4GL6A

Crystal structure of a duf5037 family protein (rumgna_01148) from ruminococcus gnavus atcc 29149 at 2.55 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
237
structure length
237
Chain Sequence
EISIKIETYLQEEYGEEFEVLSWNQPKLLPSDNGAIYATCISKNDPKHPFEGSYFNPEEPNSEIEIIYDGYGQRLLAKQMESMIEEAISQAAENYYIQGDIIIPEEWQDIPVEEISQWKNYVDLCNQSNSDYKTLGSAWVYIDASTMKGKTDEEEYQMYEEVYRDKLGGQALLYVYYLDHKSFEKAEKILEIFTSGDEGSNFEDIIEGQPYFGTIMRYGSDKFDDNLEIFKAAKQGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (RUMGNA_01148) from Ruminococcus gnavus ATCC 29149 at 2.55 A resolution
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 68
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16440 DUF5037 Domain of unknown function (DUF5037)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.80 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 4gl6A02
3.10.450.570 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4gl6A01
4GL6A
chains in the Genus database with same CATH superfamily
1Q40A 1HYFA 7GSPA 3CC43 1IV7A 1RGHA 3CCU3 1BNJA 1HZ1A 1OHSA 4MJDA 3TDGA 3KE7A 5LC7A 1OGXA 1MWUA 2WOFA 1JRQA 4K1UA 1NDOB 3F8HA 1BVIA 1D6UA 1BNGA 3WQZA 1I3FA 3PCRA 4N6NB 5I97A 4HM4B 3H51A 2K54A 3EN8A 2H9FA 2GSPA 1NU3A 4N6MA 1UI7A 3HOHA 4FCMA 4R9LA 2AZPA 5DREA 3CCR3 3F7SA 1FGMA 4HM1B 1TM0A 1GQZA 1NJI4 4LGQA 1B2XA 1WMOA 1BRHA 2Z77A 3EBTA 3ECFA 4HM2B 5EVHA 5KP3A 3WOEB 3DGOA 2XEPA 4IT7A 1W02A 5AI1A 3MG3A 3WOFB 1O7WB 1RN4A 3IJEB 1W62A 1CH0A 2XR8B 3G98A 4HOHA 2MC8A 4WP5A 4ZM8A 1BWZA 1BNEA 2F86B 4Q53A 3BNEA 3CCJ3 1GD3A 1WPPA 1NNVA 1TP6A 2C4BA 3AHWA 2GKJA 3ICJA 1U1WA 1Q864 1GY6A 1SIHA 1JN5A 1O7GB 4N3VA 3DGMA 4CDLA 1B2UA 3LH4A 3PS8A 2Z7AA 4LG3A 1FGQA 3B4PA 3QRDA 1RRLA 1STFI 4LZIA 1UCLA 1CYUA 1ZX2A 2Y74A 2F56A 3JUOA 4RPAA 5BXQA 4DKIA 1N8R4 1RGCA 3V98A 3PZWA 1VQ43 3OV4A 2ZL8A 1STDA 3CNXA 1B3SA 5BU4A 3H3HA 4QWTA 2W03A 5IG4A 1BANA 2PVZA 2XH9A 3N8BA 1ISKA 4J9AA 4RNYA 1QMAA 2KAAA 2ML6A 3ZG0A 1M1XB 3WDGB 1ZGXA 4MMYB 1LOXA 4JD7A 3FF0A 1EQKA 1E3VA 2K0MA 5M19A 4RZMA 4J8TA 3NM2A 4RBNA 3IGHX 1IT7A 3K63A 4CPKA 1W6GA 5KP4A 3SVAA 2OTNA 1BRNL 3FCSB 3FG4A 4OUQA 3QK9A 2W6JH 1YI23 1L5GB 1M1K4 3CCM3 3LTAA 3Q3FA 5AEUB 1RGAA 2SBLA 2HAWA 1OCVA 2ML5A 4EYCA 2W04A 4XBYA 5RNTA 3EJVA 3V99A 1I8VA 1YVSA 2HMJB 3CCS3 1VQM3 1B27A 1EUIC 1JZDA 4KZ1A 1DETA 1I3IA 4GL6A 3NM7A 1UCIA 1W6CA 1Z1SA 2Z76A 3V92A 6RNTA 2RCDA 1WTHA 3FG3A 2CX1A 2HMNB 3D5GA 1O7HB 1JKGA 5IERA 3KIIA 1T3BA 5EEOA 1W61A 5IEPA 2ZXRA 2PZVA 1PYLA 3LT8A 3SYUA 1YJW3 2HMMB 1QALA 2CFGA 4HM7B 4RNZA 3D79A 5BIRA 3CPOA 6GSPA 1ZO2A 1SIIA 2KF6A 2R4IA 1UW1A 1WQLB 3HIIA 3KKGA 1OF5B 1FZUA 3FKAA 3OW22 2F99A 1N9JA 1OF5A 3FLJA 1LXEA 2W9PA 5GSPA 3G4S3 1RN1A 1RDSA 3ZFZA 2KF5A 3NUVA 1A2PA 4HJLB 3OWSA 5ANPA 1LOVA 2I9WA 1NO3A 2XSOB 1GSPA 1JV2B 3G16A 3NV0B 2GBXB 4HM0B 3S5CA 4FMBA 4ILFA 3SOYA 4BTWA 4K7GB 2F5MA 2LQVA 1RHLA 2Y73A 1VZZA 2R41A 1ROVA 4PEJA 3U1WA 1WPMA 3CCQ3 1IT8A 5A0OB 1GS3A 2H0HA 3RNTA 4HM8B 1Q7HA 5IG5A 4L7KA 3NBJA 2IYJA 5KP1A 1BNFA 2W9QA 3CC73 3F7XA 1YM5A 5AIFA 5CXOA 1VQ83 3O8YA 2KCDA 1SJWA 1BRSA 3DUKA 3LTCA 4EBGA 8RNTA 3S67A 4N6LA 4K7XA 1B21A 7RNTA 2EB0A 1VQ93 1NB5I 1CEWI 1JNQA 2XGNA 1TFKA 2GEYA 1LVNA 2BMQB 3CME3 4XBTA 3LTDA 2O3OA 2HMOB 1RCLA 3G713 1IDPA 1RLSA 1CYVA 1OHPA 1IVXA 1JN5B 3BU4A 3M8CA 2Q07A 1BGSA 3F8XA 1EEJA 5H2GA 2W0QA 5BVBA 2ZHXB 1TTOA 2CK3H 5M18A 3I553 3UJMA 4R80A 4HAAA 1D6YA 4LS9A 3B7CA 1W4NA 1IVUA 1JBSA 1FUSA 1DYUA 3T0UA 4EV5A 3DGLA 3UL5A 3HI7A 3T8NA 2AAEA 2OQEC 1U8CB 1B2SA 1N8QA 3Q1CA 3WODG 3DY5A 3CNMA 4KFEA 1O7NB 2CIUA 4JBDA 2UGIA 1K23A 5CF2A 1N5PA 1GY5A 3DGNA 4LEHA 3EQQB 1A90A 1C54A 1RCKA 4EW5A 1A2VA 2CWTA 3WR2A 5IENA 1JB4A 3F9SA 1KWIA 4GSPA 1QY9A 2OOVC 2WO0A 3UB1A 9RNTA 5IW9A 3A76A 2KW7A 4L8PA 4HZBB 5STDA 1PU4A 1HU9A 1LOWA 2K3DA 4BU4A 1QVG2 3GWRA 1K41A 4JF8A 3D3LA 1BNRA 3MKIA 3EN1B 4HZ9B 2F98A 3K0ZA 3GZXB 1SDJA 4R9KA 1BRGA 4N6OB 3G6E3 1JB2A 3BB9A 4J5GA 3FVEA 3BIRA 3EX9A 4LYLB 1G0TA 1QAKA 1ROAA 3EE1A 4XM4A 3KZTA 2IMJA 5AIIA 5D82A 5G1LA 2OCTA 2XGLA 1RN7A 2JQ5A 1EG9B 3X3YA 1K20A 1YJN3 1VQ53 2OOVA 4WFOA 3PXMA 4K8LA 1NB3I 1BAOA 3CPW2 1LQMB 1QVF2 3OWUA 1WNHA 1OGZA 5D81A 5AIGA 5M47A 1X1XA 5IF6A 1V58A 2M7OA 3DH2A 3DXOA 2CG1A 4LB0A 4N6V0 1IR6A 2KF3A 4N6TA 3NBRA 2IUKA 2FGTA 2KPTA 2MF7A 3E99A 1GD4A 3F40A 1UCKA 1EKMA 2E2TA 1PY3A 3S27A 2QB6A 1O7MB 1RRHA 4EV2A 2KRTA 3Q2PA 1LNHA 1O7PB 3L0RA 3MYTA 1GOUA 1I2EA 3NHXA 3ROBA 1I0XA 3KCHA 4WWUC 4FCZA 3RGRA 3KSPA 2BMRB 1M9GA 4H3UA 2BT3A 2OQEA 3NV0A 2B1XB 2GEXA 3SLUA 1KD14 1K734 5AYRB 1NWWA 2RFRA 1DMNA 2F5WA 5JPPA 2B24B 1BSAA 4NHFA 2ZDJA 4MMZB 2D1WA 1ZS7A 2E2UA 2CFWA 5TGNA 1JBRA 4PY9A 3OXAA 4O3VA 2CFDA 5IWEA 1UUVB 2UUGC 1Q40B 2XFSA 3LZAA 1MGRA 1U0KA 3ALAA 3BNBA 2YFIB 3DEVA 1RJOA 4BTXA 4J9WA 3GZRA 3GRDA 7STDA 1JZOA 1DMQA 2Z6BA 4XB5A 3CCV3 1W7CA 3X42A 4BL2A 4K90B 1AQZA 2ENXA 3T8UA 4ORLA 4FR9A 4FMDA 3MSOA 5AIHA 4H61A 4R4KA 1RGKA 3VGNA 3FF2A 1U1XA 4KFDA 1HKXA 4AKYA 1SPUA 2P0XA 2P0MA 2RSXA 2BO9B 1YGWA 4OA3A 4J9XA 2JDIH 3EBYA 3ZG5A 5FGOA 2UX0A 1Q7Y4 1TRQA 1VQO3 3CMA3 1FGTA 4O8SA 3AMOB 1T6KA 1MOLA 1VQQA 2P38A 1Q824 4Q2HA 3K9MC 1PFPA 1B20A 1I70A 2CWUA 2XFTA 1DVCA 3CU3A 3LYGA 1YGEA 3UL6A 1G02A 1LOYA 1Q9EA 2CW9A 2WGQA 1IK3A 1BSDA 1K9M4 3SXXA 1OH0A 1BUQA 1BSEA 2CH9A 1OHOA 1RGEA 3S29A 2LT2A 5AEWB 6STDA 1RMSA 3JVCA 1TU5A 2LYXA 3EJXA 4IK0A 3VSYA 2INXA 3PGBA 1X1WA 1VQP3 4LMIA 3HX8A 1E3RA 1N5HA 5JPUA 4GHOA 1TIJA 1FW7A 2HOHA 4FMAA 3CD63 5ELUA 3MG2A 4FMCA 1U1VA 1GOVA 3BNCA 1E97A 2ZXPA 3RDEA 5JBSA 1RTUA 4DUNA 2CFLA 4L8OA 2AADA 4BL3A 2GU1A 4R1KA 3IMAB 4TX4A 3DMCA 4XDWA 4I5QA 5AYSC 3G0KA 4KVHA 3IPTA 2A15A 2CFKA 3PVHA 4HM5B 3PW9A 3GZYB 2CHCA 1W2B2 3JUPA 3SEDA 4JCIA 1OACA 2W2CA 3FG1A 1UGHI 3JUQA 4U13A 1IU7A 5G2GA 3WA2X 3X41A 2PW0A 2W56B 1B2ZA 3G8ZA 1DMMA 2C11A 3FGYA 1V74A 3K5TA 3RGAA 3CC23 8CHOA 2Q9HA 1QAFA 2QA43 1US1A 1BNIA 2XF3A 4HBRA 4WHAA 3JUMA 1XUAA 3PYJA 3AHSA 4BTYA 1MWSA 1GMRA 2F4YA 3GSPA 1LNIA 3EKMA 3B8LA 1ASKA 2BIRA 2CG0A 2O9UX 3URPA 1Y4KA 2YFLB 2KXGA 2QGUA 1IVVA 3AGOA 4FCJA 1X1UA 2L4VA 4MMXB 3FH1A 1MGWA 4O2HA 1VQL3 1FA3A 4JRFA 3A5EA 1TRPA 1FUWA 3EB8A 1N9EA 2OWPA 4OK0A 1OUNA 1JB5A 1R4YA 3VF1A 3DM8A 1FYSA 5H2YA 5IG0A 1BRJA 2OTL3 1XUBA 1I2GA 1MWRA 2XSHB 2FXTA 2XRXB 3FZWA 1W00A 5IG3A 1VQK3 1IQXA 2P05A 3GZBA 1V57A 2CC3A 1WMNA 3EHCA 4X2HA 1FGOA 3EF8A 5HOHA 1FGRA 1YIT3 1BRKA 1T2HA 4KFFA 4IIAA 3BNDA 2RBIA 2RNTA 2IY2A 2SARA 2FNQA 3F14A 4G1MB 1Q814 1KSIA 1UGIA 4STDA 3D4AA 1ULIB 5LC6A 3KN4A 3JUNA 3NQZA 1BIRA 3U97A 4HVNA 1RSNA 2ZXOA 1TJDA 1LQGC 5IEOA 1RGFA 2J8XB 1GOYA 1SARA 1AVLA 1R4CA 1S5AA 2H0IA 2PNCA 1JBTA 2QB8A 1UUWB 3I0YA 2IA7A 1UUGB 3S28A 3PCSA 1IQYA 4CJNA 1KQS2 1LRAA 1OPYA 1EA2A 2BU4A 2HMLB 1QYAA 1AY7A 1GMQA 3NQYA 4WYKA 4WYKB 5ELJA 3MG1A 1BU4A 2GU3A 4I4KA 4KT3B 2ZA4A 1RNTA 3I563 1TUHA 3STDA 1C7HA 1IVWA 2BHMA 1W5ZA 1F8NA 4AEQA 1VQ73 3NXJA 1A2KA 5M1AA 3HZPA 4LSOA 1TFOA 3B4OA 3NBBA 2WOHA 3NX0A 3ER7A 1QJGA 3G7KA 5HA4A 1MWTA 2MPBA 2L1SA 1M904 4XBXA 1G96A 1W01A 2Q9JA 3DGYA 3DZLA 2QB7A 1D6ZA 5G1KA 3K7CA 4AKZA 1K8A4 1JJ22 4NREA 3OX9A 1A67A 3CCL3 1B2MA 3LMLA 1IYYA 1J2BA 1T5YA 4NPBA 2OTJ3 4HM3B 1K28A 1W6YA 1X1YA 1VQN3 1BRIA 1YJ93 4EC6A 3MHEA 1MNLA 2BMOB 3UNLA 3D9RA 3LTBA 1YIJ3 3OWYA 4JUUA 1GMPA 3WHOA 3EC9A 3WA3A 3PTJA 2CKFB 1I0VA 1FUTA 3EDNA 4HYZA 2ZVFA 1GY7A 3MPHA 1KC84 1DE3A 4X2OA 2HMKB 1AV4A 1I2FA 3CCE3 4HM6B 1W2ZA 2YFJB 3AMOA 1IQ8A 3WMDA 1YNVX 3MWZA 3N54B 2IUJA 2QIYA 4J5KA 2KF4A 1UI8A 1GYBA 1I74A 3HK4A 1JKGB 2YX9A 4IPBA 1RKYA 2GKEA 1Q42A 3LOYA 1SQWA 1S7JA 4MEIA 3J7Yd 1WMPA 2WGOA 3X3XA 3Q90A 2CWVA 2D42A 4IJZA 2P09A 5D83A 1IV9A 1AR0A 1DVDA 1YHQ3 3GAXA 1AVKA 2E2VA 2GXFA 3N9HA 4CCVA 4GB5A 1YVBI 4Q60A 3LT9A 4N6UA 2W56A 5FW5A 5CLKA 5CF1A 2H0GA 1CQSA 1BSCA 3X40A 1BSBA 1UCJA 2C10A 3D5IA 3LXUX 4O02B 4RNTA 2IW4A 4XDVA 2QEX3 5CK6A 1UDII 1ULJB 5EQLA 5HGRA 3CXC2 4OVMA 1BUJA 2BNGA 3KFQC 2STDA 3W5WA 4HKVB 4K61A 5DRVA 4BIRA 1BOXA 3BLZA 4EXRA 3FSDA 3AGNA 2V1LA 3SOAA 1S723 1VQ63 2YMAA 1BNSA 4K1VA 2GBWB 1RGGA 3KSED 1RNBA 2CX0A 1T2IA 1RGLA 3HIGA 2RGQA 3X3ZA 3SX1A 1U5OA
chains in the Genus database with same CATH topology
1Q40A 3CC43 1IV7A 3CCU3 1OHSA 4MJDA 3TDGA 3KE7A 5LC7A 1OGXA 2WOFA 1JRQA 4K1UA 1NDOB 3F8HA 1D6UA 3WQZA 3PCRA 4N6NB 5I97A 4HM4B 3H51A 2K54A 3EN8A 2H9FA 1NU3A 4N6MA 1UI7A 4FCMA 4R9LA 2AZPA 5DREA 3CCR3 3F7SA 1FGMA 4HM1B 1TM0A 1GQZA 1NJI4 4LGQA 1WMOA 2Z77A 3EBTA 3ECFA 4HM2B 5EVHA 5KP3A 3WOEB 3DGOA 2XEPA 4IT7A 1W02A 5AI1A 3MG3A 3WOFB 1O7WB 3IJEB 1W62A 2XR8B 3G98A 2MC8A 4WP5A 4ZM8A 1BWZA 2F86B 4Q53A 3BNEA 3CCJ3 1GD3A 1WPPA 1TP6A 2GKJA 3ICJA 1U1WA 1GY6A 1SIHA 1JN5A 1O7GB 4N3VA 3DGMA 4CDLA 3LH4A 3PS8A 2Z7AA 4LG3A 1FGQA 3B4PA 3QRDA 1RRLA 1STFI 4LZIA 1CYUA 1ZX2A 2Y74A 3JUOA 4RPAA 5BXQA 1N8R4 3V98A 3PZWA 1VQ43 3OV4A 2ZL8A 1STDA 3CNXA 3H3HA 4QWTA 2W03A 5IG4A 2PVZA 2XH9A 3N8BA 1ISKA 4J9AA 4RNYA 1QMAA 2ML6A 1M1XB 3WDGB 4MMYB 1LOXA 4JD7A 3FF0A 1EQKA 1E3VA 2K0MA 4RZMA 4J8TA 3NM2A 4RBNA 3IGHX 1IT7A 3K63A 1W6GA 5KP4A 3SVAA 2OTNA 3FCSB 3FG4A 4OUQA 3QK9A 2W6JH 1YI23 1L5GB 1M1K4 3CCM3 3LTAA 5AEUB 2SBLA 2HAWA 1OCVA 2ML5A 4EYCA 2W04A 4XBYA 3EJVA 3V99A 2HMJB 1VQM3 3CCS3 4KZ1A 4GL6A 3NM7A 1W6CA 1Z1SA 2Z76A 3V92A 2RCDA 1WTHA 3FG3A 2HMNB 1O7HB 1JKGA 5IERA 3KIIA 5IEPA 5EEOA 1W61A 2ZXRA 2PZVA 3LT8A 1YJW3 2HMMB 2CFGA 1QALA 4HM7B 4RNZA 3CPOA 1ZO2A 1SIIA 2R4IA 1UW1A 1WQLB 3HIIA 3KKGA 1OF5B 3FKAA 3OW22 2F99A 1N9JA 1OF5A 3FLJA 1LXEA 2W9PA 3G4S3 3T8NA 3NUVA 4HJLB 3OWSA 5ANPA 2I9WA 3G16A 1NO3A 2XSOB 1JV2B 3NV0B 4HM0B 3SOYA 2GBXB 3S5CA 4BTWA 4FMBA 4K7GB 2LQVA 2Y73A 1VZZA 3U1WA 1ROVA 4PEJA 1WPMA 3CCQ3 1IT8A 5A0OB 1GS3A 4HM8B 5IG5A 4L7KA 3NBJA 5KP1A 2W9QA 3CC73 3F7XA 1YM5A 5AIFA 5CXOA 1VQ83 3O8YA 2KCDA 1SJWA 3DUKA 3LTCA 4EBGA 3S67A 4N6LA 4K7XA 2EB0A 1VQ93 1NB5I 1CEWI 1JNQA 2XGNA 1TFKA 2GEYA 1LVNA 2BMQB 3CME3 4XBTA 3LTDA 2O3OA 2HMOB 3G713 1IDPA 1CYVA 1OHPA 1IVXA 1JN5B 3M8CA 2Q07A 3F8XA 5H2GA 2W0QA 5BVBA 3I553 2CK3H 3UJMA 4R80A 1D6YA 4LS9A 3B7CA 1W4NA 1IVUA 1DYUA 3T0UA 4EV5A 3DGLA 3UL5A 3HI7A 2OQEC 1U8CB 1N8QA 3Q1CA 3WODG 3X3ZA 3DY5A 3CNMA 4KFEA 1O7NB 2CIUA 4JBDA 5CF2A 1K23A 1Q864 1N5PA 1GY5A 3DGNA 4LEHA 3EQQB 1A90A 1A2VA 2CWTA 5IENA 1JB4A 3F9SA 1KWIA 5IW9A 1QY9A 2OOVC 2WO0A 3UB1A 3A76A 2KW7A 4L8PA 4HZBB 5STDA 1PU4A 1HU9A 1QVG2 3GWRA 1K41A 4JF8A 3D3LA 3MKIA 3EN1B 4HZ9B 2F98A 3K0ZA 3GZXB 1SDJA 4R9KA 4N6OB 3G6E3 1JB2A 3BB9A 3FVEA 3EX9A 1QAKA 1ROAA 3EE1A 4XM4A 3KZTA 2IMJA 5AIIA 5D82A 2OCTA 2XGLA 1RN7A 2JQ5A 1EG9B 3X3YA 1K20A 1YJN3 1VQ53 2OOVA 4WFOA 3PXMA 4K8LA 1NB3I 3CPW2 1QVF2 3OWUA 1WNHA 1OGZA 5D81A 5AIGA 5M47A 5IF6A 2M7OA 3DXOA 2CG1A 4LB0A 4N6V0 1IR6A 4N6TA 3NBRA 2IUKA 2FGTA 2KPTA 2MF7A 3E99A 1GD4A 3F40A 1EKMA 2E2TA 3S27A 2QB6A 1O7MB 1RRHA 4EV2A 2KRTA 3Q2PA 1LNHA 1O7PB 3L0RA 3MYTA 3NHXA 3ROBA 4WWUC 4FCZA 3RGRA 3KSPA 2BMRB 1M9GA 4H3UA 2BT3A 2OQEA 3NV0A 2B1XB 2GEXA 3SLUA 1KD14 1K734 5AYRB 1NWWA 2RFRA 1DMNA 5JPPA 2B24B 4NHFA 2ZDJA 4MMZB 2D1WA 2E2UA 5TGNA 2CFWA 4PY9A 3OXAA 4O3VA 2CFDA 5IWEA 1UUVB 2XFSA 1Q40B 3LZAA 1U0KA 3ALAA 3BNBA 2YFIB 3DEVA 1RJOA 4BTXA 4J9WA 3GZRA 3GRDA 7STDA 1DMQA 2Z6BA 4XB5A 3CCV3 1W7CA 3X42A 4K90B 3T8UA 2ENXA 4ORLA 4FR9A 4FMDA 3MSOA 5AIHA 4H61A 4R4KA 3VGNA 3FF2A 1U1XA 4KFDA 1HKXA 4AKYA 1SPUA 2P0XA 2P0MA 2RSXA 2BO9B 3EBYA 4OA3A 4J9XA 2JDIH 5FGOA 2UX0A 1Q7Y4 1VQO3 3CMA3 1FGTA 4O8SA 3AMOB 1T6KA 1MOLA 2P38A 1Q824 4Q2HA 3K9MC 1PFPA 3CU3A 2CWUA 2XFTA 1DVCA 3LYGA 1YGEA 3UL6A 2CW9A 2WGQA 1IK3A 1K9M4 3SXXA 1OH0A 1BUQA 2CH9A 1OHOA 3S29A 2LT2A 5AEWB 6STDA 3JVCA 1TU5A 2LYXA 3EJXA 4IK0A 3VSYA 2INXA 3PGBA 1VQP3 4LMIA 3HX8A 1E3RA 1N5HA 5JPUA 1TIJA 4FMAA 3CD63 5ELUA 3MG2A 4FMCA 1U1VA 3BNCA 3RDEA 1E97A 2ZXPA 5JBSA 4DUNA 2CFLA 4L8OA 2GU1A 4R1KA 3IMAB 4TX4A 3DMCA 4XDWA 5AYSC 3G0KA 4KVHA 3IPTA 2A15A 2CFKA 3PVHA 4HM5B 3PW9A 3GZYB 2CHCA 1W2B2 3JUPA 3SEDA 4JCIA 1OACA 2W2CA 3FG1A 3JUQA 4U13A 1IU7A 5G2GA 3WA2X 3X41A 2PW0A 2W56B 3G8ZA 3K5TA 1DMMA 2C11A 3FGYA 1V74A 3RGAA 3CC23 8CHOA 2Q9HA 1QAFA 2QA43 1US1A 2XF3A 4HBRA 4WHAA 3JUMA 1XUAA 3PYJA 4BTYA 3EKMA 3B8LA 1ASKA 2CG0A 2O9UX 1Y4KA 2YFLB 2KXGA 2QGUA 1IVVA 4FCJA 2L4VA 4MMXB 3FH1A 4O2HA 1VQL3 1FA3A 4JRFA 1FUWA 3EB8A 1N9EA 2OWPA 4OK0A 1OUNA 1JB5A 3VF1A 3DM8A 5H2YA 5IG0A 2OTL3 1XUBA 2XSHB 3FZWA 2FXTA 2XRXB 1W00A 5IG3A 1VQK3 1IQXA 2P05A 3GZBA 2CC3A 1WMNA 3EHCA 4X2HA 1FGOA 3EF8A 1FGRA 1YIT3 4KFFA 4IIAA 3BNDA 3F14A 1Q814 2FNQA 4G1MB 1KSIA 4STDA 5LC6A 1ULIB 3KN4A 3JUNA 3NQZA 3U97A 4HVNA 5IEOA 2ZXOA 1AVLA 1R4CA 2PNCA 1S5AA 2QB8A 1UUWB 3I0YA 2IA7A 3S28A 3PCSA 1IQYA 1KQS2 4WYKA 1OPYA 1EA2A 2HMLB 3NQYA 1QYAA 4WYKB 5ELJA 3MG1A 4I4KA 2GU3A 3I563 1TUHA 3STDA 1C7HA 1IVWA 2BHMA 1W5ZA 1F8NA 4AEQA 1VQ73 3NXJA 1A2KA 3HZPA 4LSOA 1TFOA 3B4OA 3NBBA 2WOHA 3NX0A 3ER7A 1QJGA 3G7KA 5HA4A 2MPBA 1M904 4XBXA 1G96A 1W01A 2Q9JA 3DZLA 2QB7A 1D6ZA 4AKZA 3K7CA 1K8A4 1JJ22 4NREA 3OX9A 1A67A 3CCL3 3LMLA 1J2BA 1T5YA 2OTJ3 4HM3B 1K28A 1W6YA 1VQN3 1YJ93 4EC6A 3MHEA 1MNLA 2BMOB 3UNLA 3D9RA 3LTBA 1YIJ3 3OWYA 4JUUA 3EC9A 3WA3A 3PTJA 2CKFB 3EDNA 4HYZA 2ZVFA 1GY7A 3MPHA 1KC84 4X2OA 2HMKB 1AV4A 3CCE3 4HM6B 1W2ZA 2YFJB 3AMOA 1IQ8A 3WMDA 3MWZA 3N54B 2IUJA 2QIYA 1UI8A 1GYBA 1I74A 3HK4A 1JKGB 2YX9A 4IPBA 1RKYA 2GKEA 1Q42A 3LOYA 1SQWA 1S7JA 4MEIA 3J7Yd 1WMPA 2WGOA 3X3XA 3Q90A 2CWVA 2D42A 4IJZA 2P09A 5D83A 1IV9A 1AR0A 1DVDA 1YHQ3 3GAXA 1AVKA 2E2VA 2GXFA 3N9HA 4CCVA 4GB5A 1YVBI 4Q60A 3LT9A 4N6UA 2W56A 5FW5A 5CLKA 5CF1A 1CQSA 3X40A 2C10A 3LXUX 4O02B 4XDVA 2QEX3 2IW4A 5CK6A 1ULJB 5EQLA 3CXC2 5HGRA 4OVMA 2BNGA 3KFQC 2STDA 3W5WA 4HKVB 4K61A 5DRVA 4EXRA 3BLZA 1VQ63 3FSDA 3SOAA 2V1LA 1S723 2YMAA 4K1VA 2GBWB 3KSED 3HIGA 2RGQA 3SX1A 1U5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GL6 A; 
#chains in the Genus database with same CATH topology
 1Q40 A;  1HYF A;  7GSP A;  3CC4 3;  1IV7 A;  1RGH A;  3CCU 3;  1BNJ A;  1HZ1 A;  1OHS A;  4MJD A;  3TDG A;  3KE7 A;  5LC7 A;  1OGX A;  1MWU A;  2WOF A;  1JRQ A;  4K1U A;  1NDO B;  3F8H A;  1BVI A;  1D6U A;  1BNG A;  3WQZ A;  1I3F A;  3PCR A;  4N6N B;  5I97 A;  4HM4 B;  3H51 A;  2K54 A;  3EN8 A;  2H9F A;  2GSP A;  1NU3 A;  4N6M A;  1UI7 A;  3HOH A;  4FCM A;  4R9L A;  2AZP A;  5DRE A;  3CCR 3;  3F7S A;  1FGM A;  4HM1 B;  1TM0 A;  1GQZ A;  1NJI 4;  4LGQ A;  1B2X A;  1WMO A;  1BRH A;  2Z77 A;  3EBT A;  3ECF A;  4HM2 B;  5EVH A;  5KP3 A;  3WOE B;  3DGO A;  2XEP A;  4IT7 A;  1W02 A;  5AI1 A;  3MG3 A;  3WOF B;  1O7W B;  1RN4 A;  3IJE B;  1W62 A;  1CH0 A;  2XR8 B;  3G98 A;  4HOH A;  2MC8 A;  4WP5 A;  4ZM8 A;  1BWZ A;  1BNE A;  2F86 B;  4Q53 A;  3BNE A;  3CCJ 3;  1GD3 A;  1WPP A;  1NNV A;  1TP6 A;  2C4B A;  3AHW A;  2GKJ A;  3ICJ A;  1U1W A;  1Q86 4;  1GY6 A;  1SIH A;  1JN5 A;  1O7G B;  4N3V A;  3DGM A;  4CDL A;  1B2U A;  3LH4 A;  3PS8 A;  2Z7A A;  4LG3 A;  1FGQ A;  3B4P A;  3QRD A;  1RRL A;  1STF I;  4LZI A;  1UCL A;  1CYU A;  1ZX2 A;  2Y74 A;  2F56 A;  3JUO A;  4RPA A;  5BXQ A;  4DKI A;  1N8R 4;  1RGC A;  3V98 A;  3PZW A;  1VQ4 3;  3OV4 A;  2ZL8 A;  1STD A;  3CNX A;  1B3S A;  5BU4 A;  3H3H A;  4QWT A;  2W03 A;  5IG4 A;  1BAN A;  2PVZ A;  2XH9 A;  3N8B A;  1ISK A;  4J9A A;  4RNY A;  1QMA A;  2KAA A;  2ML6 A;  3ZG0 A;  1M1X B;  3WDG B;  1ZGX A;  4MMY B;  1LOX A;  4JD7 A;  3FF0 A;  1EQK A;  1E3V A;  2K0M A;  5M19 A;  4RZM A;  4J8T A;  3NM2 A;  4RBN A;  3IGH X;  1IT7 A;  3K63 A;  4CPK A;  1W6G A;  5KP4 A;  3SVA A;  2OTN A;  1BRN L;  3FCS B;  3FG4 A;  4OUQ A;  3QK9 A;  2W6J H;  1YI2 3;  1L5G B;  1M1K 4;  3CCM 3;  3LTA A;  3Q3F A;  5AEU B;  1RGA A;  2SBL A;  2HAW A;  1OCV A;  2ML5 A;  4EYC A;  2W04 A;  4XBY A;  5RNT A;  3EJV A;  3V99 A;  1I8V A;  1YVS A;  2HMJ B;  3CCS 3;  1VQM 3;  1B27 A;  1EUI C;  1JZD A;  4KZ1 A;  1DET A;  1I3I A;  4GL6 A;  3NM7 A;  1UCI A;  1W6C A;  1Z1S A;  2Z76 A;  3V92 A;  6RNT A;  2RCD A;  1WTH A;  3FG3 A;  2CX1 A;  2HMN B;  3D5G A;  1O7H B;  1JKG A;  5IER A;  3KII A;  1T3B A;  5EEO A;  1W61 A;  5IEP A;  2ZXR A;  2PZV A;  1PYL A;  3LT8 A;  3SYU A;  1YJW 3;  2HMM B;  1QAL A;  2CFG A;  4HM7 B;  4RNZ A;  3D79 A;  5BIR A;  3CPO A;  6GSP A;  1ZO2 A;  1SII A;  2KF6 A;  2R4I A;  1UW1 A;  1WQL B;  3HII A;  3KKG A;  1OF5 B;  1FZU A;  3FKA A;  3OW2 2;  2F99 A;  1N9J A;  1OF5 A;  3FLJ A;  1LXE A;  2W9P A;  5GSP A;  3G4S 3;  1RN1 A;  1RDS A;  3ZFZ A;  2KF5 A;  3NUV A;  1A2P A;  4HJL B;  3OWS A;  5ANP A;  1LOV A;  2I9W A;  1NO3 A;  2XSO B;  1GSP A;  1JV2 B;  3G16 A;  3NV0 B;  2GBX B;  4HM0 B;  3S5C A;  4FMB A;  4ILF A;  3SOY A;  4BTW A;  4K7G B;  2F5M A;  2LQV A;  1RHL A;  2Y73 A;  1VZZ A;  2R41 A;  1ROV A;  4PEJ A;  3U1W A;  1WPM A;  3CCQ 3;  1IT8 A;  5A0O B;  1GS3 A;  2H0H A;  3RNT A;  4HM8 B;  1Q7H A;  5IG5 A;  4L7K A;  3NBJ A;  2IYJ A;  5KP1 A;  1BNF A;  2W9Q A;  3CC7 3;  3F7X A;  1YM5 A;  5AIF A;  5CXO A;  1VQ8 3;  3O8Y A;  2KCD A;  1SJW A;  1BRS A;  3DUK A;  3LTC A;  4EBG A;  8RNT A;  3S67 A;  4N6L A;  4K7X A;  1B21 A;  7RNT A;  2EB0 A;  1VQ9 3;  1NB5 I;  1CEW I;  1JNQ A;  2XGN A;  1TFK A;  2GEY A;  1LVN A;  2BMQ B;  3CME 3;  4XBT A;  3LTD A;  2O3O A;  2HMO B;  1RCL A;  3G71 3;  1IDP A;  1RLS A;  1CYV A;  1OHP A;  1IVX A;  1JN5 B;  3BU4 A;  3M8C A;  2Q07 A;  1BGS A;  3F8X A;  1EEJ A;  5H2G A;  2W0Q A;  5BVB A;  2ZHX B;  1TTO A;  2CK3 H;  5M18 A;  3I55 3;  3UJM A;  4R80 A;  4HAA A;  1D6Y A;  4LS9 A;  3B7C A;  1W4N A;  1IVU A;  1JBS A;  1FUS A;  1DYU A;  3T0U A;  4EV5 A;  3DGL A;  3UL5 A;  3HI7 A;  3T8N A;  2AAE A;  2OQE C;  1U8C B;  1B2S A;  1N8Q A;  3Q1C A;  3WOD G;  3DY5 A;  3CNM A;  4KFE A;  1O7N B;  2CIU A;  4JBD A;  2UGI A;  1K23 A;  5CF2 A;  1N5P A;  1GY5 A;  3DGN A;  4LEH A;  3EQQ B;  1A90 A;  1C54 A;  1RCK A;  4EW5 A;  1A2V A;  2CWT A;  3WR2 A;  5IEN A;  1JB4 A;  3F9S A;  1KWI A;  4GSP A;  1QY9 A;  2OOV C;  2WO0 A;  3UB1 A;  9RNT A;  5IW9 A;  3A76 A;  2KW7 A;  4L8P A;  4HZB B;  5STD A;  1PU4 A;  1HU9 A;  1LOW A;  2K3D A;  4BU4 A;  1QVG 2;  3GWR A;  1K41 A;  4JF8 A;  3D3L A;  1BNR A;  3MKI A;  3EN1 B;  4HZ9 B;  2F98 A;  3K0Z A;  3GZX B;  1SDJ A;  4R9K A;  1BRG A;  4N6O B;  3G6E 3;  1JB2 A;  3BB9 A;  4J5G A;  3FVE A;  3BIR A;  3EX9 A;  4LYL B;  1G0T A;  1QAK A;  1ROA A;  3EE1 A;  4XM4 A;  3KZT A;  2IMJ A;  5AII A;  5D82 A;  5G1L A;  2OCT A;  2XGL A;  1RN7 A;  2JQ5 A;  1EG9 B;  3X3Y A;  1K20 A;  1YJN 3;  1VQ5 3;  2OOV A;  4WFO A;  3PXM A;  4K8L A;  1NB3 I;  1BAO A;  3CPW 2;  1LQM B;  1QVF 2;  3OWU A;  1WNH A;  1OGZ A;  5D81 A;  5AIG A;  5M47 A;  1X1X A;  5IF6 A;  1V58 A;  2M7O A;  3DH2 A;  3DXO A;  2CG1 A;  4LB0 A;  4N6V 0;  1IR6 A;  2KF3 A;  4N6T A;  3NBR A;  2IUK A;  2FGT A;  2KPT A;  2MF7 A;  3E99 A;  1GD4 A;  3F40 A;  1UCK A;  1EKM A;  2E2T A;  1PY3 A;  3S27 A;  2QB6 A;  1O7M B;  1RRH A;  4EV2 A;  2KRT A;  3Q2P A;  1LNH A;  1O7P B;  3L0R A;  3MYT A;  1GOU A;  1I2E A;  3NHX A;  3ROB A;  1I0X A;  3KCH A;  4WWU C;  4FCZ A;  3RGR A;  3KSP A;  2BMR B;  1M9G A;  4H3U A;  2BT3 A;  2OQE A;  3NV0 A;  2B1X B;  2GEX A;  3SLU A;  1KD1 4;  1K73 4;  5AYR B;  1NWW A;  2RFR A;  1DMN A;  2F5W A;  5JPP A;  2B24 B;  1BSA A;  4NHF A;  2ZDJ A;  4MMZ B;  2D1W A;  1ZS7 A;  2E2U A;  2CFW A;  5TGN A;  1JBR A;  4PY9 A;  3OXA A;  4O3V A;  2CFD A;  5IWE A;  1UUV B;  2UUG C;  1Q40 B;  2XFS A;  3LZA A;  1MGR A;  1U0K A;  3ALA A;  3BNB A;  2YFI B;  3DEV A;  1RJO A;  4BTX A;  4J9W A;  3GZR A;  3GRD A;  7STD A;  1JZO A;  1DMQ A;  2Z6B A;  4XB5 A;  3CCV 3;  1W7C A;  3X42 A;  4BL2 A;  4K90 B;  1AQZ A;  2ENX A;  3T8U A;  4ORL A;  4FR9 A;  4FMD A;  3MSO A;  5AIH A;  4H61 A;  4R4K A;  1RGK A;  3VGN A;  3FF2 A;  1U1X A;  4KFD A;  1HKX A;  4AKY A;  1SPU A;  2P0X A;  2P0M A;  2RSX A;  2BO9 B;  1YGW A;  4OA3 A;  4J9X A;  2JDI H;  3EBY A;  3ZG5 A;  5FGO A;  2UX0 A;  1Q7Y 4;  1TRQ A;  1VQO 3;  3CMA 3;  1FGT A;  4O8S A;  3AMO B;  1T6K A;  1MOL A;  1VQQ A;  2P38 A;  1Q82 4;  4Q2H A;  3K9M C;  1PFP A;  1B20 A;  1I70 A;  2CWU A;  2XFT A;  1DVC A;  3CU3 A;  3LYG A;  1YGE A;  3UL6 A;  1G02 A;  1LOY A;  1Q9E A;  2CW9 A;  2WGQ A;  1IK3 A;  1BSD A;  1K9M 4;  3SXX A;  1OH0 A;  1BUQ A;  1BSE A;  2CH9 A;  1OHO A;  1RGE A;  3S29 A;  2LT2 A;  5AEW B;  6STD A;  1RMS A;  3JVC A;  1TU5 A;  2LYX A;  3EJX A;  4IK0 A;  3VSY A;  2INX A;  3PGB A;  1X1W A;  1VQP 3;  4LMI A;  3HX8 A;  1E3R A;  1N5H A;  5JPU A;  4GHO A;  1TIJ A;  1FW7 A;  2HOH A;  4FMA A;  3CD6 3;  5ELU A;  3MG2 A;  4FMC A;  1U1V A;  1GOV A;  3BNC A;  1E97 A;  2ZXP A;  3RDE A;  5JBS A;  1RTU A;  4DUN A;  2CFL A;  4L8O A;  2AAD A;  4BL3 A;  2GU1 A;  4R1K A;  3IMA B;  4TX4 A;  3DMC A;  4XDW A;  4I5Q A;  5AYS C;  3G0K A;  4KVH A;  3IPT A;  2A15 A;  2CFK A;  3PVH A;  4HM5 B;  3PW9 A;  3GZY B;  2CHC A;  1W2B 2;  3JUP A;  3SED A;  4JCI A;  1OAC A;  2W2C A;  3FG1 A;  1UGH I;  3JUQ A;  4U13 A;  1IU7 A;  5G2G A;  3WA2 X;  3X41 A;  2PW0 A;  2W56 B;  1B2Z A;  3G8Z A;  1DMM A;  2C11 A;  3FGY A;  1V74 A;  3K5T A;  3RGA A;  3CC2 3;  8CHO A;  2Q9H A;  1QAF A;  2QA4 3;  1US1 A;  1BNI A;  2XF3 A;  4HBR A;  4WHA A;  3JUM A;  1XUA A;  3PYJ A;  3AHS A;  4BTY A;  1MWS A;  1GMR A;  2F4Y A;  3GSP A;  1LNI A;  3EKM A;  3B8L A;  1ASK A;  2BIR A;  2CG0 A;  2O9U X;  3URP A;  1Y4K A;  2YFL B;  2KXG A;  2QGU A;  1IVV A;  3AGO A;  4FCJ A;  1X1U A;  2L4V A;  4MMX B;  3FH1 A;  1MGW A;  4O2H A;  1VQL 3;  1FA3 A;  4JRF A;  3A5E A;  1TRP A;  1FUW A;  3EB8 A;  1N9E A;  2OWP A;  4OK0 A;  1OUN A;  1JB5 A;  1R4Y A;  3VF1 A;  3DM8 A;  1FYS A;  5H2Y A;  5IG0 A;  1BRJ A;  2OTL 3;  1XUB A;  1I2G A;  1MWR A;  2XSH B;  2FXT A;  2XRX B;  3FZW A;  1W00 A;  5IG3 A;  1VQK 3;  1IQX A;  2P05 A;  3GZB A;  1V57 A;  2CC3 A;  1WMN A;  3EHC A;  4X2H A;  1FGO A;  3EF8 A;  5HOH A;  1FGR A;  1YIT 3;  1BRK A;  1T2H A;  4KFF A;  4IIA A;  3BND A;  2RBI A;  2RNT A;  2IY2 A;  2SAR A;  2FNQ A;  3F14 A;  4G1M B;  1Q81 4;  1KSI A;  1UGI A;  4STD A;  3D4A A;  1ULI B;  5LC6 A;  3KN4 A;  3JUN A;  3NQZ A;  1BIR A;  3U97 A;  4HVN A;  1RSN A;  2ZXO A;  1TJD A;  1LQG C;  5IEO A;  1RGF A;  2J8X B;  1GOY A;  1SAR A;  1AVL A;  1R4C A;  1S5A A;  2H0I A;  2PNC A;  1JBT A;  2QB8 A;  1UUW B;  3I0Y A;  2IA7 A;  1UUG B;  3S28 A;  3PCS A;  1IQY A;  4CJN A;  1KQS 2;  1LRA A;  1OPY A;  1EA2 A;  2BU4 A;  2HML B;  1QYA A;  1AY7 A;  1GMQ A;  3NQY A;  4WYK A;  4WYK B;  5ELJ A;  3MG1 A;  1BU4 A;  2GU3 A;  4I4K A;  4KT3 B;  2ZA4 A;  1RNT A;  3I56 3;  1TUH A;  3STD A;  1C7H A;  1IVW A;  2BHM A;  1W5Z A;  1F8N A;  4AEQ A;  1VQ7 3;  3NXJ A;  1A2K A;  5M1A A;  3HZP A;  4LSO A;  1TFO A;  3B4O A;  3NBB A;  2WOH A;  3NX0 A;  3ER7 A;  1QJG A;  3G7K A;  5HA4 A;  1MWT A;  2MPB A;  2L1S A;  1M90 4;  4XBX A;  1G96 A;  1W01 A;  2Q9J A;  3DGY A;  3DZL A;  2QB7 A;  1D6Z A;  5G1K A;  3K7C A;  4AKZ A;  1K8A 4;  1JJ2 2;  4NRE A;  3OX9 A;  1A67 A;  3CCL 3;  1B2M A;  3LML A;  1IYY A;  1J2B A;  1T5Y A;  4NPB A;  2OTJ 3;  4HM3 B;  1K28 A;  1W6Y A;  1X1Y A;  1VQN 3;  1BRI A;  1YJ9 3;  4EC6 A;  3MHE A;  1MNL A;  2BMO B;  3UNL A;  3D9R A;  3LTB A;  1YIJ 3;  3OWY A;  4JUU A;  1GMP A;  3WHO A;  3EC9 A;  3WA3 A;  3PTJ A;  2CKF B;  1I0V A;  1FUT A;  3EDN A;  4HYZ A;  2ZVF A;  1GY7 A;  3MPH A;  1KC8 4;  1DE3 A;  4X2O A;  2HMK B;  1AV4 A;  1I2F A;  3CCE 3;  4HM6 B;  1W2Z A;  2YFJ B;  3AMO A;  1IQ8 A;  3WMD A;  1YNV X;  3MWZ A;  3N54 B;  2IUJ A;  2QIY A;  4J5K A;  2KF4 A;  1UI8 A;  1GYB A;  1I74 A;  3HK4 A;  1JKG B;  2YX9 A;  4IPB A;  1RKY A;  2GKE A;  1Q42 A;  3LOY A;  1SQW A;  1S7J A;  4MEI A;  3J7Y d;  1WMP A;  2WGO A;  3X3X A;  3Q90 A;  2CWV A;  2D42 A;  4IJZ A;  2P09 A;  5D83 A;  1IV9 A;  1AR0 A;  1DVD A;  1YHQ 3;  3GAX A;  1AVK A;  2E2V A;  2GXF A;  3N9H A;  4CCV A;  4GB5 A;  1YVB I;  4Q60 A;  3LT9 A;  4N6U A;  2W56 A;  5FW5 A;  5CLK A;  5CF1 A;  2H0G A;  1CQS A;  1BSC A;  3X40 A;  1BSB A;  1UCJ A;  2C10 A;  3D5I A;  3LXU X;  4O02 B;  4RNT A;  2IW4 A;  4XDV A;  2QEX 3;  5CK6 A;  1UDI I;  1ULJ B;  5EQL A;  5HGR A;  3CXC 2;  4OVM A;  1BUJ A;  2BNG A;  3KFQ C;  2STD A;  3W5W A;  4HKV B;  4K61 A;  5DRV A;  4BIR A;  1BOX A;  3BLZ A;  4EXR A;  3FSD A;  3AGN A;  2V1L A;  3SOA A;  1S72 3;  1VQ6 3;  2YMA A;  1BNS A;  4K1V A;  2GBW B;  1RGG A;  3KSE D;  1RNB A;  2CX0 A;  1T2I A;  1RGL A;  3HIG A;  2RGQ A;  3X3Z A;  3SX1 A;  1U5O A; 
#chains in the Genus database with same CATH homology
 1Q40 A;  3CC4 3;  1IV7 A;  3CCU 3;  1OHS A;  4MJD A;  3TDG A;  3KE7 A;  5LC7 A;  1OGX A;  2WOF A;  1JRQ A;  4K1U A;  1NDO B;  3F8H A;  1D6U A;  3WQZ A;  3PCR A;  4N6N B;  5I97 A;  4HM4 B;  3H51 A;  2K54 A;  3EN8 A;  2H9F A;  1NU3 A;  4N6M A;  1UI7 A;  4FCM A;  4R9L A;  2AZP A;  5DRE A;  3CCR 3;  3F7S A;  1FGM A;  4HM1 B;  1TM0 A;  1GQZ A;  1NJI 4;  4LGQ A;  1WMO A;  2Z77 A;  3EBT A;  3ECF A;  4HM2 B;  5EVH A;  5KP3 A;  3WOE B;  3DGO A;  2XEP A;  4IT7 A;  1W02 A;  5AI1 A;  3MG3 A;  3WOF B;  1O7W B;  3IJE B;  1W62 A;  2XR8 B;  3G98 A;  2MC8 A;  4WP5 A;  4ZM8 A;  1BWZ A;  2F86 B;  4Q53 A;  3BNE A;  3CCJ 3;  1GD3 A;  1WPP A;  1TP6 A;  2GKJ A;  3ICJ A;  1U1W A;  1GY6 A;  1SIH A;  1JN5 A;  1O7G B;  4N3V A;  3DGM A;  4CDL A;  3LH4 A;  3PS8 A;  2Z7A A;  4LG3 A;  1FGQ A;  3B4P A;  3QRD A;  1RRL A;  1STF I;  4LZI A;  1CYU A;  1ZX2 A;  2Y74 A;  3JUO A;  4RPA A;  5BXQ A;  1N8R 4;  3V98 A;  3PZW A;  1VQ4 3;  3OV4 A;  2ZL8 A;  1STD A;  3CNX A;  3H3H A;  4QWT A;  2W03 A;  5IG4 A;  2PVZ A;  2XH9 A;  3N8B A;  1ISK A;  4J9A A;  4RNY A;  1QMA A;  2ML6 A;  1M1X B;  3WDG B;  4MMY B;  1LOX A;  4JD7 A;  3FF0 A;  1EQK A;  1E3V A;  2K0M A;  4RZM A;  4J8T A;  3NM2 A;  4RBN A;  3IGH X;  1IT7 A;  3K63 A;  1W6G A;  5KP4 A;  3SVA A;  2OTN A;  3FCS B;  3FG4 A;  4OUQ A;  3QK9 A;  2W6J H;  1YI2 3;  1L5G B;  1M1K 4;  3CCM 3;  3LTA A;  5AEU B;  2SBL A;  2HAW A;  1OCV A;  2ML5 A;  4EYC A;  2W04 A;  4XBY A;  3EJV A;  3V99 A;  2HMJ B;  1VQM 3;  3CCS 3;  4KZ1 A;  4GL6 A;  3NM7 A;  1W6C A;  1Z1S A;  2Z76 A;  3V92 A;  2RCD A;  1WTH A;  3FG3 A;  2HMN B;  1O7H B;  1JKG A;  5IER A;  3KII A;  5IEP A;  5EEO A;  1W61 A;  2ZXR A;  2PZV A;  3LT8 A;  1YJW 3;  2HMM B;  2CFG A;  1QAL A;  4HM7 B;  4RNZ A;  3CPO A;  1ZO2 A;  1SII A;  2R4I A;  1UW1 A;  1WQL B;  3HII A;  3KKG A;  1OF5 B;  3FKA A;  3OW2 2;  2F99 A;  1N9J A;  1OF5 A;  3FLJ A;  1LXE A;  2W9P A;  3G4S 3;  3T8N A;  3NUV A;  4HJL B;  3OWS A;  5ANP A;  2I9W A;  3G16 A;  1NO3 A;  2XSO B;  1JV2 B;  3NV0 B;  4HM0 B;  3SOY A;  2GBX B;  3S5C A;  4BTW A;  4FMB A;  4K7G B;  2LQV A;  2Y73 A;  1VZZ A;  3U1W A;  1ROV A;  4PEJ A;  1WPM A;  3CCQ 3;  1IT8 A;  5A0O B;  1GS3 A;  4HM8 B;  5IG5 A;  4L7K A;  3NBJ A;  5KP1 A;  2W9Q A;  3CC7 3;  3F7X A;  1YM5 A;  5AIF A;  5CXO A;  1VQ8 3;  3O8Y A;  2KCD A;  1SJW A;  3DUK A;  3LTC A;  4EBG A;  3S67 A;  4N6L A;  4K7X A;  2EB0 A;  1VQ9 3;  1NB5 I;  1CEW I;  1JNQ A;  2XGN A;  1TFK A;  2GEY A;  1LVN A;  2BMQ B;  3CME 3;  4XBT A;  3LTD A;  2O3O A;  2HMO B;  3G71 3;  1IDP A;  1CYV A;  1OHP A;  1IVX A;  1JN5 B;  3M8C A;  2Q07 A;  3F8X A;  5H2G A;  2W0Q A;  5BVB A;  3I55 3;  2CK3 H;  3UJM A;  4R80 A;  1D6Y A;  4LS9 A;  3B7C A;  1W4N A;  1IVU A;  1DYU A;  3T0U A;  4EV5 A;  3DGL A;  3UL5 A;  3HI7 A;  2OQE C;  1U8C B;  1N8Q A;  3Q1C A;  3WOD G;  3X3Z A;  3DY5 A;  3CNM A;  4KFE A;  1O7N B;  2CIU A;  4JBD A;  5CF2 A;  1K23 A;  1Q86 4;  1N5P A;  1GY5 A;  3DGN A;  4LEH A;  3EQQ B;  1A90 A;  1A2V A;  2CWT A;  5IEN A;  1JB4 A;  3F9S A;  1KWI A;  5IW9 A;  1QY9 A;  2OOV C;  2WO0 A;  3UB1 A;  3A76 A;  2KW7 A;  4L8P A;  4HZB B;  5STD A;  1PU4 A;  1HU9 A;  1QVG 2;  3GWR A;  1K41 A;  4JF8 A;  3D3L A;  3MKI A;  3EN1 B;  4HZ9 B;  2F98 A;  3K0Z A;  3GZX B;  1SDJ A;  4R9K A;  4N6O B;  3G6E 3;  1JB2 A;  3BB9 A;  3FVE A;  3EX9 A;  1QAK A;  1ROA A;  3EE1 A;  4XM4 A;  3KZT A;  2IMJ A;  5AII A;  5D82 A;  2OCT A;  2XGL A;  1RN7 A;  2JQ5 A;  1EG9 B;  3X3Y A;  1K20 A;  1YJN 3;  1VQ5 3;  2OOV A;  4WFO A;  3PXM A;  4K8L A;  1NB3 I;  3CPW 2;  1QVF 2;  3OWU A;  1WNH A;  1OGZ A;  5D81 A;  5AIG A;  5M47 A;  5IF6 A;  2M7O A;  3DXO A;  2CG1 A;  4LB0 A;  4N6V 0;  1IR6 A;  4N6T A;  3NBR A;  2IUK A;  2FGT A;  2KPT A;  2MF7 A;  3E99 A;  1GD4 A;  3F40 A;  1EKM A;  2E2T A;  3S27 A;  2QB6 A;  1O7M B;  1RRH A;  4EV2 A;  2KRT A;  3Q2P A;  1LNH A;  1O7P B;  3L0R A;  3MYT A;  3NHX A;  3ROB A;  4WWU C;  4FCZ A;  3RGR A;  3KSP A;  2BMR B;  1M9G A;  4H3U A;  2BT3 A;  2OQE A;  3NV0 A;  2B1X B;  2GEX A;  3SLU A;  1KD1 4;  1K73 4;  5AYR B;  1NWW A;  2RFR A;  1DMN A;  5JPP A;  2B24 B;  4NHF A;  2ZDJ A;  4MMZ B;  2D1W A;  2E2U A;  5TGN A;  2CFW A;  4PY9 A;  3OXA A;  4O3V A;  2CFD A;  5IWE A;  1UUV B;  2XFS A;  1Q40 B;  3LZA A;  1U0K A;  3ALA A;  3BNB A;  2YFI B;  3DEV A;  1RJO A;  4BTX A;  4J9W A;  3GZR A;  3GRD A;  7STD A;  1DMQ A;  2Z6B A;  4XB5 A;  3CCV 3;  1W7C A;  3X42 A;  4K90 B;  3T8U A;  2ENX A;  4ORL A;  4FR9 A;  4FMD A;  3MSO A;  5AIH A;  4H61 A;  4R4K A;  3VGN A;  3FF2 A;  1U1X A;  4KFD A;  1HKX A;  4AKY A;  1SPU A;  2P0X A;  2P0M A;  2RSX A;  2BO9 B;  3EBY A;  4OA3 A;  4J9X A;  2JDI H;  5FGO A;  2UX0 A;  1Q7Y 4;  1VQO 3;  3CMA 3;  1FGT A;  4O8S A;  3AMO B;  1T6K A;  1MOL A;  2P38 A;  1Q82 4;  4Q2H A;  3K9M C;  1PFP A;  3CU3 A;  2CWU A;  2XFT A;  1DVC A;  3LYG A;  1YGE A;  3UL6 A;  2CW9 A;  2WGQ A;  1IK3 A;  1K9M 4;  3SXX A;  1OH0 A;  1BUQ A;  2CH9 A;  1OHO A;  3S29 A;  2LT2 A;  5AEW B;  6STD A;  3JVC A;  1TU5 A;  2LYX A;  3EJX A;  4IK0 A;  3VSY A;  2INX A;  3PGB A;  1VQP 3;  4LMI A;  3HX8 A;  1E3R A;  1N5H A;  5JPU A;  1TIJ A;  4FMA A;  3CD6 3;  5ELU A;  3MG2 A;  4FMC A;  1U1V A;  3BNC A;  3RDE A;  1E97 A;  2ZXP A;  5JBS A;  4DUN A;  2CFL A;  4L8O A;  2GU1 A;  4R1K A;  3IMA B;  4TX4 A;  3DMC A;  4XDW A;  5AYS C;  3G0K A;  4KVH A;  3IPT A;  2A15 A;  2CFK A;  3PVH A;  4HM5 B;  3PW9 A;  3GZY B;  2CHC A;  1W2B 2;  3JUP A;  3SED A;  4JCI A;  1OAC A;  2W2C A;  3FG1 A;  3JUQ A;  4U13 A;  1IU7 A;  5G2G A;  3WA2 X;  3X41 A;  2PW0 A;  2W56 B;  3G8Z A;  3K5T A;  1DMM A;  2C11 A;  3FGY A;  1V74 A;  3RGA A;  3CC2 3;  8CHO A;  2Q9H A;  1QAF A;  2QA4 3;  1US1 A;  2XF3 A;  4HBR A;  4WHA A;  3JUM A;  1XUA A;  3PYJ A;  4BTY A;  3EKM A;  3B8L A;  1ASK A;  2CG0 A;  2O9U X;  1Y4K A;  2YFL B;  2KXG A;  2QGU A;  1IVV A;  4FCJ A;  2L4V A;  4MMX B;  3FH1 A;  4O2H A;  1VQL 3;  1FA3 A;  4JRF A;  1FUW A;  3EB8 A;  1N9E A;  2OWP A;  4OK0 A;  1OUN A;  1JB5 A;  3VF1 A;  3DM8 A;  5H2Y A;  5IG0 A;  2OTL 3;  1XUB A;  2XSH B;  3FZW A;  2FXT A;  2XRX B;  1W00 A;  5IG3 A;  1VQK 3;  1IQX A;  2P05 A;  3GZB A;  2CC3 A;  1WMN A;  3EHC A;  4X2H A;  1FGO A;  3EF8 A;  1FGR A;  1YIT 3;  4KFF A;  4IIA A;  3BND A;  3F14 A;  1Q81 4;  2FNQ A;  4G1M B;  1KSI A;  4STD A;  5LC6 A;  1ULI B;  3KN4 A;  3JUN A;  3NQZ A;  3U97 A;  4HVN A;  5IEO A;  2ZXO A;  1AVL A;  1R4C A;  2PNC A;  1S5A A;  2QB8 A;  1UUW B;  3I0Y A;  2IA7 A;  3S28 A;  3PCS A;  1IQY A;  1KQS 2;  4WYK A;  1OPY A;  1EA2 A;  2HML B;  3NQY A;  1QYA A;  4WYK B;  5ELJ A;  3MG1 A;  4I4K A;  2GU3 A;  3I56 3;  1TUH A;  3STD A;  1C7H A;  1IVW A;  2BHM A;  1W5Z A;  1F8N A;  4AEQ A;  1VQ7 3;  3NXJ A;  1A2K A;  3HZP A;  4LSO A;  1TFO A;  3B4O A;  3NBB A;  2WOH A;  3NX0 A;  3ER7 A;  1QJG A;  3G7K A;  5HA4 A;  2MPB A;  1M90 4;  4XBX A;  1G96 A;  1W01 A;  2Q9J A;  3DZL A;  2QB7 A;  1D6Z A;  4AKZ A;  3K7C A;  1K8A 4;  1JJ2 2;  4NRE A;  3OX9 A;  1A67 A;  3CCL 3;  3LML A;  1J2B A;  1T5Y A;  2OTJ 3;  4HM3 B;  1K28 A;  1W6Y A;  1VQN 3;  1YJ9 3;  4EC6 A;  3MHE A;  1MNL A;  2BMO B;  3UNL A;  3D9R A;  3LTB A;  1YIJ 3;  3OWY A;  4JUU A;  3EC9 A;  3WA3 A;  3PTJ A;  2CKF B;  3EDN A;  4HYZ A;  2ZVF A;  1GY7 A;  3MPH A;  1KC8 4;  4X2O A;  2HMK B;  1AV4 A;  3CCE 3;  4HM6 B;  1W2Z A;  2YFJ B;  3AMO A;  1IQ8 A;  3WMD A;  3MWZ A;  3N54 B;  2IUJ A;  2QIY A;  1UI8 A;  1GYB A;  1I74 A;  3HK4 A;  1JKG B;  2YX9 A;  4IPB A;  1RKY A;  2GKE A;  1Q42 A;  3LOY A;  1SQW A;  1S7J A;  4MEI A;  3J7Y d;  1WMP A;  2WGO A;  3X3X A;  3Q90 A;  2CWV A;  2D42 A;  4IJZ A;  2P09 A;  5D83 A;  1IV9 A;  1AR0 A;  1DVD A;  1YHQ 3;  3GAX A;  1AVK A;  2E2V A;  2GXF A;  3N9H A;  4CCV A;  4GB5 A;  1YVB I;  4Q60 A;  3LT9 A;  4N6U A;  2W56 A;  5FW5 A;  5CLK A;  5CF1 A;  1CQS A;  3X40 A;  2C10 A;  3LXU X;  4O02 B;  4XDV A;  2QEX 3;  2IW4 A;  5CK6 A;  1ULJ B;  5EQL A;  3CXC 2;  5HGR A;  4OVM A;  2BNG A;  3KFQ C;  2STD A;  3W5W A;  4HKV B;  4K61 A;  5DRV A;  4EXR A;  3BLZ A;  1VQ6 3;  3FSD A;  3SOA A;  2V1L A;  1S72 3;  2YMA A;  4K1V A;  2GBW B;  3KSE D;  3HIG A;  2RGQ A;  3SX1 A;  1U5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...