4GL6A

Crystal structure of a duf5037 family protein (rumgna_01148) from ruminococcus gnavus atcc 29149 at 2.55 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
b'EISIKIETYLQEEYGEEFEVLSWNQPKLLPSDNGAIYATCISKNDPKHPFEGSYFNPEEPNSEIEIIYDGYGQRLLAKQMESMIEEAISQAAENYYIQGDIIIPEEWQDIPVEEISQWKNYVDLCNQSNSDYKTLGSAWVYIDASTMKGKTDEEEYQMYEEVYRDKLGGQALLYVYYLDHKSFEKAEKILEIFTSGDEGSNFEDIIEGQPYFGTIMRYGSDKFDDNLEIFKAAKQGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (RUMGNA_01148) from Ruminococcus gnavus ATCC 29149 at 2.55 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
total genus 68
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16440 DUF5037 Domain of unknown function (DUF5037)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.80 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4gl6A02
3.10.450.570 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4gl6A01
4GL6A
chains in the Genus database with same CATH superfamily
1DETA 1Q9EA 4WYKB 1N9JA 1SIIA 1PYLA 1Z1SA 1RRLA 1RNBA 1SARA 2CK3H 2KF3A 1OF5B 1Q42A 2Q07A 2Z77A 3QRDA 1QVG2 3LT9A 1GS3A 4GL6A 3NV0A 2RFRA 5DRVA 3L0RA 1EEJA 1TP6A 4Q2HA 1SQWA 1W00A 4HJLB 1RGCA 1EUIC 2C11A 2KAAA 2W56A 2P38A 3F14A 2CWTA 3WQZA 1LRAA 4HM3B 2XF3A 1B21A 1EA2A 1O7GB 1RHLA 3DEVA 2OCTA 1I2FA 3CC43 1LNIA 1T6KA 1SPUA 3G8ZA 1OGXA 3KIIA 2CIUA 2I9WA 7GSPA 3I553 1BRKA 1M904 4DUNA 1TU5A 1UI8A 1GQZA 4HZBB 1BRSA 1GY7A 3HIGA 3NX0A 4ZM8A 3AHSA 5CXOA 1FGMA 2P09A 2ZXPA 3IJEB 1D6ZA 1W6CA 1RGLA 3H51A 2QB6A 1S723 4XBXA 3UJMA 1IU7A 1GMQA 1QALA 1BRJA 1UUWB 2GU3A 2O3OA 2Z7AA 3K7CA 2OWPA 4HM2B 5HGRA 1PFPA 1PU4A 2OOVC 1IV9A 2SBLA 3UB1A 3KN4A 2KPTA 1UUGB 2BT3A 2ML5A 2XFSA 4L8PA 3HX8A 3NBBA 4EYCA 1G0TA 1QAKA 3CPW2 3FH1A 4J9AA 1BAOA 2H9FA 2KCDA 1IT8A 1OHOA 1V74A 2CKFB 3CCR3 3LXUX 2F4YA 3O8YA 2BU4A 1A2VA 1QY9A 1B3SA 4EBGA 3K63A 5AIFA 3EBTA 4R9KA 4STDA 1X1UA 1STFI 2RGQA 3FF0A 3LTBA 1YI23 3PW9A 3U97A 3N54B 1U1WA 3HK4A 2MPBA 1YIT3 2CFGA 1ZGXA 3KE7A 3CNXA 1HKXA 3DGYA 4BL3A 2XGNA 4RNTA 2MC8A 1LXEA 1YJW3 3B4PA 3DGMA 3GAXA 2RSXA 3PTJA 2XFTA 1S7JA 4LG3A 2CHCA 1TRQA 2BMRB 4LMIA 3HIIA 1ROAA 3D79A 5AEWB 3DGOA 2STDA 4N6MA 1ASKA 1JBSA 2AADA 1HYFA 1BUJA 4N6NB 4HYZA 2CG1A 3V99A 4XDWA 1B2SA 1I2GA 2CFLA 5I97A 1IVUA 4DKIA 1R4YA 7STDA 1FZUA 1VZZA 2C4BA 1FA3A 2JDIH 3GZXB 4JRFA 5HA4A 1JKGA 4R80A 4OK0A 4RNZA 1JB5A 3J7Yd 1IT7A 2E2VA 3D5IA 2BIRA 1BSAA 1HZ1A 3WOEB 2W9PA 1LQGC 2XSHB 5CK6A 2MF7A 3G6E3 1MGRA 2AAEA 2WGOA 1U1VA 2M7OA 2BMOB 4X2HA 4KFEA 3ZG5A 1BNFA 2BHMA 2Q9HA 4XBYA 5JPUA 3E99A 3CCU3 4FCJA 1BSCA 2CX0A 1A2KA 2V1LA 3G713 3N9HA 2XSOB 3EN8A 4O3VA 3F7SA 3F40A 4NHFA 3G98A 1WTHA 5AIHA 5HOHA 4NPBA 1N8R4 1TTOA 4FMCA 4HM0B 4K7XA 3NV0B 3DUKA 4XDVA 4BTWA 2Y74A 2GBWB 3K0ZA 1T2IA 5IG3A 5IW9A 2IYJA 4HM5B 4HBRA 1K41A 3SVAA 3ZG0A 1DMQA 3GZYB 1MOLA 3I0YA 4HM6B 3WR2A 1YVBI 1PY3A 4HZ9B 1L5GB 3RDEA 4FR9A 1VQM3 3X3ZA 1JBTA 1TRPA 2OTNA 5H2GA 2B1XB 1AR0A 3CCJ3 4JCIA 1NJI4 1K23A 1AV4A 4RNYA 1I74A 1B2MA 2E2UA 4MMYB 2W03A 1I3IA 1K8A4 3DH2A 2OQEA 1GYBA 1N5PA 4KFDA 2H0HA 4H61A 4FMDA 1BU4A 3NM2A 4XBTA 3EN1B 2RNTA 2HMKB 3AMOA 3EKMA 4K61A 4KZ1A 4EXRA 2KW7A 3BNDA 3DGLA 4K8LA 1AQZA 2GEYA 2UX0A 3BNCA 3SEDA 1JN5A 1RMSA 3CXC2 5M1AA 2CW9A 5AYSC 3EBYA 5AEUB 2E2TA 4HAAA 1Q7Y4 1LOXA 4L7KA 2RCDA 1T2HA 3VSYA 4BU4A 3Q2PA 1W01A 3EQQB 1I2EA 1NB5I 1RN4A 3LOYA 3LTDA 3CMA3 2WOHA 2WOFA 3NHXA 3FZWA 1QAFA 3WHOA 5ANPA 1Q40A 2Z6BA 1KSIA 4JUUA 1A67A 2XGLA 3LZAA 1DMMA 4WP5A 3BIRA 4EV2A 1UCLA 4HKVB 2ML6A 4HM4B 1I0VA 1U8CB 3PS8A 3Q3FA 4LYLB 3KZTA 1UCKA 1LOVA 1TJDA 4KVHA 1GD4A 1DVCA 3DM8A 5D83A 1O7HB 1BSEA 2CFWA 2RBIA 3F8HA 1RN7A 4K1UA 2BNGA 2GSPA 1CEWI 1VQN3 1RNTA 4J5KA 1QJGA 4J8TA 6GSPA 3OV4A 4K1VA 4L8OA 5ELUA 2BMQB 1B2XA 4KFFA 3RNTA 4XB5A 4MJDA 1M1XB 3NBRA 8CHOA 3KSPA 1OUNA 2UUGC 2GBXB 2XH9A 2FXTA 3KKGA 3N8BA 1T5YA 3PCSA 4R1KA 3RGAA 3TDGA 1M9GA 3EDNA 1YHQ3 1MNLA 3EF8A 1Q864 3AHWA 4N3VA 3V92A 3X3XA 1EQKA 1ULIB 1RCKA 6RNTA 1VQ63 1AY7A 3STDA 1UI7A 3SX1A 2ZVFA 4OUQA 1SIHA 4CDLA 3GSPA 2YFLB 1U0KA 3EHCA 1O7NB 2EB0A 3SOAA 5BVBA 1IVXA 1E3VA 5JBSA 1BGSA 4LB0A 1LOYA 3MG1A 3KCHA 1BRIA 1O7MB 2HMLB 4LZIA 1YJ93 1BUQA 1GOYA 2R4IA 1F8NA 1IVVA 1WNHA 2QIYA 2W6JH 1VQ73 1IQYA 2CWVA 3AGNA 4AKZA 2ZL8A 2WO0A 3D5GA 3DY5A 3LH4A 2CX1A 1C54A 3FG3A 1JKGB 1O7WB 3OWSA 4H3UA 1RGEA 4GSPA 2F56A 2OOVA 1IK3A 4IJZA 1ZX2A 3PCRA 3F9SA 4BTXA 1OPYA 3CCV3 1VQ53 5STDA 3S27A 3B4OA 1B2ZA 3MYTA 3FKAA 1DE3A 3HI7A 4OVMA 3RGRA 3EJXA 5G1LA 2CH9A 3MKIA 4NREA 1VQ43 1RGGA 1KWIA 3I563 3S29A 1LOWA 2HMNB 2IMJA 3OX9A 4JBDA 2F86B 4G1MB 2GKEA 1BNEA 1N8QA 2KXGA 3KFQC 3ROBA 1W2B2 1GY5A 1BRNL 1RDSA 2JQ5A 3JUOA 5IERA 1W5ZA 1ROVA 1V58A 5IEPA 1US1A 3FGYA 5AI1A 5M47A 3PGBA 4MEIA 4QWTA 3H3HA 4N6TA 4RPAA 1BSDA 1QVF2 4HOHA 2IA7A 3JVCA 4R9LA 3FF2A 4TX4A 1STDA 5CF1A 1K28A 1FYSA 1D6UA 3K9MC 2XRXB 1RN1A 1ULJB 4PEJA 1G96A 2QGUA 1S5AA 1WMNA 1YGEA 2UGIA 2OTL3 1SDJA 1K20A 3Q90A 3FCSB 3D4AA 2IY2A 3X40A 1JB4A 1YVSA 3IMAB 2K54A 1I3FA 3SYUA 2PNCA 3FLJA 1YGWA 2W9QA 2CFKA 3AMOB 1Q814 2KF6A 3UL5A 3B8LA 3WMDA 7RNTA 3URPA 5G1KA 1CQSA 4IPBA 1JN5B 1OH0A 1BRHA 4N6OB 4LGQA 2Q9JA 4HVNA 2P0XA 1LVNA 5IG4A 3PXMA 1WQLB 3GZRA 4K7GB 3OWYA 3QK9A 2PW0A 3SOYA 1N5HA 1Q40B 3S28A 3ICJA 1GMPA 1V57A 1K9M4 1U1XA 3ALAA 2D1WA 1GOUA 5IEOA 1IYYA 4J9WA 1BNSA 4PY9A 2F98A 3DGNA 3VGNA 3EB8A 4WHAA 4O2HA 1BWZA 4MMZB 2R41A 2P0MA 5FW5A 4Q60A 3GZBA 4JF8A 3CD63 1RTUA 3Q1CA 1CYVA 5EEOA 5IF6A 2B24B 1TIJA 4IIAA 2GKJA 3M8CA 1GOVA 3HOHA 4HM8B 1GY6A 4N6UA 5AIGA 3NQZA 1WPMA 2PVZA 5IWEA 2HAWA 1B2UA 1JB2A 1DYUA 1JZDA 3BNEA 5CF2A 1FGQA 2O9UX 2INXA 1VQK3 2XEPA 1TM0A 4J5GA 6STDA 1OHPA 2H0IA 3FG1A 3NQYA 5FGOA 1I0XA 1IDPA 2HMJB 5GSPA 1CYUA 1T3BA 2F5WA 3NBJA 5D81A 1DVDA 1W7CA 1CH0A 3WODG 1YJN3 4RZMA 1MWRA 1NWWA 1QMAA 3D9RA 1JRQA 1TFKA 1NB3I 3MHEA 1LNHA 3PYJA 4HM7B 1W2ZA 3WDGB 2IUKA 1FUWA 3F7XA 5ELJA 2GU1A 4O02B 4AKYA 1M1K4 3EJVA 1RGKA 1G02A 3OW22 3AGOA 3MWZA 3CCL3 1A90A 3MG2A 2K0MA 2Z76A 5IENA 3G0KA 4WWUC 2GXFA 1ZO2A 2HMMB 1FGOA 2ZXRA 1RCLA 5AYRB 1UCJA 2SARA 3ER7A 1BANA 1MWTA 3JUNA 4GHOA 5KP3A 3V98A 1OHSA 3S5CA 5KP1A 5M18A 4U13A 1N9EA 4J9XA 5EVHA 2IW4A 1W62A 3LMLA 2P05A 1DMNA 9RNTA 4MMXB 1FGTA 1VQO3 4EW5A 1E97A 4WFOA 2QEX3 1IR6A 2IUJA 3WA3A 4FCMA 4WYKA 1RGAA 2YFJB 1K734 4I4KA 1FGRA 3CU3A 2CFDA 1WMOA 3NM7A 2CC3A 1OF5A 1C7HA 2D42A 1RRHA 1W02A 2K3DA 1UCIA 1U5OA 3F8XA 2ZHXB 1W4NA 5BU4A 3HZPA 3ECFA 1QYAA 1LQMB 3NUVA 2ZA4A 3CNMA 3MPHA 3LTCA 4KT3B 1X1WA 3UL6A 3ZFZA 1FUSA 3MG3A 3DMCA 1AVLA 5IG5A 1D6YA 4FCZA 1I70A 2KF4A 4IK0A 1BSBA 1BNRA 3FG4A 3CCM3 4BL2A 1TUHA 3KSED 3CME3 3A5EA 1BOXA 3CCE3 2W0QA 1X1YA 1BRGA 1IV7A 1UGHI 2WGQA 3OWUA 3CC23 5TGNA 1UGIA 1YNVX 1B27A 1WMPA 4LSOA 1IQXA 1NDOB 1NNVA 3BLZA 3BU4A 4FMBA 4N6LA 3X42A 3B7CA 1Y4KA 3NXJA 1UUVB 1RGFA 4CPKA 4K90B 2YFIB 4OA3A 2L4VA 3GRDA 1ZS7A 2CWUA 1NO3A 2FNQA 3CPOA 3DXOA 3EE1A 1MGWA 3A76A 3VF1A 1JV2B 3D3LA 3FSDA 1Q824 3WA2X 3IPTA 1I8VA 3LT8A 4R4KA 2KRTA 1A2PA 1GSPA 3FVEA 3T0UA 1W61A 1YM5A 1VQQA 5D82A 2AZPA 1RLSA 2HMOB 4LS9A 1FUTA 1SJWA 3T8UA 1JZOA 2L1SA 4CCVA 2Y73A 4XM4A 2OTJ3 2CG0A 4CJNA 4O8SA 1RKYA 1BNJA 1MWUA 1UDII 1GD3A 5H2YA 1XUAA 1IQ8A 1GMRA 2GEXA 3LYGA 3BNBA 1B20A 3S67A 2HOHA 4AEQA 3GWRA 2BO9B 4N6V0 5DREA 4EC6A 5LC6A 4RBNA 3SXXA 5IG0A 5BIRA 5KP4A 1VQ93 4JD7A 3BB9A 3OXAA 1J2BA 1KQS2 3X41A 3UNLA 3IGHX 5G2GA 5EQLA 1VQL3 1AVKA 3JUQA 4BIRA 1Q7HA 1TFOA 1OCVA 5BXQA 2ZXOA 2H0GA 3T8NA 1W6YA 3JUMA 1X1XA 2LT2A 1EG9B 4BTYA 4LEHA 4IT7A 1HU9A 1XUBA 2LYXA 1IVWA 1EKMA 3PVHA 3LTAA 1UW1A 1WPPA 1JNQA 5A0OB 1FW7A 1VQP3 1BNIA 1RJOA 2W2CA 1O7PB 2W04A 3WOFB 5JPPA 4ILFA 3PZWA 2C10A 1BNGA 2PZVA 1W6GA 2YMAA 1NU3A 3W5WA 5CLKA 5LC7A 3X3YA 3G16A 2ZDJA 2OQEC 2F99A 2QB8A 3G7KA 4HM1B 5RNTA 1ISKA 1BIRA 1E3RA 3CC73 4EV5A 2FGTA 1BVIA 3MSOA 2A15A 1VQ83 3EC9A 2QB7A 5M19A 1JJ22 2W56B 8RNTA 3DZLA 1OACA 3JUPA 3K5TA 1RSNA 2J8XB 4Q53A 3EX9A 1R4CA 2YX9A 4ORLA 3U1WA 2ENXA 1OGZA 3SLUA 4X2OA 2QA43 2LQVA 2XR8B 3CCS3 2F5MA 3G4S3 1JBRA 5AIIA 1RGHA 3CCQ3 1YIJ3 1MWSA 4GB5A 1KC84 1KD14 2KF5A 4I5QA 4FMAA
chains in the Genus database with same CATH topology
4WYKB 1N9JA 1SIIA 1Z1SA 1RRLA 2Q07A 2CK3H 2Z77A 1OF5B 1Q42A 1QVG2 3QRDA 3LT9A 1GS3A 4GL6A 3NV0A 2RFRA 5DRVA 3L0RA 1TP6A 4Q2HA 1SQWA 1W00A 4HJLB 2C11A 2W56A 2P38A 3F14A 2CWTA 3WQZA 4HM3B 2XF3A 1EA2A 1O7GB 2OCTA 3DEVA 3CC43 1T6KA 1SPUA 3G8ZA 1OGXA 3KIIA 2CIUA 2I9WA 3I553 1M904 4DUNA 1TU5A 1UI8A 1GQZA 4HZBB 1GY7A 3HIGA 3NX0A 4ZM8A 5CXOA 1FGMA 2P09A 2ZXPA 3IJEB 1D6ZA 1W6CA 3H51A 2QB6A 1S723 4XBXA 3UJMA 1IU7A 1QALA 2O3OA 1UUWB 2GU3A 2Z7AA 3K7CA 4HM2B 5HGRA 2OWPA 1PU4A 1PFPA 2OOVC 1IV9A 2SBLA 3UB1A 2KPTA 2BT3A 2ML5A 2XFSA 4L8PA 3HX8A 3NBBA 4EYCA 1QAKA 3CPW2 3FH1A 4J9AA 2H9FA 2KCDA 1IT8A 1OHOA 1V74A 2CKFB 3CCR3 3LXUX 3O8YA 1A2VA 1QY9A 4EBGA 3K63A 5AIFA 3EBTA 4R9KA 4STDA 1STFI 2RGQA 3FF0A 3LTBA 1YI23 3PW9A 3U97A 3N54B 1U1WA 3HK4A 2MPBA 1YIT3 2CFGA 3KE7A 3CNXA 1HKXA 2XGNA 2MC8A 1LXEA 1YJW3 3B4PA 3DGMA 3GAXA 2RSXA 3PTJA 2XFTA 1S7JA 2CHCA 4LG3A 2BMRB 4LMIA 3HIIA 1ROAA 5AEWB 3DGOA 2STDA 4N6MA 1ASKA 4N6NB 4HYZA 2CG1A 3V99A 4XDWA 5I97A 2CFLA 1IVUA 7STDA 1VZZA 1FA3A 2JDIH 3GZXB 4JRFA 5HA4A 1JKGA 4R80A 4OK0A 4RNZA 1JB5A 3J7Yd 1IT7A 2E2VA 3WOEB 2W9PA 2XSHB 5CK6A 2MF7A 3G6E3 2WGOA 1U1VA 2M7OA 2BMOB 4X2HA 4KFEA 5JPUA 3CCU3 2BHMA 2Q9HA 4XBYA 3E99A 4FCJA 1A2KA 2V1LA 3G713 3N9HA 2XSOB 3EN8A 4O3VA 3F7SA 3F40A 4NHFA 3G98A 1WTHA 5AIHA 1N8R4 4FMCA 4HM0B 4K7XA 3NV0B 3DUKA 4XDVA 4BTWA 2Y74A 2GBWB 3K0ZA 5IG3A 5IW9A 4HM5B 4HBRA 1K41A 3SVAA 1DMQA 3GZYB 1MOLA 3I0YA 4HM6B 1YVBI 4HZ9B 1L5GB 1VQM3 3RDEA 4FR9A 3X3ZA 2OTNA 5H2GA 2B1XB 1AR0A 3CCJ3 4JCIA 1NJI4 1K23A 1AV4A 4RNYA 1I74A 2E2UA 2W03A 1K8A4 2OQEA 1GYBA 1N5PA 4KFDA 4H61A 4FMDA 4XBTA 3NM2A 3EN1B 3AMOA 2HMKB 4K61A 3EKMA 4KZ1A 2KW7A 3BNDA 3DGLA 4K8LA 2GEYA 2UX0A 3BNCA 3SEDA 3CXC2 1JN5A 2CW9A 5AYSC 3EBYA 5AEUB 2E2TA 1Q7Y4 1LOXA 4L7KA 2RCDA 3VSYA 3Q2PA 1W01A 3EQQB 1NB5I 3LOYA 3LTDA 3CMA3 2WOHA 2WOFA 3NHXA 3FZWA 1QAFA 5ANPA 1Q40A 2Z6BA 1KSIA 4JUUA 1A67A 2XGLA 3LZAA 1DMMA 4WP5A 4EV2A 1EQKA 4HKVB 4HM4B 2ML6A 1U8CB 3PS8A 3KZTA 4KVHA 1GD4A 1DVCA 3DM8A 5D83A 1O7HB 2CFWA 3F8HA 1RN7A 4K1UA 2BNGA 1CEWI 1VQN3 1QJGA 4J8TA 3OV4A 4K1VA 4L8OA 5ELUA 2BMQB 4KFFA 4XB5A 4MJDA 1M1XB 3NBRA 8CHOA 3KSPA 1OUNA 2GBXB 2XH9A 2FXTA 3KKGA 3N8BA 1T5YA 3PCSA 4R1KA 3RGAA 3TDGA 1M9GA 3EDNA 1YHQ3 1MNLA 3EF8A 1Q864 4N3VA 3V92A 3X3XA 1ULIB 1VQ63 3STDA 1UI7A 3SX1A 2ZVFA 4OUQA 1SIHA 4CDLA 2YFLB 1U0KA 3EHCA 1O7NB 2EB0A 3SOAA 5BVBA 1IVXA 1E3VA 5JBSA 4LB0A 3MG1A 1O7MB 2HMLB 4LZIA 1YJ93 1BUQA 2R4IA 1VQ73 1F8NA 1IVVA 1WNHA 2QIYA 2W6JH 1IQYA 2CWVA 4AKZA 2ZL8A 2WO0A 3DY5A 3LH4A 3FG3A 1JKGB 1O7WB 3OWSA 4H3UA 2OOVA 1IK3A 4IJZA 1ZX2A 3PCRA 3F9SA 4BTXA 1OPYA 3CCV3 1VQ53 5STDA 3S27A 3B4OA 3MYTA 3FKAA 3HI7A 4OVMA 3RGRA 3EJXA 2CH9A 3MKIA 4NREA 1VQ43 1KWIA 3I563 3S29A 2HMNB 2IMJA 3OX9A 4JBDA 2F86B 4G1MB 2GKEA 1N8QA 2KXGA 3KFQC 3ROBA 1W2B2 1GY5A 2JQ5A 3JUOA 5IERA 1W5ZA 1ROVA 5IEPA 1US1A 3FGYA 5AI1A 5M47A 3PGBA 4MEIA 4QWTA 3H3HA 4N6TA 4RPAA 1QVF2 2IA7A 3JVCA 4R9LA 3FF2A 4TX4A 1STDA 5CF1A 1K28A 3K9MC 1D6UA 2XRXB 1ULJB 4PEJA 1G96A 2QGUA 1S5AA 1WMNA 1YGEA 2OTL3 1SDJA 1K20A 3Q90A 3FCSB 3X40A 1JB4A 3IMAB 2K54A 2PNCA 3FLJA 2W9QA 2CFKA 3AMOB 1Q814 3UL5A 3B8LA 3WMDA 1CQSA 4IPBA 1JN5B 1OH0A 4N6OB 4LGQA 2Q9JA 4HVNA 2P0XA 1LVNA 5IG4A 3PXMA 1WQLB 3GZRA 4K7GB 3OWYA 3QK9A 2PW0A 3SOYA 1N5HA 1Q40B 3S28A 3ICJA 1K9M4 1U1XA 3ALAA 2D1WA 5IEOA 4J9WA 4PY9A 2F98A 3DGNA 3VGNA 3EB8A 4WHAA 4O2HA 1BWZA 4MMZB 2P0MA 5FW5A 4Q60A 3GZBA 4JF8A 3CD63 3Q1CA 1CYVA 5EEOA 5IF6A 2B24B 1TIJA 4IIAA 2GKJA 3M8CA 4HM8B 1GY6A 4N6UA 5AIGA 3NQZA 1WPMA 2PVZA 5IWEA 2HAWA 1JB2A 1DYUA 5CF2A 3BNEA 1FGQA 2O9UX 2INXA 1VQK3 2XEPA 1TM0A 6STDA 1OHPA 3FG1A 3NQYA 5FGOA 1IDPA 2HMJB 1CYUA 3NBJA 1DVDA 5D81A 1W7CA 3WODG 1YJN3 4RZMA 1NWWA 1QMAA 3D9RA 1TFKA 1JRQA 1NB3I 3MHEA 1LNHA 3PYJA 4HM7B 1W2ZA 3WDGB 2IUKA 1FUWA 3F7XA 5ELJA 2GU1A 4O02B 4AKYA 1M1K4 3EJVA 3OW22 1A90A 3MWZA 3CCL3 3MG2A 2K0MA 2Z76A 5IENA 3G0KA 4WWUC 2GXFA 1ZO2A 2HMMB 1FGOA 2ZXRA 5AYRB 3ER7A 3JUNA 5KP3A 3V98A 1OHSA 3S5CA 5KP1A 4U13A 1N9EA 4J9XA 5EVHA 2IW4A 1W62A 3LMLA 2P05A 1DMNA 4MMXB 1FGTA 1VQO3 1E97A 4WFOA 2QEX3 1IR6A 2IUJA 3WA3A 4FCMA 4WYKA 2YFJB 1K734 4I4KA 1FGRA 3CU3A 2CFDA 1WMOA 3NM7A 2CC3A 1OF5A 1C7HA 2D42A 1RRHA 1W02A 1U5OA 3F8XA 1W4NA 3HZPA 3ECFA 1QYAA 3NUVA 3CNMA 3MPHA 3LTCA 3UL6A 3MG3A 3DMCA 1AVLA 5IG5A 1D6YA 4FCZA 4IK0A 3FG4A 3CCM3 1TUHA 3KSED 3CME3 3CCE3 2W0QA 1IV7A 2WGQA 3OWUA 3CC23 5TGNA 4LSOA 1WMPA 1IQXA 1NDOB 3BLZA 4FMBA 4N6LA 3X42A 3B7CA 1Y4KA 3NXJA 1UUVB 4K90B 2YFIB 4OA3A 2L4VA 3GRDA 2FNQA 2CWUA 1NO3A 3KN4A 3CPOA 3DXOA 3EE1A 3VF1A 3A76A 1JV2B 3D3LA 3FSDA 1Q824 3WA2X 3IPTA 3LT8A 4R4KA 2KRTA 3FVEA 3T0UA 1W61A 1YM5A 5D82A 2AZPA 2HMOB 4LS9A 1SJWA 3T8UA 4CCVA 2Y73A 4XM4A 2OTJ3 2CG0A 4O8SA 1RKYA 1GD3A 5H2YA 1XUAA 1IQ8A 3LYGA 2GEXA 3BNBA 4AEQA 3S67A 4EC6A 3GWRA 2BO9B 4N6V0 5DREA 5LC6A 4RBNA 3SXXA 5IG0A 1VQ93 5KP4A 4JD7A 3BB9A 3OXAA 1J2BA 1KQS2 3X41A 3UNLA 3IGHX 5G2GA 5EQLA 1VQL3 1AVKA 3JUQA 1TFOA 1OCVA 5BXQA 2ZXOA 3T8NA 1W6YA 3JUMA 2LT2A 1EG9B 4BTYA 4LEHA 4IT7A 1HU9A 1XUBA 2LYXA 1IVWA 1EKMA 3PVHA 3LTAA 1UW1A 1WPPA 1JNQA 5A0OB 1VQP3 1RJOA 2W2CA 1O7PB 2W04A 3WOFB 5JPPA 3PZWA 2C10A 2PZVA 1W6GA 2YMAA 1NU3A 3W5WA 5CLKA 5LC7A 3X3YA 3G16A 2ZDJA 2OQEC 2F99A 2QB8A 3G7KA 4HM1B 1ISKA 1E3RA 3CC73 4EV5A 2FGTA 3MSOA 2A15A 1VQ83 3EC9A 2QB7A 1JJ22 2W56B 3DZLA 1OACA 3JUPA 3K5TA 4Q53A 3EX9A 1R4CA 2YX9A 4ORLA 3U1WA 2ENXA 1OGZA 3SLUA 4X2OA 2QA43 2LQVA 2XR8B 3CCS3 3G4S3 5AIIA 3CCQ3 1YIJ3 1KC84 4GB5A 1KD14 4EXRA 4MMYB 4FMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GL6 A; 
#chains in the Genus database with same CATH topology
 1DET A;  1Q9E A;  4WYK B;  1N9J A;  1SII A;  1PYL A;  1Z1S A;  1RRL A;  1RNB A;  1SAR A;  2CK3 H;  2KF3 A;  1OF5 B;  1Q42 A;  2Q07 A;  2Z77 A;  3QRD A;  1QVG 2;  3LT9 A;  1GS3 A;  4GL6 A;  3NV0 A;  2RFR A;  5DRV A;  3L0R A;  1EEJ A;  1TP6 A;  4Q2H A;  1SQW A;  1W00 A;  4HJL B;  1RGC A;  1EUI C;  2C11 A;  2KAA A;  2W56 A;  2P38 A;  3F14 A;  2CWT A;  3WQZ A;  1LRA A;  4HM3 B;  2XF3 A;  1B21 A;  1EA2 A;  1O7G B;  1RHL A;  3DEV A;  2OCT A;  1I2F A;  3CC4 3;  1LNI A;  1T6K A;  1SPU A;  3G8Z A;  1OGX A;  3KII A;  2CIU A;  2I9W A;  7GSP A;  3I55 3;  1BRK A;  1M90 4;  4DUN A;  1TU5 A;  1UI8 A;  1GQZ A;  4HZB B;  1BRS A;  1GY7 A;  3HIG A;  3NX0 A;  4ZM8 A;  3AHS A;  5CXO A;  1FGM A;  2P09 A;  2ZXP A;  3IJE B;  1D6Z A;  1W6C A;  1RGL A;  3H51 A;  2QB6 A;  1S72 3;  4XBX A;  3UJM A;  1IU7 A;  1GMQ A;  1QAL A;  1BRJ A;  1UUW B;  2GU3 A;  2O3O A;  2Z7A A;  3K7C A;  2OWP A;  4HM2 B;  5HGR A;  1PFP A;  1PU4 A;  2OOV C;  1IV9 A;  2SBL A;  3UB1 A;  3KN4 A;  2KPT A;  1UUG B;  2BT3 A;  2ML5 A;  2XFS A;  4L8P A;  3HX8 A;  3NBB A;  4EYC A;  1G0T A;  1QAK A;  3CPW 2;  3FH1 A;  4J9A A;  1BAO A;  2H9F A;  2KCD A;  1IT8 A;  1OHO A;  1V74 A;  2CKF B;  3CCR 3;  3LXU X;  2F4Y A;  3O8Y A;  2BU4 A;  1A2V A;  1QY9 A;  1B3S A;  4EBG A;  3K63 A;  5AIF A;  3EBT A;  4R9K A;  4STD A;  1X1U A;  1STF I;  2RGQ A;  3FF0 A;  3LTB A;  1YI2 3;  3PW9 A;  3U97 A;  3N54 B;  1U1W A;  3HK4 A;  2MPB A;  1YIT 3;  2CFG A;  1ZGX A;  3KE7 A;  3CNX A;  1HKX A;  3DGY A;  4BL3 A;  2XGN A;  4RNT A;  2MC8 A;  1LXE A;  1YJW 3;  3B4P A;  3DGM A;  3GAX A;  2RSX A;  3PTJ A;  2XFT A;  1S7J A;  4LG3 A;  2CHC A;  1TRQ A;  2BMR B;  4LMI A;  3HII A;  1ROA A;  3D79 A;  5AEW B;  3DGO A;  2STD A;  4N6M A;  1ASK A;  1JBS A;  2AAD A;  1HYF A;  1BUJ A;  4N6N B;  4HYZ A;  2CG1 A;  3V99 A;  4XDW A;  1B2S A;  1I2G A;  2CFL A;  5I97 A;  1IVU A;  4DKI A;  1R4Y A;  7STD A;  1FZU A;  1VZZ A;  2C4B A;  1FA3 A;  2JDI H;  3GZX B;  4JRF A;  5HA4 A;  1JKG A;  4R80 A;  4OK0 A;  4RNZ A;  1JB5 A;  3J7Y d;  1IT7 A;  2E2V A;  3D5I A;  2BIR A;  1BSA A;  1HZ1 A;  3WOE B;  2W9P A;  1LQG C;  2XSH B;  5CK6 A;  2MF7 A;  3G6E 3;  1MGR A;  2AAE A;  2WGO A;  1U1V A;  2M7O A;  2BMO B;  4X2H A;  4KFE A;  3ZG5 A;  1BNF A;  2BHM A;  2Q9H A;  4XBY A;  5JPU A;  3E99 A;  3CCU 3;  4FCJ A;  1BSC A;  2CX0 A;  1A2K A;  2V1L A;  3G71 3;  3N9H A;  2XSO B;  3EN8 A;  4O3V A;  3F7S A;  3F40 A;  4NHF A;  3G98 A;  1WTH A;  5AIH A;  5HOH A;  4NPB A;  1N8R 4;  1TTO A;  4FMC A;  4HM0 B;  4K7X A;  3NV0 B;  3DUK A;  4XDV A;  4BTW A;  2Y74 A;  2GBW B;  3K0Z A;  1T2I A;  5IG3 A;  5IW9 A;  2IYJ A;  4HM5 B;  4HBR A;  1K41 A;  3SVA A;  3ZG0 A;  1DMQ A;  3GZY B;  1MOL A;  3I0Y A;  4HM6 B;  3WR2 A;  1YVB I;  1PY3 A;  4HZ9 B;  1L5G B;  3RDE A;  4FR9 A;  1VQM 3;  3X3Z A;  1JBT A;  1TRP A;  2OTN A;  5H2G A;  2B1X B;  1AR0 A;  3CCJ 3;  4JCI A;  1NJI 4;  1K23 A;  1AV4 A;  4RNY A;  1I74 A;  1B2M A;  2E2U A;  4MMY B;  2W03 A;  1I3I A;  1K8A 4;  3DH2 A;  2OQE A;  1GYB A;  1N5P A;  4KFD A;  2H0H A;  4H61 A;  4FMD A;  1BU4 A;  3NM2 A;  4XBT A;  3EN1 B;  2RNT A;  2HMK B;  3AMO A;  3EKM A;  4K61 A;  4KZ1 A;  4EXR A;  2KW7 A;  3BND A;  3DGL A;  4K8L A;  1AQZ A;  2GEY A;  2UX0 A;  3BNC A;  3SED A;  1JN5 A;  1RMS A;  3CXC 2;  5M1A A;  2CW9 A;  5AYS C;  3EBY A;  5AEU B;  2E2T A;  4HAA A;  1Q7Y 4;  1LOX A;  4L7K A;  2RCD A;  1T2H A;  3VSY A;  4BU4 A;  3Q2P A;  1W01 A;  3EQQ B;  1I2E A;  1NB5 I;  1RN4 A;  3LOY A;  3LTD A;  3CMA 3;  2WOH A;  2WOF A;  3NHX A;  3FZW A;  1QAF A;  3WHO A;  5ANP A;  1Q40 A;  2Z6B A;  1KSI A;  4JUU A;  1A67 A;  2XGL A;  3LZA A;  1DMM A;  4WP5 A;  3BIR A;  4EV2 A;  1UCL A;  4HKV B;  2ML6 A;  4HM4 B;  1I0V A;  1U8C B;  3PS8 A;  3Q3F A;  4LYL B;  3KZT A;  1UCK A;  1LOV A;  1TJD A;  4KVH A;  1GD4 A;  1DVC A;  3DM8 A;  5D83 A;  1O7H B;  1BSE A;  2CFW A;  2RBI A;  3F8H A;  1RN7 A;  4K1U A;  2BNG A;  2GSP A;  1CEW I;  1VQN 3;  1RNT A;  4J5K A;  1QJG A;  4J8T A;  6GSP A;  3OV4 A;  4K1V A;  4L8O A;  5ELU A;  2BMQ B;  1B2X A;  4KFF A;  3RNT A;  4XB5 A;  4MJD A;  1M1X B;  3NBR A;  8CHO A;  3KSP A;  1OUN A;  2UUG C;  2GBX B;  2XH9 A;  2FXT A;  3KKG A;  3N8B A;  1T5Y A;  3PCS A;  4R1K A;  3RGA A;  3TDG A;  1M9G A;  3EDN A;  1YHQ 3;  1MNL A;  3EF8 A;  1Q86 4;  3AHW A;  4N3V A;  3V92 A;  3X3X A;  1EQK A;  1ULI B;  1RCK A;  6RNT A;  1VQ6 3;  1AY7 A;  3STD A;  1UI7 A;  3SX1 A;  2ZVF A;  4OUQ A;  1SIH A;  4CDL A;  3GSP A;  2YFL B;  1U0K A;  3EHC A;  1O7N B;  2EB0 A;  3SOA A;  5BVB A;  1IVX A;  1E3V A;  5JBS A;  1BGS A;  4LB0 A;  1LOY A;  3MG1 A;  3KCH A;  1BRI A;  1O7M B;  2HML B;  4LZI A;  1YJ9 3;  1BUQ A;  1GOY A;  2R4I A;  1F8N A;  1IVV A;  1WNH A;  2QIY A;  2W6J H;  1VQ7 3;  1IQY A;  2CWV A;  3AGN A;  4AKZ A;  2ZL8 A;  2WO0 A;  3D5G A;  3DY5 A;  3LH4 A;  2CX1 A;  1C54 A;  3FG3 A;  1JKG B;  1O7W B;  3OWS A;  4H3U A;  1RGE A;  4GSP A;  2F56 A;  2OOV A;  1IK3 A;  4IJZ A;  1ZX2 A;  3PCR A;  3F9S A;  4BTX A;  1OPY A;  3CCV 3;  1VQ5 3;  5STD A;  3S27 A;  3B4O A;  1B2Z A;  3MYT A;  3FKA A;  1DE3 A;  3HI7 A;  4OVM A;  3RGR A;  3EJX A;  5G1L A;  2CH9 A;  3MKI A;  4NRE A;  1VQ4 3;  1RGG A;  1KWI A;  3I56 3;  3S29 A;  1LOW A;  2HMN B;  2IMJ A;  3OX9 A;  4JBD A;  2F86 B;  4G1M B;  2GKE A;  1BNE A;  1N8Q A;  2KXG A;  3KFQ C;  3ROB A;  1W2B 2;  1GY5 A;  1BRN L;  1RDS A;  2JQ5 A;  3JUO A;  5IER A;  1W5Z A;  1ROV A;  1V58 A;  5IEP A;  1US1 A;  3FGY A;  5AI1 A;  5M47 A;  3PGB A;  4MEI A;  4QWT A;  3H3H A;  4N6T A;  4RPA A;  1BSD A;  1QVF 2;  4HOH A;  2IA7 A;  3JVC A;  4R9L A;  3FF2 A;  4TX4 A;  1STD A;  5CF1 A;  1K28 A;  1FYS A;  1D6U A;  3K9M C;  2XRX B;  1RN1 A;  1ULJ B;  4PEJ A;  1G96 A;  2QGU A;  1S5A A;  1WMN A;  1YGE A;  2UGI A;  2OTL 3;  1SDJ A;  1K20 A;  3Q90 A;  3FCS B;  3D4A A;  2IY2 A;  3X40 A;  1JB4 A;  1YVS A;  3IMA B;  2K54 A;  1I3F A;  3SYU A;  2PNC A;  3FLJ A;  1YGW A;  2W9Q A;  2CFK A;  3AMO B;  1Q81 4;  2KF6 A;  3UL5 A;  3B8L A;  3WMD A;  7RNT A;  3URP A;  5G1K A;  1CQS A;  4IPB A;  1JN5 B;  1OH0 A;  1BRH A;  4N6O B;  4LGQ A;  2Q9J A;  4HVN A;  2P0X A;  1LVN A;  5IG4 A;  3PXM A;  1WQL B;  3GZR A;  4K7G B;  3OWY A;  3QK9 A;  2PW0 A;  3SOY A;  1N5H A;  1Q40 B;  3S28 A;  3ICJ A;  1GMP A;  1V57 A;  1K9M 4;  1U1X A;  3ALA A;  2D1W A;  1GOU A;  5IEO A;  1IYY A;  4J9W A;  1BNS A;  4PY9 A;  2F98 A;  3DGN A;  3VGN A;  3EB8 A;  4WHA A;  4O2H A;  1BWZ A;  4MMZ B;  2R41 A;  2P0M A;  5FW5 A;  4Q60 A;  3GZB A;  4JF8 A;  3CD6 3;  1RTU A;  3Q1C A;  1CYV A;  5EEO A;  5IF6 A;  2B24 B;  1TIJ A;  4IIA A;  2GKJ A;  3M8C A;  1GOV A;  3HOH A;  4HM8 B;  1GY6 A;  4N6U A;  5AIG A;  3NQZ A;  1WPM A;  2PVZ A;  5IWE A;  2HAW A;  1B2U A;  1JB2 A;  1DYU A;  1JZD A;  3BNE A;  5CF2 A;  1FGQ A;  2O9U X;  2INX A;  1VQK 3;  2XEP A;  1TM0 A;  4J5G A;  6STD A;  1OHP A;  2H0I A;  3FG1 A;  3NQY A;  5FGO A;  1I0X A;  1IDP A;  2HMJ B;  5GSP A;  1CYU A;  1T3B A;  2F5W A;  3NBJ A;  5D81 A;  1DVD A;  1W7C A;  1CH0 A;  3WOD G;  1YJN 3;  4RZM A;  1MWR A;  1NWW A;  1QMA A;  3D9R A;  1JRQ A;  1TFK A;  1NB3 I;  3MHE A;  1LNH A;  3PYJ A;  4HM7 B;  1W2Z A;  3WDG B;  2IUK A;  1FUW A;  3F7X A;  5ELJ A;  2GU1 A;  4O02 B;  4AKY A;  1M1K 4;  3EJV A;  1RGK A;  1G02 A;  3OW2 2;  3AGO A;  3MWZ A;  3CCL 3;  1A90 A;  3MG2 A;  2K0M A;  2Z76 A;  5IEN A;  3G0K A;  4WWU C;  2GXF A;  1ZO2 A;  2HMM B;  1FGO A;  2ZXR A;  1RCL A;  5AYR B;  1UCJ A;  2SAR A;  3ER7 A;  1BAN A;  1MWT A;  3JUN A;  4GHO A;  5KP3 A;  3V98 A;  1OHS A;  3S5C A;  5KP1 A;  5M18 A;  4U13 A;  1N9E A;  4J9X A;  5EVH A;  2IW4 A;  1W62 A;  3LML A;  2P05 A;  1DMN A;  9RNT A;  4MMX B;  1FGT A;  1VQO 3;  4EW5 A;  1E97 A;  4WFO A;  2QEX 3;  1IR6 A;  2IUJ A;  3WA3 A;  4FCM A;  4WYK A;  1RGA A;  2YFJ B;  1K73 4;  4I4K A;  1FGR A;  3CU3 A;  2CFD A;  1WMO A;  3NM7 A;  2CC3 A;  1OF5 A;  1C7H A;  2D42 A;  1RRH A;  1W02 A;  2K3D A;  1UCI A;  1U5O A;  3F8X A;  2ZHX B;  1W4N A;  5BU4 A;  3HZP A;  3ECF A;  1QYA A;  1LQM B;  3NUV A;  2ZA4 A;  3CNM A;  3MPH A;  3LTC A;  4KT3 B;  1X1W A;  3UL6 A;  3ZFZ A;  1FUS A;  3MG3 A;  3DMC A;  1AVL A;  5IG5 A;  1D6Y A;  4FCZ A;  1I70 A;  2KF4 A;  4IK0 A;  1BSB A;  1BNR A;  3FG4 A;  3CCM 3;  4BL2 A;  1TUH A;  3KSE D;  3CME 3;  3A5E A;  1BOX A;  3CCE 3;  2W0Q A;  1X1Y A;  1BRG A;  1IV7 A;  1UGH I;  2WGQ A;  3OWU A;  3CC2 3;  5TGN A;  1UGI A;  1YNV X;  1B27 A;  1WMP A;  4LSO A;  1IQX A;  1NDO B;  1NNV A;  3BLZ A;  3BU4 A;  4FMB A;  4N6L A;  3X42 A;  3B7C A;  1Y4K A;  3NXJ A;  1UUV B;  1RGF A;  4CPK A;  4K90 B;  2YFI B;  4OA3 A;  2L4V A;  3GRD A;  1ZS7 A;  2CWU A;  1NO3 A;  2FNQ A;  3CPO A;  3DXO A;  3EE1 A;  1MGW A;  3A76 A;  3VF1 A;  1JV2 B;  3D3L A;  3FSD A;  1Q82 4;  3WA2 X;  3IPT A;  1I8V A;  3LT8 A;  4R4K A;  2KRT A;  1A2P A;  1GSP A;  3FVE A;  3T0U A;  1W61 A;  1YM5 A;  1VQQ A;  5D82 A;  2AZP A;  1RLS A;  2HMO B;  4LS9 A;  1FUT A;  1SJW A;  3T8U A;  1JZO A;  2L1S A;  4CCV A;  2Y73 A;  4XM4 A;  2OTJ 3;  2CG0 A;  4CJN A;  4O8S A;  1RKY A;  1BNJ A;  1MWU A;  1UDI I;  1GD3 A;  5H2Y A;  1XUA A;  1IQ8 A;  1GMR A;  2GEX A;  3LYG A;  3BNB A;  1B20 A;  3S67 A;  2HOH A;  4AEQ A;  3GWR A;  2BO9 B;  4N6V 0;  5DRE A;  4EC6 A;  5LC6 A;  4RBN A;  3SXX A;  5IG0 A;  5BIR A;  5KP4 A;  1VQ9 3;  4JD7 A;  3BB9 A;  3OXA A;  1J2B A;  1KQS 2;  3X41 A;  3UNL A;  3IGH X;  5G2G A;  5EQL A;  1VQL 3;  1AVK A;  3JUQ A;  4BIR A;  1Q7H A;  1TFO A;  1OCV A;  5BXQ A;  2ZXO A;  2H0G A;  3T8N A;  1W6Y A;  3JUM A;  1X1X A;  2LT2 A;  1EG9 B;  4BTY A;  4LEH A;  4IT7 A;  1HU9 A;  1XUB A;  2LYX A;  1IVW A;  1EKM A;  3PVH A;  3LTA A;  1UW1 A;  1WPP A;  1JNQ A;  5A0O B;  1FW7 A;  1VQP 3;  1BNI A;  1RJO A;  2W2C A;  1O7P B;  2W04 A;  3WOF B;  5JPP A;  4ILF A;  3PZW A;  2C10 A;  1BNG A;  2PZV A;  1W6G A;  2YMA A;  1NU3 A;  3W5W A;  5CLK A;  5LC7 A;  3X3Y A;  3G16 A;  2ZDJ A;  2OQE C;  2F99 A;  2QB8 A;  3G7K A;  4HM1 B;  5RNT A;  1ISK A;  1BIR A;  1E3R A;  3CC7 3;  4EV5 A;  2FGT A;  1BVI A;  3MSO A;  2A15 A;  1VQ8 3;  3EC9 A;  2QB7 A;  5M19 A;  1JJ2 2;  2W56 B;  8RNT A;  3DZL A;  1OAC A;  3JUP A;  3K5T A;  1RSN A;  2J8X B;  4Q53 A;  3EX9 A;  1R4C A;  2YX9 A;  4ORL A;  3U1W A;  2ENX A;  1OGZ A;  3SLU A;  4X2O A;  2QA4 3;  2LQV A;  2XR8 B;  3CCS 3;  2F5M A;  3G4S 3;  1JBR A;  5AII A;  1RGH A;  3CCQ 3;  1YIJ 3;  1MWS A;  4GB5 A;  1KC8 4;  1KD1 4;  2KF5 A;  4I5Q A;  4FMA A; 
#chains in the Genus database with same CATH homology
 4WYK B;  1N9J A;  1SII A;  1Z1S A;  1RRL A;  2Q07 A;  2CK3 H;  2Z77 A;  1OF5 B;  1Q42 A;  1QVG 2;  3QRD A;  3LT9 A;  1GS3 A;  4GL6 A;  3NV0 A;  2RFR A;  5DRV A;  3L0R A;  1TP6 A;  4Q2H A;  1SQW A;  1W00 A;  4HJL B;  2C11 A;  2W56 A;  2P38 A;  3F14 A;  2CWT A;  3WQZ A;  4HM3 B;  2XF3 A;  1EA2 A;  1O7G B;  2OCT A;  3DEV A;  3CC4 3;  1T6K A;  1SPU A;  3G8Z A;  1OGX A;  3KII A;  2CIU A;  2I9W A;  3I55 3;  1M90 4;  4DUN A;  1TU5 A;  1UI8 A;  1GQZ A;  4HZB B;  1GY7 A;  3HIG A;  3NX0 A;  4ZM8 A;  5CXO A;  1FGM A;  2P09 A;  2ZXP A;  3IJE B;  1D6Z A;  1W6C A;  3H51 A;  2QB6 A;  1S72 3;  4XBX A;  3UJM A;  1IU7 A;  1QAL A;  2O3O A;  1UUW B;  2GU3 A;  2Z7A A;  3K7C A;  4HM2 B;  5HGR A;  2OWP A;  1PU4 A;  1PFP A;  2OOV C;  1IV9 A;  2SBL A;  3UB1 A;  2KPT A;  2BT3 A;  2ML5 A;  2XFS A;  4L8P A;  3HX8 A;  3NBB A;  4EYC A;  1QAK A;  3CPW 2;  3FH1 A;  4J9A A;  2H9F A;  2KCD A;  1IT8 A;  1OHO A;  1V74 A;  2CKF B;  3CCR 3;  3LXU X;  3O8Y A;  1A2V A;  1QY9 A;  4EBG A;  3K63 A;  5AIF A;  3EBT A;  4R9K A;  4STD A;  1STF I;  2RGQ A;  3FF0 A;  3LTB A;  1YI2 3;  3PW9 A;  3U97 A;  3N54 B;  1U1W A;  3HK4 A;  2MPB A;  1YIT 3;  2CFG A;  3KE7 A;  3CNX A;  1HKX A;  2XGN A;  2MC8 A;  1LXE A;  1YJW 3;  3B4P A;  3DGM A;  3GAX A;  2RSX A;  3PTJ A;  2XFT A;  1S7J A;  2CHC A;  4LG3 A;  2BMR B;  4LMI A;  3HII A;  1ROA A;  5AEW B;  3DGO A;  2STD A;  4N6M A;  1ASK A;  4N6N B;  4HYZ A;  2CG1 A;  3V99 A;  4XDW A;  5I97 A;  2CFL A;  1IVU A;  7STD A;  1VZZ A;  1FA3 A;  2JDI H;  3GZX B;  4JRF A;  5HA4 A;  1JKG A;  4R80 A;  4OK0 A;  4RNZ A;  1JB5 A;  3J7Y d;  1IT7 A;  2E2V A;  3WOE B;  2W9P A;  2XSH B;  5CK6 A;  2MF7 A;  3G6E 3;  2WGO A;  1U1V A;  2M7O A;  2BMO B;  4X2H A;  4KFE A;  5JPU A;  3CCU 3;  2BHM A;  2Q9H A;  4XBY A;  3E99 A;  4FCJ A;  1A2K A;  2V1L A;  3G71 3;  3N9H A;  2XSO B;  3EN8 A;  4O3V A;  3F7S A;  3F40 A;  4NHF A;  3G98 A;  1WTH A;  5AIH A;  1N8R 4;  4FMC A;  4HM0 B;  4K7X A;  3NV0 B;  3DUK A;  4XDV A;  4BTW A;  2Y74 A;  2GBW B;  3K0Z A;  5IG3 A;  5IW9 A;  4HM5 B;  4HBR A;  1K41 A;  3SVA A;  1DMQ A;  3GZY B;  1MOL A;  3I0Y A;  4HM6 B;  1YVB I;  4HZ9 B;  1L5G B;  1VQM 3;  3RDE A;  4FR9 A;  3X3Z A;  2OTN A;  5H2G A;  2B1X B;  1AR0 A;  3CCJ 3;  4JCI A;  1NJI 4;  1K23 A;  1AV4 A;  4RNY A;  1I74 A;  2E2U A;  2W03 A;  1K8A 4;  2OQE A;  1GYB A;  1N5P A;  4KFD A;  4H61 A;  4FMD A;  4XBT A;  3NM2 A;  3EN1 B;  3AMO A;  2HMK B;  4K61 A;  3EKM A;  4KZ1 A;  2KW7 A;  3BND A;  3DGL A;  4K8L A;  2GEY A;  2UX0 A;  3BNC A;  3SED A;  3CXC 2;  1JN5 A;  2CW9 A;  5AYS C;  3EBY A;  5AEU B;  2E2T A;  1Q7Y 4;  1LOX A;  4L7K A;  2RCD A;  3VSY A;  3Q2P A;  1W01 A;  3EQQ B;  1NB5 I;  3LOY A;  3LTD A;  3CMA 3;  2WOH A;  2WOF A;  3NHX A;  3FZW A;  1QAF A;  5ANP A;  1Q40 A;  2Z6B A;  1KSI A;  4JUU A;  1A67 A;  2XGL A;  3LZA A;  1DMM A;  4WP5 A;  4EV2 A;  1EQK A;  4HKV B;  4HM4 B;  2ML6 A;  1U8C B;  3PS8 A;  3KZT A;  4KVH A;  1GD4 A;  1DVC A;  3DM8 A;  5D83 A;  1O7H B;  2CFW A;  3F8H A;  1RN7 A;  4K1U A;  2BNG A;  1CEW I;  1VQN 3;  1QJG A;  4J8T A;  3OV4 A;  4K1V A;  4L8O A;  5ELU A;  2BMQ B;  4KFF A;  4XB5 A;  4MJD A;  1M1X B;  3NBR A;  8CHO A;  3KSP A;  1OUN A;  2GBX B;  2XH9 A;  2FXT A;  3KKG A;  3N8B A;  1T5Y A;  3PCS A;  4R1K A;  3RGA A;  3TDG A;  1M9G A;  3EDN A;  1YHQ 3;  1MNL A;  3EF8 A;  1Q86 4;  4N3V A;  3V92 A;  3X3X A;  1ULI B;  1VQ6 3;  3STD A;  1UI7 A;  3SX1 A;  2ZVF A;  4OUQ A;  1SIH A;  4CDL A;  2YFL B;  1U0K A;  3EHC A;  1O7N B;  2EB0 A;  3SOA A;  5BVB A;  1IVX A;  1E3V A;  5JBS A;  4LB0 A;  3MG1 A;  1O7M B;  2HML B;  4LZI A;  1YJ9 3;  1BUQ A;  2R4I A;  1VQ7 3;  1F8N A;  1IVV A;  1WNH A;  2QIY A;  2W6J H;  1IQY A;  2CWV A;  4AKZ A;  2ZL8 A;  2WO0 A;  3DY5 A;  3LH4 A;  3FG3 A;  1JKG B;  1O7W B;  3OWS A;  4H3U A;  2OOV A;  1IK3 A;  4IJZ A;  1ZX2 A;  3PCR A;  3F9S A;  4BTX A;  1OPY A;  3CCV 3;  1VQ5 3;  5STD A;  3S27 A;  3B4O A;  3MYT A;  3FKA A;  3HI7 A;  4OVM A;  3RGR A;  3EJX A;  2CH9 A;  3MKI A;  4NRE A;  1VQ4 3;  1KWI A;  3I56 3;  3S29 A;  2HMN B;  2IMJ A;  3OX9 A;  4JBD A;  2F86 B;  4G1M B;  2GKE A;  1N8Q A;  2KXG A;  3KFQ C;  3ROB A;  1W2B 2;  1GY5 A;  2JQ5 A;  3JUO A;  5IER A;  1W5Z A;  1ROV A;  5IEP A;  1US1 A;  3FGY A;  5AI1 A;  5M47 A;  3PGB A;  4MEI A;  4QWT A;  3H3H A;  4N6T A;  4RPA A;  1QVF 2;  2IA7 A;  3JVC A;  4R9L A;  3FF2 A;  4TX4 A;  1STD A;  5CF1 A;  1K28 A;  3K9M C;  1D6U A;  2XRX B;  1ULJ B;  4PEJ A;  1G96 A;  2QGU A;  1S5A A;  1WMN A;  1YGE A;  2OTL 3;  1SDJ A;  1K20 A;  3Q90 A;  3FCS B;  3X40 A;  1JB4 A;  3IMA B;  2K54 A;  2PNC A;  3FLJ A;  2W9Q A;  2CFK A;  3AMO B;  1Q81 4;  3UL5 A;  3B8L A;  3WMD A;  1CQS A;  4IPB A;  1JN5 B;  1OH0 A;  4N6O B;  4LGQ A;  2Q9J A;  4HVN A;  2P0X A;  1LVN A;  5IG4 A;  3PXM A;  1WQL B;  3GZR A;  4K7G B;  3OWY A;  3QK9 A;  2PW0 A;  3SOY A;  1N5H A;  1Q40 B;  3S28 A;  3ICJ A;  1K9M 4;  1U1X A;  3ALA A;  2D1W A;  5IEO A;  4J9W A;  4PY9 A;  2F98 A;  3DGN A;  3VGN A;  3EB8 A;  4WHA A;  4O2H A;  1BWZ A;  4MMZ B;  2P0M A;  5FW5 A;  4Q60 A;  3GZB A;  4JF8 A;  3CD6 3;  3Q1C A;  1CYV A;  5EEO A;  5IF6 A;  2B24 B;  1TIJ A;  4IIA A;  2GKJ A;  3M8C A;  4HM8 B;  1GY6 A;  4N6U A;  5AIG A;  3NQZ A;  1WPM A;  2PVZ A;  5IWE A;  2HAW A;  1JB2 A;  1DYU A;  5CF2 A;  3BNE A;  1FGQ A;  2O9U X;  2INX A;  1VQK 3;  2XEP A;  1TM0 A;  6STD A;  1OHP A;  3FG1 A;  3NQY A;  5FGO A;  1IDP A;  2HMJ B;  1CYU A;  3NBJ A;  1DVD A;  5D81 A;  1W7C A;  3WOD G;  1YJN 3;  4RZM A;  1NWW A;  1QMA A;  3D9R A;  1TFK A;  1JRQ A;  1NB3 I;  3MHE A;  1LNH A;  3PYJ A;  4HM7 B;  1W2Z A;  3WDG B;  2IUK A;  1FUW A;  3F7X A;  5ELJ A;  2GU1 A;  4O02 B;  4AKY A;  1M1K 4;  3EJV A;  3OW2 2;  1A90 A;  3MWZ A;  3CCL 3;  3MG2 A;  2K0M A;  2Z76 A;  5IEN A;  3G0K A;  4WWU C;  2GXF A;  1ZO2 A;  2HMM B;  1FGO A;  2ZXR A;  5AYR B;  3ER7 A;  3JUN A;  5KP3 A;  3V98 A;  1OHS A;  3S5C A;  5KP1 A;  4U13 A;  1N9E A;  4J9X A;  5EVH A;  2IW4 A;  1W62 A;  3LML A;  2P05 A;  1DMN A;  4MMX B;  1FGT A;  1VQO 3;  1E97 A;  4WFO A;  2QEX 3;  1IR6 A;  2IUJ A;  3WA3 A;  4FCM A;  4WYK A;  2YFJ B;  1K73 4;  4I4K A;  1FGR A;  3CU3 A;  2CFD A;  1WMO A;  3NM7 A;  2CC3 A;  1OF5 A;  1C7H A;  2D42 A;  1RRH A;  1W02 A;  1U5O A;  3F8X A;  1W4N A;  3HZP A;  3ECF A;  1QYA A;  3NUV A;  3CNM A;  3MPH A;  3LTC A;  3UL6 A;  3MG3 A;  3DMC A;  1AVL A;  5IG5 A;  1D6Y A;  4FCZ A;  4IK0 A;  3FG4 A;  3CCM 3;  1TUH A;  3KSE D;  3CME 3;  3CCE 3;  2W0Q A;  1IV7 A;  2WGQ A;  3OWU A;  3CC2 3;  5TGN A;  4LSO A;  1WMP A;  1IQX A;  1NDO B;  3BLZ A;  4FMB A;  4N6L A;  3X42 A;  3B7C A;  1Y4K A;  3NXJ A;  1UUV B;  4K90 B;  2YFI B;  4OA3 A;  2L4V A;  3GRD A;  2FNQ A;  2CWU A;  1NO3 A;  3KN4 A;  3CPO A;  3DXO A;  3EE1 A;  3VF1 A;  3A76 A;  1JV2 B;  3D3L A;  3FSD A;  1Q82 4;  3WA2 X;  3IPT A;  3LT8 A;  4R4K A;  2KRT A;  3FVE A;  3T0U A;  1W61 A;  1YM5 A;  5D82 A;  2AZP A;  2HMO B;  4LS9 A;  1SJW A;  3T8U A;  4CCV A;  2Y73 A;  4XM4 A;  2OTJ 3;  2CG0 A;  4O8S A;  1RKY A;  1GD3 A;  5H2Y A;  1XUA A;  1IQ8 A;  3LYG A;  2GEX A;  3BNB A;  4AEQ A;  3S67 A;  4EC6 A;  3GWR A;  2BO9 B;  4N6V 0;  5DRE A;  5LC6 A;  4RBN A;  3SXX A;  5IG0 A;  1VQ9 3;  5KP4 A;  4JD7 A;  3BB9 A;  3OXA A;  1J2B A;  1KQS 2;  3X41 A;  3UNL A;  3IGH X;  5G2G A;  5EQL A;  1VQL 3;  1AVK A;  3JUQ A;  1TFO A;  1OCV A;  5BXQ A;  2ZXO A;  3T8N A;  1W6Y A;  3JUM A;  2LT2 A;  1EG9 B;  4BTY A;  4LEH A;  4IT7 A;  1HU9 A;  1XUB A;  2LYX A;  1IVW A;  1EKM A;  3PVH A;  3LTA A;  1UW1 A;  1WPP A;  1JNQ A;  5A0O B;  1VQP 3;  1RJO A;  2W2C A;  1O7P B;  2W04 A;  3WOF B;  5JPP A;  3PZW A;  2C10 A;  2PZV A;  1W6G A;  2YMA A;  1NU3 A;  3W5W A;  5CLK A;  5LC7 A;  3X3Y A;  3G16 A;  2ZDJ A;  2OQE C;  2F99 A;  2QB8 A;  3G7K A;  4HM1 B;  1ISK A;  1E3R A;  3CC7 3;  4EV5 A;  2FGT A;  3MSO A;  2A15 A;  1VQ8 3;  3EC9 A;  2QB7 A;  1JJ2 2;  2W56 B;  3DZL A;  1OAC A;  3JUP A;  3K5T A;  4Q53 A;  3EX9 A;  1R4C A;  2YX9 A;  4ORL A;  3U1W A;  2ENX A;  1OGZ A;  3SLU A;  4X2O A;  2QA4 3;  2LQV A;  2XR8 B;  3CCS 3;  3G4S 3;  5AII A;  3CCQ 3;  1YIJ 3;  1KC8 4;  4GB5 A;  1KD1 4;  4EXR A;  4MMY B;  4FMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...