8A 1TM0A 2EB0A 3O8YA 2B1XB 1Q864 3MG2A 3PGBA 3EJVA 2XRXB 5AYSC 2P0MA 2XSOB 3JUOA 3L0RA 4KFFA 4LZIA 5D81A 4R9KA 1MNLA 1VQ83 1SJWA 2P0XA 4IPBA 3PTJA 1TFOA 1QVG2 2HMJB 3OWUA 3F8HA 1JB5A 3LXUX 1RKYA 2GBXB 2P05A 4MEIA 3MG1A 3GRDA 4J9XA 3FF2A 3PCSA 4ORLA 2QB8A 2M7OA 5AEUB 3D3LA 1OCVA 1RN7A 1V74A 3KKGA 2WGQA 3OWYA 4WWUC 1KQS2 4I4KA 3WA3A 4IJZA 2XEPA 3X3YA 7STDA 1Q824 4EV2A 3KE7A 1K41A 2OOVA 1U1WA 3X41A 2R4IA 1K734 2CWTA 3MWZA 2B24B 3KIIA 2HMNB 5CLKA 2KPTA 4GL6A 4HBRA 3S67A 1CQSA 2LYXA 3STDA 3LTBA 3NXJA 2XGNA 1N8QA 1OGXA 2KRTA 1Y4KA 1OACA 5AI1A 2OQEA 1KD14 4N6LA 2QGUA 1ULJB 5IF6A 1W6YA 3GZXB 3MSOA 1IK3A 3BLZA 4EBGA 3CNXA 4JRFA 4N6NB 3PXMA 1TIJA 3OXAA 3LMLA 4R1KA 5BXQA 2W2CA 1EA2A 2CHCA 2JQ5A 4LG3A 3K0ZA 3EF8A 1R4CA 4LS9A 3N9HA 3U1WA 1VQ93 2CIUA 3V98A 1SIHA 3GZYB 1OUNA 4L8PA 2XH9A 5AIGA 1QVF2 3IPTA 4STDA 3PVHA 3QRDA 3NBBA 2YMAA 4EC6A 1QALA 4LMIA 1IVUA 4XM4A 1SPUA 4JBDA 4CCVA 3EHCA 1W61A 2O9UX 1VQO3 5ANPA 1RJOA 2CW9A 3B7CA 5KP3A 4K1VA 4RNZA 2L4VA 2XSHB 4HM7B 1VQL3 4K7GB 1US1A 3JUMA 3NX0A 1TFKA 3IMAB 1KSIA 1U8CB 4XDVA 4AKYA 3NM2A 2ZDJA 3FZWA 1K9M4 5BVBA 3CCE3 3KN4A 2JDIH 3LYGA 1T6KA 3DXOA 5D82A 5EEOA 1IU7A 1DMNA 2BMRB 2SBLA 1A90A 5TGNA 1JN5B 1F8NA 3CNMA 4FCZA 1OF5B 1VQK3 3UJMA 4LB0A 1SIIA 1IVVA 1U5OA 2OWPA 1AR0A 3UL6A 2CWUA 4BTYA 1JB4A 4WYKA 1AV4A 5JBSA 1CEWI 1GYBA 1ULIB 4R4KA 1O7NB 4Q53A 5EQLA 3T8UA 1AVLA 4XBXA 4O2HA 2HMLB 4R80A 3K63A 3S28A 3ALAA 1OHPA 3EBYA 1STFI 2ENXA 2YFJB 2RSXA 1JJ22 1VQ73 5ELJA 2INXA 5ELUA 1W4NA 2FGTA 3LTAA 3I563 4N6UA 3VGNA 2HAWA 1FGRA 1KWIA 3HZPA 3KSED 2Y74A 2CK3H 4XDWA 2W56B 3OW22 2KCDA 2YX9A 4HM4B 5IG5A 4KFEA 1RRHA 1W62A 2W9QA 3HX8A 1YIT3 4HZBB 2OTJ3 5JPUA 1IV7A 2CFWA 2PNCA 1U0KA 1VQ43 2E2VA 4FMDA 4K1UA 4KZ1A 3S27A 2QEX3 1DVDA 1O7PB 5IW9A 3DGOA 1NO3A 1PU4A 3B4OA 3GZBA 3K5TA 1UW1A 1W01A 1ROVA 1IQXA 3G16A 3KSPA 4HM5B 1K23A 3T8NA 1A2VA 5AYRB 2O3OA 5HA4A 4J9WA 2I9WA 3TDGA 4HVNA 3LZAA 3EN8A 3BNDA 2P09A 2W03A 1DMQA 3G713 4U13A 5IEOA 4MMYB 1GD4A 5LC7A 1FA3A 4N6MA 1D6ZA 4FMAA 2WOHA 3ER7A 1VQP3 3JUQA 3MHEA 2CFDA 1UI7A 1XUAA 3AMOB 3LT9A 2QIYA 3ICJA 2IUKA 4N3VA 3W5WA 1VQN3 1D6UA 1YVBI 1LNHA 2KXGA 3CCS3 4FCJA 3A76A 1G96A 2RFRA 3HI7A 3BNEA 3CCM3 2UX0A 1E3VA 3QK9A 1S5AA 1OGZA 2CG1A 1YIJ3 2E2TA 3Q2PA 3I553 3EC9A 3V99A 3CC73 3FG3A 1DVCA 4NHFA 3WQZA 3CCL3 1D6YA 5FW5A 1SQWA 2H9FA 3S29A 1CYUA 3B4PA 4CDLA 1Q40B 1YI23 2F86B 3DGMA 4HM6B 1PFPA 4GB5A 5AIFA 3WODG 3FF0A 3MG3A 4L7KA 3JUPA 4XBTA 1NWWA 3I0YA 3DY5A 4FMCA 2WO0A 1N9JA 3EBTA 2ZXOA 1N9EA 3UNLA 3VF1A 1FGQA 5IWEA 1STDA 3RGRA 3CXC2 2Z77A 3FCSB 3UL5A 3F7SA 1WNHA 2BMOB 5JPPA 5DREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GL6 A; 
#chains in the Genus database with same CATH topology
 1EUI C;  3MKI A;  1T2H A;  1K20 A;  2CFL A;  1A2K A;  2F5M A;  1I2G A;  3EB8 A;  2XF3 A;  3ROB A;  2RGQ A;  3D5I A;  2V1L A;  4HZ9 B;  3WOF B;  3EQQ B;  2FXT A;  3S5C A;  3OX9 A;  2XGL A;  4HM2 B;  5M18 A;  1B2M A;  1VQ6 3;  3HIG A;  3ECF A;  4FR9 A;  3WR2 A;  3X42 A;  2Z6B A;  1GY6 A;  4MMZ B;  4JF8 A;  2GBW B;  2Z7A A;  1LQM B;  1EEJ A;  2ML6 A;  2KAA A;  1YGE A;  2KF3 A;  2W6J H;  3A5E A;  3F8X A;  3FG1 A;  3CD6 3;  3AGO A;  2MF7 A;  3G7K A;  1O7H B;  4X2H A;  1YJ9 3;  5G1L A;  3F9S A;  2K0M A;  3RGA A;  1XUB A;  1M1X B;  1K28 A;  1LOV A;  1BAN A;  3SED A;  3D79 A;  3KZT A;  1W7C A;  1I0X A;  1GY5 A;  2CC3 A;  4AKZ A;  1QAF A;  1Q42 A;  1MOL A;  3PYJ A;  1MWT A;  4KFD A;  5AII A;  3D5G A;  5KP4 A;  3PS8 A;  3KFQ C;  1UUV B;  1K8A 4;  1YJN 3;  2L1S A;  5CK6 A;  3WHO A;  3CCR 3;  4J9A A;  4K90 B;  2CFK A;  1BRS A;  3AGN A;  3X3X A;  3CPO A;  1IQ8 A;  4XBY A;  1BNI A;  4IT7 A;  3NQZ A;  2WOF A;  1VZZ A;  4BTX A;  1Q7Y 4;  2FNQ A;  5H2G A;  2F98 A;  4H3U A;  1LOY A;  3GAX A;  2GKE A;  1GY7 A;  3HK4 A;  1UCI A;  1IR6 A;  1OH0 A;  1UGI A;  1L5G B;  3VSY A;  1WPP A;  1EG9 B;  2E2U A;  3K9M C;  4GSP A;  1B20 A;  4J5G A;  4X2O A;  1JKG B;  2OCT A;  4OA3 A;  1BRI A;  3K7C A;  4KVH A;  3OWS A;  2H0I A;  1WTH A;  4I5Q A;  1FZU A;  2QB6 A;  1QYA A;  3EN1 B;  2W9P A;  5CF2 A;  1JV2 B;  1QY9 A;  2F99 A;  1MWR A;  1W02 A;  4WFO A;  1M90 4;  4TX4 A;  1J2B A;  1LVN A;  4PEJ A;  5G1K A;  3WMD A;  4AEQ A;  1YM5 A;  3KCH A;  1JN5 A;  1RGH A;  2CH9 A;  3J7Y d;  1CH0 A;  1OF5 A;  1DMM A;  1WQL B;  1BUQ A;  1Q9E A;  1IDP A;  1RGC A;  2AZP A;  1BVI A;  6STD A;  1ROA A;  1B3S A;  3NV0 B;  1GMR A;  5IEN A;  1I74 A;  2ZA4 A;  3PCR A;  2BIR A;  2BHM A;  2BMQ B;  1BAO A;  1IVX A;  3PZW A;  1X1Y A;  3NUV A;  1A67 A;  3MPH A;  2D1W A;  1ZGX A;  3Q90 A;  4HKV B;  2BO9 B;  4FMB A;  3BIR A;  1QJG A;  1JZO A;  4JCI A;  2CFG A;  1YHQ 3;  3NQY A;  5FGO A;  1RMS A;  1GQZ A;  3BB9 A;  1IT8 A;  1W00 A;  1BUJ A;  3X3Z A;  4LGQ A;  5G2G A;  3LOY A;  3LTC A;  2KW7 A;  1RNT A;  3BNC A;  6GSP A;  3DH2 A;  1UDI I;  1FGM A;  1LQG C;  1BRH A;  1I0V A;  1I70 A;  1EKM A;  2YFI B;  5IG3 A;  1SDJ A;  1AVK A;  3EX9 A;  2IY2 A;  1U1V A;  4ZM8 A;  3SVA A;  2PVZ A;  4MJD A;  1HU9 A;  3B8L A;  3UB1 A;  1W2B 2;  3JVC A;  2OOV C;  2HMM B;  3G4S 3;  2LQV A;  4DUN A;  4N6V 0;  5STD A;  2GXF A;  3CCJ 3;  2KF4 A;  4WP5 A;  2K54 A;  1MWU A;  1QMA A;  1U1X A;  2GEY A;  2OTL 3;  1O7G B;  2QB7 A;  1BWZ A;  4IK0 A;  1BSE A;  1RGL A;  3CC4 3;  5LC6 A;  5DRV A;  3SLU A;  3WOE B;  2LT2 A;  5IEP A;  3CPW 2;  7GSP A;  1O7M B;  3SYU A;  1RN1 A;  3T0U A;  2Q9J A;  3AHS A;  3EDN A;  1UGH I;  4RBN A;  2ZL8 A;  1GOY A;  1TRP A;  2OQE C;  4K7X A;  5A0O B;  1LNI A;  3FLJ A;  1CYV A;  3U97 A;  1M9G A;  4RNY A;  4O3V A;  4NRE A;  3CCU 3;  1UCJ A;  2W0Q A;  2GKJ A;  3AMO A;  1NDO B;  3ZG0 A;  3G8Z A;  1VQM 3;  3D9R A;  2HMO B;  1FUW A;  1EQK A;  3IGH X;  3G0K A;  3EJX A;  2C10 A;  1RTU A;  1E97 A;  1W6C A;  2GSP A;  4O8S A;  1IVW A;  1TP6 A;  3G6E 3;  1T5Y A;  4Q60 A;  5KP1 A;  1UCK A;  3SX1 A;  1N5H A;  4HM3 B;  1JRQ A;  4H61 A;  1IT7 A;  2XFS A;  2PZV A;  4LSO A;  1C54 A;  4XB5 A;  5I97 A;  4LEH A;  2IW4 A;  2GU1 A;  1Z1S A;  3LH4 A;  5HGR A;  9RNT A;  1V58 A;  1JBS A;  3LTD A;  1WMO A;  2PW0 A;  2C11 A;  1N5P A;  4R9L A;  5D83 A;  3CC2 3;  1QAK A;  1BSA A;  1E3R A;  2RCD A;  3LT8 A;  3FG4 A;  1Q40 A;  1S72 3;  2WGO A;  1B2Z A;  4HYZ A;  1NB5 I;  1BNJ A;  1W5Z A;  1RNB A;  1RHL A;  5IER A;  3NHX A;  2J8X B;  3PW9 A;  3F7X A;  1I8V A;  5BU4 A;  3WA2 X;  1WMP A;  3SOA A;  1M1K 4;  2CG0 A;  4HJL B;  8CHO A;  3H3H A;  2OTN A;  1DE3 A;  2ZXR A;  1RCK A;  1X1X A;  3CCQ 3;  3CCV 3;  3DUK A;  3X40 A;  4K61 A;  4O02 B;  4DKI A;  2STD A;  3F14 A;  1YNV X;  1C7H A;  2BNG A;  2D42 A;  2YFL B;  1ISK A;  4EV5 A;  4OUQ A;  3DGY A;  5M47 A;  3EE1 A;  2IUJ A;  1OHO A;  4EXR A;  1VQQ A;  2ML5 A;  4WYK B;  1TU5 A;  3NBJ A;  4RZM A;  5M1A A;  1RCL A;  4L8O A;  3IJE B;  4WHA A;  1NU3 A;  3FSD A;  3M8C A;  4HM1 B;  4HM0 B;  1S7J A;  1IV9 A;  5H2Y A;  1ZX2 A;  1LRA A;  1WMN A;  5BIR A;  3EKM A;  4RNT A;  5AEW B;  4KT3 B;  3CME 3;  3V92 A;  1FUT A;  3DGN A;  2GU3 A;  1DYU A;  3E99 A;  1FYS A;  3FGY A;  4IIA A;  4MMX B;  1TUH A;  2CKF B;  2Q9H A;  2IMJ A;  3DEV A;  3NBR A;  2Z76 A;  2AAE A;  3N8B A;  4RPA A;  3H51 A;  2H0G A;  3Q1C A;  3ZG5 A;  1GMQ A;  2ZVF A;  3SXX A;  4HM8 B;  3N54 B;  3BNB A;  3OV4 A;  2MC8 A;  3HII A;  1ZO2 A;  3DZL A;  4K8L A;  3NM7 A;  4EYC A;  3CMA 3;  4FCM A;  1FGT A;  2P38 A;  1UUW B;  2BT3 A;  1OHS A;  3GWR A;  2KF5 A;  3DM8 A;  4J8T A;  1GS3 A;  2HMK B;  1FGO A;  2QA4 3;  1JB2 A;  3SOY A;  1PY3 A;  3DMC A;  5IG4 A;  1N8R 4;  2MPB A;  1LXE A;  1W6G A;  3F40 A;  1YGW A;  1B2S A;  2CWV A;  1DET A;  3WDG B;  1GD3 A;  2Q07 A;  4JD7 A;  2A15 A;  1ASK A;  2XFT A;  4N6O B;  1JKG A;  1KC8 4;  1HKX A;  1IQY A;  2AAD A;  4QWT A;  5M19 A;  1VQ5 3;  4N6T A;  2GEX A;  5EVH A;  1X1U A;  1RGE A;  3MYT A;  1YJW 3;  3JUN A;  5AIH A;  4JUU A;  2IA7 A;  1BSC A;  1RRL A;  1WPM A;  2Y73 A;  1I2E A;  4PY9 A;  4OK0 A;  1W2Z A;  1B2X A;  2W56 A;  5IG0 A;  1OPY A;  2W04 A;  1Q81 4;  3GZR A;  3FVE A;  5DRE A;  3CU3 A;  3FH1 A;  1ZS7 A;  4GHO A;  1NJI 4;  3RDE A;  4CPK A;  2ZXP A;  4Q2H A;  3G98 A;  1JNQ A;  1Q7H A;  3DGL A;  3NV0 A;  5CF1 A;  1NB3 I;  1O7W B;  2XR8 B;  5CXO A;  1B2U A;  4OVM A;  3FKA A;  1LOX A;  2CX1 A;  4G1M B;  4BTW A;  1UI8 A;  1TM0 A;  7RNT A;  2EB0 A;  3O8Y A;  2B1X B;  1UCL A;  1Q86 4;  1PYL A;  1SAR A;  3MG2 A;  3PGB A;  3EJV A;  2XRX B;  4HOH A;  5AYS C;  5GSP A;  2F4Y A;  4ILF A;  2P0M A;  2XSO B;  1TTO A;  3JUO A;  3L0R A;  4KFF A;  1MGW A;  4LZI A;  1HZ1 A;  4R9K A;  1MNL A;  5D81 A;  1SJW A;  2P0X A;  1VQ8 3;  4IPB A;  3PTJ A;  1TFO A;  1QVG 2;  2HMJ B;  1I3F A;  3URP A;  3OWU A;  3F8H A;  1JB5 A;  1IYY A;  3LXU X;  1RKY A;  2GBX B;  2P05 A;  3D4A A;  3MG1 A;  4MEI A;  3GRD A;  4J9X A;  3FF2 A;  3PCS A;  4ORL A;  2QB8 A;  1RGF A;  2M7O A;  5AEU B;  3D3L A;  1OCV A;  1RN7 A;  1RN4 A;  1V74 A;  1G02 A;  3KKG A;  2WGQ A;  3OWY A;  4WWU C;  1KQS 2;  4I4K A;  6RNT A;  4IJZ A;  2XEP A;  3X3Y A;  7STD A;  3WA3 A;  1Q82 4;  4EV2 A;  1BRG A;  1K41 A;  3GSP A;  1U1W A;  3KE7 A;  2OOV A;  3X41 A;  2R4I A;  2SAR A;  4EW5 A;  4HAA A;  1K73 4;  2CWT A;  3MWZ A;  2B24 B;  3RNT A;  3KII A;  1JBR A;  2HMN B;  5CLK A;  2KPT A;  4GL6 A;  1A2P A;  4HBR A;  3S67 A;  1CQS A;  2LYX A;  3HOH A;  2H0H A;  3LTB A;  3NXJ A;  3STD A;  2XGN A;  1N8Q A;  1OGX A;  2KRT A;  1Y4K A;  1RGA A;  1OAC A;  5AI1 A;  1GOU A;  2OQE A;  1KD1 4;  4N6L A;  1BRK A;  2QGU A;  1BSD A;  1ULJ B;  4BU4 A;  5IF6 A;  1W6Y A;  3GZX B;  3MSO A;  1IK3 A;  3BLZ A;  4EBG A;  3CNX A;  4JRF A;  4N6N B;  3PXM A;  1TIJ A;  3OXA A;  3LML A;  4R1K A;  5BXQ A;  2UGI A;  2W2C A;  1EA2 A;  2CHC A;  2JQ5 A;  4LG3 A;  3K0Z A;  3EF8 A;  1AQZ A;  1R4C A;  4LS9 A;  3N9H A;  3U1W A;  1VQ9 3;  2CIU A;  3V98 A;  1SIH A;  3GZY B;  1OUN A;  1BNG A;  4L8P A;  2XH9 A;  5AIG A;  1QVF 2;  3AHW A;  4NPB A;  3IPT A;  4STD A;  3PVH A;  3QRD A;  3NBB A;  2YMA A;  4EC6 A;  1QAL A;  4LMI A;  2RBI A;  1IVU A;  1GSP A;  3Q3F A;  1BNE A;  4JBD A;  1SPU A;  1V57 A;  1W61 A;  2O9U X;  3EHC A;  4XM4 A;  5ANP A;  4CCV A;  1VQO 3;  1RJO A;  2CW9 A;  3B7C A;  5KP3 A;  8RNT A;  1GOV A;  4K1V A;  4RNZ A;  1MGR A;  1RGG A;  1UUG B;  2L4V A;  2XSH B;  1RSN A;  4HM7 B;  1VQL 3;  4K7G B;  1BOX A;  1US1 A;  3JUM A;  3NX0 A;  1TFK A;  3IMA B;  1I3I A;  1KSI A;  1U8C B;  4XDV A;  4AKY A;  3NM2 A;  1JBT A;  2ZDJ A;  3FZW A;  1X1W A;  1K9M 4;  5BVB A;  3CCE 3;  1AY7 A;  3KN4 A;  2JDI H;  3LYG A;  1T6K A;  3DXO A;  5D82 A;  5EEO A;  2IYJ A;  1IU7 A;  1DMN A;  2BMR B;  2SBL A;  1BGS A;  5HOH A;  1A90 A;  5TGN A;  1JN5 B;  1B21 A;  1F8N A;  1BU4 A;  3CNM A;  1MWS A;  1LOW A;  1OF5 B;  4FCZ A;  1VQK 3;  3UJM A;  4BL2 A;  4LB0 A;  1SII A;  1IVV A;  1U5O A;  2OWP A;  1AR0 A;  1T2I A;  3UL6 A;  2CWU A;  4BTY A;  4CJN A;  1JB4 A;  2UUG C;  4WYK A;  1AV4 A;  5JBS A;  1RDS A;  1CEW I;  1GYB A;  1ULI B;  4R4K A;  1O7N B;  4Q53 A;  5EQL A;  3T8U A;  1AVL A;  4XBX A;  4O2H A;  2HML B;  4R80 A;  3K63 A;  3S28 A;  1BNR A;  2F56 A;  3ALA A;  1OHP A;  3EBY A;  1STF I;  2ENX A;  2YFJ B;  2RSX A;  1JJ2 2;  1VQ7 3;  5ELJ A;  1YVS A;  1I2F A;  2INX A;  5ELU A;  1W4N A;  1NNV A;  2FGT A;  3LTA A;  3I56 3;  4N6U A;  3VGN A;  1BNF A;  2HAW A;  1G0T A;  1FGR A;  1KWI A;  3HZP A;  3KSE D;  2Y74 A;  2CK3 H;  4XDW A;  2W56 B;  1HYF A;  1BSB A;  3OW2 2;  2KCD A;  2YX9 A;  4HM4 B;  2K3D A;  5IG5 A;  4KFE A;  1RRH A;  1W62 A;  2W9Q A;  1BIR A;  3HX8 A;  1YIT 3;  4HZB B;  2OTJ 3;  5JPU A;  1IV7 A;  2CFW A;  2PNC A;  1U0K A;  1VQ4 3;  2E2V A;  4FMD A;  4K1U A;  1FUS A;  4KZ1 A;  3S27 A;  2QEX 3;  1DVD A;  1O7P B;  1T3B A;  5IW9 A;  3DGO A;  1NO3 A;  1PU4 A;  3B4O A;  3GZB A;  3K5T A;  1R4Y A;  1UW1 A;  1W01 A;  1ROV A;  1IQX A;  3G16 A;  3KSP A;  4HM5 B;  1K23 A;  3T8N A;  1A2V A;  5AYR B;  1BRN L;  2O3O A;  4J5K A;  4LYL B;  5HA4 A;  4J9W A;  2I9W A;  3TDG A;  4HVN A;  3LZA A;  3EN8 A;  3BND A;  2P09 A;  2W03 A;  1DMQ A;  3G71 3;  5RNT A;  4U13 A;  5IEO A;  4MMY B;  1GD4 A;  5LC7 A;  1FA3 A;  4N6M A;  1D6Z A;  4FMA A;  1TJD A;  2WOH A;  3ER7 A;  2CX0 A;  1VQP 3;  3JUQ A;  1JZD A;  3MHE A;  2CFD A;  1UI7 A;  1XUA A;  3AMO B;  2RNT A;  3LT9 A;  2QIY A;  3BU4 A;  3ICJ A;  1BRJ A;  2IUK A;  4N3V A;  3W5W A;  1VQN 3;  1D6U A;  1YVB I;  1LNH A;  2KXG A;  3CCS 3;  4FCJ A;  3A76 A;  1G96 A;  2RFR A;  1TRQ A;  3HI7 A;  1FW7 A;  3BNE A;  3CCM 3;  2UX0 A;  1E3V A;  3QK9 A;  4BIR A;  1S5A A;  2KF6 A;  1OGZ A;  2C4B A;  2CG1 A;  1YIJ 3;  2E2T A;  3Q2P A;  3I55 3;  3EC9 A;  3V99 A;  1BNS A;  3CC7 3;  3FG3 A;  1DVC A;  4NHF A;  3WQZ A;  3CCL 3;  1D6Y A;  1RGK A;  5FW5 A;  1SQW A;  2H9F A;  3S29 A;  1CYU A;  3B4P A;  4CDL A;  1Q40 B;  1YI2 3;  2F86 B;  3DGM A;  2BU4 A;  1PFP A;  4HM6 B;  4GB5 A;  5AIF A;  4BL3 A;  3WOD G;  3FF0 A;  3MG3 A;  2HOH A;  3JUP A;  4L7K A;  4XBT A;  1NWW A;  2R41 A;  1RLS A;  3I0Y A;  3DY5 A;  3ZFZ A;  4FMC A;  2WO0 A;  1N9J A;  3EBT A;  2ZXO A;  1N9E A;  3UNL A;  3VF1 A;  1FGQ A;  5IWE A;  1STD A;  2ZHX B;  3RGR A;  3CXC 2;  2F5W A;  2Z77 A;  3FCS B;  1B27 A;  3F7S A;  1WNH A;  2BMO B;  3UL5 A;  5JPP A;  1GMP A; 
#chains in the Genus database with same CATH homology
 3MKI A;  1K20 A;  2CFL A;  1A2K A;  3EB8 A;  2XF3 A;  3ROB A;  2RGQ A;  4HZ9 B;  2V1L A;  3WOF B;  3EQQ B;  2FXT A;  3S5C A;  3OX9 A;  2XGL A;  4HM2 B;  1VQ6 3;  3HIG A;  3ECF A;  4FR9 A;  3X42 A;  2Z6B A;  1GY6 A;  4MMZ B;  4JF8 A;  2GBW B;  2Z7A A;  2ML6 A;  3F8X A;  1YGE A;  2W6J H;  3FG1 A;  3CD6 3;  2MF7 A;  3G7K A;  1O7H B;  4X2H A;  1YJ9 3;  3F9S A;  2K0M A;  3RGA A;  1XUB A;  1M1X B;  1K28 A;  3SED A;  3KZT A;  1W7C A;  2CC3 A;  1GY5 A;  4AKZ A;  1QAF A;  1Q42 A;  1MOL A;  3PYJ A;  4KFD A;  5AII A;  5KP4 A;  3PS8 A;  3KFQ C;  1UUV B;  1K8A 4;  1YJN 3;  5CK6 A;  3CCR 3;  4J9A A;  4K90 B;  2CFK A;  3X3X A;  3CPO A;  1IQ8 A;  4XBY A;  1Q7Y 4;  4IT7 A;  3NQZ A;  2WOF A;  1VZZ A;  4BTX A;  2FNQ A;  5H2G A;  2F98 A;  4H3U A;  3GAX A;  2GKE A;  1GY7 A;  3HK4 A;  1IR6 A;  1OH0 A;  1L5G B;  3VSY A;  1WPP A;  1EG9 B;  2E2U A;  3K9M C;  4X2O A;  1JKG B;  2OCT A;  4OA3 A;  3K7C A;  4KVH A;  3OWS A;  1WTH A;  2QB6 A;  1QYA A;  3EN1 B;  2W9P A;  5CF2 A;  1JV2 B;  1QY9 A;  2F99 A;  1W02 A;  4WFO A;  1M90 4;  4TX4 A;  1J2B A;  1LVN A;  4PEJ A;  3WMD A;  4AEQ A;  1YM5 A;  1JN5 A;  2CH9 A;  3J7Y d;  1WQL B;  1OF5 A;  1DMM A;  1BUQ A;  1IDP A;  2AZP A;  6STD A;  1ROA A;  3NV0 B;  5IEN A;  1I74 A;  3PCR A;  2BHM A;  2BMQ B;  1IVX A;  3PZW A;  3NUV A;  1A67 A;  3MPH A;  2D1W A;  3Q90 A;  4HKV B;  2BO9 B;  4FMB A;  1QJG A;  4JCI A;  2CFG A;  1YHQ 3;  3NQY A;  5FGO A;  1GQZ A;  3BB9 A;  1IT8 A;  1W00 A;  3X3Z A;  4LGQ A;  5G2G A;  3LOY A;  3LTC A;  2KW7 A;  3BNC A;  1FGM A;  1EKM A;  2YFI B;  5IG3 A;  1SDJ A;  1AVK A;  3EX9 A;  1U1V A;  4ZM8 A;  3SVA A;  2PVZ A;  4MJD A;  1HU9 A;  3B8L A;  3UB1 A;  1W2B 2;  3JVC A;  2OOV C;  2HMM B;  3G4S 3;  2LQV A;  4DUN A;  4N6V 0;  5STD A;  2GXF A;  3CCJ 3;  4WP5 A;  2K54 A;  1QMA A;  1U1X A;  2GEY A;  2OTL 3;  1O7G B;  2QB7 A;  1BWZ A;  4IK0 A;  3CC4 3;  5LC6 A;  5DRV A;  3SLU A;  3WOE B;  2LT2 A;  5IEP A;  3CPW 2;  1O7M B;  3T0U A;  2Q9J A;  3EDN A;  4RBN A;  2ZL8 A;  2OQE C;  5A0O B;  4K7X A;  3FLJ A;  1CYV A;  3U97 A;  1M9G A;  4RNY A;  4O3V A;  4NRE A;  3CCU 3;  2W0Q A;  2GKJ A;  3AMO A;  1NDO B;  3G8Z A;  1VQM 3;  3D9R A;  2HMO B;  1FUW A;  1EQK A;  3IGH X;  3G0K A;  3EJX A;  2C10 A;  1W6C A;  1E97 A;  3G6E 3;  4O8S A;  1IVW A;  1TP6 A;  1T5Y A;  4Q60 A;  5KP1 A;  3SX1 A;  1N5H A;  4HM3 B;  1JRQ A;  4H61 A;  1IT7 A;  2XFS A;  2PZV A;  4LSO A;  4XB5 A;  5I97 A;  4LEH A;  2IW4 A;  2GU1 A;  1Z1S A;  3LH4 A;  5HGR A;  3LTD A;  1WMO A;  2PW0 A;  2C11 A;  1N5P A;  4R9L A;  5D83 A;  3CC2 3;  1QAK A;  1E3R A;  2RCD A;  3LT8 A;  3FG4 A;  1Q40 A;  1S72 3;  2WGO A;  4HYZ A;  1NB5 I;  1W5Z A;  5IER A;  3NHX A;  3PW9 A;  3F7X A;  3WA2 X;  1WMP A;  3SOA A;  1M1K 4;  2CG0 A;  4HJL B;  8CHO A;  3H3H A;  2OTN A;  2ZXR A;  3CCQ 3;  3CCV 3;  3DUK A;  3X40 A;  4K61 A;  4O02 B;  2STD A;  3F14 A;  1C7H A;  2BNG A;  2D42 A;  2YFL B;  1ISK A;  4EV5 A;  4OUQ A;  5M47 A;  3EE1 A;  2IUJ A;  1OHO A;  4EXR A;  2ML5 A;  4WYK B;  1TU5 A;  3NBJ A;  4RZM A;  4L8O A;  3IJE B;  4WHA A;  1NU3 A;  3FSD A;  3M8C A;  4HM1 B;  4HM0 B;  1S7J A;  1IV9 A;  5H2Y A;  1ZX2 A;  1WMN A;  3EKM A;  5AEW B;  3CME 3;  3V92 A;  3DGN A;  2GU3 A;  1DYU A;  3E99 A;  3FGY A;  4IIA A;  4MMX B;  1TUH A;  2CKF B;  2Q9H A;  2IMJ A;  3DEV A;  3NBR A;  2Z76 A;  3N8B A;  4RPA A;  3H51 A;  3Q1C A;  2ZVF A;  3SXX A;  4HM8 B;  3N54 B;  3BNB A;  3OV4 A;  2MC8 A;  3HII A;  1ZO2 A;  3DZL A;  4K8L A;  3NM7 A;  4EYC A;  3CMA 3;  4FCM A;  1FGT A;  2P38 A;  1UUW B;  2BT3 A;  1OHS A;  3GWR A;  3DM8 A;  4J8T A;  1GS3 A;  2HMK B;  1FGO A;  2QA4 3;  1JB2 A;  3SOY A;  3DMC A;  5IG4 A;  1N8R 4;  2MPB A;  1W6G A;  1LXE A;  3F40 A;  2CWV A;  3WDG B;  1GD3 A;  2Q07 A;  2A15 A;  4JD7 A;  1ASK A;  2XFT A;  4N6O B;  1JKG A;  1KC8 4;  1HKX A;  1IQY A;  4QWT A;  1VQ5 3;  4N6T A;  2GEX A;  5EVH A;  3MYT A;  1YJW 3;  3JUN A;  5AIH A;  4JUU A;  2IA7 A;  1RRL A;  1WPM A;  2Y73 A;  4PY9 A;  4OK0 A;  1W2Z A;  2W56 A;  5IG0 A;  1Q81 4;  1OPY A;  2W04 A;  3GZR A;  3FVE A;  3CU3 A;  3FH1 A;  1NJI 4;  3RDE A;  2ZXP A;  4Q2H A;  3G98 A;  1JNQ A;  3DGL A;  5CF1 A;  3NV0 A;  1NB3 I;  1O7W B;  2XR8 B;  5CXO A;  4BTW A;  4OVM A;  3FKA A;  1LOX A;  4G1M B;  1UI8 A;  1TM0 A;  2EB0 A;  3O8Y A;  2B1X B;  1Q86 4;  3MG2 A;  3PGB A;  3EJV A;  2XRX B;  5AYS C;  2P0M A;  2XSO B;  3JUO A;  3L0R A;  4KFF A;  4LZI A;  5D81 A;  4R9K A;  1MNL A;  1VQ8 3;  1SJW A;  2P0X A;  4IPB A;  3PTJ A;  1TFO A;  1QVG 2;  2HMJ B;  3OWU A;  3F8H A;  1JB5 A;  3LXU X;  1RKY A;  2GBX B;  2P05 A;  4MEI A;  3MG1 A;  3GRD A;  4J9X A;  3FF2 A;  3PCS A;  4ORL A;  2QB8 A;  2M7O A;  5AEU B;  3D3L A;  1OCV A;  1RN7 A;  1V74 A;  3KKG A;  2WGQ A;  3OWY A;  4WWU C;  1KQS 2;  4I4K A;  3WA3 A;  4IJZ A;  2XEP A;  3X3Y A;  7STD A;  1Q82 4;  4EV2 A;  3KE7 A;  1K41 A;  2OOV A;  1U1W A;  3X41 A;  2R4I A;  1K73 4;  2CWT A;  3MWZ A;  2B24 B;  3KII A;  2HMN B;  5CLK A;  2KPT A;  4GL6 A;  4HBR A;  3S67 A;  1CQS A;  2LYX A;  3STD A;  3LTB A;  3NXJ A;  2XGN A;  1N8Q A;  1OGX A;  2KRT A;  1Y4K A;  1OAC A;  5AI1 A;  2OQE A;  1KD1 4;  4N6L A;  2QGU A;  1ULJ B;  5IF6 A;  1W6Y A;  3GZX B;  3MSO A;  1IK3 A;  3BLZ A;  4EBG A;  3CNX A;  4JRF A;  4N6N B;  3PXM A;  1TIJ A;  3OXA A;  3LML A;  4R1K A;  5BXQ A;  2W2C A;  1EA2 A;  2CHC A;  2JQ5 A;  4LG3 A;  3K0Z A;  3EF8 A;  1R4C A;  4LS9 A;  3N9H A;  3U1W A;  1VQ9 3;  2CIU A;  3V98 A;  1SIH A;  3GZY B;  1OUN A;  4L8P A;  2XH9 A;  5AIG A;  1QVF 2;  3IPT A;  4STD A;  3PVH A;  3QRD A;  3NBB A;  2YMA A;  4EC6 A;  1QAL A;  4LMI A;  1IVU A;  4XM4 A;  1SPU A;  4JBD A;  4CCV A;  3EHC A;  1W61 A;  2O9U X;  1VQO 3;  5ANP A;  1RJO A;  2CW9 A;  3B7C A;  5KP3 A;  4K1V A;  4RNZ A;  2L4V A;  2XSH B;  4HM7 B;  1VQL 3;  4K7G B;  1US1 A;  3JUM A;  3NX0 A;  1TFK A;  3IMA B;  1KSI A;  1U8C B;  4XDV A;  4AKY A;  3NM2 A;  2ZDJ A;  3FZW A;  1K9M 4;  5BVB A;  3CCE 3;  3KN4 A;  2JDI H;  3LYG A;  1T6K A;  3DXO A;  5D82 A;  5EEO A;  1IU7 A;  1DMN A;  2BMR B;  2SBL A;  1A90 A;  5TGN A;  1JN5 B;  1F8N A;  3CNM A;  4FCZ A;  1OF5 B;  1VQK 3;  3UJM A;  4LB0 A;  1SII A;  1IVV A;  1U5O A;  2OWP A;  1AR0 A;  3UL6 A;  2CWU A;  4BTY A;  1JB4 A;  4WYK A;  1AV4 A;  5JBS A;  1CEW I;  1GYB A;  1ULI B;  4R4K A;  1O7N B;  4Q53 A;  5EQL A;  3T8U A;  1AVL A;  4XBX A;  4O2H A;  2HML B;  4R80 A;  3K63 A;  3S28 A;  3ALA A;  1OHP A;  3EBY A;  1STF I;  2ENX A;  2YFJ B;  2RSX A;  1JJ2 2;  1VQ7 3;  5ELJ A;  2INX A;  5ELU A;  1W4N A;  2FGT A;  3LTA A;  3I56 3;  4N6U A;  3VGN A;  2HAW A;  1FGR A;  1KWI A;  3HZP A;  3KSE D;  2Y74 A;  2CK3 H;  4XDW A;  2W56 B;  3OW2 2;  2KCD A;  2YX9 A;  4HM4 B;  5IG5 A;  4KFE A;  1RRH A;  1W62 A;  2W9Q A;  3HX8 A;  1YIT 3;  4HZB B;  2OTJ 3;  5JPU A;  1IV7 A;  2CFW A;  2PNC A;  1U0K A;  1VQ4 3;  2E2V A;  4FMD A;  4K1U A;  4KZ1 A;  3S27 A;  2QEX 3;  1DVD A;  1O7P B;  5IW9 A;  3DGO A;  1NO3 A;  1PU4 A;  3B4O A;  3GZB A;  3K5T A;  1UW1 A;  1W01 A;  1ROV A;  1IQX A;  3G16 A;  3KSP A;  4HM5 B;  1K23 A;  3T8N A;  1A2V A;  5AYR B;  2O3O A;  5HA4 A;  4J9W A;  2I9W A;  3TDG A;  4HVN A;  3LZA A;  3EN8 A;  3BND A;  2P09 A;  2W03 A;  1DMQ A;  3G71 3;  4U13 A;  5IEO A;  4MMY B;  1GD4 A;  5LC7 A;  1FA3 A;  4N6M A;  1D6Z A;  4FMA A;  2WOH A;  3ER7 A;  1VQP 3;  3JUQ A;  3MHE A;  2CFD A;  1UI7 A;  1XUA A;  3AMO B;  3LT9 A;  2QIY A;  3ICJ A;  2IUK A;  4N3V A;  3W5W A;  1VQN 3;  1D6U A;  1YVB I;  1LNH A;  2KXG A;  3CCS 3;  4FCJ A;  3A76 A;  1G96 A;  2RFR A;  3HI7 A;  3BNE A;  3CCM 3;  2UX0 A;  1E3V A;  3QK9 A;  1S5A A;  1OGZ A;  2CG1 A;  1YIJ 3;  2E2T A;  3Q2P A;  3I55 3;  3EC9 A;  3V99 A;  3CC7 3;  3FG3 A;  1DVC A;  4NHF A;  3WQZ A;  3CCL 3;  1D6Y A;  5FW5 A;  1SQW A;  2H9F A;  3S29 A;  1CYU A;  3B4P A;  4CDL A;  1Q40 B;  1YI2 3;  2F86 B;  3DGM A;  4HM6 B;  1PFP A;  4GB5 A;  5AIF A;  3WOD G;  3FF0 A;  3MG3 A;  4L7K A;  3JUP A;  4XBT A;  1NWW A;  3I0Y A;  3DY5 A;  4FMC A;  2WO0 A;  1N9J A;  3EBT A;  2ZXO A;  1N9E A;  3UNL A;  3VF1 A;  1FGQ A;  5IWE A;  1STD A;  3RGR A;  3CXC 2;  2Z77 A;  3FCS B;  3UL5 A;  3F7S A;  1WNH A;  2BMO B;  5JPP A;  5DRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...