4GL6A

Crystal structure of a duf5037 family protein (rumgna_01148) from ruminococcus gnavus atcc 29149 at 2.55 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
EISIKIETYLQEEYGEEFEVLSWNQPKLLPSDNGAIYATCISKNDPKHPFEGSYFNPEEPNSEIEIIYDGYGQRLLAKQMESMIEEAISQAAENYYIQGDIIIPEEWQDIPVEEISQWKNYVDLCNQSNSDYKTLGSAWVYIDASTMKGKTDEEEYQMYEEVYRDKLGGQALLYVYYLDHKSFEKAEKILEIFTSGDEGSNFEDIIEGQPYFGTIMRYGSDKFDDNLEIFKAAKQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (RUMGNA_01148) from Ruminococcus gnavus ATCC 29149 at 2.55 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 68
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16440 DUF5037 Domain of unknown function (DUF5037)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.80 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4gl6A02
3.10.450.570 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4gl6A01
4GL6A
chains in the Genus database with same CATH superfamily
3L0RA 1YJ93 4HVNA 1GD3A 1OGZA 1LQGC 2E2VA 2OCTA 4RNYA 3G713 3URPA 1FGMA 1WNHA 2PNCA 5IEPA 1T5YA 1GQZA 4HJLB 4HZBB 3T0UA 1G96A 5EEOA 2W0QA 4Q2HA 4I4KA 5AEUB 1MWSA 1IVWA 3Q90A 2WGOA 3NXJA 7RNTA 1EQKA 4K1UA 1C7HA 3MHEA 4LEHA 2F5WA 2Q9JA 5M47A 2CKFB 2ML5A 3F9SA 5STDA 3HIIA 4BL2A 1RNTA 2XR8B 5M1AA 3X3XA 4CCVA 5ELUA 3FSDA 1S7JA 3SOAA 3RGRA 1YNVX 5IF6A 3G98A 1BAOA 4X2OA 4RZMA 5A0OB 3LMLA 4Q60A 2CWTA 3OX9A 6RNTA 1YGEA 1I74A 1RJOA 3DY5A 2FGTA 2UX0A 3CCJ3 5D82A 3EJXA 2W56B 3BIRA 3GSPA 2GKEA 4MMZB 1B2ZA 2IY2A 1US1A 2W2CA 3JUNA 2CG0A 3LTBA 2L1SA 2LQVA 3MSOA 3LXUX 3CCS3 1LRAA 4PY9A 1BNSA 1IU7A 3LTAA 4R80A 2MC8A 2Y74A 5IEOA 4JCIA 3DGMA 4N6MA 1IQ8A 1BRNL 4EV2A 3NBRA 2W56A 3IPTA 1WMPA 2BHMA 3HX8A 1FZUA 1RTUA 1BRHA 1D6ZA 3NBBA 3CC73 3OW22 3CCV3 1PU4A 1PYLA 1RCKA 1WPMA 3BB9A 1K41A 1VQ73 4IJZA 3RGAA 1CEWI 1XUBA 3DZLA 1MNLA 4GSPA 2ZXOA 1U1XA 3PS8A 1M904 4L8OA 1IT8A 2RGQA 1MWRA 1QJGA 2WOHA 1OPYA 4N6V0 3MG1A 4ILFA 4CJNA 3X3ZA 3KSPA 1YM5A 2RNTA 1AV4A 1CH0A 4K1VA 1ZX2A 5G2GA 1IK3A 3WR2A 4XB5A 2IMJA 4WYKB 3EJVA 1QYAA 2Z76A 4FMDA 4I5QA 3ZFZA 2H0IA 1O7WB 2F4YA 1Q7Y4 3DGLA 3FKAA 3EKMA 3FF0A 4MMXB 1DMNA 2PW0A 3CCL3 3SLUA 1Q814 1YJW3 4K61A 1UUGB 2GKJA 3B8LA 2PZVA 1X1WA 2CHCA 1A67A 1VQ43 2CWVA 1LOWA 3B4OA 1JN5A 2F98A 2OTNA 2RFRA 2BO9B 1UUWB 1ROAA 1BOXA 1NJI4 2YMAA 1OCVA 2AAEA 2UUGC 3AHWA 1FUWA 2ZA4A 3LYGA 3G7KA 1K28A 2C4BA 1QALA 1B3SA 1TRQA 3AGOA 1DMMA 1I2FA 3GZRA 1YIT3 2YX9A 1TTOA 1RRHA 1K23A 1I3FA 3PVHA 1WMNA 1VQK3 2CIUA 1E3RA 1UCJA 3EBTA 3UL5A 2P0XA 1UUVB 5AIFA 4FCMA 5CK6A 3S29A 2KF3A 4WWUC 5CLKA 3X3YA 2GBWB 2CG1A 1KWIA 2GBXB 2XEPA 3DMCA 3O8YA 2GEXA 3EN8A 1O7PB 5IWEA 1U1VA 3LT8A 9RNTA 1OACA 3K63A 1BANA 2SARA 2QB7A 1VQM3 5HGRA 1GMRA 4JF8A 3G4S3 3KSED 1YHQ3 2CX1A 2RCDA 3NUVA 1LNIA 1HU9A 3UJMA 1UGHI 3KKGA 1J2BA 1BNJA 3PXMA 3NM2A 5KP1A 1W02A 3IGHX 5AIHA 4RNTA 3SXXA 2D1WA 3DEVA 4JRFA 3OV4A 1OF5B 1RGLA 4RBNA 3PCRA 4IPBA 4EXRA 1DYUA 4IK0A 3IJEB 1M1K4 1BSEA 1DVCA 1FA3A 3G8ZA 3CU3A 1FYSA 1GY7A 1Z1SA 1HZ1A 1JB4A 4ORLA 1V58A 3HK4A 1YJN3 4HZ9B 1IDPA 2WOFA 1O7NB 1U8CB 4MMYB 4N6OB 4EC6A 5BIRA 1YIJ3 1QVG2 3NX0A 3OWSA 1BRIA 6STDA 4KT3B 1I8VA 2YFIB 4NPBA 5IENA 1ULIB 3DUKA 3F7XA 3JUMA 4O3VA 3PTJA 5CXOA 4AKYA 1Q42A 4BU4A 2C10A 4BL3A 3DH2A 1E97A 5AIGA 3FF2A 5DRVA 2PVZA 3D5IA 4DKIA 4LG3A 5HOHA 5H2GA 1RGEA 2W9PA 1GY5A 5IG3A 3DGNA 2KF4A 4XDWA 1VQ83 3F8XA 4J5KA 4QWTA 4BTYA 4FR9A 4PEJA 1IQYA 1OHPA 4N6NB 3GZXB 1GMQA 3G6E3 1LVNA 4EYCA 5IG5A 5M18A 2I9WA 1SIIA 3EHCA 1JKGA 2JDIH 5KP3A 4L8PA 3LT9A 4GL6A 1JRQA 5G1LA 4EV5A 6GSPA 1B2XA 3NM7A 1KSIA 4HM1B 1LOXA 1R4YA 2B1XB 1G0TA 1RNBA 3WHOA 5JPPA 3D79A 4LYLB 3D4AA 3B7CA 3DGOA 1BNIA 1RN7A 1OF5A 2CFGA 4R9KA 1X1YA 4TX4A 5GSPA 1ZGXA 1D6UA 1RN4A 3Q2PA 4HM4B 1ROVA 3FZWA 1PFPA 4HM6B 1AR0A 4Q53A 4HM5B 2IW4A 1MWUA 3EN1B 1LOYA 2Z6BA 3GRDA 5FW5A 3FCSB 2ZHXB 2KF5A 5BVBA 1DETA 1BWZA 1WQLB 2GEYA 2HMMB 2K0MA 4HM8B 3VGNA 3WOFB 1OH0A 3UB1A 2HOHA 2YFJB 3WA2X 3UL6A 1JN5B 1K8A4 4BTWA 3EDNA 2CW9A 4R1KA 3FVEA 4OVMA 3BLZA 4L7KA 3S5CA 1NB3I 3TDGA 1N8R4 2GU3A 3BU4A 2GXFA 1I3IA 1A90A 1W6YA 3NQZA 3EBYA 3H3HA 4K90B 3HZPA 4LS9A 2E2TA 4KFDA 4MEIA 3V99A 2OTJ3 4KZ1A 1TM0A 1AVKA 1O7GB 1B2UA 3CPOA 3PZWA 3V98A 2XFSA 1B2MA 1S5AA 4U13A 3H51A 1JBSA 1BSAA 2P38A 3KFQC 4WYKA 4EBGA 2O9UX 4K7GB 1GD4A 1EG9B 1JZDA 3JUOA 5D81A 3PGBA 1OGXA 4HM3B 1RGHA 2XGNA 4KVHA 1UCLA 1RGKA 1TFOA 5JPUA 2W04A 4LB0A 1B27A 1GYBA 1UCKA 1JBTA 3HOHA 4AEQA 1TU5A 1N9EA 1NB5I 3BNEA 4BTXA 4J9AA 1F8NA 5EQLA 1UGIA 1SQWA 4H3UA 2F86B 1NDOB 1DVDA 2CK3H 1RLSA 2AADA 1NO3A 2AZPA 1IVXA 1BNEA 3Q1CA 1QY9A 1QAFA 3I0YA 3RDEA 3K5TA 1EUIC 4J9XA 1RGAA 3MPHA 1N5HA 3D5GA 3SEDA 1BRKA 3FG1A 2O3OA 3ECFA 1M1XB 2KCDA 1BSBA 1W00A 3D3LA 3S67A 2BMOB 4HM2B 5IG0A 5KP4A 4HBRA 1Q40B 2H0HA 4LSOA 1V57A 5M19A 1A2VA 2QB6A 2XGLA 3KN4A 1IR6A 2Z7AA 1IV7A 1PY3A 3CNXA 1VQO3 1AQZA 2XSOB 4LZIA 1MGWA 3S28A 1I2EA 1W61A 1I2GA 1T3BA 1Q40A 1I0VA 1WPPA 5G1KA 2QB8A 2QA43 2QGUA 1NWWA 1OHSA 2FNQA 1UW1A 2WO0A 3RNTA 1SDJA 1I70A 1W6CA 3CC23 1R4CA 1W5ZA 1Q824 1VQ63 1DE3A 1MOLA 1RDSA 3M8CA 4STDA 5CF2A 2W03A 1BSDA 1FGQA 3QRDA 3EQQB 1E3VA 2B24B 2K3DA 3F8HA 1STFI 4GHOA 3NHXA 1A2KA 1BRSA 1JV2B 1X1UA 4KFFA 3U1WA 3X42A 1GMPA 3ZG0A 1Y4KA 4JBDA 3FLJA 3G0KA 3GZYB 1VQN3 2HMKB 1N8QA 3WOEB 2Q07A 3ICJA 1VQQA 1YVSA 2D42A 1Q7HA 3LTDA 1ASKA 2UGIA 4K7XA 2P05A 3FG4A 1EEJA 4XBYA 3FH1A 4O8SA 1T2IA 4K8LA 4HM7B 2K54A 3KIIA 3JUQA 5BXQA 2KAAA 1N9JA 1FW7A 2GSPA 1IVVA 2L4VA 4FCJA 3CXC2 1SIHA 1RKYA 3CCE3 1C54A 1EKMA 1BUQA 4FCZA 4OK0A 7STDA 1O7HB 1BNFA 3FG3A 1X1XA 1UDII 4H61A 4LMIA 3J7Yd 2BNGA 1S723 2ZXRA 1IT7A 2RSXA 4LGQA 3K9MC 3LZAA 3OXAA 1MWTA 4HM0B 3WMDA 1V74A 2GU1A 3E99A 1UCIA 1AVLA 3F14A 1GOUA 5AYRB 3STDA 5BU4A 1XUAA 1QMAA 4HKVB 2HAWA 4FMBA 1VZZA 1B20A 3KCHA 2XFTA 3NBJA 2QIYA 3SYUA 1G02A 2J8XB 2F56A 1RGFA 2EB0A 2ENXA 2CFKA 2W9QA 3AMOB 3JVCA 2IYJA 5IW9A 3NV0B 2KF6A 2LT2A 2V1LA 3ALAA 2IUJA 4RPAA 1WTHA 3CPW2 1CYUA 5AIIA 2CFLA 1U5OA 1GS3A 3CCU3 1JB5A 1OUNA 1WMOA 1U1WA 2CX0A 2INXA 3EX9A 3PYJA 3Q3FA 4N3VA 3HI7A 3OWUA 3X40A 2R4IA 3D9RA 5EVHA 5ANPA 1T6KA 2Y73A 1B21A 1KC84 4HOHA 4JD7A 1ZO2A 3KE7A 5FGOA 1W6GA 1NNVA 3GZBA 3UNLA 2W6JH 3IMAB 4FMCA 3ZG5A 2R41A 4AKZA 1RGGA 1O7MB 1TJDA 2E2UA 2MF7A 2HMJB 3BNBA 4OUQA 3SVAA 4BIRA 1K9M4 1FGRA 4WP5A 3I563 4IT7A 1FUTA 1VQP3 5AEWB 2BMRB 1L5GB 1TP6A 2HMLB 3ER7A 1IV9A 1MGRA 2CWUA 1BSCA 3N8BA 3VSYA 1RCLA 4KFEA 1QVF2 4DUNA 4ZM8A 1GOVA 2OQEC 1YVBI 3X41A 5HA4A 2ZXPA 2ZVFA 1BVIA 2CFWA 2FXTA 1I0XA 2CC3A 3DM8A 4WFOA 2OTL3 3N9HA 1OHOA 3BNCA 1RSNA 2SBLA 3MG3A 1FGTA 1IYYA 1GOYA 1TFKA 2WGQA 3AHSA 1SARA 3B4PA 1IVUA 1HKXA 1JKGB 1RN1A 3MG2A 1CYVA 2BT3A 2H9FA 3VF1A 4WHAA 2BMQB 1M9GA 4R4KA 4CPKA 3OWYA 1BU4A 5IERA 5AI1A 4R9LA 3CMA3 3T8NA 8RNTA 3MKIA 4HYZA 3I553 1TUHA 2MPBA 1BNGA 2OWPA 3AGNA 5ELJA 1W2ZA 1YGWA 8CHOA 5TGNA 2A15A 5AYSC 1UI8A 1GY6A 1RRLA 4IIAA 7GSPA 1W01A 1VQ93 3WODG 3DXOA 1KQS2 1RMSA 1U0KA 1BRGA 2BIRA 4XBTA 3WQZA 4FMAA 4N6TA 2Q9HA 4JUUA 3K0ZA 3DGYA 1SPUA 1W4NA 2KXGA 2OOVC 3CD63 1STDA 3S27A 3MYTA 1BRJA 1ZS7A 2KPTA 2F99A 3WDGB 2P0MA 1BNRA 3QK9A 1BUJA 1FUSA 2KW7A 4J5GA 5DREA 2JQ5A 5LC7A 3SX1A 3WA3A 1VQL3 2Z77A 1B2SA 3CNMA 3MWZA 3K7CA 3V92A 5I97A 3A76A 5D83A 3F7SA 1VQ53 4EW5A 5LC6A 3HIGA 1AY7A 1K20A 1LNHA 1QAKA 3W5WA 3CCR3 4XM4A 1JZOA 3EB8A 1W7CA 2STDA 1RGCA 1Q9EA 3CCM3 1LOVA 2H0GA 3N54B 3CME3 1SJWA 2XF3A 3BNDA 4HAAA 3LH4A 1DMQA 3U97A 3KZTA 5CF1A 1LXEA 4NHFA 1D6YA 2C11A 2KRTA 2XRXB 4J8TA 1ULJB 5RNTA 4X2HA 5JBSA 1JB2A 4J9WA 3NQYA 4N6LA 2YFLB 1W62A 2BU4A 1JBRA 3EC9A 4O02B 3LOYA 5IG4A 3CCQ3 3GAXA 3A5EA 2P09A 3SOYA 2ZDJA 3GWRA 4GB5A 2HMOB 1Q864 2RBIA 1JNQA 2OOVA 1T2HA 3EE1A 5H2YA 1LQMB 2HMNB 2OQEA 1CQSA 3CC43 4CDLA 2ZL8A 2ML6A 1GSPA 3JUPA 1BIRA 4MJDA 1EA2A 1FGOA 4OA3A 4XBXA 3ROBA 1UI7A 1YI23 1ISKA 3G16A 4G1MB 3EF8A 2IUKA 1RHLA 3FGYA 2F5MA 4N6UA 2CH9A 4XDVA 1K734 1KD14 1W2B2 1N5PA 2XSHB 3NV0A 1IQXA 2CFDA 3PW9A 2IA7A 3F40A 3AMOA 2XH9A 3T8UA 3LTCA 2LYXA 1BGSA 2M7OA 4O2HA 4RNZA 1A2PA 1JJ22 2QEX3 1NU3A 1TIJA 4NREA 3PCSA 1HYFA 1TRPA
chains in the Genus database with same CATH topology
3L0RA 1YJ93 4HVNA 1GD3A 1OGZA 2E2VA 2OCTA 4RNYA 3G713 1FGMA 1WNHA 2PNCA 5IEPA 1T5YA 1GQZA 4HJLB 4HZBB 3T0UA 1G96A 5EEOA 2W0QA 4Q2HA 4I4KA 5AEUB 1IVWA 3Q90A 2WGOA 3NXJA 1EQKA 4K1UA 1C7HA 3MHEA 4LEHA 2Q9JA 5M47A 2CKFB 2ML5A 3F9SA 5STDA 3HIIA 3X3XA 2XR8B 4CCVA 5ELUA 3FSDA 1S7JA 3SOAA 3RGRA 5IF6A 3G98A 4X2OA 4RZMA 3LMLA 4Q60A 2CWTA 3OX9A 1YGEA 1I74A 1RJOA 3DY5A 2FGTA 2UX0A 3CCJ3 5D82A 3EJXA 2W56B 4MMZB 2GKEA 3JUNA 2W2CA 1US1A 2CG0A 3LTBA 2LQVA 3MSOA 3LXUX 3CCS3 4PY9A 1IU7A 3LTAA 4R80A 2MC8A 2Y74A 5IEOA 4JCIA 3DGMA 4N6MA 1IQ8A 4EV2A 3NBRA 2W56A 3IPTA 1WMPA 2BHMA 3HX8A 1D6ZA 3CC73 3NBBA 3OW22 3CCV3 1PU4A 1VQ73 1WPMA 3BB9A 1K41A 4IJZA 3RGAA 1CEWI 1XUBA 3DZLA 1MNLA 2ZXOA 1U1XA 3PS8A 1M904 4L8OA 1IT8A 2RGQA 1QJGA 2WOHA 1OPYA 4N6V0 3MG1A 3X3ZA 3KSPA 1YM5A 4K1VA 1AV4A 1ZX2A 5G2GA 1IK3A 4XB5A 2IMJA 4WYKB 3EJVA 1QYAA 2Z76A 4FMDA 1O7WB 1Q7Y4 3DGLA 3FKAA 3EKMA 3FF0A 4MMXB 1DMNA 2PW0A 3CCL3 3SLUA 1Q814 1YJW3 4K61A 2GKJA 3B8LA 2PZVA 1A67A 2CHCA 1VQ43 2CWVA 3B4OA 1JN5A 2F98A 2OTNA 2RFRA 2BO9B 1UUWB 1ROAA 1NJI4 2YMAA 1OCVA 1FUWA 3LYGA 3G7KA 1K28A 1QALA 1YIT3 3GZRA 1DMMA 2YX9A 1RRHA 1K23A 3PVHA 1WMNA 1VQK3 2CIUA 1E3RA 3UL5A 3EBTA 2P0XA 1UUVB 5AIFA 4FCMA 5CK6A 3S29A 5CLKA 4WWUC 3X3YA 2GBWB 2CG1A 1KWIA 2GBXB 2XEPA 3DMCA 3O8YA 2GEXA 3EN8A 1O7PB 5IWEA 1U1VA 3LT8A 1OACA 3K63A 2QB7A 1VQM3 5HGRA 4JF8A 3G4S3 3KSED 1YHQ3 2RCDA 3NUVA 1HU9A 3UJMA 3KKGA 1J2BA 3PXMA 3NM2A 5KP1A 1W02A 3IGHX 5AIHA 3SXXA 2D1WA 3DEVA 4JRFA 3OV4A 1OF5B 4RBNA 3PCRA 4IPBA 4EXRA 1DYUA 4IK0A 3IJEB 1M1K4 1DVCA 1FA3A 3G8ZA 3CU3A 1GY7A 1Z1SA 1JB4A 4ORLA 3HK4A 1YJN3 4HZ9B 1IDPA 2WOFA 1O7NB 1U8CB 4MMYB 4N6OB 4EC6A 1YIJ3 1QVG2 3NX0A 3OWSA 6STDA 2YFIB 5IENA 1ULIB 3DUKA 3F7XA 3JUMA 4O3VA 3PTJA 5CXOA 4AKYA 1Q42A 2C10A 1E97A 5AIGA 3FF2A 5DRVA 2PVZA 4LG3A 5H2GA 2W9PA 1GY5A 5IG3A 3DGNA 4XDWA 1VQ83 3F8XA 4QWTA 4BTYA 4FR9A 4PEJA 1IQYA 1OHPA 4N6NB 3GZXB 3G6E3 1LVNA 4EYCA 5IG5A 2I9WA 1SIIA 3EHCA 1JKGA 2JDIH 5KP3A 4L8PA 3LT9A 4GL6A 1JRQA 4EV5A 3NM7A 1KSIA 4HM1B 1LOXA 2B1XB 5JPPA 3DGOA 3B7CA 1RN7A 1OF5A 2CFGA 4R9KA 4TX4A 1D6UA 3Q2PA 4HM4B 1ROVA 3FZWA 1PFPA 4HM6B 1AR0A 4Q53A 4HM5B 2IW4A 5FW5A 3EN1B 2Z6BA 3GRDA 3FCSB 5BVBA 3WOFB 1BWZA 1WQLB 2GEYA 2HMMB 2K0MA 4HM8B 3VGNA 1OH0A 3UB1A 3WA2X 2YFJB 3UL6A 1JN5B 1K8A4 4BTWA 3EDNA 2CW9A 4R1KA 3FVEA 4OVMA 3BLZA 4L7KA 3S5CA 1NB3I 3TDGA 1N8R4 2GU3A 2GXFA 1A90A 1W6YA 3NQZA 3EBYA 3H3HA 4K90B 3HZPA 4LS9A 2E2TA 4KFDA 4MEIA 3V99A 2OTJ3 4KZ1A 1TM0A 1AVKA 1O7GB 3CPOA 3PZWA 3V98A 2XFSA 1S5AA 4U13A 3H51A 2P38A 3KFQC 4WYKA 4EBGA 2O9UX 4K7GB 1GD4A 1EG9B 3JUOA 5D81A 3PGBA 1OGXA 4HM3B 2XGNA 4KVHA 1TFOA 5JPUA 2W04A 4LB0A 1GYBA 4AEQA 1TU5A 1N9EA 1NB5I 3BNEA 4BTXA 4J9AA 1F8NA 5EQLA 4H3UA 1SQWA 2F86B 1NDOB 1DVDA 2CK3H 1NO3A 2AZPA 1IVXA 3Q1CA 1QY9A 1QAFA 3I0YA 3RDEA 3K5TA 4J9XA 3MPHA 3SEDA 1N5HA 3FG1A 2O3OA 3ECFA 1M1XB 2KCDA 1W00A 3D3LA 3S67A 2BMOB 4HM2B 5IG0A 5KP4A 4HBRA 1Q40B 4LSOA 1A2VA 2QB6A 2XGLA 3KN4A 1IR6A 2Z7AA 1IV7A 3CNXA 1VQO3 2XSOB 4LZIA 3S28A 1W61A 1Q40A 1WPPA 2QB8A 2QA43 2QGUA 1NWWA 1OHSA 2FNQA 1UW1A 2WO0A 1SDJA 1W6CA 3CC23 1R4CA 1W5ZA 1Q824 1VQ63 1MOLA 3M8CA 4STDA 5CF2A 2W03A 1FGQA 3QRDA 3EQQB 1E3VA 2B24B 3F8HA 1STFI 3X42A 3NHXA 1A2KA 1JV2B 4KFFA 3U1WA 1Y4KA 4JBDA 3FLJA 3G0KA 3GZYB 1VQN3 2HMKB 1N8QA 3WOEB 2Q07A 3ICJA 2D42A 3LTDA 1ASKA 3FG4A 4K7XA 2P05A 4XBYA 3FH1A 4O8SA 4K8LA 4HM7B 2K54A 3KIIA 3JUQA 5BXQA 1N9JA 1IVVA 2L4VA 4FCJA 3CXC2 1SIHA 1RKYA 3CCE3 1EKMA 1BUQA 4FCZA 4OK0A 7STDA 1O7HB 3FG3A 4H61A 3J7Yd 4LMIA 1S723 2BNGA 2ZXRA 1IT7A 2RSXA 4LGQA 3K9MC 3LZAA 3OXAA 4HM0B 3WMDA 1V74A 2GU1A 3E99A 1AVLA 3F14A 5AYRB 3STDA 1XUAA 1QMAA 4HKVB 2HAWA 4FMBA 1VZZA 2XFTA 3NBJA 2QIYA 2EB0A 2ENXA 2CFKA 2W9QA 3AMOB 3JVCA 5IW9A 3NV0B 3CPW2 2LT2A 2V1LA 3ALAA 2IUJA 4RPAA 1WTHA 1CYUA 5AIIA 2CFLA 1U5OA 1GS3A 3CCU3 1JB5A 2INXA 1OUNA 1U1WA 1WMOA 3EX9A 3PYJA 4N3VA 3X40A 3HI7A 3OWUA 2R4IA 3D9RA 5EVHA 5ANPA 1T6KA 2Y73A 1KC84 4JD7A 1ZO2A 3KE7A 5FGOA 1W6GA 3GZBA 3UNLA 2W6JH 3IMAB 4FMCA 4AKZA 1O7MB 2E2UA 2MF7A 2HMJB 3BNBA 4OUQA 3SVAA 1K9M4 1FGRA 4WP5A 3I563 4IT7A 1VQP3 5AEWB 2BMRB 1L5GB 1TP6A 2HMLB 3ER7A 1IV9A 2CWUA 3N8BA 3VSYA 4KFEA 1QVF2 4DUNA 4ZM8A 2OQEC 1YVBI 3X41A 5HA4A 2ZXPA 2ZVFA 2CFWA 2FXTA 3DM8A 4WFOA 2CC3A 2OTL3 3N9HA 1OHOA 3BNCA 2SBLA 3MG3A 1FGTA 1TFKA 2WGQA 3B4PA 1IVUA 1HKXA 1JKGB 3MG2A 1CYVA 2BT3A 2H9FA 3VF1A 4WHAA 2BMQB 1M9GA 4R4KA 3OWYA 5IERA 5AI1A 4R9LA 3CMA3 3T8NA 3MKIA 4HYZA 3I553 2MPBA 1TUHA 2OWPA 5ELJA 1W2ZA 8CHOA 5TGNA 2A15A 5AYSC 1UI8A 1GY6A 1RRLA 4IIAA 1W01A 1VQ93 3WODG 3DXOA 1KQS2 1U0KA 4XBTA 3WQZA 4FMAA 4N6TA 2Q9HA 4JUUA 3K0ZA 1SPUA 1W4NA 2KXGA 2OOVC 3CD63 1STDA 3S27A 3MYTA 3WDGB 2KPTA 2F99A 2P0MA 3QK9A 2KW7A 5DREA 2JQ5A 5LC7A 3SX1A 3WA3A 1VQL3 2Z77A 3CNMA 3MWZA 3V92A 3K7CA 5I97A 3A76A 5D83A 3F7SA 1VQ53 5LC6A 3HIGA 1K20A 1LNHA 1QAKA 3W5WA 3CCR3 4XM4A 3EB8A 1W7CA 2STDA 3CCM3 3N54B 3CME3 1SJWA 2XF3A 3BNDA 3LH4A 1DMQA 3U97A 3KZTA 5CF1A 1LXEA 4NHFA 1D6YA 2C11A 2KRTA 2XRXB 4J8TA 1ULJB 4X2HA 5JBSA 1JB2A 4J9WA 3NQYA 4N6LA 2YFLB 1W62A 3EC9A 4O02B 3LOYA 5IG4A 3CCQ3 3GAXA 3SOYA 2P09A 2ZDJA 3GWRA 4GB5A 2HMOB 1Q864 1JNQA 2OOVA 3EE1A 5H2YA 3CC43 2HMNB 2OQEA 1CQSA 4CDLA 2ZL8A 2ML6A 5A0OB 3JUPA 4MJDA 4XBXA 1EA2A 1FGOA 4OA3A 3ROBA 1YI23 1UI7A 1ISKA 3G16A 4G1MB 3EF8A 2IUKA 3FGYA 4N6UA 4XDVA 1K734 2CH9A 1KD14 1W2B2 1N5PA 2XSHB 3NV0A 1IQXA 2CFDA 3PW9A 2IA7A 3F40A 3AMOA 3T8UA 3LTCA 2LYXA 2M7OA 4O2HA 4RNZA 1JJ22 2QEX3 1NU3A 1TIJA 4NREA 3PCSA 2XH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GL6 A; 
#chains in the Genus database with same CATH topology
 3L0R A;  1YJ9 3;  4HVN A;  1GD3 A;  1OGZ A;  1LQG C;  2E2V A;  2OCT A;  4RNY A;  3G71 3;  3URP A;  1FGM A;  1WNH A;  2PNC A;  5IEP A;  1T5Y A;  1GQZ A;  4HJL B;  4HZB B;  3T0U A;  1G96 A;  5EEO A;  2W0Q A;  4Q2H A;  4I4K A;  5AEU B;  1MWS A;  1IVW A;  3Q90 A;  2WGO A;  3NXJ A;  7RNT A;  1EQK A;  4K1U A;  1C7H A;  3MHE A;  4LEH A;  2F5W A;  2Q9J A;  5M47 A;  2CKF B;  2ML5 A;  3F9S A;  5STD A;  3HII A;  4BL2 A;  1RNT A;  2XR8 B;  5M1A A;  3X3X A;  4CCV A;  5ELU A;  3FSD A;  1S7J A;  3SOA A;  3RGR A;  1YNV X;  5IF6 A;  3G98 A;  1BAO A;  4X2O A;  4RZM A;  5A0O B;  3LML A;  4Q60 A;  2CWT A;  3OX9 A;  6RNT A;  1YGE A;  1I74 A;  1RJO A;  3DY5 A;  2FGT A;  2UX0 A;  3CCJ 3;  5D82 A;  3EJX A;  2W56 B;  3BIR A;  3GSP A;  2GKE A;  4MMZ B;  1B2Z A;  2IY2 A;  1US1 A;  2W2C A;  3JUN A;  2CG0 A;  3LTB A;  2L1S A;  2LQV A;  3MSO A;  3LXU X;  3CCS 3;  1LRA A;  4PY9 A;  1BNS A;  1IU7 A;  3LTA A;  4R80 A;  2MC8 A;  2Y74 A;  5IEO A;  4JCI A;  3DGM A;  4N6M A;  1IQ8 A;  1BRN L;  4EV2 A;  3NBR A;  2W56 A;  3IPT A;  1WMP A;  2BHM A;  3HX8 A;  1FZU A;  1RTU A;  1BRH A;  1D6Z A;  3NBB A;  3CC7 3;  3OW2 2;  3CCV 3;  1PU4 A;  1PYL A;  1RCK A;  1WPM A;  3BB9 A;  1K41 A;  1VQ7 3;  4IJZ A;  3RGA A;  1CEW I;  1XUB A;  3DZL A;  1MNL A;  4GSP A;  2ZXO A;  1U1X A;  3PS8 A;  1M90 4;  4L8O A;  1IT8 A;  2RGQ A;  1MWR A;  1QJG A;  2WOH A;  1OPY A;  4N6V 0;  3MG1 A;  4ILF A;  4CJN A;  3X3Z A;  3KSP A;  1YM5 A;  2RNT A;  1AV4 A;  1CH0 A;  4K1V A;  1ZX2 A;  5G2G A;  1IK3 A;  3WR2 A;  4XB5 A;  2IMJ A;  4WYK B;  3EJV A;  1QYA A;  2Z76 A;  4FMD A;  4I5Q A;  3ZFZ A;  2H0I A;  1O7W B;  2F4Y A;  1Q7Y 4;  3DGL A;  3FKA A;  3EKM A;  3FF0 A;  4MMX B;  1DMN A;  2PW0 A;  3CCL 3;  3SLU A;  1Q81 4;  1YJW 3;  4K61 A;  1UUG B;  2GKJ A;  3B8L A;  2PZV A;  1X1W A;  2CHC A;  1A67 A;  1VQ4 3;  2CWV A;  1LOW A;  3B4O A;  1JN5 A;  2F98 A;  2OTN A;  2RFR A;  2BO9 B;  1UUW B;  1ROA A;  1BOX A;  1NJI 4;  2YMA A;  1OCV A;  2AAE A;  2UUG C;  3AHW A;  1FUW A;  2ZA4 A;  3LYG A;  3G7K A;  1K28 A;  2C4B A;  1QAL A;  1B3S A;  1TRQ A;  3AGO A;  1DMM A;  1I2F A;  3GZR A;  1YIT 3;  2YX9 A;  1TTO A;  1RRH A;  1K23 A;  1I3F A;  3PVH A;  1WMN A;  1VQK 3;  2CIU A;  1E3R A;  1UCJ A;  3EBT A;  3UL5 A;  2P0X A;  1UUV B;  5AIF A;  4FCM A;  5CK6 A;  3S29 A;  2KF3 A;  4WWU C;  5CLK A;  3X3Y A;  2GBW B;  2CG1 A;  1KWI A;  2GBX B;  2XEP A;  3DMC A;  3O8Y A;  2GEX A;  3EN8 A;  1O7P B;  5IWE A;  1U1V A;  3LT8 A;  9RNT A;  1OAC A;  3K63 A;  1BAN A;  2SAR A;  2QB7 A;  1VQM 3;  5HGR A;  1GMR A;  4JF8 A;  3G4S 3;  3KSE D;  1YHQ 3;  2CX1 A;  2RCD A;  3NUV A;  1LNI A;  1HU9 A;  3UJM A;  1UGH I;  3KKG A;  1J2B A;  1BNJ A;  3PXM A;  3NM2 A;  5KP1 A;  1W02 A;  3IGH X;  5AIH A;  4RNT A;  3SXX A;  2D1W A;  3DEV A;  4JRF A;  3OV4 A;  1OF5 B;  1RGL A;  4RBN A;  3PCR A;  4IPB A;  4EXR A;  1DYU A;  4IK0 A;  3IJE B;  1M1K 4;  1BSE A;  1DVC A;  1FA3 A;  3G8Z A;  3CU3 A;  1FYS A;  1GY7 A;  1Z1S A;  1HZ1 A;  1JB4 A;  4ORL A;  1V58 A;  3HK4 A;  1YJN 3;  4HZ9 B;  1IDP A;  2WOF A;  1O7N B;  1U8C B;  4MMY B;  4N6O B;  4EC6 A;  5BIR A;  1YIJ 3;  1QVG 2;  3NX0 A;  3OWS A;  1BRI A;  6STD A;  4KT3 B;  1I8V A;  2YFI B;  4NPB A;  5IEN A;  1ULI B;  3DUK A;  3F7X A;  3JUM A;  4O3V A;  3PTJ A;  5CXO A;  4AKY A;  1Q42 A;  4BU4 A;  2C10 A;  4BL3 A;  3DH2 A;  1E97 A;  5AIG A;  3FF2 A;  5DRV A;  2PVZ A;  3D5I A;  4DKI A;  4LG3 A;  5HOH A;  5H2G A;  1RGE A;  2W9P A;  1GY5 A;  5IG3 A;  3DGN A;  2KF4 A;  4XDW A;  1VQ8 3;  3F8X A;  4J5K A;  4QWT A;  4BTY A;  4FR9 A;  4PEJ A;  1IQY A;  1OHP A;  4N6N B;  3GZX B;  1GMQ A;  3G6E 3;  1LVN A;  4EYC A;  5IG5 A;  5M18 A;  2I9W A;  1SII A;  3EHC A;  1JKG A;  2JDI H;  5KP3 A;  4L8P A;  3LT9 A;  4GL6 A;  1JRQ A;  5G1L A;  4EV5 A;  6GSP A;  1B2X A;  3NM7 A;  1KSI A;  4HM1 B;  1LOX A;  1R4Y A;  2B1X B;  1G0T A;  1RNB A;  3WHO A;  5JPP A;  3D79 A;  4LYL B;  3D4A A;  3B7C A;  3DGO A;  1BNI A;  1RN7 A;  1OF5 A;  2CFG A;  4R9K A;  1X1Y A;  4TX4 A;  5GSP A;  1ZGX A;  1D6U A;  1RN4 A;  3Q2P A;  4HM4 B;  1ROV A;  3FZW A;  1PFP A;  4HM6 B;  1AR0 A;  4Q53 A;  4HM5 B;  2IW4 A;  1MWU A;  3EN1 B;  1LOY A;  2Z6B A;  3GRD A;  5FW5 A;  3FCS B;  2ZHX B;  2KF5 A;  5BVB A;  1DET A;  1BWZ A;  1WQL B;  2GEY A;  2HMM B;  2K0M A;  4HM8 B;  3VGN A;  3WOF B;  1OH0 A;  3UB1 A;  2HOH A;  2YFJ B;  3WA2 X;  3UL6 A;  1JN5 B;  1K8A 4;  4BTW A;  3EDN A;  2CW9 A;  4R1K A;  3FVE A;  4OVM A;  3BLZ A;  4L7K A;  3S5C A;  1NB3 I;  3TDG A;  1N8R 4;  2GU3 A;  3BU4 A;  2GXF A;  1I3I A;  1A90 A;  1W6Y A;  3NQZ A;  3EBY A;  3H3H A;  4K90 B;  3HZP A;  4LS9 A;  2E2T A;  4KFD A;  4MEI A;  3V99 A;  2OTJ 3;  4KZ1 A;  1TM0 A;  1AVK A;  1O7G B;  1B2U A;  3CPO A;  3PZW A;  3V98 A;  2XFS A;  1B2M A;  1S5A A;  4U13 A;  3H51 A;  1JBS A;  1BSA A;  2P38 A;  3KFQ C;  4WYK A;  4EBG A;  2O9U X;  4K7G B;  1GD4 A;  1EG9 B;  1JZD A;  3JUO A;  5D81 A;  3PGB A;  1OGX A;  4HM3 B;  1RGH A;  2XGN A;  4KVH A;  1UCL A;  1RGK A;  1TFO A;  5JPU A;  2W04 A;  4LB0 A;  1B27 A;  1GYB A;  1UCK A;  1JBT A;  3HOH A;  4AEQ A;  1TU5 A;  1N9E A;  1NB5 I;  3BNE A;  4BTX A;  4J9A A;  1F8N A;  5EQL A;  1UGI A;  1SQW A;  4H3U A;  2F86 B;  1NDO B;  1DVD A;  2CK3 H;  1RLS A;  2AAD A;  1NO3 A;  2AZP A;  1IVX A;  1BNE A;  3Q1C A;  1QY9 A;  1QAF A;  3I0Y A;  3RDE A;  3K5T A;  1EUI C;  4J9X A;  1RGA A;  3MPH A;  1N5H A;  3D5G A;  3SED A;  1BRK A;  3FG1 A;  2O3O A;  3ECF A;  1M1X B;  2KCD A;  1BSB A;  1W00 A;  3D3L A;  3S67 A;  2BMO B;  4HM2 B;  5IG0 A;  5KP4 A;  4HBR A;  1Q40 B;  2H0H A;  4LSO A;  1V57 A;  5M19 A;  1A2V A;  2QB6 A;  2XGL A;  3KN4 A;  1IR6 A;  2Z7A A;  1IV7 A;  1PY3 A;  3CNX A;  1VQO 3;  1AQZ A;  2XSO B;  4LZI A;  1MGW A;  3S28 A;  1I2E A;  1W61 A;  1I2G A;  1T3B A;  1Q40 A;  1I0V A;  1WPP A;  5G1K A;  2QB8 A;  2QA4 3;  2QGU A;  1NWW A;  1OHS A;  2FNQ A;  1UW1 A;  2WO0 A;  3RNT A;  1SDJ A;  1I70 A;  1W6C A;  3CC2 3;  1R4C A;  1W5Z A;  1Q82 4;  1VQ6 3;  1DE3 A;  1MOL A;  1RDS A;  3M8C A;  4STD A;  5CF2 A;  2W03 A;  1BSD A;  1FGQ A;  3QRD A;  3EQQ B;  1E3V A;  2B24 B;  2K3D A;  3F8H A;  1STF I;  4GHO A;  3NHX A;  1A2K A;  1BRS A;  1JV2 B;  1X1U A;  4KFF A;  3U1W A;  3X42 A;  1GMP A;  3ZG0 A;  1Y4K A;  4JBD A;  3FLJ A;  3G0K A;  3GZY B;  1VQN 3;  2HMK B;  1N8Q A;  3WOE B;  2Q07 A;  3ICJ A;  1VQQ A;  1YVS A;  2D42 A;  1Q7H A;  3LTD A;  1ASK A;  2UGI A;  4K7X A;  2P05 A;  3FG4 A;  1EEJ A;  4XBY A;  3FH1 A;  4O8S A;  1T2I A;  4K8L A;  4HM7 B;  2K54 A;  3KII A;  3JUQ A;  5BXQ A;  2KAA A;  1N9J A;  1FW7 A;  2GSP A;  1IVV A;  2L4V A;  4FCJ A;  3CXC 2;  1SIH A;  1RKY A;  3CCE 3;  1C54 A;  1EKM A;  1BUQ A;  4FCZ A;  4OK0 A;  7STD A;  1O7H B;  1BNF A;  3FG3 A;  1X1X A;  1UDI I;  4H61 A;  4LMI A;  3J7Y d;  2BNG A;  1S72 3;  2ZXR A;  1IT7 A;  2RSX A;  4LGQ A;  3K9M C;  3LZA A;  3OXA A;  1MWT A;  4HM0 B;  3WMD A;  1V74 A;  2GU1 A;  3E99 A;  1UCI A;  1AVL A;  3F14 A;  1GOU A;  5AYR B;  3STD A;  5BU4 A;  1XUA A;  1QMA A;  4HKV B;  2HAW A;  4FMB A;  1VZZ A;  1B20 A;  3KCH A;  2XFT A;  3NBJ A;  2QIY A;  3SYU A;  1G02 A;  2J8X B;  2F56 A;  1RGF A;  2EB0 A;  2ENX A;  2CFK A;  2W9Q A;  3AMO B;  3JVC A;  2IYJ A;  5IW9 A;  3NV0 B;  2KF6 A;  2LT2 A;  2V1L A;  3ALA A;  2IUJ A;  4RPA A;  1WTH A;  3CPW 2;  1CYU A;  5AII A;  2CFL A;  1U5O A;  1GS3 A;  3CCU 3;  1JB5 A;  1OUN A;  1WMO A;  1U1W A;  2CX0 A;  2INX A;  3EX9 A;  3PYJ A;  3Q3F A;  4N3V A;  3HI7 A;  3OWU A;  3X40 A;  2R4I A;  3D9R A;  5EVH A;  5ANP A;  1T6K A;  2Y73 A;  1B21 A;  1KC8 4;  4HOH A;  4JD7 A;  1ZO2 A;  3KE7 A;  5FGO A;  1W6G A;  1NNV A;  3GZB A;  3UNL A;  2W6J H;  3IMA B;  4FMC A;  3ZG5 A;  2R41 A;  4AKZ A;  1RGG A;  1O7M B;  1TJD A;  2E2U A;  2MF7 A;  2HMJ B;  3BNB A;  4OUQ A;  3SVA A;  4BIR A;  1K9M 4;  1FGR A;  4WP5 A;  3I56 3;  4IT7 A;  1FUT A;  1VQP 3;  5AEW B;  2BMR B;  1L5G B;  1TP6 A;  2HML B;  3ER7 A;  1IV9 A;  1MGR A;  2CWU A;  1BSC A;  3N8B A;  3VSY A;  1RCL A;  4KFE A;  1QVF 2;  4DUN A;  4ZM8 A;  1GOV A;  2OQE C;  1YVB I;  3X41 A;  5HA4 A;  2ZXP A;  2ZVF A;  1BVI A;  2CFW A;  2FXT A;  1I0X A;  2CC3 A;  3DM8 A;  4WFO A;  2OTL 3;  3N9H A;  1OHO A;  3BNC A;  1RSN A;  2SBL A;  3MG3 A;  1FGT A;  1IYY A;  1GOY A;  1TFK A;  2WGQ A;  3AHS A;  1SAR A;  3B4P A;  1IVU A;  1HKX A;  1JKG B;  1RN1 A;  3MG2 A;  1CYV A;  2BT3 A;  2H9F A;  3VF1 A;  4WHA A;  2BMQ B;  1M9G A;  4R4K A;  4CPK A;  3OWY A;  1BU4 A;  5IER A;  5AI1 A;  4R9L A;  3CMA 3;  3T8N A;  8RNT A;  3MKI A;  4HYZ A;  3I55 3;  1TUH A;  2MPB A;  1BNG A;  2OWP A;  3AGN A;  5ELJ A;  1W2Z A;  1YGW A;  8CHO A;  5TGN A;  2A15 A;  5AYS C;  1UI8 A;  1GY6 A;  1RRL A;  4IIA A;  7GSP A;  1W01 A;  1VQ9 3;  3WOD G;  3DXO A;  1KQS 2;  1RMS A;  1U0K A;  1BRG A;  2BIR A;  4XBT A;  3WQZ A;  4FMA A;  4N6T A;  2Q9H A;  4JUU A;  3K0Z A;  3DGY A;  1SPU A;  1W4N A;  2KXG A;  2OOV C;  3CD6 3;  1STD A;  3S27 A;  3MYT A;  1BRJ A;  1ZS7 A;  2KPT A;  2F99 A;  3WDG B;  2P0M A;  1BNR A;  3QK9 A;  1BUJ A;  1FUS A;  2KW7 A;  4J5G A;  5DRE A;  2JQ5 A;  5LC7 A;  3SX1 A;  3WA3 A;  1VQL 3;  2Z77 A;  1B2S A;  3CNM A;  3MWZ A;  3K7C A;  3V92 A;  5I97 A;  3A76 A;  5D83 A;  3F7S A;  1VQ5 3;  4EW5 A;  5LC6 A;  3HIG A;  1AY7 A;  1K20 A;  1LNH A;  1QAK A;  3W5W A;  3CCR 3;  4XM4 A;  1JZO A;  3EB8 A;  1W7C A;  2STD A;  1RGC A;  1Q9E A;  3CCM 3;  1LOV A;  2H0G A;  3N54 B;  3CME 3;  1SJW A;  2XF3 A;  3BND A;  4HAA A;  3LH4 A;  1DMQ A;  3U97 A;  3KZT A;  5CF1 A;  1LXE A;  4NHF A;  1D6Y A;  2C11 A;  2KRT A;  2XRX B;  4J8T A;  1ULJ B;  5RNT A;  4X2H A;  5JBS A;  1JB2 A;  4J9W A;  3NQY A;  4N6L A;  2YFL B;  1W62 A;  2BU4 A;  1JBR A;  3EC9 A;  4O02 B;  3LOY A;  5IG4 A;  3CCQ 3;  3GAX A;  3A5E A;  2P09 A;  3SOY A;  2ZDJ A;  3GWR A;  4GB5 A;  2HMO B;  1Q86 4;  2RBI A;  1JNQ A;  2OOV A;  1T2H A;  3EE1 A;  5H2Y A;  1LQM B;  2HMN B;  2OQE A;  1CQS A;  3CC4 3;  4CDL A;  2ZL8 A;  2ML6 A;  1GSP A;  3JUP A;  1BIR A;  4MJD A;  1EA2 A;  1FGO A;  4OA3 A;  4XBX A;  3ROB A;  1UI7 A;  1YI2 3;  1ISK A;  3G16 A;  4G1M B;  3EF8 A;  2IUK A;  1RHL A;  3FGY A;  2F5M A;  4N6U A;  2CH9 A;  4XDV A;  1K73 4;  1KD1 4;  1W2B 2;  1N5P A;  2XSH B;  3NV0 A;  1IQX A;  2CFD A;  3PW9 A;  2IA7 A;  3F40 A;  3AMO A;  2XH9 A;  3T8U A;  3LTC A;  2LYX A;  1BGS A;  2M7O A;  4O2H A;  4RNZ A;  1A2P A;  1JJ2 2;  2QEX 3;  1NU3 A;  1TIJ A;  4NRE A;  3PCS A;  1HYF A;  1TRP A; 
#chains in the Genus database with same CATH homology
 3L0R A;  1YJ9 3;  4HVN A;  1GD3 A;  1OGZ A;  2E2V A;  2OCT A;  4RNY A;  3G71 3;  1FGM A;  1WNH A;  2PNC A;  5IEP A;  1T5Y A;  1GQZ A;  4HJL B;  4HZB B;  3T0U A;  1G96 A;  5EEO A;  2W0Q A;  4Q2H A;  4I4K A;  5AEU B;  1IVW A;  3Q90 A;  2WGO A;  3NXJ A;  1EQK A;  4K1U A;  1C7H A;  3MHE A;  4LEH A;  2Q9J A;  5M47 A;  2CKF B;  2ML5 A;  3F9S A;  5STD A;  3HII A;  3X3X A;  2XR8 B;  4CCV A;  5ELU A;  3FSD A;  1S7J A;  3SOA A;  3RGR A;  5IF6 A;  3G98 A;  4X2O A;  4RZM A;  3LML A;  4Q60 A;  2CWT A;  3OX9 A;  1YGE A;  1I74 A;  1RJO A;  3DY5 A;  2FGT A;  2UX0 A;  3CCJ 3;  5D82 A;  3EJX A;  2W56 B;  4MMZ B;  2GKE A;  3JUN A;  2W2C A;  1US1 A;  2CG0 A;  3LTB A;  2LQV A;  3MSO A;  3LXU X;  3CCS 3;  4PY9 A;  1IU7 A;  3LTA A;  4R80 A;  2MC8 A;  2Y74 A;  5IEO A;  4JCI A;  3DGM A;  4N6M A;  1IQ8 A;  4EV2 A;  3NBR A;  2W56 A;  3IPT A;  1WMP A;  2BHM A;  3HX8 A;  1D6Z A;  3CC7 3;  3NBB A;  3OW2 2;  3CCV 3;  1PU4 A;  1VQ7 3;  1WPM A;  3BB9 A;  1K41 A;  4IJZ A;  3RGA A;  1CEW I;  1XUB A;  3DZL A;  1MNL A;  2ZXO A;  1U1X A;  3PS8 A;  1M90 4;  4L8O A;  1IT8 A;  2RGQ A;  1QJG A;  2WOH A;  1OPY A;  4N6V 0;  3MG1 A;  3X3Z A;  3KSP A;  1YM5 A;  4K1V A;  1AV4 A;  1ZX2 A;  5G2G A;  1IK3 A;  4XB5 A;  2IMJ A;  4WYK B;  3EJV A;  1QYA A;  2Z76 A;  4FMD A;  1O7W B;  1Q7Y 4;  3DGL A;  3FKA A;  3EKM A;  3FF0 A;  4MMX B;  1DMN A;  2PW0 A;  3CCL 3;  3SLU A;  1Q81 4;  1YJW 3;  4K61 A;  2GKJ A;  3B8L A;  2PZV A;  1A67 A;  2CHC A;  1VQ4 3;  2CWV A;  3B4O A;  1JN5 A;  2F98 A;  2OTN A;  2RFR A;  2BO9 B;  1UUW B;  1ROA A;  1NJI 4;  2YMA A;  1OCV A;  1FUW A;  3LYG A;  3G7K A;  1K28 A;  1QAL A;  1YIT 3;  3GZR A;  1DMM A;  2YX9 A;  1RRH A;  1K23 A;  3PVH A;  1WMN A;  1VQK 3;  2CIU A;  1E3R A;  3UL5 A;  3EBT A;  2P0X A;  1UUV B;  5AIF A;  4FCM A;  5CK6 A;  3S29 A;  5CLK A;  4WWU C;  3X3Y A;  2GBW B;  2CG1 A;  1KWI A;  2GBX B;  2XEP A;  3DMC A;  3O8Y A;  2GEX A;  3EN8 A;  1O7P B;  5IWE A;  1U1V A;  3LT8 A;  1OAC A;  3K63 A;  2QB7 A;  1VQM 3;  5HGR A;  4JF8 A;  3G4S 3;  3KSE D;  1YHQ 3;  2RCD A;  3NUV A;  1HU9 A;  3UJM A;  3KKG A;  1J2B A;  3PXM A;  3NM2 A;  5KP1 A;  1W02 A;  3IGH X;  5AIH A;  3SXX A;  2D1W A;  3DEV A;  4JRF A;  3OV4 A;  1OF5 B;  4RBN A;  3PCR A;  4IPB A;  4EXR A;  1DYU A;  4IK0 A;  3IJE B;  1M1K 4;  1DVC A;  1FA3 A;  3G8Z A;  3CU3 A;  1GY7 A;  1Z1S A;  1JB4 A;  4ORL A;  3HK4 A;  1YJN 3;  4HZ9 B;  1IDP A;  2WOF A;  1O7N B;  1U8C B;  4MMY B;  4N6O B;  4EC6 A;  1YIJ 3;  1QVG 2;  3NX0 A;  3OWS A;  6STD A;  2YFI B;  5IEN A;  1ULI B;  3DUK A;  3F7X A;  3JUM A;  4O3V A;  3PTJ A;  5CXO A;  4AKY A;  1Q42 A;  2C10 A;  1E97 A;  5AIG A;  3FF2 A;  5DRV A;  2PVZ A;  4LG3 A;  5H2G A;  2W9P A;  1GY5 A;  5IG3 A;  3DGN A;  4XDW A;  1VQ8 3;  3F8X A;  4QWT A;  4BTY A;  4FR9 A;  4PEJ A;  1IQY A;  1OHP A;  4N6N B;  3GZX B;  3G6E 3;  1LVN A;  4EYC A;  5IG5 A;  2I9W A;  1SII A;  3EHC A;  1JKG A;  2JDI H;  5KP3 A;  4L8P A;  3LT9 A;  4GL6 A;  1JRQ A;  4EV5 A;  3NM7 A;  1KSI A;  4HM1 B;  1LOX A;  2B1X B;  5JPP A;  3DGO A;  3B7C A;  1RN7 A;  1OF5 A;  2CFG A;  4R9K A;  4TX4 A;  1D6U A;  3Q2P A;  4HM4 B;  1ROV A;  3FZW A;  1PFP A;  4HM6 B;  1AR0 A;  4Q53 A;  4HM5 B;  2IW4 A;  5FW5 A;  3EN1 B;  2Z6B A;  3GRD A;  3FCS B;  5BVB A;  3WOF B;  1BWZ A;  1WQL B;  2GEY A;  2HMM B;  2K0M A;  4HM8 B;  3VGN A;  1OH0 A;  3UB1 A;  3WA2 X;  2YFJ B;  3UL6 A;  1JN5 B;  1K8A 4;  4BTW A;  3EDN A;  2CW9 A;  4R1K A;  3FVE A;  4OVM A;  3BLZ A;  4L7K A;  3S5C A;  1NB3 I;  3TDG A;  1N8R 4;  2GU3 A;  2GXF A;  1A90 A;  1W6Y A;  3NQZ A;  3EBY A;  3H3H A;  4K90 B;  3HZP A;  4LS9 A;  2E2T A;  4KFD A;  4MEI A;  3V99 A;  2OTJ 3;  4KZ1 A;  1TM0 A;  1AVK A;  1O7G B;  3CPO A;  3PZW A;  3V98 A;  2XFS A;  1S5A A;  4U13 A;  3H51 A;  2P38 A;  3KFQ C;  4WYK A;  4EBG A;  2O9U X;  4K7G B;  1GD4 A;  1EG9 B;  3JUO A;  5D81 A;  3PGB A;  1OGX A;  4HM3 B;  2XGN A;  4KVH A;  1TFO A;  5JPU A;  2W04 A;  4LB0 A;  1GYB A;  4AEQ A;  1TU5 A;  1N9E A;  1NB5 I;  3BNE A;  4BTX A;  4J9A A;  1F8N A;  5EQL A;  4H3U A;  1SQW A;  2F86 B;  1NDO B;  1DVD A;  2CK3 H;  1NO3 A;  2AZP A;  1IVX A;  3Q1C A;  1QY9 A;  1QAF A;  3I0Y A;  3RDE A;  3K5T A;  4J9X A;  3MPH A;  3SED A;  1N5H A;  3FG1 A;  2O3O A;  3ECF A;  1M1X B;  2KCD A;  1W00 A;  3D3L A;  3S67 A;  2BMO B;  4HM2 B;  5IG0 A;  5KP4 A;  4HBR A;  1Q40 B;  4LSO A;  1A2V A;  2QB6 A;  2XGL A;  3KN4 A;  1IR6 A;  2Z7A A;  1IV7 A;  3CNX A;  1VQO 3;  2XSO B;  4LZI A;  3S28 A;  1W61 A;  1Q40 A;  1WPP A;  2QB8 A;  2QA4 3;  2QGU A;  1NWW A;  1OHS A;  2FNQ A;  1UW1 A;  2WO0 A;  1SDJ A;  1W6C A;  3CC2 3;  1R4C A;  1W5Z A;  1Q82 4;  1VQ6 3;  1MOL A;  3M8C A;  4STD A;  5CF2 A;  2W03 A;  1FGQ A;  3QRD A;  3EQQ B;  1E3V A;  2B24 B;  3F8H A;  1STF I;  3X42 A;  3NHX A;  1A2K A;  1JV2 B;  4KFF A;  3U1W A;  1Y4K A;  4JBD A;  3FLJ A;  3G0K A;  3GZY B;  1VQN 3;  2HMK B;  1N8Q A;  3WOE B;  2Q07 A;  3ICJ A;  2D42 A;  3LTD A;  1ASK A;  3FG4 A;  4K7X A;  2P05 A;  4XBY A;  3FH1 A;  4O8S A;  4K8L A;  4HM7 B;  2K54 A;  3KII A;  3JUQ A;  5BXQ A;  1N9J A;  1IVV A;  2L4V A;  4FCJ A;  3CXC 2;  1SIH A;  1RKY A;  3CCE 3;  1EKM A;  1BUQ A;  4FCZ A;  4OK0 A;  7STD A;  1O7H B;  3FG3 A;  4H61 A;  3J7Y d;  4LMI A;  1S72 3;  2BNG A;  2ZXR A;  1IT7 A;  2RSX A;  4LGQ A;  3K9M C;  3LZA A;  3OXA A;  4HM0 B;  3WMD A;  1V74 A;  2GU1 A;  3E99 A;  1AVL A;  3F14 A;  5AYR B;  3STD A;  1XUA A;  1QMA A;  4HKV B;  2HAW A;  4FMB A;  1VZZ A;  2XFT A;  3NBJ A;  2QIY A;  2EB0 A;  2ENX A;  2CFK A;  2W9Q A;  3AMO B;  3JVC A;  5IW9 A;  3NV0 B;  3CPW 2;  2LT2 A;  2V1L A;  3ALA A;  2IUJ A;  4RPA A;  1WTH A;  1CYU A;  5AII A;  2CFL A;  1U5O A;  1GS3 A;  3CCU 3;  1JB5 A;  2INX A;  1OUN A;  1U1W A;  1WMO A;  3EX9 A;  3PYJ A;  4N3V A;  3X40 A;  3HI7 A;  3OWU A;  2R4I A;  3D9R A;  5EVH A;  5ANP A;  1T6K A;  2Y73 A;  1KC8 4;  4JD7 A;  1ZO2 A;  3KE7 A;  5FGO A;  1W6G A;  3GZB A;  3UNL A;  2W6J H;  3IMA B;  4FMC A;  4AKZ A;  1O7M B;  2E2U A;  2MF7 A;  2HMJ B;  3BNB A;  4OUQ A;  3SVA A;  1K9M 4;  1FGR A;  4WP5 A;  3I56 3;  4IT7 A;  1VQP 3;  5AEW B;  2BMR B;  1L5G B;  1TP6 A;  2HML B;  3ER7 A;  1IV9 A;  2CWU A;  3N8B A;  3VSY A;  4KFE A;  1QVF 2;  4DUN A;  4ZM8 A;  2OQE C;  1YVB I;  3X41 A;  5HA4 A;  2ZXP A;  2ZVF A;  2CFW A;  2FXT A;  3DM8 A;  4WFO A;  2CC3 A;  2OTL 3;  3N9H A;  1OHO A;  3BNC A;  2SBL A;  3MG3 A;  1FGT A;  1TFK A;  2WGQ A;  3B4P A;  1IVU A;  1HKX A;  1JKG B;  3MG2 A;  1CYV A;  2BT3 A;  2H9F A;  3VF1 A;  4WHA A;  2BMQ B;  1M9G A;  4R4K A;  3OWY A;  5IER A;  5AI1 A;  4R9L A;  3CMA 3;  3T8N A;  3MKI A;  4HYZ A;  3I55 3;  2MPB A;  1TUH A;  2OWP A;  5ELJ A;  1W2Z A;  8CHO A;  5TGN A;  2A15 A;  5AYS C;  1UI8 A;  1GY6 A;  1RRL A;  4IIA A;  1W01 A;  1VQ9 3;  3WOD G;  3DXO A;  1KQS 2;  1U0K A;  4XBT A;  3WQZ A;  4FMA A;  4N6T A;  2Q9H A;  4JUU A;  3K0Z A;  1SPU A;  1W4N A;  2KXG A;  2OOV C;  3CD6 3;  1STD A;  3S27 A;  3MYT A;  3WDG B;  2KPT A;  2F99 A;  2P0M A;  3QK9 A;  2KW7 A;  5DRE A;  2JQ5 A;  5LC7 A;  3SX1 A;  3WA3 A;  1VQL 3;  2Z77 A;  3CNM A;  3MWZ A;  3V92 A;  3K7C A;  5I97 A;  3A76 A;  5D83 A;  3F7S A;  1VQ5 3;  5LC6 A;  3HIG A;  1K20 A;  1LNH A;  1QAK A;  3W5W A;  3CCR 3;  4XM4 A;  3EB8 A;  1W7C A;  2STD A;  3CCM 3;  3N54 B;  3CME 3;  1SJW A;  2XF3 A;  3BND A;  3LH4 A;  1DMQ A;  3U97 A;  3KZT A;  5CF1 A;  1LXE A;  4NHF A;  1D6Y A;  2C11 A;  2KRT A;  2XRX B;  4J8T A;  1ULJ B;  4X2H A;  5JBS A;  1JB2 A;  4J9W A;  3NQY A;  4N6L A;  2YFL B;  1W62 A;  3EC9 A;  4O02 B;  3LOY A;  5IG4 A;  3CCQ 3;  3GAX A;  3SOY A;  2P09 A;  2ZDJ A;  3GWR A;  4GB5 A;  2HMO B;  1Q86 4;  1JNQ A;  2OOV A;  3EE1 A;  5H2Y A;  3CC4 3;  2HMN B;  2OQE A;  1CQS A;  4CDL A;  2ZL8 A;  2ML6 A;  5A0O B;  3JUP A;  4MJD A;  4XBX A;  1EA2 A;  1FGO A;  4OA3 A;  3ROB A;  1YI2 3;  1UI7 A;  1ISK A;  3G16 A;  4G1M B;  3EF8 A;  2IUK A;  3FGY A;  4N6U A;  4XDV A;  1K73 4;  2CH9 A;  1KD1 4;  1W2B 2;  1N5P A;  2XSH B;  3NV0 A;  1IQX A;  2CFD A;  3PW9 A;  2IA7 A;  3F40 A;  3AMO A;  3T8U A;  3LTC A;  2LYX A;  2M7O A;  4O2H A;  4RNZ A;  1JJ2 2;  2QEX 3;  1NU3 A;  1TIJ A;  4NRE A;  3PCS A;  2XH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...