4GL6A

Crystal structure of a duf5037 family protein (rumgna_01148) from ruminococcus gnavus atcc 29149 at 2.55 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
EISIKIETYLQEEYGEEFEVLSWNQPKLLPSDNGAIYATCISKNDPKHPFEGSYFNPEEPNSEIEIIYDGYGQRLLAKQMESMIEEAISQAAENYYIQGDIIIPEEWQDIPVEEISQWKNYVDLCNQSNSDYKTLGSAWVYIDASTMKGKTDEEEYQMYEEVYRDKLGGQALLYVYYLDHKSFEKAEKILEIFTSGDEGSNFEDIIEGQPYFGTIMRYGSDKFDDNLEIFKAAKQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (RUMGNA_01148) from Ruminococcus gnavus ATCC 29149 at 2.55 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
total genus 68
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16440 DUF5037 Domain of unknown function (DUF5037)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.80 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4gl6A02
3.10.450.570 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4gl6A01
4GL6A
chains in the Genus database with same CATH superfamily
2Z6BA 3EJXA 1TUHA 3LT9A 4MMXB 1IDPA 3KSPA 1S723 1GQZA 1JB4A 3CCS3 1IQXA 3WODG 1JKGB 4NPBA 2CFKA 2Z77A 1B2ZA 3MHEA 4EYCA 4WYKB 1N5HA 3F9SA 3STDA 1U8CB 1US1A 1UCJA 3HIGA 1TRQA 1RTUA 5JBSA 3JUQA 1N9JA 1RCKA 2LYXA 1MGRA 2V1LA 3DEVA 3KE7A 2Y74A 1UW1A 2O9UX 3SX1A 2GSPA 4LEHA 3I553 1FUTA 1ULJB 4O3VA 1CQSA 2CKFB 4EV2A 3MG3A 1BNSA 3DZLA 4K7XA 3OW22 1A2PA 2LQVA 1JB5A 4RZMA 2RGQA 4LZIA 2AADA 3WA2X 1BSBA 3NBRA 5CLKA 1IT7A 2AAEA 2GKEA 4HOHA 1R4YA 4N3VA 4CJNA 1VQ73 5STDA 1GOVA 3LH4A 1YJ93 1N8QA 1J2BA 3ZG0A 2KW7A 2CWTA 3DGLA 1DVDA 4WHAA 1RNBA 1NB3I 3DGYA 3F8HA 3T8UA 5JPUA 1IR6A 1OACA 2C10A 2CG0A 5IF6A 4WP5A 3G0KA 3D79A 3CU3A 3KZTA 1VQ83 3GZBA 2HMOB 1B21A 6STDA 3O8YA 1VQ63 1U1VA 1YGWA 2KRTA 8RNTA 2XSHB 4CCVA 3LMLA 2EB0A 4BIRA 2B24B 3GAXA 2KF5A 4HM4B 1BNGA 1FGOA 2H9FA 1JN5A 2ZXRA 4PY9A 4MEIA 3K7CA 4N6MA 1LNHA 3V92A 1WPPA 5AI1A 5A0OB 2KXGA 4R1KA 1GD4A 1BNEA 3BNBA 1UUVB 3PW9A 4FCZA 3V98A 3G713 3K5TA 4Q53A 3F8XA 2QGUA 3V99A 1UUGB 1BRKA 4N6NB 5CF2A 4WWUC 4OK0A 2HMKB 1AQZA 5IWEA 5BVBA 3HX8A 1AY7A 3DM8A 2HOHA 5AYSC 4GB5A 7STDA 1Q864 2WOFA 3RGRA 1V58A 2F5MA 3UL6A 2HMJB 1JJ22 1WQLB 2D1WA 2CX1A 1STDA 4K1UA 1ZS7A 2R41A 3PTJA 3MWZA 2LT2A 4K8LA 1IQ8A 1QALA 4CPKA 2XR8B 3CC43 1VQQA 1AV4A 1UGHI 5AIHA 2W9PA 3LTBA 1MWRA 3B4OA 5KP3A 2RFRA 2M7OA 4BL3A 1L5GB 4JBDA 1JB2A 1RKYA 2RNTA 5BIRA 2ZXOA 2ZHXB 1IV7A 3VSYA 3CCU3 2CX0A 2CH9A 2W56A 2BMRB 5DRVA 5IG5A 1BWZA 1BSAA 1QVG2 3FSDA 1Q824 2UX0A 3SYUA 1T2HA 1IVUA 3AMOA 2XF3A 1BOXA 1RRLA 1YVBI 7GSPA 3CCM3 4XBTA 4N6V0 1RGAA 1TIJA 4K7GB 3NBJA 4IJZA 4NREA 1X1UA 1JBSA 2BMQB 1YNVX 3X3YA 3WQZA 3D5GA 1BNIA 1BANA 1RGCA 5ELJA 1OH0A 4N6TA 1ZO2A 3W5WA 3G7KA 1QAFA 3JUPA 3S67A 1ROAA 2CIUA 4L7KA 3ECFA 5AIIA 1B2SA 4RPAA 1I3FA 1VQ43 1BSCA 4HM8B 4KFFA 4ORLA 1KWIA 2ML6A 3UNLA 1SIHA 3DY5A 1RGLA 2BMOB 2IUKA 2OQEC 2W0QA 3F14A 3RDEA 4J9WA 3NUVA 1RGHA 3FKAA 1TFKA 3LTCA 4IT7A 3CPW2 4HM0B 3LZAA 1NB5I 4JD7A 2QIYA 4LG3A 1BUQA 1B2MA 2CFLA 3K9MC 3CCR3 1JV2B 3CD63 1NU3A 1UGIA 3EDNA 3S27A 1U5OA 3DGNA 2E2VA 2P05A 5H2GA 1RDSA 1TFOA 3KSED 4QWTA 3IMAB 4STDA 2MPBA 5M1AA 1A2KA 1K8A4 3MSOA 4N6OB 1MOLA 5DREA 1FUSA 5M19A 3CC23 5KP4A 1OHOA 2GBXB 2XEPA 3KIIA 1SPUA 1SIIA 2GKJA 1CYVA 4LSOA 3SLUA 2PW0A 4HM6B 1I8VA 1VQL3 4MJDA 1QVF2 1M9GA 2HMMB 5M18A 1E97A 1OHPA 2F86B 1Q7HA 3EBYA 6GSPA 1WPMA 4I5QA 5RNTA 2RSXA 2OOVA 2CC3A 4XB5A 1LOVA 1UCLA 1W7CA 2JQ5A 2BIRA 3BB9A 3OV4A 4IK0A 1O7MB 2CWUA 2GBWB 2ZA4A 4FR9A 2CG1A 2BNGA 1M904 3UL5A 3NX0A 3GWRA 1W5ZA 2KAAA 3G98A 3HOHA 3LTAA 1TP6A 1LXEA 2GEXA 1FGTA 1O7WB 3DGMA 3HZPA 3KKGA 3PGBA 1I70A 4I4KA 3OWYA 4JUUA 1U0KA 4KT3B 2CWVA 2UUGC 3CNMA 3GZXB 4HJLB 4J9AA 5GSPA 1RN7A 3EN1B 4PEJA 4XBXA 1BNRA 4HM7B 3IJEB 1BRGA 1GY6A 3CPOA 2WOHA 1D6ZA 2JDIH 3DH2A 1JRQA 1Q40A 2H0IA 1CH0A 1S7JA 5IENA 2OOVC 3NXJA 2Z76A 3X42A 4CDLA 2CFGA 3NV0B 3N9HA 1RN1A 9RNTA 4MMZB 5G2GA 4U13A 3FVEA 1E3VA 2CFWA 3AHSA 4HM1B 1Q9EA 1SQWA 1YI23 1TRPA 3SOYA 2GU1A 4K90B 5AIGA 3S29A 5IG0A 1ULIB 1DE3A 2Y73A 3UJMA 4AEQA 2HMLB 3CNXA 3EX9A 4RNZA 3EBTA 3SXXA 4EXRA 1GY5A 5FGOA 3HK4A 1W6GA 1FYSA 1M1K4 1JZDA 4MMYB 2H0HA 3AMOB 3M8CA 3PXMA 1W6CA 1U1WA 3S5CA 1JBTA 1DETA 4JCIA 1KSIA 4N6UA 3CCL3 1M1XB 4OA3A 1B2UA 1QJGA 2HMNB 3IGHX 3MPHA 2PZVA 3BNDA 3CCJ3 2QB8A 1S5AA 2R4IA 4ZM8A 1O7HB 2KCDA 1NWWA 3ICJA 1GMPA 1LQMB 3MKIA 2P0XA 1GMQA 3OWSA 1IU7A 1MWTA 1N9EA 1RSNA 2IA7A 3ALAA 3URPA 4BTYA 3FLJA 4BTXA 2WO0A 2YX9A 3DUKA 3E99A 1ROVA 2K54A 4HZ9B 2OTNA 1HYFA 1GD3A 3D3LA 3NBBA 1IV9A 1BGSA 2L1SA 2P0MA 4HM3B 1JKGA 1T6KA 4WYKA 3K63A 5H2YA 1FZUA 1D6YA 2CHCA 4IPBA 1NNVA 3J7Yd 2F99A 4KFEA 3MG2A 4HZBB 2O3OA 4ILFA 4HAAA 4J5GA 5BXQA 1LNIA 3HIIA 8CHOA 2I9WA 3MG1A 3WOFB 1TTOA 1VQO3 2P38A 4K61A 4X2OA 3BLZA 4DUNA 3BU4A 1UI7A 4XDWA 1EQKA 1UDII 4GSPA 1T3BA 3ER7A 1B20A 1PY3A 1UCKA 3K0ZA 1JZOA 3PCSA 3AGOA 1JBRA 1V74A 1T5YA 3EN8A 1FGRA 1U1XA 1W00A 3BNEA 3Q3FA 1ASKA 2BHMA 2CFDA 3NHXA 4OVMA 5G1KA 1YJN3 3CMA3 3L0RA 1IT8A 1JNQA 3PS8A 4LB0A 5AIFA 2P09A 1A67A 3N8BA 3Q1CA 1OUNA 4O2HA 4O8SA 3NQYA 1K734 1K9M4 2WGQA 1G0TA 4Q60A 1I2EA 3JUNA 3T0UA 1FGMA 4KVHA 1Q814 5HOHA 7RNTA 3CCV3 1DVCA 2MF7A 1NJI4 1A2VA 4FMBA 1ZX2A 3SEDA 1BUJA 1IVXA 3KN4A 1OPYA 3I0YA 3LXUX 3SVAA 4XDVA 2KF3A 3DXOA 3HI7A 4XM4A 2YFJB 3U1WA 1XUAA 1MWSA 2ZDJA 2ZL8A 1IVVA 1WMOA 3OWUA 4L8PA 3FG4A 3GSPA 2GU3A 1STFI 3F7XA 4FMDA 2RBIA 3PYJA 1VQP3 3PVHA 2PVZA 3FG1A 1YJW3 3MYTA 1FGQA 3CCE3 4HBRA 3FF2A 2YFLB 5AYRB 1IK3A 4LYLB 2XGLA 2CK3H 4J8TA 3PZWA 4EW5A 1C54A 1YGEA 5M47A 2ENXA 1B3SA 1DYUA 1QAKA 5IG4A 5D82A 2ZXPA 2W6JH 1QY9A 4HYZA 2SBLA 5KP1A 1YIT3 1X1YA 1JN5B 1GY7A 3BNCA 1SDJA 4GL6A 1AVKA 1OF5A 1LQGC 4G1MB 1YVSA 4LS9A 1PFPA 3EF8A 2CW9A 1GMRA 2GEYA 3NQZA 1O7PB 4RNTA 3WR2A 3EB8A 2HAWA 1RCLA 1MNLA 1VZZA 1EKMA 1RJOA 3X3ZA 5IG3A 3X41A 1I74A 1ISKA 3D5IA 4H61A 1VQ53 3CME3 1O7NB 1DMNA 1QMAA 2Q9HA 3AHWA 4EV5A 2ZVFA 3OXAA 1W2ZA 1GS3A 3VGNA 1XUBA 1OGZA 1RN4A 1WMNA 2AZPA 2W9QA 2OWPA 3KCHA 3EJVA 3JUMA 1IYYA 1WNHA 1FW7A 3CXC2 1RHLA 2YMAA 2RCDA 2IMJA 3LOYA 2H0GA 4KFDA 2IY2A 3BIRA 1GSPA 1K28A 2K0MA 4HVNA 3N54B 3B4PA 3QRDA 6RNTA 4H3UA 2B1XB 1AR0A 1HZ1A 4FMCA 3H3HA 1RLSA 1N5PA 2F5WA 1BVIA 1CEWI 1RGEA 4RBNA 3DGOA 2KF6A 1SJWA 4IIAA 4O02B 3NM2A 5LC6A 4XBYA 5IEPA 4HM2B 1A90A 1BU4A 1NO3A 2W56B 3Q2PA 3Q90A 1KQS2 3G16A 4GHOA 4AKYA 5JPPA 2XFTA 3KFQC 1K20A 3FZWA 3EE1A 1BNJA 1C7HA 2IUJA 3ZFZA 2XRXB 3EHCA 1ZGXA 3VF1A 2MC8A 1TU5A 2FXTA 2SARA 5CXOA 3IPTA 4K1VA 2C11A 1BRIA 3B8LA 4AKZA 4J9XA 4EC6A 1YHQ3 1MWUA 1HKXA 1WTHA 4R80A 2E2TA 2W03A 4FCMA 3S28A 1RGGA 1FA3A 2XFSA 1G02A 2Q9JA 2J8XB 1V57A 1NDOB 1RGKA 2QB7A 3DMCA 3EQQB 3G6E3 4FMAA 4R9LA 5EQLA 2OTL3 4FCJA 5CF1A 2IW4A 5BU4A 2FGTA 3I563 1Q42A 1VQ93 2BO9B 1EG9B 5HA4A 3JUOA 3JVCA 3G4S3 4TX4A 3PCRA 4BTWA 3EKMA 2FNQA 3F7SA 1QYAA 2BT3A 1EUIC 1BRJA 1IQYA 1BAOA 1I0XA 2INXA 2STDA 1BRHA 1RMSA 3LT8A 4HM5B 1KC84 3G8ZA 1VQM3 3A5EA 2WGOA 1I0VA 1RRHA 3D4AA 5EVHA 1OGXA 4RNYA 3X3XA 1K23A 3FH1A 1PYLA 1E3RA 2E2UA 3FG3A 3OX9A 1I3IA 2W04A 2UGIA 2Z7AA 3FF0A 1W01A 3NM7A 4JF8A 2XGNA 5IEOA 2F98A 2YFIB 1LVNA 4L8OA 1DMMA 3WDGB 2XSOB 3LTDA 1IVWA 5ANPA 4R4KA 1GOUA 1W02A 2XH9A 3WHOA 1VQK3 1HU9A 3QK9A 4EBGA 1D6UA 1UI8A 1OF5B 3LYGA 4N6LA 1N8R4 4LGQA 5D83A 1CYUA 3FGYA 4X2HA 5AEUB 5HGRA 1TM0A 5I97A 2PNCA 2QB6A 1I2GA 2KPTA 3NV0A 1W6YA 1G96A 1X1XA 4HKVB 1BRNL 5D81A 2Q07A 1K41A 1GYBA 3CCQ3 1B27A 1W4NA 3U97A 1FUWA 4Q2HA 3CC73 3ROBA 4BL2A 2QEX3 1PU4A 4LMIA 4R9KA 2OQEA 3WMDA 1Z1SA 1RNTA 2OTJ3 1AVLA 1EA2A 3A76A 3T8NA 4KZ1A 1BSEA 1Q40B 3FCSB 1BNFA 3X40A 5IERA 1LOWA 2F4YA 4NHFA 4JRFA 3ZG5A 5CK6A 3RGAA 1BSDA 2OCTA 3D9RA 5AEWB 1BIRA 1DMQA 2BU4A 3TDGA 4WFOA 5IW9A 1KD14 1LOYA 3AGNA 2A15A 2C4BA 1SARA 1YM5A 3UB1A 3SOAA 1GOYA 1VQN3 2K3DA 5EEOA 5G1LA 1YIJ3 1W2B2 3GZRA 2GXFA 4OUQA 2QA43 1X1WA 1RGFA 1LOXA 1W62A 3RNTA 1MGWA 1B2XA 5ELUA 2ML5A 5LC7A 2W2CA 1BRSA 1OHSA 2D42A 5TGNA 1WMPA 1OCVA 2F56A 3H51A 3B7CA 3WOEB 2L4VA 4BU4A 1TJDA 1W61A 4DKIA 2IYJA 1UCIA 5FW5A 1I2FA 3GZYB 1EEJA 1T2IA 1F8NA 1Q7Y4 1UUWB 1LRAA 1Y4KA 2KF4A 3F40A 1O7GB 1R4CA 3EC9A 3WA3A 4J5KA 3GRDA
chains in the Genus database with same CATH topology
2Z6BA 3EJXA 1TUHA 3LT9A 4MMXB 1IDPA 3KSPA 1S723 1GQZA 1JB4A 3CCS3 1IQXA 3WODG 1JKGB 2CFKA 2Z77A 3MHEA 4EYCA 4WYKB 1N5HA 3F9SA 3STDA 1U8CB 1US1A 3HIGA 5JBSA 3JUQA 1N9JA 2LYXA 2V1LA 3DEVA 3KE7A 2Y74A 1UW1A 2O9UX 3SX1A 4LEHA 3I553 1ULJB 4O3VA 1CQSA 2CKFB 4EV2A 3MG3A 3DZLA 4K7XA 3OW22 2LQVA 1JB5A 4RZMA 2RGQA 3WA2X 3NBRA 5CLKA 1IT7A 2GKEA 4N3VA 1VQ73 5STDA 3LH4A 1YJ93 1N8QA 1J2BA 2KW7A 2CWTA 3DGLA 1DVDA 4WHAA 1NB3I 3F8HA 5JPUA 1IR6A 1OACA 2C10A 2CG0A 5IF6A 4WP5A 3G0KA 3CU3A 3KZTA 1VQ83 3GZBA 2HMOB 6STDA 3O8YA 1VQ63 1U1VA 2KRTA 2XSHB 4CCVA 3LMLA 2EB0A 2B24B 3GAXA 4HM4B 1FGOA 2H9FA 1JN5A 2ZXRA 4PY9A 4MEIA 3K7CA 4N6MA 1LNHA 3V92A 1WPPA 5AI1A 5A0OB 2KXGA 4R1KA 1GD4A 3BNBA 1QVF2 1UUVB 3PW9A 4FCZA 3V98A 3K5TA 4Q53A 3F8XA 2QGUA 3V99A 4N6NB 5CF2A 4WWUC 4OK0A 2HMKB 5IWEA 5BVBA 3HX8A 3DM8A 5AYSC 4GB5A 7STDA 1Q864 2WOFA 3RGRA 3UL6A 2HMJB 1JJ22 1WQLB 2D1WA 1STDA 4K1UA 3PTJA 3MWZA 2LT2A 4K8LA 1IQ8A 1QALA 2XR8B 3CC43 1AV4A 5AIHA 2W9PA 3LTBA 3B4OA 5KP3A 2RFRA 2M7OA 1L5GB 4JBDA 1JB2A 1RKYA 2ZXOA 1IV7A 3VSYA 3CCU3 2CH9A 2W56A 2BMRB 5DRVA 5IG5A 1BWZA 1QVG2 3FSDA 1Q824 2UX0A 1IVUA 3AMOA 2XF3A 1YVBI 1RRLA 3CCM3 4XBTA 4N6V0 1TIJA 4K7GB 3NBJA 4IJZA 4NREA 2BMQB 3X3YA 3WQZA 5ELJA 1OH0A 4N6TA 1ZO2A 3W5WA 3G7KA 1QAFA 3JUPA 3S67A 1ROAA 2CIUA 4L7KA 3ECFA 5AIIA 4RPAA 1VQ43 4HM8B 4KFFA 4ORLA 1KWIA 2ML6A 3UNLA 1SIHA 3DY5A 2OQEC 2BMOB 2IUKA 3RDEA 2W0QA 3F14A 4J9WA 3NUVA 3FKAA 1TFKA 3LTCA 4IT7A 3CPW2 4HM0B 3LZAA 1NB5I 4JD7A 2QIYA 4LG3A 1BUQA 2CFLA 3K9MC 3CCR3 1JV2B 3CD63 1NU3A 3EDNA 3S27A 1U5OA 3DGNA 2E2VA 2P05A 5H2GA 1TFOA 4QWTA 3KSED 3IMAB 4STDA 2MPBA 1A2KA 1K8A4 3MSOA 4N6OB 1MOLA 5DREA 3CC23 5KP4A 1OHOA 2GBXB 2XEPA 3KIIA 1SPUA 1SIIA 2GKJA 1CYVA 4LSOA 3SLUA 2PW0A 4HM6B 1VQL3 4MJDA 1M9GA 2HMMB 1E97A 1OHPA 2F86B 3EBYA 1WPMA 2RSXA 2OOVA 2CC3A 4XB5A 1W7CA 2JQ5A 3BB9A 3OV4A 4IK0A 1O7MB 2CWUA 2GBWB 2CG1A 4FR9A 2BNGA 1M904 3UL5A 3NX0A 3GWRA 1W5ZA 4LZIA 3G98A 3LTAA 4R9LA 1TP6A 1LXEA 2GEXA 1FGTA 1O7WB 3DGMA 3HZPA 3KKGA 3PGBA 4I4KA 3OWYA 4JUUA 1U0KA 2CWVA 3GZXB 3CNMA 4HJLB 4J9AA 1RN7A 3EN1B 4PEJA 4XBXA 4HM7B 3IJEB 1GY6A 3CPOA 2WOHA 1D6ZA 2JDIH 1JRQA 1Q40A 1S7JA 5IENA 2OOVC 3NXJA 2Z76A 3X42A 4CDLA 2CFGA 3NV0B 3N9HA 4MMZB 5G2GA 4U13A 3FVEA 1E3VA 2CFWA 4HM1B 1SQWA 1YI23 3SOYA 2GU1A 4K90B 5AIGA 3S29A 5IG0A 1ULIB 2Y73A 3UJMA 4AEQA 2HMLB 3CNXA 3EX9A 4RNZA 3EBTA 3SXXA 4EXRA 1GY5A 5FGOA 3HK4A 1W6GA 1M1K4 4MMYB 3AMOB 3M8CA 3PXMA 1W6CA 1U1WA 3S5CA 4JCIA 1KSIA 4N6UA 3CCL3 1M1XB 4OA3A 1QJGA 2HMNB 3IGHX 3MPHA 2PZVA 3BNDA 3CCJ3 2QB8A 1S5AA 2R4IA 4ZM8A 1O7HB 2KCDA 1NWWA 3ICJA 3OWSA 3MKIA 2P0XA 5JPPA 1IU7A 1N9EA 2IA7A 3ALAA 3G713 4BTYA 3FLJA 4BTXA 2WO0A 2YX9A 3DUKA 3E99A 1ROVA 2K54A 4HZ9B 2OTNA 1GD3A 3D3LA 3NBBA 1IV9A 2P0MA 4HM3B 1JKGA 1T6KA 4WYKA 3K63A 5H2YA 1D6YA 2CHCA 4IPBA 3J7Yd 2F99A 4KFEA 3MG2A 4HZBB 2O3OA 5BXQA 3HIIA 8CHOA 2I9WA 3MG1A 3WOFB 1VQO3 2P38A 4K61A 4X2OA 3BLZA 4DUNA 1UI7A 4XDWA 1EQKA 3ER7A 3K0ZA 3PCSA 1V74A 1T5YA 3EN8A 1FGRA 1U1XA 1W00A 3BNEA 1ASKA 2BHMA 2CFDA 3NHXA 4OVMA 1YJN3 3CMA3 3L0RA 1IT8A 1JNQA 3PS8A 4LB0A 5AIFA 2P09A 1A67A 3N8BA 3Q1CA 1OUNA 4O2HA 4O8SA 3NQYA 1K734 1K9M4 2WGQA 4Q60A 3JUNA 3T0UA 1FGMA 4KVHA 1Q814 3CCV3 1DVCA 2MF7A 1NJI4 1A2VA 4FMBA 1ZX2A 3SEDA 1IVXA 3KN4A 1OPYA 3I0YA 3LXUX 3SVAA 4XDVA 3DXOA 3HI7A 4XM4A 2YFJB 3U1WA 1XUAA 2ZDJA 2ZL8A 1IVVA 1WMOA 3OWUA 4L8PA 3FG4A 2GU3A 1STFI 3F7XA 4FMDA 3PYJA 1VQP3 3PVHA 2PVZA 3FG1A 1YJW3 3MYTA 1FGQA 3CCE3 4HBRA 3FF2A 2YFLB 5AYRB 1IK3A 2XGLA 2CK3H 4J8TA 3PZWA 1YGEA 5M47A 2ENXA 1DYUA 1QAKA 5IG4A 5D82A 2ZXPA 2W6JH 1QY9A 4HYZA 2SBLA 5KP1A 1YIT3 3BNCA 1JN5B 1GY7A 1SDJA 4GL6A 1AVKA 1OF5A 4G1MB 4LS9A 1PFPA 3EF8A 2CW9A 2GEYA 3NQZA 1O7PB 3EB8A 2HAWA 1MNLA 1VZZA 1EKMA 1RJOA 3X3ZA 5IG3A 3X41A 1I74A 1ISKA 4H61A 1VQ53 3CME3 1O7NB 1DMNA 1QMAA 2Q9HA 4EV5A 2ZVFA 3OXAA 1W2ZA 1GS3A 3VGNA 1XUBA 1OGZA 1WMNA 2AZPA 2W9QA 2OWPA 3EJVA 3JUMA 1WNHA 3CXC2 2YMAA 2RCDA 2IMJA 3LOYA 4KFDA 1K28A 2K0MA 4HVNA 3N54B 3B4PA 3QRDA 4H3UA 2B1XB 1AR0A 4FMCA 3T8UA 3H3HA 4RBNA 1N5PA 1CEWI 5LC6A 1PU4A 3DGOA 4IIAA 1SJWA 4O02B 5IEPA 3NM2A 1A90A 4XBYA 4HM2B 2W56B 1NO3A 3Q2PA 3Q90A 1KQS2 3G16A 4AKYA 2XFTA 3KFQC 1K20A 3FZWA 3EE1A 2IUJA 1C7HA 2XRXB 3EHCA 3VF1A 2MC8A 1TU5A 2FXTA 5CXOA 3IPTA 4K1VA 2C11A 3B8LA 4AKZA 4J9XA 4EC6A 1YHQ3 1HKXA 1WTHA 4R80A 2E2TA 2W03A 4FCMA 3S28A 1FA3A 2XFSA 2Q9JA 1NDOB 3DMCA 2QB7A 3EQQB 3G6E3 4FMAA 5EQLA 2OTL3 4FCJA 5CF1A 2IW4A 2FGTA 3I563 1Q42A 1VQ93 2BO9B 1EG9B 5HA4A 3JUOA 3JVCA 3G4S3 4TX4A 3PCRA 4BTWA 3EKMA 2FNQA 3F7SA 1QYAA 2BT3A 2INXA 1IQYA 2STDA 3LT8A 4HM5B 1KC84 3G8ZA 1VQM3 2WGOA 1RRHA 5EVHA 1OGXA 4RNYA 3X3XA 1K23A 3FH1A 1E3RA 2E2UA 3FG3A 3OX9A 2W04A 2Z7AA 3FF0A 1W01A 3NM7A 4JF8A 2XGNA 5IEOA 2F98A 2YFIB 1LVNA 4L8OA 1DMMA 3WDGB 2XSOB 3LTDA 1IVWA 5ANPA 4R4KA 1W02A 2XH9A 1VQK3 1HU9A 3QK9A 4EBGA 1D6UA 1UI8A 1OF5B 3LYGA 4N6LA 1N8R4 4LGQA 5D83A 1CYUA 3FGYA 4X2HA 5AEUB 5HGRA 1TM0A 5I97A 2PNCA 2QB6A 2KPTA 3NV0A 1W6YA 1G96A 4HKVB 5D81A 2Q07A 1K41A 1GYBA 3CCQ3 1W4NA 3U97A 1FUWA 4Q2HA 3CC73 3ROBA 2QEX3 4LMIA 4R9KA 2OQEA 3WMDA 1Z1SA 2OTJ3 1AVLA 1EA2A 3A76A 3T8NA 4KZ1A 1Q40B 3FCSB 3X40A 5IERA 4NHFA 4JRFA 5CK6A 3RGAA 2OCTA 5AEWB 3D9RA 5IW9A 1DMQA 3WA3A 3TDGA 1KD14 4WFOA 2A15A 1YM5A 3UB1A 3SOAA 1VQN3 5EEOA 1YIJ3 1W2B2 3GZRA 2GXFA 4OUQA 2QA43 1LOXA 1W62A 5ELUA 2ML5A 5LC7A 2W2CA 1OHSA 2D42A 5TGNA 1WMPA 1OCVA 3WOEB 3H51A 3B7CA 2L4VA 1W61A 5FW5A 3GZYB 1F8NA 1Q7Y4 1UUWB 1Y4KA 3F40A 1O7GB 1R4CA 3EC9A 3GRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GL6 A; 
#chains in the Genus database with same CATH topology
 2Z6B A;  3EJX A;  1TUH A;  3LT9 A;  4MMX B;  1IDP A;  3KSP A;  1S72 3;  1GQZ A;  1JB4 A;  3CCS 3;  1IQX A;  3WOD G;  1JKG B;  4NPB A;  2CFK A;  2Z77 A;  1B2Z A;  3MHE A;  4EYC A;  4WYK B;  1N5H A;  3F9S A;  3STD A;  1U8C B;  1US1 A;  1UCJ A;  3HIG A;  1TRQ A;  1RTU A;  5JBS A;  3JUQ A;  1N9J A;  1RCK A;  2LYX A;  1MGR A;  2V1L A;  3DEV A;  3KE7 A;  2Y74 A;  1UW1 A;  2O9U X;  3SX1 A;  2GSP A;  4LEH A;  3I55 3;  1FUT A;  1ULJ B;  4O3V A;  1CQS A;  2CKF B;  4EV2 A;  3MG3 A;  1BNS A;  3DZL A;  4K7X A;  3OW2 2;  1A2P A;  2LQV A;  1JB5 A;  4RZM A;  2RGQ A;  4LZI A;  2AAD A;  3WA2 X;  1BSB A;  3NBR A;  5CLK A;  1IT7 A;  2AAE A;  2GKE A;  4HOH A;  1R4Y A;  4N3V A;  4CJN A;  1VQ7 3;  5STD A;  1GOV A;  3LH4 A;  1YJ9 3;  1N8Q A;  1J2B A;  3ZG0 A;  2KW7 A;  2CWT A;  3DGL A;  1DVD A;  4WHA A;  1RNB A;  1NB3 I;  3DGY A;  3F8H A;  3T8U A;  5JPU A;  1IR6 A;  1OAC A;  2C10 A;  2CG0 A;  5IF6 A;  4WP5 A;  3G0K A;  3D79 A;  3CU3 A;  3KZT A;  1VQ8 3;  3GZB A;  2HMO B;  1B21 A;  6STD A;  3O8Y A;  1VQ6 3;  1U1V A;  1YGW A;  2KRT A;  8RNT A;  2XSH B;  4CCV A;  3LML A;  2EB0 A;  4BIR A;  2B24 B;  3GAX A;  2KF5 A;  4HM4 B;  1BNG A;  1FGO A;  2H9F A;  1JN5 A;  2ZXR A;  4PY9 A;  4MEI A;  3K7C A;  4N6M A;  1LNH A;  3V92 A;  1WPP A;  5AI1 A;  5A0O B;  2KXG A;  4R1K A;  1GD4 A;  1BNE A;  3BNB A;  1UUV B;  3PW9 A;  4FCZ A;  3V98 A;  3G71 3;  3K5T A;  4Q53 A;  3F8X A;  2QGU A;  3V99 A;  1UUG B;  1BRK A;  4N6N B;  5CF2 A;  4WWU C;  4OK0 A;  2HMK B;  1AQZ A;  5IWE A;  5BVB A;  3HX8 A;  1AY7 A;  3DM8 A;  2HOH A;  5AYS C;  4GB5 A;  7STD A;  1Q86 4;  2WOF A;  3RGR A;  1V58 A;  2F5M A;  3UL6 A;  2HMJ B;  1JJ2 2;  1WQL B;  2D1W A;  2CX1 A;  1STD A;  4K1U A;  1ZS7 A;  2R41 A;  3PTJ A;  3MWZ A;  2LT2 A;  4K8L A;  1IQ8 A;  1QAL A;  4CPK A;  2XR8 B;  3CC4 3;  1VQQ A;  1AV4 A;  1UGH I;  5AIH A;  2W9P A;  3LTB A;  1MWR A;  3B4O A;  5KP3 A;  2RFR A;  2M7O A;  4BL3 A;  1L5G B;  4JBD A;  1JB2 A;  1RKY A;  2RNT A;  5BIR A;  2ZXO A;  2ZHX B;  1IV7 A;  3VSY A;  3CCU 3;  2CX0 A;  2CH9 A;  2W56 A;  2BMR B;  5DRV A;  5IG5 A;  1BWZ A;  1BSA A;  1QVG 2;  3FSD A;  1Q82 4;  2UX0 A;  3SYU A;  1T2H A;  1IVU A;  3AMO A;  2XF3 A;  1BOX A;  1RRL A;  1YVB I;  7GSP A;  3CCM 3;  4XBT A;  4N6V 0;  1RGA A;  1TIJ A;  4K7G B;  3NBJ A;  4IJZ A;  4NRE A;  1X1U A;  1JBS A;  2BMQ B;  1YNV X;  3X3Y A;  3WQZ A;  3D5G A;  1BNI A;  1BAN A;  1RGC A;  5ELJ A;  1OH0 A;  4N6T A;  1ZO2 A;  3W5W A;  3G7K A;  1QAF A;  3JUP A;  3S67 A;  1ROA A;  2CIU A;  4L7K A;  3ECF A;  5AII A;  1B2S A;  4RPA A;  1I3F A;  1VQ4 3;  1BSC A;  4HM8 B;  4KFF A;  4ORL A;  1KWI A;  2ML6 A;  3UNL A;  1SIH A;  3DY5 A;  1RGL A;  2BMO B;  2IUK A;  2OQE C;  2W0Q A;  3F14 A;  3RDE A;  4J9W A;  3NUV A;  1RGH A;  3FKA A;  1TFK A;  3LTC A;  4IT7 A;  3CPW 2;  4HM0 B;  3LZA A;  1NB5 I;  4JD7 A;  2QIY A;  4LG3 A;  1BUQ A;  1B2M A;  2CFL A;  3K9M C;  3CCR 3;  1JV2 B;  3CD6 3;  1NU3 A;  1UGI A;  3EDN A;  3S27 A;  1U5O A;  3DGN A;  2E2V A;  2P05 A;  5H2G A;  1RDS A;  1TFO A;  3KSE D;  4QWT A;  3IMA B;  4STD A;  2MPB A;  5M1A A;  1A2K A;  1K8A 4;  3MSO A;  4N6O B;  1MOL A;  5DRE A;  1FUS A;  5M19 A;  3CC2 3;  5KP4 A;  1OHO A;  2GBX B;  2XEP A;  3KII A;  1SPU A;  1SII A;  2GKJ A;  1CYV A;  4LSO A;  3SLU A;  2PW0 A;  4HM6 B;  1I8V A;  1VQL 3;  4MJD A;  1QVF 2;  1M9G A;  2HMM B;  5M18 A;  1E97 A;  1OHP A;  2F86 B;  1Q7H A;  3EBY A;  6GSP A;  1WPM A;  4I5Q A;  5RNT A;  2RSX A;  2OOV A;  2CC3 A;  4XB5 A;  1LOV A;  1UCL A;  1W7C A;  2JQ5 A;  2BIR A;  3BB9 A;  3OV4 A;  4IK0 A;  1O7M B;  2CWU A;  2GBW B;  2ZA4 A;  4FR9 A;  2CG1 A;  2BNG A;  1M90 4;  3UL5 A;  3NX0 A;  3GWR A;  1W5Z A;  2KAA A;  3G98 A;  3HOH A;  3LTA A;  1TP6 A;  1LXE A;  2GEX A;  1FGT A;  1O7W B;  3DGM A;  3HZP A;  3KKG A;  3PGB A;  1I70 A;  4I4K A;  3OWY A;  4JUU A;  1U0K A;  4KT3 B;  2CWV A;  2UUG C;  3CNM A;  3GZX B;  4HJL B;  4J9A A;  5GSP A;  1RN7 A;  3EN1 B;  4PEJ A;  4XBX A;  1BNR A;  4HM7 B;  3IJE B;  1BRG A;  1GY6 A;  3CPO A;  2WOH A;  1D6Z A;  2JDI H;  3DH2 A;  1JRQ A;  1Q40 A;  2H0I A;  1CH0 A;  1S7J A;  5IEN A;  2OOV C;  3NXJ A;  2Z76 A;  3X42 A;  4CDL A;  2CFG A;  3NV0 B;  3N9H A;  1RN1 A;  9RNT A;  4MMZ B;  5G2G A;  4U13 A;  3FVE A;  1E3V A;  2CFW A;  3AHS A;  4HM1 B;  1Q9E A;  1SQW A;  1YI2 3;  1TRP A;  3SOY A;  2GU1 A;  4K90 B;  5AIG A;  3S29 A;  5IG0 A;  1ULI B;  1DE3 A;  2Y73 A;  3UJM A;  4AEQ A;  2HML B;  3CNX A;  3EX9 A;  4RNZ A;  3EBT A;  3SXX A;  4EXR A;  1GY5 A;  5FGO A;  3HK4 A;  1W6G A;  1FYS A;  1M1K 4;  1JZD A;  4MMY B;  2H0H A;  3AMO B;  3M8C A;  3PXM A;  1W6C A;  1U1W A;  3S5C A;  1JBT A;  1DET A;  4JCI A;  1KSI A;  4N6U A;  3CCL 3;  1M1X B;  4OA3 A;  1B2U A;  1QJG A;  2HMN B;  3IGH X;  3MPH A;  2PZV A;  3BND A;  3CCJ 3;  2QB8 A;  1S5A A;  2R4I A;  4ZM8 A;  1O7H B;  2KCD A;  1NWW A;  3ICJ A;  1GMP A;  1LQM B;  3MKI A;  2P0X A;  1GMQ A;  3OWS A;  1IU7 A;  1MWT A;  1N9E A;  1RSN A;  2IA7 A;  3ALA A;  3URP A;  4BTY A;  3FLJ A;  4BTX A;  2WO0 A;  2YX9 A;  3DUK A;  3E99 A;  1ROV A;  2K54 A;  4HZ9 B;  2OTN A;  1HYF A;  1GD3 A;  3D3L A;  3NBB A;  1IV9 A;  1BGS A;  2L1S A;  2P0M A;  4HM3 B;  1JKG A;  1T6K A;  4WYK A;  3K63 A;  5H2Y A;  1FZU A;  1D6Y A;  2CHC A;  4IPB A;  1NNV A;  3J7Y d;  2F99 A;  4KFE A;  3MG2 A;  4HZB B;  2O3O A;  4ILF A;  4HAA A;  4J5G A;  5BXQ A;  1LNI A;  3HII A;  8CHO A;  2I9W A;  3MG1 A;  3WOF B;  1TTO A;  1VQO 3;  2P38 A;  4K61 A;  4X2O A;  3BLZ A;  4DUN A;  3BU4 A;  1UI7 A;  4XDW A;  1EQK A;  1UDI I;  4GSP A;  1T3B A;  3ER7 A;  1B20 A;  1PY3 A;  1UCK A;  3K0Z A;  1JZO A;  3PCS A;  3AGO A;  1JBR A;  1V74 A;  1T5Y A;  3EN8 A;  1FGR A;  1U1X A;  1W00 A;  3BNE A;  3Q3F A;  1ASK A;  2BHM A;  2CFD A;  3NHX A;  4OVM A;  5G1K A;  1YJN 3;  3CMA 3;  3L0R A;  1IT8 A;  1JNQ A;  3PS8 A;  4LB0 A;  5AIF A;  2P09 A;  1A67 A;  3N8B A;  3Q1C A;  1OUN A;  4O2H A;  4O8S A;  3NQY A;  1K73 4;  1K9M 4;  2WGQ A;  1G0T A;  4Q60 A;  1I2E A;  3JUN A;  3T0U A;  1FGM A;  4KVH A;  1Q81 4;  5HOH A;  7RNT A;  3CCV 3;  1DVC A;  2MF7 A;  1NJI 4;  1A2V A;  4FMB A;  1ZX2 A;  3SED A;  1BUJ A;  1IVX A;  3KN4 A;  1OPY A;  3I0Y A;  3LXU X;  3SVA A;  4XDV A;  2KF3 A;  3DXO A;  3HI7 A;  4XM4 A;  2YFJ B;  3U1W A;  1XUA A;  1MWS A;  2ZDJ A;  2ZL8 A;  1IVV A;  1WMO A;  3OWU A;  4L8P A;  3FG4 A;  3GSP A;  2GU3 A;  1STF I;  3F7X A;  4FMD A;  2RBI A;  3PYJ A;  1VQP 3;  3PVH A;  2PVZ A;  3FG1 A;  1YJW 3;  3MYT A;  1FGQ A;  3CCE 3;  4HBR A;  3FF2 A;  2YFL B;  5AYR B;  1IK3 A;  4LYL B;  2XGL A;  2CK3 H;  4J8T A;  3PZW A;  4EW5 A;  1C54 A;  1YGE A;  5M47 A;  2ENX A;  1B3S A;  1DYU A;  1QAK A;  5IG4 A;  5D82 A;  2ZXP A;  2W6J H;  1QY9 A;  4HYZ A;  2SBL A;  5KP1 A;  1YIT 3;  1X1Y A;  1JN5 B;  1GY7 A;  3BNC A;  1SDJ A;  4GL6 A;  1AVK A;  1OF5 A;  1LQG C;  4G1M B;  1YVS A;  4LS9 A;  1PFP A;  3EF8 A;  2CW9 A;  1GMR A;  2GEY A;  3NQZ A;  1O7P B;  4RNT A;  3WR2 A;  3EB8 A;  2HAW A;  1RCL A;  1MNL A;  1VZZ A;  1EKM A;  1RJO A;  3X3Z A;  5IG3 A;  3X41 A;  1I74 A;  1ISK A;  3D5I A;  4H61 A;  1VQ5 3;  3CME 3;  1O7N B;  1DMN A;  1QMA A;  2Q9H A;  3AHW A;  4EV5 A;  2ZVF A;  3OXA A;  1W2Z A;  1GS3 A;  3VGN A;  1XUB A;  1OGZ A;  1RN4 A;  1WMN A;  2AZP A;  2W9Q A;  2OWP A;  3KCH A;  3EJV A;  3JUM A;  1IYY A;  1WNH A;  1FW7 A;  3CXC 2;  1RHL A;  2YMA A;  2RCD A;  2IMJ A;  3LOY A;  2H0G A;  4KFD A;  2IY2 A;  3BIR A;  1GSP A;  1K28 A;  2K0M A;  4HVN A;  3N54 B;  3B4P A;  3QRD A;  6RNT A;  4H3U A;  2B1X B;  1AR0 A;  1HZ1 A;  4FMC A;  3H3H A;  1RLS A;  1N5P A;  2F5W A;  1BVI A;  1CEW I;  1RGE A;  4RBN A;  3DGO A;  2KF6 A;  1SJW A;  4IIA A;  4O02 B;  3NM2 A;  5LC6 A;  4XBY A;  5IEP A;  4HM2 B;  1A90 A;  1BU4 A;  1NO3 A;  2W56 B;  3Q2P A;  3Q90 A;  1KQS 2;  3G16 A;  4GHO A;  4AKY A;  5JPP A;  2XFT A;  3KFQ C;  1K20 A;  3FZW A;  3EE1 A;  1BNJ A;  1C7H A;  2IUJ A;  3ZFZ A;  2XRX B;  3EHC A;  1ZGX A;  3VF1 A;  2MC8 A;  1TU5 A;  2FXT A;  2SAR A;  5CXO A;  3IPT A;  4K1V A;  2C11 A;  1BRI A;  3B8L A;  4AKZ A;  4J9X A;  4EC6 A;  1YHQ 3;  1MWU A;  1HKX A;  1WTH A;  4R80 A;  2E2T A;  2W03 A;  4FCM A;  3S28 A;  1RGG A;  1FA3 A;  2XFS A;  1G02 A;  2Q9J A;  2J8X B;  1V57 A;  1NDO B;  1RGK A;  2QB7 A;  3DMC A;  3EQQ B;  3G6E 3;  4FMA A;  4R9L A;  5EQL A;  2OTL 3;  4FCJ A;  5CF1 A;  2IW4 A;  5BU4 A;  2FGT A;  3I56 3;  1Q42 A;  1VQ9 3;  2BO9 B;  1EG9 B;  5HA4 A;  3JUO A;  3JVC A;  3G4S 3;  4TX4 A;  3PCR A;  4BTW A;  3EKM A;  2FNQ A;  3F7S A;  1QYA A;  2BT3 A;  1EUI C;  1BRJ A;  1IQY A;  1BAO A;  1I0X A;  2INX A;  2STD A;  1BRH A;  1RMS A;  3LT8 A;  4HM5 B;  1KC8 4;  3G8Z A;  1VQM 3;  3A5E A;  2WGO A;  1I0V A;  1RRH A;  3D4A A;  5EVH A;  1OGX A;  4RNY A;  3X3X A;  1K23 A;  3FH1 A;  1PYL A;  1E3R A;  2E2U A;  3FG3 A;  3OX9 A;  1I3I A;  2W04 A;  2UGI A;  2Z7A A;  3FF0 A;  1W01 A;  3NM7 A;  4JF8 A;  2XGN A;  5IEO A;  2F98 A;  2YFI B;  1LVN A;  4L8O A;  1DMM A;  3WDG B;  2XSO B;  3LTD A;  1IVW A;  5ANP A;  4R4K A;  1GOU A;  1W02 A;  2XH9 A;  3WHO A;  1VQK 3;  1HU9 A;  3QK9 A;  4EBG A;  1D6U A;  1UI8 A;  1OF5 B;  3LYG A;  4N6L A;  1N8R 4;  4LGQ A;  5D83 A;  1CYU A;  3FGY A;  4X2H A;  5AEU B;  5HGR A;  1TM0 A;  5I97 A;  2PNC A;  2QB6 A;  1I2G A;  2KPT A;  3NV0 A;  1W6Y A;  1G96 A;  1X1X A;  4HKV B;  1BRN L;  5D81 A;  2Q07 A;  1K41 A;  1GYB A;  3CCQ 3;  1B27 A;  1W4N A;  3U97 A;  1FUW A;  4Q2H A;  3CC7 3;  3ROB A;  4BL2 A;  2QEX 3;  1PU4 A;  4LMI A;  4R9K A;  2OQE A;  3WMD A;  1Z1S A;  1RNT A;  2OTJ 3;  1AVL A;  1EA2 A;  3A76 A;  3T8N A;  4KZ1 A;  1BSE A;  1Q40 B;  3FCS B;  1BNF A;  3X40 A;  5IER A;  1LOW A;  2F4Y A;  4NHF A;  4JRF A;  3ZG5 A;  5CK6 A;  3RGA A;  1BSD A;  2OCT A;  3D9R A;  5AEW B;  1BIR A;  1DMQ A;  2BU4 A;  3TDG A;  4WFO A;  5IW9 A;  1KD1 4;  1LOY A;  3AGN A;  2A15 A;  2C4B A;  1SAR A;  1YM5 A;  3UB1 A;  3SOA A;  1GOY A;  1VQN 3;  2K3D A;  5EEO A;  5G1L A;  1YIJ 3;  1W2B 2;  3GZR A;  2GXF A;  4OUQ A;  2QA4 3;  1X1W A;  1RGF A;  1LOX A;  1W62 A;  3RNT A;  1MGW A;  1B2X A;  5ELU A;  2ML5 A;  5LC7 A;  2W2C A;  1BRS A;  1OHS A;  2D42 A;  5TGN A;  1WMP A;  1OCV A;  2F56 A;  3H51 A;  3B7C A;  3WOE B;  2L4V A;  4BU4 A;  1TJD A;  1W61 A;  4DKI A;  2IYJ A;  1UCI A;  5FW5 A;  1I2F A;  3GZY B;  1EEJ A;  1T2I A;  1F8N A;  1Q7Y 4;  1UUW B;  1LRA A;  1Y4K A;  2KF4 A;  3F40 A;  1O7G B;  1R4C A;  3EC9 A;  3WA3 A;  4J5K A;  3GRD A; 
#chains in the Genus database with same CATH homology
 2Z6B A;  3EJX A;  1TUH A;  3LT9 A;  4MMX B;  1IDP A;  3KSP A;  1S72 3;  1GQZ A;  1JB4 A;  3CCS 3;  1IQX A;  3WOD G;  1JKG B;  2CFK A;  2Z77 A;  3MHE A;  4EYC A;  4WYK B;  1N5H A;  3F9S A;  3STD A;  1U8C B;  1US1 A;  3HIG A;  5JBS A;  3JUQ A;  1N9J A;  2LYX A;  2V1L A;  3DEV A;  3KE7 A;  2Y74 A;  1UW1 A;  2O9U X;  3SX1 A;  4LEH A;  3I55 3;  1ULJ B;  4O3V A;  1CQS A;  2CKF B;  4EV2 A;  3MG3 A;  3DZL A;  4K7X A;  3OW2 2;  2LQV A;  1JB5 A;  4RZM A;  2RGQ A;  3WA2 X;  3NBR A;  5CLK A;  1IT7 A;  2GKE A;  4N3V A;  1VQ7 3;  5STD A;  3LH4 A;  1YJ9 3;  1N8Q A;  1J2B A;  2KW7 A;  2CWT A;  3DGL A;  1DVD A;  4WHA A;  1NB3 I;  3F8H A;  5JPU A;  1IR6 A;  1OAC A;  2C10 A;  2CG0 A;  5IF6 A;  4WP5 A;  3G0K A;  3CU3 A;  3KZT A;  1VQ8 3;  3GZB A;  2HMO B;  6STD A;  3O8Y A;  1VQ6 3;  1U1V A;  2KRT A;  2XSH B;  4CCV A;  3LML A;  2EB0 A;  2B24 B;  3GAX A;  4HM4 B;  1FGO A;  2H9F A;  1JN5 A;  2ZXR A;  4PY9 A;  4MEI A;  3K7C A;  4N6M A;  1LNH A;  3V92 A;  1WPP A;  5AI1 A;  5A0O B;  2KXG A;  4R1K A;  1GD4 A;  3BNB A;  1QVF 2;  1UUV B;  3PW9 A;  4FCZ A;  3V98 A;  3K5T A;  4Q53 A;  3F8X A;  2QGU A;  3V99 A;  4N6N B;  5CF2 A;  4WWU C;  4OK0 A;  2HMK B;  5IWE A;  5BVB A;  3HX8 A;  3DM8 A;  5AYS C;  4GB5 A;  7STD A;  1Q86 4;  2WOF A;  3RGR A;  3UL6 A;  2HMJ B;  1JJ2 2;  1WQL B;  2D1W A;  1STD A;  4K1U A;  3PTJ A;  3MWZ A;  2LT2 A;  4K8L A;  1IQ8 A;  1QAL A;  2XR8 B;  3CC4 3;  1AV4 A;  5AIH A;  2W9P A;  3LTB A;  3B4O A;  5KP3 A;  2RFR A;  2M7O A;  1L5G B;  4JBD A;  1JB2 A;  1RKY A;  2ZXO A;  1IV7 A;  3VSY A;  3CCU 3;  2CH9 A;  2W56 A;  2BMR B;  5DRV A;  5IG5 A;  1BWZ A;  1QVG 2;  3FSD A;  1Q82 4;  2UX0 A;  1IVU A;  3AMO A;  2XF3 A;  1YVB I;  1RRL A;  3CCM 3;  4XBT A;  4N6V 0;  1TIJ A;  4K7G B;  3NBJ A;  4IJZ A;  4NRE A;  2BMQ B;  3X3Y A;  3WQZ A;  5ELJ A;  1OH0 A;  4N6T A;  1ZO2 A;  3W5W A;  3G7K A;  1QAF A;  3JUP A;  3S67 A;  1ROA A;  2CIU A;  4L7K A;  3ECF A;  5AII A;  4RPA A;  1VQ4 3;  4HM8 B;  4KFF A;  4ORL A;  1KWI A;  2ML6 A;  3UNL A;  1SIH A;  3DY5 A;  2OQE C;  2BMO B;  2IUK A;  3RDE A;  2W0Q A;  3F14 A;  4J9W A;  3NUV A;  3FKA A;  1TFK A;  3LTC A;  4IT7 A;  3CPW 2;  4HM0 B;  3LZA A;  1NB5 I;  4JD7 A;  2QIY A;  4LG3 A;  1BUQ A;  2CFL A;  3K9M C;  3CCR 3;  1JV2 B;  3CD6 3;  1NU3 A;  3EDN A;  3S27 A;  1U5O A;  3DGN A;  2E2V A;  2P05 A;  5H2G A;  1TFO A;  4QWT A;  3KSE D;  3IMA B;  4STD A;  2MPB A;  1A2K A;  1K8A 4;  3MSO A;  4N6O B;  1MOL A;  5DRE A;  3CC2 3;  5KP4 A;  1OHO A;  2GBX B;  2XEP A;  3KII A;  1SPU A;  1SII A;  2GKJ A;  1CYV A;  4LSO A;  3SLU A;  2PW0 A;  4HM6 B;  1VQL 3;  4MJD A;  1M9G A;  2HMM B;  1E97 A;  1OHP A;  2F86 B;  3EBY A;  1WPM A;  2RSX A;  2OOV A;  2CC3 A;  4XB5 A;  1W7C A;  2JQ5 A;  3BB9 A;  3OV4 A;  4IK0 A;  1O7M B;  2CWU A;  2GBW B;  2CG1 A;  4FR9 A;  2BNG A;  1M90 4;  3UL5 A;  3NX0 A;  3GWR A;  1W5Z A;  4LZI A;  3G98 A;  3LTA A;  4R9L A;  1TP6 A;  1LXE A;  2GEX A;  1FGT A;  1O7W B;  3DGM A;  3HZP A;  3KKG A;  3PGB A;  4I4K A;  3OWY A;  4JUU A;  1U0K A;  2CWV A;  3GZX B;  3CNM A;  4HJL B;  4J9A A;  1RN7 A;  3EN1 B;  4PEJ A;  4XBX A;  4HM7 B;  3IJE B;  1GY6 A;  3CPO A;  2WOH A;  1D6Z A;  2JDI H;  1JRQ A;  1Q40 A;  1S7J A;  5IEN A;  2OOV C;  3NXJ A;  2Z76 A;  3X42 A;  4CDL A;  2CFG A;  3NV0 B;  3N9H A;  4MMZ B;  5G2G A;  4U13 A;  3FVE A;  1E3V A;  2CFW A;  4HM1 B;  1SQW A;  1YI2 3;  3SOY A;  2GU1 A;  4K90 B;  5AIG A;  3S29 A;  5IG0 A;  1ULI B;  2Y73 A;  3UJM A;  4AEQ A;  2HML B;  3CNX A;  3EX9 A;  4RNZ A;  3EBT A;  3SXX A;  4EXR A;  1GY5 A;  5FGO A;  3HK4 A;  1W6G A;  1M1K 4;  4MMY B;  3AMO B;  3M8C A;  3PXM A;  1W6C A;  1U1W A;  3S5C A;  4JCI A;  1KSI A;  4N6U A;  3CCL 3;  1M1X B;  4OA3 A;  1QJG A;  2HMN B;  3IGH X;  3MPH A;  2PZV A;  3BND A;  3CCJ 3;  2QB8 A;  1S5A A;  2R4I A;  4ZM8 A;  1O7H B;  2KCD A;  1NWW A;  3ICJ A;  3OWS A;  3MKI A;  2P0X A;  5JPP A;  1IU7 A;  1N9E A;  2IA7 A;  3ALA A;  3G71 3;  4BTY A;  3FLJ A;  4BTX A;  2WO0 A;  2YX9 A;  3DUK A;  3E99 A;  1ROV A;  2K54 A;  4HZ9 B;  2OTN A;  1GD3 A;  3D3L A;  3NBB A;  1IV9 A;  2P0M A;  4HM3 B;  1JKG A;  1T6K A;  4WYK A;  3K63 A;  5H2Y A;  1D6Y A;  2CHC A;  4IPB A;  3J7Y d;  2F99 A;  4KFE A;  3MG2 A;  4HZB B;  2O3O A;  5BXQ A;  3HII A;  8CHO A;  2I9W A;  3MG1 A;  3WOF B;  1VQO 3;  2P38 A;  4K61 A;  4X2O A;  3BLZ A;  4DUN A;  1UI7 A;  4XDW A;  1EQK A;  3ER7 A;  3K0Z A;  3PCS A;  1V74 A;  1T5Y A;  3EN8 A;  1FGR A;  1U1X A;  1W00 A;  3BNE A;  1ASK A;  2BHM A;  2CFD A;  3NHX A;  4OVM A;  1YJN 3;  3CMA 3;  3L0R A;  1IT8 A;  1JNQ A;  3PS8 A;  4LB0 A;  5AIF A;  2P09 A;  1A67 A;  3N8B A;  3Q1C A;  1OUN A;  4O2H A;  4O8S A;  3NQY A;  1K73 4;  1K9M 4;  2WGQ A;  4Q60 A;  3JUN A;  3T0U A;  1FGM A;  4KVH A;  1Q81 4;  3CCV 3;  1DVC A;  2MF7 A;  1NJI 4;  1A2V A;  4FMB A;  1ZX2 A;  3SED A;  1IVX A;  3KN4 A;  1OPY A;  3I0Y A;  3LXU X;  3SVA A;  4XDV A;  3DXO A;  3HI7 A;  4XM4 A;  2YFJ B;  3U1W A;  1XUA A;  2ZDJ A;  2ZL8 A;  1IVV A;  1WMO A;  3OWU A;  4L8P A;  3FG4 A;  2GU3 A;  1STF I;  3F7X A;  4FMD A;  3PYJ A;  1VQP 3;  3PVH A;  2PVZ A;  3FG1 A;  1YJW 3;  3MYT A;  1FGQ A;  3CCE 3;  4HBR A;  3FF2 A;  2YFL B;  5AYR B;  1IK3 A;  2XGL A;  2CK3 H;  4J8T A;  3PZW A;  1YGE A;  5M47 A;  2ENX A;  1DYU A;  1QAK A;  5IG4 A;  5D82 A;  2ZXP A;  2W6J H;  1QY9 A;  4HYZ A;  2SBL A;  5KP1 A;  1YIT 3;  3BNC A;  1JN5 B;  1GY7 A;  1SDJ A;  4GL6 A;  1AVK A;  1OF5 A;  4G1M B;  4LS9 A;  1PFP A;  3EF8 A;  2CW9 A;  2GEY A;  3NQZ A;  1O7P B;  3EB8 A;  2HAW A;  1MNL A;  1VZZ A;  1EKM A;  1RJO A;  3X3Z A;  5IG3 A;  3X41 A;  1I74 A;  1ISK A;  4H61 A;  1VQ5 3;  3CME 3;  1O7N B;  1DMN A;  1QMA A;  2Q9H A;  4EV5 A;  2ZVF A;  3OXA A;  1W2Z A;  1GS3 A;  3VGN A;  1XUB A;  1OGZ A;  1WMN A;  2AZP A;  2W9Q A;  2OWP A;  3EJV A;  3JUM A;  1WNH A;  3CXC 2;  2YMA A;  2RCD A;  2IMJ A;  3LOY A;  4KFD A;  1K28 A;  2K0M A;  4HVN A;  3N54 B;  3B4P A;  3QRD A;  4H3U A;  2B1X B;  1AR0 A;  4FMC A;  3T8U A;  3H3H A;  4RBN A;  1N5P A;  1CEW I;  5LC6 A;  1PU4 A;  3DGO A;  4IIA A;  1SJW A;  4O02 B;  5IEP A;  3NM2 A;  1A90 A;  4XBY A;  4HM2 B;  2W56 B;  1NO3 A;  3Q2P A;  3Q90 A;  1KQS 2;  3G16 A;  4AKY A;  2XFT A;  3KFQ C;  1K20 A;  3FZW A;  3EE1 A;  2IUJ A;  1C7H A;  2XRX B;  3EHC A;  3VF1 A;  2MC8 A;  1TU5 A;  2FXT A;  5CXO A;  3IPT A;  4K1V A;  2C11 A;  3B8L A;  4AKZ A;  4J9X A;  4EC6 A;  1YHQ 3;  1HKX A;  1WTH A;  4R80 A;  2E2T A;  2W03 A;  4FCM A;  3S28 A;  1FA3 A;  2XFS A;  2Q9J A;  1NDO B;  3DMC A;  2QB7 A;  3EQQ B;  3G6E 3;  4FMA A;  5EQL A;  2OTL 3;  4FCJ A;  5CF1 A;  2IW4 A;  2FGT A;  3I56 3;  1Q42 A;  1VQ9 3;  2BO9 B;  1EG9 B;  5HA4 A;  3JUO A;  3JVC A;  3G4S 3;  4TX4 A;  3PCR A;  4BTW A;  3EKM A;  2FNQ A;  3F7S A;  1QYA A;  2BT3 A;  2INX A;  1IQY A;  2STD A;  3LT8 A;  4HM5 B;  1KC8 4;  3G8Z A;  1VQM 3;  2WGO A;  1RRH A;  5EVH A;  1OGX A;  4RNY A;  3X3X A;  1K23 A;  3FH1 A;  1E3R A;  2E2U A;  3FG3 A;  3OX9 A;  2W04 A;  2Z7A A;  3FF0 A;  1W01 A;  3NM7 A;  4JF8 A;  2XGN A;  5IEO A;  2F98 A;  2YFI B;  1LVN A;  4L8O A;  1DMM A;  3WDG B;  2XSO B;  3LTD A;  1IVW A;  5ANP A;  4R4K A;  1W02 A;  2XH9 A;  1VQK 3;  1HU9 A;  3QK9 A;  4EBG A;  1D6U A;  1UI8 A;  1OF5 B;  3LYG A;  4N6L A;  1N8R 4;  4LGQ A;  5D83 A;  1CYU A;  3FGY A;  4X2H A;  5AEU B;  5HGR A;  1TM0 A;  5I97 A;  2PNC A;  2QB6 A;  2KPT A;  3NV0 A;  1W6Y A;  1G96 A;  4HKV B;  5D81 A;  2Q07 A;  1K41 A;  1GYB A;  3CCQ 3;  1W4N A;  3U97 A;  1FUW A;  4Q2H A;  3CC7 3;  3ROB A;  2QEX 3;  4LMI A;  4R9K A;  2OQE A;  3WMD A;  1Z1S A;  2OTJ 3;  1AVL A;  1EA2 A;  3A76 A;  3T8N A;  4KZ1 A;  1Q40 B;  3FCS B;  3X40 A;  5IER A;  4NHF A;  4JRF A;  5CK6 A;  3RGA A;  2OCT A;  5AEW B;  3D9R A;  5IW9 A;  1DMQ A;  3WA3 A;  3TDG A;  1KD1 4;  4WFO A;  2A15 A;  1YM5 A;  3UB1 A;  3SOA A;  1VQN 3;  5EEO A;  1YIJ 3;  1W2B 2;  3GZR A;  2GXF A;  4OUQ A;  2QA4 3;  1LOX A;  1W62 A;  5ELU A;  2ML5 A;  5LC7 A;  2W2C A;  1OHS A;  2D42 A;  5TGN A;  1WMP A;  1OCV A;  3WOE B;  3H51 A;  3B7C A;  2L4V A;  1W61 A;  5FW5 A;  3GZY B;  1F8N A;  1Q7Y 4;  1UUW B;  1Y4K A;  3F40 A;  1O7G B;  1R4C A;  3EC9 A;  3GRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...