4GL8A

X-ray crystal structure of a periplasmic oligopeptide-binding protein/oligopeptide abc transporter(oppaiv) from borrelia burgdorferi
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
500
structure length
500
Chain Sequence
KLVFKLNIGSEPATLDAQLINDTVGSGIVSQMFLGILDGDPRTGGYRPGLAKSWDISDDGVVYTFHLRDNLVWSDGVSITAEGIRKSYLRILDKETGSSFVNMIKSVIKNAEEYFDGKANESELGIKALDEKTLEITLKSPKPYFLDMLVHQTFIPVPMHVIEKYGQRWTDPENMVVSGPFKLKSRVLNEKVVLEKNNKYYNSKDVVLDSIIFFVTDNSITAYNMYLNDELDAIFKNVPPDLLKDLKLRDDYYSMGINSTSFYSLNMKVKPLDNVKVRKALSFAIDRKTLTESVLNDSSIPTRRATPDYIDYSYKSNLSLFDAEMAKKLLADAGYPNGNNFPLLKVKYNTSDSQRKIAEFIQNQWKKNLNINVQLENEEWSTYINSRVNGNYEIIRSGWSGDYADPMTFLSIFQTENTSFSSYGYSNSEYDELLIKSDNERDIFKRQEILKKAEAIIIERDFPAVFLNITSSSYLFRNDKWKGWEPNISERFNLSEIKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of a periplasmic oligopeptide-binding protein/Oligopeptide ABC transporter(OppAIV) from Borrelia burgdorferi
rcsb
source organism Borrelia burgdorferi b31
molecule tags Protein transport
molecule keywords Oligopeptide ABC transporter OppAIV
total genus 178
structure length 500
sequence length 500
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 4gl8A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gl8A01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 4gl8A02
1ANFA 1F9BA 2R71A 4NTLA 4F31B 1B7HA 2DP8A 2ONKE 2Z8FA 1MXWA 2P0SA 4H1XA 1M5DA 2V3TA 2DE2A 3TELA 1QVSA 3RGYA 3TTRA 3UA8A 3VFJA 3FASA 4WEPA 3OO8A 4GLIA 1MXYA 1S9TA 3GLBA 1TFDA 4G2ZA 4IO5A 1MDP1 1R9QA 2A5TB 4KYEA 1A7LA 5L9OA 1PC3A 2CZLA 4OFOA 1B0HA 1URDA 3MWBA 4R9GA 3KSXA 3PUYE 3MVZA 3PUXE 1WODA 2Z8EA 3DP6A 4EXKA 1OLAA 1MS7A 3PPRA 1MDQA 4LZ5A 4U22A 1VFEA 1R9LA 3OMBA 5H8HA 1UIVA 1IUDA 2PT1A 2DWHA 1M5EA 2PVUA 2XXPA 1FCKA 3O9PA 3ZSFA 1A99A 1N04A 1H76A 3KJTA 5B7DA 3MW0A 4JWYA 3H4ZA 3IO6A 1BP5A 3C4MA 3CIJA 4LQ5A 1FQDA 3KG2A 4LONB 1GGGA 2UVIA 2F35A 5AA4B 1DMBA 5H8FA 3FXQA 4QF9A 2XXRA 2XX8A 2Z8DA 3SDFA 2F34A 2PBWA 3MAMA 4IGTA 4QSCA 5DVJA 5TP9A 4TLMB 4MBPA 2QS4A 2OLBA 3TFLA 1VR5A 3V83A 2QS2A 1VFDA 2ZNTA 4NF6A 3PGFA 1MY4A 1SW2A 2X7QA 2Y7KA 4YICA 2DSFA 4X1DA 2Q2AA 4ZEDA 4G68A 4MH5A 3MUQA 1TXFA 3L6HA 4R2FA 3RY3A 2I48A 2Q2CA 2QJEA 2DXRA 3OD7A 5CRYA 2I49A 4G68B 3U92A 3MP6A 3QYTA 3IOTA 4G4PA 5DVIA 3S9MC 2E1SA 1MQDA 1PB9A 3IL1B 1D4NA 1H45A 3MPLA 5CMMA 1B1HA 2VP1A 4YMAA 2V25A 2DWAA 3TCHA 2HZKA 4LUBA 3HV1A 4QRZA 4LZ7A 1D9YA 1USYE 3V5AA 3RQTA 5KDTA 3TTMA 4UACA 4G8MA 3T22A 3OO7A 2I4BA 5I2NB 2A5TA 3MVWA 3K02A 2AIXA 1IITA 1JEUA 2HCAA 5CI5A 3K0VA 1QULA 4ELQA 1VSOA 1N3WA 4OFLA 3R26A 1IXCA 2F7CA 2H5YA 4IO3A 1NKXA 4HW8A 2XXXA 4QFOA 3QXMA 3S9LC 1N7WA 1EZOA 1Y4TA 3FATA 1EU8A 1P1WA 3FD3A 1M5CA 3RLFE 1SYIA 4NE4A 1WDNA 4OTEA 2Y7IA 2PYYA 1GV8A 3TUSA 4ELRA 2ESNA 3FGSA 3K00A 1FTLA 3MBPA 4RPNA 3IJOB 3KZGA 1OQHA 3SETA 3THIA 1B7ZA 4ZZEA 1Y3QA 4ZECA 1Z7ME 2ZNUA 3I6VA 1P1NA 3RTFB 5I84A 5AA1A 1AOVA 1FTOA 1NH7A 1URSA 4PFWA 3IORA 3UGWA 1VE4A 3QK6A 1QUJA 1MH4A 4YKJA 4I9DA 3H03A 3T9VA 2THIA 4KI0E 3EHUA 3R6UA 4F1VA 3M3KA 3PPOA 4YB7A 4RNSA 3DRFA 1L5TA 5ITPA 1YTVA 3C31A 1JEVA 2F8DA 3FXRA 1IXGA 5HM4B 4G77A 2ZNSA 4HCYA 4DE8A 3LSFB 1ZU0A 3TODA 3IO4A 2DWIA 4PQJA 2D5WA 1S50A 4N13A 3VXBA 4QSEA 4AQ4A 5I58A 4OERA 1NNKA 1OMPA 1XC1A 3KN8A 3CR9A 3HHGA 3M3LA 4G8HA 1BIYA 4LP2B 3L6GA 2HAUA 2I6EA 2VGQA 3CVGA 4FORA 3QAXA 1URGA 2VD3A 3G3IA 4IO2A 1MXVA 4EF1A 3LR1A 4DDDA 3C34A 4IB2A 1OQGA 5M2VA 2GRVA 4FEDA 2XD2A 1LFGA 4EQ7A 4F29A 3KOSA 3N6UA 1US4A 3FJGA 3O29A 4OENA 4OXVA 1D3KA 1DTGA 5K2XA 1MM6A 3M8UA 4JBZA 5EYFA 5I59B 5F1QA 3H06B 2O84X 1LAXA 2FNCA 2RINA 1QW0A 3MP8A 3TQLA 3LSXA 4X1BA 4P11A 2NWJA 4YKPA 1FQAA 1PBPA 2B3BA 1OVTA 4EQBA 3KFMA 5TPAB 4G8NA 4HS7A 1GTKA 1B2HA 3G3FA 4U1ZA 5AE4A 1NNTA 1SD3A 2QS3A 3O6PA 3OELA 5L9SA 4KHZE 4TQUQ 4RY1A 1Q1KA 3CRBA 2WOPA 1QKBA 4YB5A 3H6TA 1T0KA 1A54A 1BKAA 4IO6A 4R75A 4EXLA 3KSJA 5I2KB 3E3KA 1US5A 4EUOA 1P1UA 1AMFA 3JV9A 4NF6B 1LSTA 1MY1A 4AB5A 2Q9TA 3VV5A 3PMWA 5IAIA 3B6WA 4LVQA 1PB8A 1KWHA 4X9TA 4IY6A 1SBPA 3VE1B 4OEUA 2DYXA 3ILTB 4H5FA 4U4XA 3DP8A 4FJPA 3U94A 5BWJA 3U72A 2WKYA 3OEMA 1SI0A 4GWOA 4KFQA 3TEPA 4QFNA 2YPNA 1AH5A 3BBRA 4R72A 2F78A 4BDRA 1SW1A 4ELPA 3OEKA 3TCGA 1LB9A 4PETA 4ECFA 5DT6A 1LAFE 1LBCA 2DOJA 3ZKLA 1JNFA 3T9HB 4BDNA 4R6KA 2M8CA 3ZS6A 1USYH 1MQIA 3CG1A 3KEIA 4NWCA 4YKIA 3C33A 5I57A 2Q88A 1A8EA 4OMBA 1FQBA 3TKDA 2RCAA 4IGRA 4YKKA 2ONSA 3ECRA 2QRYA 1NFTA 1SDXA 2REJA 4Q30B 3GXAA 3SEWA 3VLVA 1LB8A 4R2BA 1MY0A 4F2OA 5AA2A 4G68C 1B58A 2OWSA 2O68A 4GD5A 2WOLA 1LCFA 2XX9A 3O6HA 3G3GA 4IO7A 3BKIB 4NMYA 2ZMBA 2P2AA 1B46A 3K2DA 4JSDA 1ZMGA 2X26A 3PMVA 4OWDA 1B0LA 3TDJA 4R9FA 4E0XA 1MPCA 2P1SA 1B5IA 1RKMA 4NF8A 5FTIA 1MQJA 3U1OA 3IJXB 1O63A 2V93A 2AYSA 2R6GE 1H3DA 3JYRA 3O2AA 4LZ8A 1TT1A 2DQVA 3E4RA 3VLUA 4F3PA 3MVYA 3EPEA 3MC2A 5TU0A 2LAOA 3D4CA 4WKMA 3T96B 3MP1A 1NNPA 4NWDA 2AL5A 1ZBMA 1ZIUA 4JDFA 4ESXA 5JK4A 4H67A 4OHNA 3E9XA 1MH3A 3DRKA 2CMOA 2B4LA 1DPPA 2O1MA 3FIRA 3FVNA 1UQWA 3EQ1A 3FUZA 3EHTA 3K6XA 4LA9A 5L9MA 3FJMA 5CMKA 3H3GA 3R7XA 3QIMA 3T66A 1A40A 4PFYA 2IEEA 4H0WA 4KPTA 2F6PA 2XXVA 3H6UA 4ZDMA 2RF1A 1MPBA 2X7PA 4Q0CA 5LOMA 1XS5A 4KQPA 3QUJA 5DEXB 1S7YA 3MZ9A 3PAMA 1FTKA 1MQHA 4O3AA 3FZVA 3G7WA 4RK2A 3USDA 1MM7A 3K1PA 2QMWA 4JWOA 4OVJA 3B6TA 4R6YA 3F11A 3PPQA 4N6PA 3B6QA 4UA8A 3FV1A 1CB6A 4DIGA 4RJZA 3GBAA 4KCCA 4XKRA 3RYAA 2I58A 4DCYA 1LFIA 1EH3A 3EHSA 3HSTA 4IY5A 3FJ7A 1N0TA 2UVGA 3VLWA 1I69A 5AA2D 3FTOA 5FHOA 4QFKA 3KN3A 3Q27A 3HCQA 3TTKA 2HXWA 3IR1A 1DSNA 1FQCA 4GFRA 2D21A 5I57B 4FE8A 1DPEA 5F7VA 1FTMA 1H44A 3IB1A 1Y3PA 2ONRA 4XIGQ 1MY3A 2F5XA 4KR5A 4ZEBA 1MRPA 3SEYA 4OQOA 3OXNA 5FHNA 3KOTA 3SESA 5FTHA 2V84A 3W9WA 2D3IA 1HSLA 1B3LA 2RC8A 3CFZA 4FECA 3P7IA 4BDLA 1LGBC 2GHAA 4POXA 5CBRA 2PX1A 4GQOA 1FW0A 1I6BA 3KN7A 2B4MA 5ISUA 4OZ9A 5CMBA 2PT2A 1DTZA 2XXWA 2Y7PA 3JZJA 4U4SA 3SEXA 4F3SA 3AXFA 3Q28A 1MG1A 2PMSA 3CSGA 4H6DA 3RUMA 2V3UA 4DXUA 1PBQA 3TYHA 5A5XB 4JWXA 5I56B 3T9UA 2ZYKA 1B3GA 2H9BA 1SI1A 2DVCA 2I3WA 3K1MA 3C36A 4XKQA 3S2VA 1HSJA 2O51A 5H8NA 4FATA 1MXZA 2GH9A 1B7UA 1YPNA 3PPPA 2ZYNA 3A09A 5H8NB 4POWA 2UVHA 2UVJA 2I3VA 1R1NA 4KYSA 1JQFA 1B9JA 2DWJA 3C9HA 1Y1MA 1N3XA 4U1OA 5FHMA 2DE4A 4ONYA 3K6VA 4F3GA 4ZEKA 2W7YA 3IOUA 1MXXA 1XVXA 2XX7A 4NEDA 3FVKA 5H8QA 1JETA 3SERA 4DCXA 1WVJA 5EHSA 4DXCA 3MQ9A 3KJ7A 2ZYOA 4GF8A 2Q89A 5CMCA 1QUKA 2DVZA 1PB7A 3HO7A 1UIUA 1B40A 3PD8A 1D9VA 4M1VA 4TLLB 3EF7A 1CE2A 3FXUA 4PE5B 2OBGA 1I6AA 3LBSA 4P0IA 3G3HA 3CFXA 2ANJA 1JW1A 3V8XB 1FQEA 2WOKA 4QSDA 5HBCA 3T9XB 3V89B 2A5SA 2DE3A 2XXTA 2BJJX 3TAJA 3PUVE 5HPQA 4IO4A 4GL8A 1N84A 3K1NA 2ZYMA 3DRHA 4ZEIA 3RT6B 1GVCA 3DP4A 3GZGA 5K2YA 3RPWA 1XOCA 3CG3A 3BFTA 4Q5TA 4DXBA 3FVGA 5TP9B 1A8FA 1NNFA 2RC7A 4F1UA 4THIA 2OZZA 2NVUB 3W9VA 4O3CA 3S4UA 2UYFA 4C1TA 3Q25A 4JSOA 4ESWA 1UTBB 2YLNA 1B3EA 3K4UA 3RN8A 1Y1ZA 3K6WA 5DTBA 2H4IA 4MLVA 1II5A 2H25A 2XXIA 3H7MA 2RKMA 3QSLA 1UTBA 2FYIA 4MFIA 4Z0IA 3UORA 3VVDA 1IXIA 3PPNA 4ND9A 3UP9A 2VHAA 2F36A 1OLCA 3DRJA 4Z7EA 1ELJA 5JTYA 1SW4A 3BFUA 4F22A 2HAVA 3CI8A 4F19A 3RNNA 3RTWB 1PDAA 2VD2A 4QHQA 3O97A 4EDPA 1R6ZA 4OEVA 2XXYA 1OIBA 5KCJA 2QL3A 3PUZE 3TCFA 5EHMA 3CHGA 3DLNA 3UIFA 5JEIA 1ZJLA 4HTGA 1J1NA 3K6UA 2OK2A 2QSXA 1IQ7A 3KGCA 4L17A 3RT8A 4RXLA 4KD5A 2O1LA 4OESA 1P99A 1IEJA 1H43A 3FV2A 4M4GA 1DOTA 3D4GA 3VXCA 4O3BA 4I8CA 3TQWA 2O69A 3N94A 3PU5A 2REGA 3M3FA 1XHYA 3ONMA 3OO9A 4NF4A 4U23A 3S9NC 2G29A 2Y84A 3LSWA 5ELVA 3O28A 3SEUA 5I2KA 1BLFA 4MF3A 4NF4B 1YCJA 3TTNA 5AA4A 5KDTB 3UK4A 5I59A 1MY2A 4FIMA 3G3JA 4RA1A 1NL5A 1B6HA 3LC8A 2ZXTA 4FEBA 1B3FA 5CM6A 4R6HA 3Q26A 1XVYA 3K01A 2XXHA 3TMGA 5CBSA 1M5BA 2QS1A 3A3UA 3WAEA 4E0WA 1LBBA 1LAHE 2Y7WA 5H8QB 4BDOA 2DS9A 2QPQA 4X48A 5AA3A 3TPAA 1GR2A 1Y3NA 2F7BA 2KLFA 2O7UA 3IK6B 3IX1A 4WXJA 4ZEFA 3VVFA 5IKBA 2H99A 2V3QA 1B5HA 5I58B 3Q29A 4ZE9A 3O66A 5I2NA 4PFTA 4F2QA 1MQGA 4PFUA 3H6VA 2XD3A 3H6WA 1YAEA 3WAFA 3QUFA 4F18A 4Q8RA 1B5JA 2GFEA 3TTLA 4EF2A 2FA7A 1UTHA 4JXIA 2Z23A 1ZLQA 1OVBA 2IA4A 5B70A 2HQ0A 4GXSB 1NH8A 2I0BA 2DXYA 2F7AA 2HEUA 3TZAA 4DLDA 4GIZA 3FVOA 1UTHB 3VDFA 1LCTA 1QUIA 4C0RA 5BUUA 3T93B 1Y20A 3ZKKA 2HZLA 2Z22A 3S9EA 3OO6A 1NMUA 3MZ1A 1JVYA 3U93A 3MZBA 1Q35A 2XHDA 5ICQA 3C32A 4I62A 4RPOA 2F6GA 2QMXA 3DRGA 2ABHA 2I0CA 2O6AA 3KBRA 4XTCQ 1HSEA 4KCDA 1I6QA 3OSQA 4F1YA 2Q8JA 3HPIA 3DRIA 4N07A 1IIWA 4QFPA 5TPAA 1EZPA 3W15C 2NOOA 4U21A 1AIVA 1N7XA 3LVUA 1P1OA 2G93A 2VOZA 1JVXA 3DELB 2ALUA 2RC9A 4GOTA 1B52A 2XXQA 4NF5B 3O6GA 4YZZA 1B05A 4ZS9A 3DM0A 1XT8A 2NXOA 3SEVA 5DVFA 3HHFA 5ITOA 2XXUA 4H5GA 5A5XA 1JW4A 5I56A 3LUYA 2GHBA 4F39A 4ZZAA 4EQ9A 1O7TA 1LFHA 3A3CA 5JTYB 3OOAA 1TFAA 4OETA 4BDQA 4GL0A 1B3HA 3LSLA 3RYBA 1SQYA 3OENA 3CSBA 2I4CA 3G3KA 3GBBA 1QKAA 1ZTYA 1N76A 3O6IA 2YJPA 4JB7A 5J1DA 2UYEA 3SKPA 3UN6A 3VVEA 4FAJA 1LLSA 1PEBA 4H8JA 1RYOA 4OYVA 3PUWE 4TOZA 3N5LA 3PD9A 4MLQA 4RK9A 4BDMA 1SYHA 3PV0E 3OSRA 2F97A 5H8HB 3ILUB 3MPKA 4GXAA 4NF5A 4NF8B 4XKPA 1QJMA 1B51A 3E13X 4ISUA 4U2RA 3ODBA 1RYXA 3IB2A 4P0GA 5DYHA 1SVXB 5CC2A 4C1UA 1ATGA 2Y7RA 4H65A 1B4ZA 3MVXA 2H98A 2OWTA 1A55A 1POY1 5AA2B 3IB0A 2B3FA 2O7IA 4LQ2A 5H8SA 1JW5A 5KZTA 2UXAA 1B32A 4PP0A 5L8DA 1AL3A 1LAGE 2RCBA 1IXHA 1ZKBA 5H8FB 1SW5A 3U8QA 3MJNA 1FQFA 3B7DA 4ELOA 4H8IA 4R74A 3IAZA 3IOWA 4K3FA 1M5FA 1B4HA 1EZ9A 2B65A 2OCUA 3CFLA 3N6TA 4KYDA 1B1XA 1TWYA 4BLAA 4DZ1A 1Y4CA 4XKNA 3PMXA 1IZ1A 4ZE8A 1MXUA 4YU0A 5DEXA 1P1QA 3HN0A 4F3BA 1BTJA 4RYAA 4YMBA 1POTA 3I3VA 2HFBA 4XXUA 3I5OA 5KCJB 5ICTA 3C35A 2AL4A 4GVOA 1MPDA 1FTJA 1O64A 2E0SA 4GRKA 4I1DA 3IOVA 3EN3A 1Z7NE 4YB6A 4YAHX 2R9JA 1Y9UA 4AB6A 4OFJA 4WEDA 2OJTA 4HCWA 4LATA 2NUVA 3N26A 4QFLA 4R73A
chains in the Genus database with same CATH superfamily
1F9BA 1B7HA 2Z8FA 2ONKE 2V3TA 2DE2A 4MNIA 3TTRA 3UA8A 1S9TA 2A5TB 4EXKA 1VFEA 3NOHA 1H76A 2CEXA 4NGUA 3CIJA 4LONB 2F35A 5AA4B 3HFUA 1FPLA 5H8FA 3FXQA 4HXVA 2QS4A 3TFLA 4PF8A 2Y7KA 2DSFA 4G68A 4FBPA 4MH5A 3MUQA 1EYJA 1TXFA 2I48A 2VPNA 5CRYA 3OD7A 1FRPA 1D4NA 1H45A 2V25A 3TCHA 4LZ7A 1D9YA 2KR0A 4G8MA 1JEUA 1IXCA 3QXMA 1P1WA 2WBDA 3TUSA 1GV8A 2ESNA 5KCJB 1FTLA 4RPNA 5IGAA 3LV0A 1B7ZA 3I6VA 3BIGA 1VE4A 2THIA 3EHUA 4F1VA 3M3KA 3PPOA 1L5TA 1YTVA 4N15A 5HM4B 2ZNSA 2DWIA 4N13A 2FIEA 4AS5A 3UP9A 4NF6B 2I6EA 2VD3A 4DDDA 4IB2A 1OQGA 4GX3A 2GRVA 4N8GA 3KOSA 3N6UA 1D3KA 1MM6A 3M8UA 2FNCA 2RINA 3TQLA 4X1BA 4EQBA 4G8NA 4HS7A 1GTKA 3G3FA 4U1ZA 2QS3A 3OELA 4RY1A 3CRBA 2PFZA 3B8BA 1BKAA 3E3KA 4LVQA 4IY6A 3U94A 2WKYA 4QFNA 3BBRA 2F78A 1SW1A 3TCGA 4PETA 4X8RA 4PFIA 3ZKLA 1USYH 4YKIA 2Q88A 1SDXA 4IR8A 4O8MA 4Q30B 3VLVA 1YYZA 1LB8A 4PF6A 4G68C 2O68A 2WOLA 1BK4A 2XX9A 4PAKA 4JVIA 2ZMBA 2P2AA 1B46A 3K2DA 4OWDA 4ELPA 4JVDA 4R9FA 4NF8A 4MHFA 3IJXB 1O63A 1H3DA 3VLUA 3MVYA 3EPEA 1NNPA 2AL5A 4JDFA 5JK4A 3DRKA 3FVNA 2B4LA 1DPPA 3FIRA 3IFAA 1JP4A 5CMKA 3QIMA 3T66A 2RF1A 1MPBA 4KQPA 1FTKA 3FZVA 1G0IA 4DIGA 4N6PA 3T1BA 4KCCA 3EHSA 4PAIA 3FJ7A 1N0TA 2UVGA 3FBPA 3FTOA 3TTKA 4QFKA 3Q27A 2HXWA 2D21A 5I57B 4FE8A 5F7VA 2F5XA 4KR5A 4OQOA 3KOTA 5FTHA 1B3LA 2RC8A 3CFZA 4POXA 4GQOA 1FW0A 2L5VA 2Y7PA 4U4SA 3SEXA 3Q28A 1MG1A 3CSGA 4DXUA 5A5XB 3T9UA 2I3WA 4PE3A 3S2VA 1MXZA 1YPNA 1R1NA 4KYSA 4MEVA 1B9JA 4NF0A 3RYDA 4N17A 2QFLA 4F3GA 2W7YA 2XX7A 5CMCA 3HO7A 1PB7A 5IM2A 1UIUA 4TLLB 3EF7A 3G3HA 2ANJA 1JW1A 3V8XB 2GQ1A 2A5SA 2XXTA 1DCUA 1N84A 2ZYMA 4ZEIA 3RT6B 3BFTA 4THIA 3MYUA 2NVUB 4O3CA 3S4UA 3QSLA 4MFIA 2XXIA 2RKMA 2FYIA 2CZIA 3VVDA 2F36A 4Z7EA 1ELJA 2HAVA 3RTWB 1PDAA 4EDPA 1OIBA 3TCFA 3CHGA 5JEIA 1ZJLA 5IZ3A 3KGCA 2OX3A 4OESA 1P99A 1H43A 4O3BA 4NF4A 4U23A 1XHYA 2G29A 3LSWA 3SEUA 3TTNA 3G3JA 4RA1A 2ZXTA 3Q26A 4QBAA 1XVYA 5LDZA 3TMGA 5CBSA 2QS1A 3WAEA 4E0WA 4BDOA 4X48A 3TPAA 2KLFA 1Q9DA 2F7BA 3IX1A 4WXJA 3Q29A 4ZE9A 1MQGA 4PFUA 4Q8RA 3TTLA 1ZLQA 2IA4A 2HQ0A 1UTHB 5BUUA 3T93B 2HZLA 2Z22A 1JVYA 1Q35A 4GWSA 2XWVA 2I0CA 2O6AA 4KCDA 3HPIA 5TPAA 4U21A 1N7XA 2G93A 2RC9A 5ITOA 2XXUA 1NI9A 1O7TA 1LBWA 5JTYB 4GBWA 4BDQA 1NV7A 3LSLA 3CSBA 3O6IA 3A29A 3N5LA 4BDMA 1SYHA 3PV0E 5H8HB 3ILUB 3MPKA 4OVPA 3E13X 3ODBA 5DYHA 1SVXB 4H65A 2H98A 2OWTA 1A55A 4LQ2A 5KZTA 1B32A 4PP0A 4O7IA 5H8FB 1IXHA 1SW5A 1FQFA 3B7DA 4ELOA 1EZ9A 4KYDA 1IZ1A 2FHYA 4ZE8A 1NUXA 3HN0A 3I5OA 1FBFA 1D9QA 2E0SA 1NUZA 1Z7NE 4N91A 1IMAA 4OFJA 4WEDA 1FBPA 5EQ7A 2DP8A 3VFJA 1MXYA 3GLBA 3RPLA 1MDP1 1R9QA 5L9OA 2CZLA 4OFOA 3DP6A 2Z8EA 1OLAA 1MS7A 2DWHA 1N04A 1KA1A 4O94A 3MW0A 3H4ZA 1BP5A 4LQ5A 4NN3A 1FQDA 3KG2A 1KZ8A 4OVQA 2XX8A 2Z8DA 4H45A 5DVJA 1FBHA 5ET8A 4MBPA 2QS2A 2ZNTA 1SW2A 4YICA 2Q2AA 3RY3A 2DXRA 4NX1A 2I49A 4G68B 3U92A 3MP6A 3S9MC 1B1HA 4GWWA 2DWAA 4P56A 4QRZA 3TTMA 5I2NB 1LBZA 3R26A 4IO3A 4HW8A 1N7WA 4XF5A 4NE4A 4JVCA 4ELRA 4F29A 3THIA 5KDTA 1NV0A 5I84A 1P1NA 1FTOA 1NH7A 3IORA 1MH4A 4YKJA 5ITPA 1JEVA 2F8DA 1EYIA 1FPGA 3TODA 3IO4A 1S50A 4QSEA 1NNKA 1XC1A 4G8HA 2HAUA 2VGQA 2ZZXA 3QAXA 3G3IA 4EF1A 1MXVA 3O29A 1US4A 4OENA 1DTGA 5I59B 5EYFA 3H06B 3MP8A 3LSXA 2NWJA 1FQAA 2B3BA 3KFMA 4OVRA 4MIJA 5AE4A 5L9SA 1SD3A 3O6PA 2XXKA 1QKBA 3H6TA 1A54A 1FPBA 4IO6A 4AB5A 1SBPA 5BWJA 3ILTB 4FJPA 3TEPA 5DW8A 4R72A 4BDRA 1LB9A 2ZZWA 4ECFA 5DT6A 1LAFE 5A5LA 1JNFA 4BDNA 4R6KA 3CG1A 4NWCA 4P1LA 1A8EA 1FQBA 3TKDA 3GXAA 4PC9A 1B58A 2OWSA 4GD5A 2Q8MA 4IO7A 2R8TA 2WBBA 2F3DA 2X26A 3TDJA 1B0LA 1MPCA 4PGNA 1RKMA 3U1OA 3JYRA 2V93A 2AYSA 2R6GE 3MSTA 4N6KA 5TU0A 5I7IA 2QVRA 4PDHA 3K6XA 3EQ1A 3FUZA 4PFYA 4H0WA 2X7PA 4UABA 5DEXB 3USDA 1MM7A 4R6YA 4UA8A 3FV1A 3RYAA 1LFIA 4IY5A 1EH3A 5AA2D 2WYPA 5FHOA 4DI4B 1LEVA 1DPEA 4NHBA 1Y3PA 2ONRA 3SEYA 2D3IA 1HSLA 5CBRA 2GHAA 4OZ9A 2B4MA 5ISUA 5IZ3B 2PT2A 5ESYA 2CZHA 2PMSA 2V3UA 2XWIA 4PFBA 1SI1A 4XKQA 4FATA 5H8NA 2O51A 2GH9A 1NV2A 3PPPA 2ZYNA 3A09A 2UVHA 2I3VA 3C9HA 1Y1MA 1N3XA 3K6VA 3IOUA 1MXXA 1XVXA 5H8QA 3FVKA 1JETA 5EHSA 2FVZA 1B40A 1D9VA 4M1VA 3FXUA 4PE5B 2OBGA 3LBSA 1FQEA 4QSDA 2DE3A 4GWUA 3PUVE 4H46A 3K1NA 1XOCA 4Q5TA 3FVGA 4F1UA 1A8FA 1NNFA 3W9VA 4C1TA 4F39A 4ESWA 3Q25A 4JSOA 1UTBB 3K4UA 1Y1ZA 5DTBA 4MLVA 1II5A 1KA0A 3PPNA 2VHAA 5JTYA 1SW4A 4QHQA 1R6ZA 4OEVA 3UIFA 1J1NA 3K6UA 1IQ7A 2O1LA 3FV2A 1IEJA 4M4GA 1QGXA 2O69A 2PFYA 3M3FA 3OO9A 4NF4B 1YCJA 5I59A 1MY2A 4X04A 1DBZA 5CM6A 5J16A 1M5BA 2JJKA 3A3UA 2DS9A 2O7UA 2H99A 2V3QA 5I58B 3O66A 4F2QA 3QUFA 4F18A 4GXSB 1NH8A 3TZAA 2P3VA 4GIZA 4O7MA 3ZKKA 1NMUA 3U93A 3MZBA 3C32A 2F6GA 2QMXA 3DRGA 4XTCQ 4OA4A 1EZPA 3W15C 1YXIA 3LVUA 4YZZA 5DVFA 3HHFA 4H5GA 5I56A 2GHBA 1TFAA 4GL0A 1B3HA 3RYBA 3GBBA 1ZTYA 1N76A 4JB7A 3UN6A 3VVEA 1PEBA 3PUWE 4TOZA 1B51A 1RYXA 3IB2A 4P0GA 1ATGA 2Y7RA 1POY1 3IB0A 2B3FA 2UXAA 1ZKBA 3U8QA 3EKIA 3MJNA 4H8IA 3IOWA 4K3FA 2OCUA 1TWYA 4XKNA 1P1QA 1BTJA 1POTA 4XXUA 2HFBA 3C35A 4YB6A 3IOVA 3EN3A 4I3YA 2OJTA 4HCWA 3H7MA 1FJ9A 1ANFA 2R71A 4NTLA 4F31B 2FBPA 1LBXA 1MXWA 2P0SA 1M5DA 3TELA 1QVSA 2KQZA 1TFDA 4G2ZA 4IO5A 4KYEA 1A7LA 3KSXA 3PPRA 4U22A 3OMBA 1IMFA 1UIVA 1M5EA 2PVUA 2XXPA 4N8YA 3O9PA 3ZSFA 1A99A 3KJTA 4JWYA 3IO6A 4NQ8A 1SPIA 2XXRA 4GX4A 2F34A 4NAPA 2PBWA 3MAMA 4IGTA 3T0JA 1T0KA 2OLBA 3V83A 4NF6A 1VFDA 3PGFA 1MY4A 4HE1A 3L6HA 2QJEA 2Q2CA 3QYTA 4G4PA 3IOTA 2E1SA 1PB9A 3MPLA 5CMMA 2VP1A 2HZKA 3HV1A 3RQTA 3T22A 2FIXA 2I4BA 5CI5A 1QULA 1N3WA 1NKXA 4QFOA 1EZOA 1Y4TA 3FATA 1SYIA 3MBPA 3FGSA 3SETA 3KZGA 4ZZEA 1Y3QA 4ZECA 1AOVA 4PFWA 4NG7A 3QK6A 1QUJA 3T9VA 4P9KA 4YB7A 4RNSA 3DRFA 3C31A 3FXRA 1IXGA 4DE8A 2V4CA 1FTAA 4PQJA 3VXBA 4OERA 3E79A 3M3LA 4LP2B 3CVGA 4FORA 5M2VA 4FEDA 2XD2A 1LFGA 4EQ7A 5AA4A 4OXVA 5F1QA 2O84X 4MMPA 1LAXA 4P11A 1OVTA 5TPAB 1NNTA 4KHZE 4DI3D 1FBEA 2Y5LA 4YB5A 4R75A 2BJIA 1US5A 3JV9A 1LSTA 1MY1A 3VV5A 1FPEA 5IAIA 4X9TA 1IMDA 4OEUA 2DYXA 3VE1B 2XA5A 1SI0A 1AH5A 1VDWA 4I40A 3OEKA 1LBCA 4GWXA 2M8CA 3ZS6A 1MQIA 5I57A 1FSAA 1FJ6A 2RCAA 4IGRA 4PBQA 1NUWA 3ECRA 1NFTA 3GYYA 1MY0A 3O6HA 3G3GA 4P1EA 4NMYA 4JSDA 1ZMGA 1RDXA 2F3BA 5FTIA 1MQJA 4LZ8A 3O2AA 1TT1A 4N4UA 3MC2A 2LAOA 3D4CA 3T96B 4NWDA 1ZBMA 4ESXA 4OHNA 3E9XA 1MH3A 2CMOA 2O1MA 1FPFA 4LA9A 3FJMA 1RDYA 3R7XA 1A40A 2IEEA 4KPTA 2F6PA 3QUJA 3E78A 3PAMA 1NV6A 1MQHA 4O3AA 3K1PA 4JWOA 3B6TA 3B6QA 1CB6A 1FBDA 4LN5A 3GBAA 4XKRA 5IZ1A 4KXPA 3HCQA 3IFCA 4GFRA 1H44A 3IB1A 4ZEBA 1MRPA 5FHNA 2V84A 1LGBC 2PX1A 1I6BA 3KN7A 4PGPA 1DTZA 2XXWA 1K9YA 4H6DA 3RUMA 5I56B 1B3GA 4XEQA 2H9BA 2DVCA 3C36A 1HSJA 5IZZA 4POWA 1JQFA 4U1OA 4ONYA 4ZEKA 4C0RA 3SERA 4DCXA 1WVJA 4DXCA 3MQ9A 2ZYOA 4GF8A 2Q89A 1QUKA 2DVZA 3U65A 3PD8A 1CE2A 4P0IA 3CFXA 2WOKA 5HBCA 3T9XB 3V89B 5HPQA 4GL8A 3DP4A 3RPWA 3CG3A 4DXBA 5TP9B 2RC7A 2OZZA 1B3EA 3K6WA 4Z0IA 4QXDA 4ND9A 1INPA 1OLCA 3DRJA 3CI8A 4F19A 3O97A 5KCJA 4MJOA 5EHMA 5FBPA 4HTGA 1IMBA 2OK2A 4L17A 3RT8A 4I8CA 3ONMA 3S9NC 2Y84A 1NV4A 3O28A 4MF3A 3UK4A 1B6HA 3LC8A 3K01A 1LBBA 1LAHE 2Y7WA 4PBHA 5AA3A 5K2YA 1GR2A 5IKBA 5I2NA 3H6VA 2XD3A 3WAFA 2MKZA 1B5JA 2FA7A 1OVBA 2DXYA 3VDFA 1LCTA 1QUIA 1Y20A 3S9EA 2HHMA 2XHDA 5ICQA 4RPOA 3KBRA 1FPIA 2Q8JA 1IIWA 4QFPA 1AIVA 2NOOA 1P1OA 3DELB 2ALUA 4ZS9A 3O6GA 5ET5A 1B05A 3DM0A 1XT8A 2NXOA 1JW4A 3LUYA 4ZZAA 4EQ9A 1LFHA 3A3CA 3OOAA 1IMEA 4OETA 1SQYA 3OENA 3RPLB 2I4CA 1QKAA 5J1DA 4MNCA 1LLSA 4H8JA 3OSRA 2F97A 3B50A 1K9ZA 4NF8B 4U2RA 1B4ZA 5ET6A 5AA2B 2O7IA 5H8SA 4MCOA 4R74A 1M5FA 1B4HA 2B65A 3N6TA 1B1XA 4BLAA 1Y4CA 4RYAA 5I3SA 4GVOA 1MPDA 1FTJA 4GRKA 4I1DA 4YAHX 5I5PA 4AB6A 4LATA 2NUVA 3N26A 4R73A 1CNQA 4MNPA 4H1XA 2OWZA 3FASA 4WEPA 3OO8A 4GLIA 1NV5A 4OVTA 1PC3A 1B0HA 1URDA 3MWBA 4R9GA 3PUYE 3MVZA 3PUXE 1WODA 1MDQA 4LZ5A 5H8HA 1R9LA 4PCDA 1IUDA 2PT1A 1FCKA 2VT5A 3LUZA 5B7DA 2WEFA 3C4MA 1GGGA 2UVIA 1DMBA 4QF9A 3SDFA 4QSCA 5TP9A 4TLMB 1VR5A 2X7QA 4X1DA 4ZEDA 4R2FA 5DVIA 1MQDA 3IL1B 2QVVA 4YMAA 4LUBA 3KC0A 1USYE 3V5AA 4UACA 3OO7A 2A5TA 3MVWA 3K02A 2AIXA 1IITA 2HCAA 3K0VA 1VSOA 4OFLA 2F7CA 2H5YA 2XXXA 3S9LC 1EU8A 3FD3A 1M5CA 3RLFE 3QMFA 1WDNA 4OTEA 2Y7IA 2PYYA 4OVSA 3K00A 2ZZVA 1AWBA 3IJOB 1OQHA 3UGWA 1Z7ME 2ZNUA 3RTFB 5AA1A 1URSA 4I9DA 3H03A 4KI0E 3R6UA 4HCYA 4G77A 3LSFB 1ZU0A 4AQ4A 2D5WA 1LBVA 5I58A 1OMPA 3KN8A 3CR9A 3HHGA 4PAFA 1BIYA 3L6GA 1URGA 4IO2A 3LR1A 3C34A 4XFEA 3FJGA 5K2XA 4JBZA 1LBYA 1QW0A 4YKPA 1FBCA 1PBPA 1B2HA 4TQUQ 1Q1KA 2WOPA 4EXLA 2PCRA 3KSJA 5I2KB 4EUOA 1P1UA 1AMFA 1G0HA 4GBVA 2Q9TA 3PMWA 3B6WA 1PB8A 1KWHA 4H5FA 4U4XA 3DP8A 2CEYA 3OEMA 4GWOA 3U72A 4KFQA 2YPNA 2Y5KA 2DOJA 3T9HB 3KEIA 3C33A 4OMBA 4YKKA 1EYKA 4HE2A 2ONSA 3SEWA 2QRYA 2REJA 4P47A 4R2BA 5AA2A 4F2OA 1LCFA 3BKIB 1YZ0A 3PMVA 1NV1A 4E0XA 2P1SA 1B5IA 1XI6A 2DQVA 3E4RA 4F3PA 4WKMA 3MP1A 1ZIUA 4H67A 4ELQA 1UQWA 5L9MA 3EHTA 3H3GA 4ZDMA 2XXVA 3H6UA 4Q0CA 5LOMA 5LTCA 1XS5A 3MZ9A 1S7YA 4RK2A 3G7WA 2QMWA 4OVJA 3F11A 3PPQA 4MX6A 4RJZA 2I58A 3HSTA 4DCYA 2HXRA 4P3LA 1IMCA 3SZPA 3VLWA 1I69A 3KN3A 3PTYA 3IR1A 3KBZA 1DSNA 1FQCA 1FTMA 4XIGQ 1MY3A 3OXNA 3SESA 3W9WA 5EQ8A 4FECA 3P7IA 4BDLA 5CMBA 3KC1A 3JZJA 4F3SA 3AXFA 5EYGA 1PBQA 3TYHA 4JWXA 2ZYKA 3K1MA 1B7UA 5EQ9A 5H8NB 2UVJA 3FXBA 2DWJA 5FHMA 2DE4A 4N6DA 2WYKA 4NEDA 3KJ7A 4PTKA 4GX6A 1I6AA 5T3JA 3TAJA 2BJJX 4IO4A 3DRHA 4AS4A 1GVCA 3GZGA 2UYFA 2YLNA 3RN8A 2H4IA 4PDDA 2H25A 1FPKA 1UTBA 1FPDA 3UORA 1IXIA 4N81A 2QVUA 5F24A 2CZKA 3BFUA 4F22A 3RNNA 2VD2A 2XXYA 2QL3A 4HE0A 3PUZE 3DLNA 2QSXA 4RXLA 2HPGA 4KD5A 1DOTA 3D4GA 3VXCA 3TQWA 2Q74A 3N94A 3PU5A 2REGA 2VPOA 5ELVA 5I2KA 5EQAA 1BLFA 5KDTB 4FIMA 4I3EA 1NL5A 4FEBA 1B3FA 4R6HA 2XXHA 5H8QB 2QPQA 4ZEFA 1Y3NA 3IK6B 3ISPA 3VVFA 5EYHA 1B5HA 1NUYA 4PFTA 4GWYA 3H6WA 1YAEA 3D1RA 2XWOA 2GFEA 4EF2A 4JXIA 1UTHA 4MAGA 4P8BA 2Z23A 4GWZA 5B70A 2I0BA 4DLDA 2F7AA 2HEUA 3FVOA 4OANA 3OO6A 3MZ1A 4I62A 2ABHA 2P3NA 1RDZA 1HSEA 1I6QA 3OSQA 4F1YA 3DRIA 4N07A 4PFRA 2VOZA 1JVXA 3RGYA 4GOTA 1B52A 4NF5B 3SEVA 5A5XA 1NV3A 3G3KA 2YJPA 2UYEA 3SKPA 4FAJA 1RYOA 4OYVA 4RK9A 3PD9A 4MLQA 5ET7A 4GXAA 2XWKA 4NF5A 4XKPA 1QJMA 4ISUA 5CC2A 4C1UA 2WX9A 3MVXA 1JW5A 5L8DA 1AL3A 1LAGE 2RCBA 1FPJA 3IAZA 2DDKA 3CFLA 4DZ1A 3PMXA 1DK4A 1MXUA 4YU0A 5DEXA 4F3BA 4YMBA 3ROJA 3I3VA 3BIHA 5ICTA 2AL4A 1FBGA 1O64A 2R9JA 1Y9UA 4G61A 2XXQA 4QFLA
chains in the Genus database with same CATH topology
1ANFA 1F9BA 2R71A 4NTLA 4F31B 1B7HA 2DP8A 2ONKE 2Z8FA 1MXWA 2P0SA 4H1XA 1M5DA 2V3TA 2DE2A 3TELA 1QVSA 3RGYA 3TTRA 3UA8A 3VFJA 3FASA 4WEPA 3OO8A 4GLIA 1MXYA 1S9TA 3GLBA 1TFDA 4G2ZA 4IO5A 1MDP1 1R9QA 2A5TB 4KYEA 1A7LA 5L9OA 1PC3A 2CZLA 4OFOA 1B0HA 1URDA 3MWBA 4R9GA 3KSXA 3PUYE 3MVZA 3PUXE 1WODA 2Z8EA 3DP6A 4EXKA 1OLAA 1MS7A 3PPRA 1MDQA 4LZ5A 4U22A 1VFEA 1R9LA 3OMBA 5H8HA 1UIVA 1IUDA 2PT1A 2DWHA 1M5EA 2PVUA 2XXPA 1FCKA 3O9PA 3ZSFA 1A99A 1N04A 1H76A 3KJTA 5B7DA 3MW0A 4JWYA 3H4ZA 3IO6A 1BP5A 3C4MA 3CIJA 4LQ5A 1FQDA 3KG2A 4LONB 1GGGA 2UVIA 2F35A 5AA4B 1DMBA 5H8FA 3FXQA 4QF9A 2XXRA 2XX8A 2Z8DA 3SDFA 2F34A 2PBWA 3MAMA 4IGTA 4QSCA 5DVJA 5TP9A 4TLMB 4MBPA 2QS4A 2OLBA 3TFLA 1VR5A 3V83A 2QS2A 1VFDA 2ZNTA 4NF6A 3PGFA 1MY4A 1SW2A 2X7QA 2Y7KA 4YICA 2DSFA 4X1DA 2Q2AA 4ZEDA 4G68A 4MH5A 3MUQA 1TXFA 3L6HA 4R2FA 3RY3A 2I48A 2Q2CA 2QJEA 2DXRA 3OD7A 5CRYA 2I49A 4G68B 3U92A 3MP6A 3QYTA 3IOTA 4G4PA 5DVIA 3S9MC 2E1SA 1MQDA 1PB9A 3IL1B 1D4NA 1H45A 3MPLA 5CMMA 1B1HA 2VP1A 4YMAA 2V25A 2DWAA 3TCHA 2HZKA 4LUBA 3HV1A 4QRZA 4LZ7A 1D9YA 1USYE 3V5AA 3RQTA 5KDTA 3TTMA 4UACA 4G8MA 3T22A 3OO7A 2I4BA 5I2NB 2A5TA 3MVWA 3K02A 2AIXA 1IITA 1JEUA 2HCAA 5CI5A 3K0VA 1QULA 4ELQA 1VSOA 1N3WA 4OFLA 3R26A 1IXCA 2F7CA 2H5YA 4IO3A 1NKXA 4HW8A 2XXXA 4QFOA 3QXMA 3S9LC 1N7WA 1EZOA 1Y4TA 3FATA 1EU8A 1P1WA 3FD3A 1M5CA 3RLFE 1SYIA 4NE4A 1WDNA 4OTEA 2Y7IA 2PYYA 1GV8A 3TUSA 4ELRA 2ESNA 3FGSA 3K00A 1FTLA 3MBPA 4RPNA 3IJOB 3KZGA 1OQHA 3SETA 3THIA 1B7ZA 4ZZEA 1Y3QA 4ZECA 1Z7ME 2ZNUA 3I6VA 1P1NA 3RTFB 5I84A 5AA1A 1AOVA 1FTOA 1NH7A 1URSA 4PFWA 3IORA 3UGWA 1VE4A 3QK6A 1QUJA 1MH4A 4YKJA 4I9DA 3H03A 3T9VA 2THIA 4KI0E 3EHUA 3R6UA 4F1VA 3M3KA 3PPOA 4YB7A 4RNSA 3DRFA 1L5TA 5ITPA 1YTVA 3C31A 1JEVA 2F8DA 3FXRA 1IXGA 5HM4B 4G77A 2ZNSA 4HCYA 4DE8A 3LSFB 1ZU0A 3TODA 3IO4A 2DWIA 4PQJA 2D5WA 1S50A 4N13A 3VXBA 4QSEA 4AQ4A 5I58A 4OERA 1NNKA 1OMPA 1XC1A 3KN8A 3CR9A 3HHGA 3M3LA 4G8HA 1BIYA 4LP2B 3L6GA 2HAUA 2I6EA 2VGQA 3CVGA 4FORA 3QAXA 1URGA 2VD3A 3G3IA 4IO2A 1MXVA 4EF1A 3LR1A 4DDDA 3C34A 4IB2A 1OQGA 5M2VA 2GRVA 4FEDA 2XD2A 1LFGA 4EQ7A 4F29A 3KOSA 3N6UA 1US4A 3FJGA 3O29A 4OENA 4OXVA 1D3KA 1DTGA 5K2XA 1MM6A 3M8UA 4JBZA 5EYFA 5I59B 5F1QA 3H06B 2O84X 1LAXA 2FNCA 2RINA 1QW0A 3MP8A 3TQLA 3LSXA 4X1BA 4P11A 2NWJA 4YKPA 1FQAA 1PBPA 2B3BA 1OVTA 4EQBA 3KFMA 5TPAB 4G8NA 4HS7A 1GTKA 1B2HA 3G3FA 4U1ZA 5AE4A 1NNTA 1SD3A 2QS3A 3O6PA 3OELA 5L9SA 4KHZE 4TQUQ 4RY1A 1Q1KA 3CRBA 2WOPA 1QKBA 4YB5A 3H6TA 1T0KA 1A54A 1BKAA 4IO6A 4R75A 4EXLA 3KSJA 5I2KB 3E3KA 1US5A 4EUOA 1P1UA 1AMFA 3JV9A 4NF6B 1LSTA 1MY1A 4AB5A 2Q9TA 3VV5A 3PMWA 5IAIA 3B6WA 4LVQA 1PB8A 1KWHA 4X9TA 4IY6A 1SBPA 3VE1B 4OEUA 2DYXA 3ILTB 4H5FA 4U4XA 3DP8A 4FJPA 3U94A 5BWJA 3U72A 2WKYA 3OEMA 1SI0A 4GWOA 4KFQA 3TEPA 4QFNA 2YPNA 1AH5A 3BBRA 4R72A 2F78A 4BDRA 1SW1A 4ELPA 3OEKA 3TCGA 1LB9A 4PETA 4ECFA 5DT6A 1LAFE 1LBCA 2DOJA 3ZKLA 1JNFA 3T9HB 4BDNA 4R6KA 2M8CA 3ZS6A 1USYH 1MQIA 3CG1A 3KEIA 4NWCA 4YKIA 3C33A 5I57A 2Q88A 1A8EA 4OMBA 1FQBA 3TKDA 2RCAA 4IGRA 4YKKA 2ONSA 3ECRA 2QRYA 1NFTA 1SDXA 2REJA 4Q30B 3GXAA 3SEWA 3VLVA 1LB8A 4R2BA 1MY0A 4F2OA 5AA2A 4G68C 1B58A 2OWSA 2O68A 4GD5A 2WOLA 1LCFA 2XX9A 3O6HA 3G3GA 4IO7A 3BKIB 4NMYA 2ZMBA 2P2AA 1B46A 3K2DA 4JSDA 1ZMGA 2X26A 3PMVA 4OWDA 1B0LA 3TDJA 4R9FA 4E0XA 1MPCA 2P1SA 1B5IA 1RKMA 4NF8A 5FTIA 1MQJA 3U1OA 3IJXB 1O63A 2V93A 2AYSA 2R6GE 1H3DA 3JYRA 3O2AA 4LZ8A 1TT1A 2DQVA 3E4RA 3VLUA 4F3PA 3MVYA 3EPEA 3MC2A 5TU0A 2LAOA 3D4CA 4WKMA 3T96B 3MP1A 1NNPA 4NWDA 2AL5A 1ZBMA 1ZIUA 4JDFA 4ESXA 5JK4A 4H67A 4OHNA 3E9XA 1MH3A 3DRKA 2CMOA 2B4LA 1DPPA 2O1MA 3FIRA 3FVNA 1UQWA 3EQ1A 3FUZA 3EHTA 3K6XA 4LA9A 5L9MA 3FJMA 5CMKA 3H3GA 3R7XA 3QIMA 3T66A 1A40A 4PFYA 2IEEA 4H0WA 4KPTA 2F6PA 2XXVA 3H6UA 4ZDMA 2RF1A 1MPBA 2X7PA 4Q0CA 5LOMA 1XS5A 4KQPA 3QUJA 5DEXB 1S7YA 3MZ9A 3PAMA 1FTKA 1MQHA 4O3AA 3FZVA 3G7WA 4RK2A 3USDA 1MM7A 3K1PA 2QMWA 4JWOA 4OVJA 3B6TA 4R6YA 3F11A 3PPQA 4N6PA 3B6QA 4UA8A 3FV1A 1CB6A 4DIGA 4RJZA 3GBAA 4KCCA 4XKRA 3RYAA 2I58A 4DCYA 1LFIA 1EH3A 3EHSA 3HSTA 4IY5A 3FJ7A 1N0TA 2UVGA 3VLWA 1I69A 5AA2D 3FTOA 5FHOA 4QFKA 3KN3A 3Q27A 3HCQA 3TTKA 2HXWA 3IR1A 1DSNA 1FQCA 4GFRA 2D21A 5I57B 4FE8A 1DPEA 5F7VA 1FTMA 1H44A 3IB1A 1Y3PA 2ONRA 4XIGQ 1MY3A 2F5XA 4KR5A 4ZEBA 1MRPA 3SEYA 4OQOA 3OXNA 5FHNA 3KOTA 3SESA 5FTHA 2V84A 3W9WA 2D3IA 1HSLA 1B3LA 2RC8A 3CFZA 4FECA 3P7IA 4BDLA 1LGBC 2GHAA 4POXA 5CBRA 2PX1A 4GQOA 1FW0A 1I6BA 3KN7A 2B4MA 5ISUA 4OZ9A 5CMBA 2PT2A 1DTZA 2XXWA 2Y7PA 3JZJA 4U4SA 3SEXA 4F3SA 3AXFA 3Q28A 1MG1A 2PMSA 3CSGA 4H6DA 3RUMA 2V3UA 4DXUA 1PBQA 3TYHA 5A5XB 4JWXA 5I56B 3T9UA 2ZYKA 1B3GA 2H9BA 1SI1A 2DVCA 2I3WA 3K1MA 3C36A 4XKQA 3S2VA 1HSJA 2O51A 5H8NA 4FATA 1MXZA 2GH9A 1B7UA 1YPNA 3PPPA 2ZYNA 3A09A 5H8NB 4POWA 2UVHA 2UVJA 2I3VA 1R1NA 4KYSA 1JQFA 1B9JA 2DWJA 3C9HA 1Y1MA 1N3XA 4U1OA 5FHMA 2DE4A 4ONYA 3K6VA 4F3GA 4ZEKA 2W7YA 3IOUA 1MXXA 1XVXA 2XX7A 4NEDA 3FVKA 5H8QA 1JETA 3SERA 4DCXA 1WVJA 5EHSA 4DXCA 3MQ9A 3KJ7A 2ZYOA 4GF8A 2Q89A 5CMCA 1QUKA 2DVZA 1PB7A 3HO7A 1UIUA 1B40A 3PD8A 1D9VA 4M1VA 4TLLB 3EF7A 1CE2A 3FXUA 4PE5B 2OBGA 1I6AA 3LBSA 4P0IA 3G3HA 3CFXA 2ANJA 1JW1A 3V8XB 1FQEA 2WOKA 4QSDA 5HBCA 3T9XB 3V89B 2A5SA 2DE3A 2XXTA 2BJJX 3TAJA 3PUVE 5HPQA 4IO4A 4GL8A 1N84A 3K1NA 2ZYMA 3DRHA 4ZEIA 3RT6B 1GVCA 3DP4A 3GZGA 5K2YA 3RPWA 1XOCA 3CG3A 3BFTA 4Q5TA 4DXBA 3FVGA 5TP9B 1A8FA 1NNFA 2RC7A 4F1UA 4THIA 2OZZA 2NVUB 3W9VA 4O3CA 3S4UA 2UYFA 4C1TA 3Q25A 4JSOA 4ESWA 1UTBB 2YLNA 1B3EA 3K4UA 3RN8A 1Y1ZA 3K6WA 5DTBA 2H4IA 4MLVA 1II5A 2H25A 2XXIA 3H7MA 2RKMA 3QSLA 1UTBA 2FYIA 4MFIA 4Z0IA 3UORA 3VVDA 1IXIA 3PPNA 4ND9A 3UP9A 2VHAA 2F36A 1OLCA 3DRJA 4Z7EA 1ELJA 5JTYA 1SW4A 3BFUA 4F22A 2HAVA 3CI8A 4F19A 3RNNA 3RTWB 1PDAA 2VD2A 4QHQA 3O97A 4EDPA 1R6ZA 4OEVA 2XXYA 1OIBA 5KCJA 2QL3A 3PUZE 3TCFA 5EHMA 3CHGA 3DLNA 3UIFA 5JEIA 1ZJLA 4HTGA 1J1NA 3K6UA 2OK2A 2QSXA 1IQ7A 3KGCA 4L17A 3RT8A 4RXLA 4KD5A 2O1LA 4OESA 1P99A 1IEJA 1H43A 3FV2A 4M4GA 1DOTA 3D4GA 3VXCA 4O3BA 4I8CA 3TQWA 2O69A 3N94A 3PU5A 2REGA 3M3FA 1XHYA 3ONMA 3OO9A 4NF4A 4U23A 3S9NC 2G29A 2Y84A 3LSWA 5ELVA 3O28A 3SEUA 5I2KA 1BLFA 4MF3A 4NF4B 1YCJA 3TTNA 5AA4A 5KDTB 3UK4A 5I59A 1MY2A 4FIMA 3G3JA 4RA1A 1NL5A 1B6HA 3LC8A 2ZXTA 4FEBA 1B3FA 5CM6A 4R6HA 3Q26A 1XVYA 3K01A 2XXHA 3TMGA 5CBSA 1M5BA 2QS1A 3A3UA 3WAEA 4E0WA 1LBBA 1LAHE 2Y7WA 5H8QB 4BDOA 2DS9A 2QPQA 4X48A 5AA3A 3TPAA 1GR2A 1Y3NA 2F7BA 2KLFA 2O7UA 3IK6B 3IX1A 4WXJA 4ZEFA 3VVFA 5IKBA 2H99A 2V3QA 1B5HA 5I58B 3Q29A 4ZE9A 3O66A 5I2NA 4PFTA 4F2QA 1MQGA 4PFUA 3H6VA 2XD3A 3H6WA 1YAEA 3WAFA 3QUFA 4F18A 4Q8RA 1B5JA 2GFEA 3TTLA 4EF2A 2FA7A 1UTHA 4JXIA 2Z23A 1ZLQA 1OVBA 2IA4A 5B70A 2HQ0A 4GXSB 1NH8A 2I0BA 2DXYA 2F7AA 2HEUA 3TZAA 4DLDA 4GIZA 3FVOA 1UTHB 3VDFA 1LCTA 1QUIA 4C0RA 5BUUA 3T93B 1Y20A 3ZKKA 2HZLA 2Z22A 3S9EA 3OO6A 1NMUA 3MZ1A 1JVYA 3U93A 3MZBA 1Q35A 2XHDA 5ICQA 3C32A 4I62A 4RPOA 2F6GA 2QMXA 3DRGA 2ABHA 2I0CA 2O6AA 3KBRA 4XTCQ 1HSEA 4KCDA 1I6QA 3OSQA 4F1YA 2Q8JA 3HPIA 3DRIA 4N07A 1IIWA 4QFPA 5TPAA 1EZPA 3W15C 2NOOA 4U21A 1AIVA 1N7XA 3LVUA 1P1OA 2G93A 2VOZA 1JVXA 3DELB 2ALUA 2RC9A 4GOTA 1B52A 2XXQA 4NF5B 3O6GA 4YZZA 1B05A 4ZS9A 3DM0A 1XT8A 2NXOA 3SEVA 5DVFA 3HHFA 5ITOA 2XXUA 4H5GA 5A5XA 1JW4A 5I56A 3LUYA 2GHBA 4F39A 4ZZAA 4EQ9A 1O7TA 1LFHA 3A3CA 5JTYB 3OOAA 1TFAA 4OETA 4BDQA 4GL0A 1B3HA 3LSLA 3RYBA 1SQYA 3OENA 3CSBA 2I4CA 3G3KA 3GBBA 1QKAA 1ZTYA 1N76A 3O6IA 2YJPA 4JB7A 5J1DA 2UYEA 3SKPA 3UN6A 3VVEA 4FAJA 1LLSA 1PEBA 4H8JA 1RYOA 4OYVA 3PUWE 4TOZA 3N5LA 3PD9A 4MLQA 4RK9A 4BDMA 1SYHA 3PV0E 3OSRA 2F97A 5H8HB 3ILUB 3MPKA 4GXAA 4NF5A 4NF8B 4XKPA 1QJMA 1B51A 3E13X 4ISUA 4U2RA 3ODBA 1RYXA 3IB2A 4P0GA 5DYHA 1SVXB 5CC2A 4C1UA 1ATGA 2Y7RA 4H65A 1B4ZA 3MVXA 2H98A 2OWTA 1A55A 1POY1 5AA2B 3IB0A 2B3FA 2O7IA 4LQ2A 5H8SA 1JW5A 5KZTA 2UXAA 1B32A 4PP0A 5L8DA 1AL3A 1LAGE 2RCBA 1IXHA 1ZKBA 5H8FB 1SW5A 3U8QA 3MJNA 1FQFA 3B7DA 4ELOA 4H8IA 4R74A 3IAZA 3IOWA 4K3FA 1M5FA 1B4HA 1EZ9A 2B65A 2OCUA 3CFLA 3N6TA 4KYDA 1B1XA 1TWYA 4BLAA 4DZ1A 1Y4CA 4XKNA 3PMXA 1IZ1A 4ZE8A 1MXUA 4YU0A 5DEXA 1P1QA 3HN0A 4F3BA 1BTJA 4RYAA 4YMBA 1POTA 3I3VA 2HFBA 4XXUA 3I5OA 5KCJB 5ICTA 3C35A 2AL4A 4GVOA 1MPDA 1FTJA 1O64A 2E0SA 4GRKA 4I1DA 3IOVA 3EN3A 1Z7NE 4YB6A 4YAHX 2R9JA 1Y9UA 4AB6A 4OFJA 4WEDA 2OJTA 4HCWA 4LATA 2NUVA 3N26A 4QFLA 4R73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ANF A;  1F9B A;  2R71 A;  4NTL A;  4F31 B;  1B7H A;  2DP8 A;  2ONK E;  2Z8F A;  1MXW A;  2P0S A;  4H1X A;  1M5D A;  2V3T A;  2DE2 A;  3TEL A;  1QVS A;  3RGY A;  3TTR A;  3UA8 A;  3VFJ A;  3FAS A;  4WEP A;  3OO8 A;  4GLI A;  1MXY A;  1S9T A;  3GLB A;  1TFD A;  4G2Z A;  4IO5 A;  1MDP 1;  1R9Q A;  2A5T B;  4KYE A;  1A7L A;  5L9O A;  1PC3 A;  2CZL A;  4OFO A;  1B0H A;  1URD A;  3MWB A;  4R9G A;  3KSX A;  3PUY E;  3MVZ A;  3PUX E;  1WOD A;  2Z8E A;  3DP6 A;  4EXK A;  1OLA A;  1MS7 A;  3PPR A;  1MDQ A;  4LZ5 A;  4U22 A;  1VFE A;  1R9L A;  3OMB A;  5H8H A;  1UIV A;  1IUD A;  2PT1 A;  2DWH A;  1M5E A;  2PVU A;  2XXP A;  1FCK A;  3O9P A;  3ZSF A;  1A99 A;  1N04 A;  1H76 A;  3KJT A;  5B7D A;  3MW0 A;  4JWY A;  3H4Z A;  3IO6 A;  1BP5 A;  3C4M A;  3CIJ A;  4LQ5 A;  1FQD A;  3KG2 A;  4LON B;  1GGG A;  2UVI A;  2F35 A;  5AA4 B;  1DMB A;  5H8F A;  3FXQ A;  4QF9 A;  2XXR A;  2XX8 A;  2Z8D A;  3SDF A;  2F34 A;  2PBW A;  3MAM A;  4IGT A;  4QSC A;  5DVJ A;  5TP9 A;  4TLM B;  4MBP A;  2QS4 A;  2OLB A;  3TFL A;  1VR5 A;  3V83 A;  2QS2 A;  1VFD A;  2ZNT A;  4NF6 A;  3PGF A;  1MY4 A;  1SW2 A;  2X7Q A;  2Y7K A;  4YIC A;  2DSF A;  4X1D A;  2Q2A A;  4ZED A;  4G68 A;  4MH5 A;  3MUQ A;  1TXF A;  3L6H A;  4R2F A;  3RY3 A;  2I48 A;  2Q2C A;  2QJE A;  2DXR A;  3OD7 A;  5CRY A;  2I49 A;  4G68 B;  3U92 A;  3MP6 A;  3QYT A;  3IOT A;  4G4P A;  5DVI A;  3S9M C;  2E1S A;  1MQD A;  1PB9 A;  3IL1 B;  1D4N A;  1H45 A;  3MPL A;  5CMM A;  1B1H A;  2VP1 A;  4YMA A;  2V25 A;  2DWA A;  3TCH A;  2HZK A;  4LUB A;  3HV1 A;  4QRZ A;  4LZ7 A;  1D9Y A;  1USY E;  3V5A A;  3RQT A;  5KDT A;  3TTM A;  4UAC A;  4G8M A;  3T22 A;  3OO7 A;  2I4B A;  5I2N B;  2A5T A;  3MVW A;  3K02 A;  2AIX A;  1IIT A;  1JEU A;  2HCA A;  5CI5 A;  3K0V A;  1QUL A;  4ELQ A;  1VSO A;  1N3W A;  4OFL A;  3R26 A;  1IXC A;  2F7C A;  2H5Y A;  4IO3 A;  1NKX A;  4HW8 A;  2XXX A;  4QFO A;  3QXM A;  3S9L C;  1N7W A;  1EZO A;  1Y4T A;  3FAT A;  1EU8 A;  1P1W A;  3FD3 A;  1M5C A;  3RLF E;  1SYI A;  4NE4 A;  1WDN A;  4OTE A;  2Y7I A;  2PYY A;  1GV8 A;  3TUS A;  4ELR A;  2ESN A;  3FGS A;  3K00 A;  1FTL A;  3MBP A;  4RPN A;  3IJO B;  3KZG A;  1OQH A;  3SET A;  3THI A;  1B7Z A;  4ZZE A;  1Y3Q A;  4ZEC A;  1Z7M E;  2ZNU A;  3I6V A;  1P1N A;  3RTF B;  5I84 A;  5AA1 A;  1AOV A;  1FTO A;  1NH7 A;  1URS A;  4PFW A;  3IOR A;  3UGW A;  1VE4 A;  3QK6 A;  1QUJ A;  1MH4 A;  4YKJ A;  4I9D A;  3H03 A;  3T9V A;  2THI A;  4KI0 E;  3EHU A;  3R6U A;  4F1V A;  3M3K A;  3PPO A;  4YB7 A;  4RNS A;  3DRF A;  1L5T A;  5ITP A;  1YTV A;  3C31 A;  1JEV A;  2F8D A;  3FXR A;  1IXG A;  5HM4 B;  4G77 A;  2ZNS A;  4HCY A;  4DE8 A;  3LSF B;  1ZU0 A;  3TOD A;  3IO4 A;  2DWI A;  4PQJ A;  2D5W A;  1S50 A;  4N13 A;  3VXB A;  4QSE A;  4AQ4 A;  5I58 A;  4OER A;  1NNK A;  1OMP A;  1XC1 A;  3KN8 A;  3CR9 A;  3HHG A;  3M3L A;  4G8H A;  1BIY A;  4LP2 B;  3L6G A;  2HAU A;  2I6E A;  2VGQ A;  3CVG A;  4FOR A;  3QAX A;  1URG A;  2VD3 A;  3G3I A;  4IO2 A;  1MXV A;  4EF1 A;  3LR1 A;  4DDD A;  3C34 A;  4IB2 A;  1OQG A;  5M2V A;  2GRV A;  4FED A;  2XD2 A;  1LFG A;  4EQ7 A;  4F29 A;  3KOS A;  3N6U A;  1US4 A;  3FJG A;  3O29 A;  4OEN A;  4OXV A;  1D3K A;  1DTG A;  5K2X A;  1MM6 A;  3M8U A;  4JBZ A;  5EYF A;  5I59 B;  5F1Q A;  3H06 B;  2O84 X;  1LAX A;  2FNC A;  2RIN A;  1QW0 A;  3MP8 A;  3TQL A;  3LSX A;  4X1B A;  4P11 A;  2NWJ A;  4YKP A;  1FQA A;  1PBP A;  2B3B A;  1OVT A;  4EQB A;  3KFM A;  5TPA B;  4G8N A;  4HS7 A;  1GTK A;  1B2H A;  3G3F A;  4U1Z A;  5AE4 A;  1NNT A;  1SD3 A;  2QS3 A;  3O6P A;  3OEL A;  5L9S A;  4KHZ E;  4TQU Q;  4RY1 A;  1Q1K A;  3CRB A;  2WOP A;  1QKB A;  4YB5 A;  3H6T A;  1T0K A;  1A54 A;  1BKA A;  4IO6 A;  4R75 A;  4EXL A;  3KSJ A;  5I2K B;  3E3K A;  1US5 A;  4EUO A;  1P1U A;  1AMF A;  3JV9 A;  4NF6 B;  1LST A;  1MY1 A;  4AB5 A;  2Q9T A;  3VV5 A;  3PMW A;  5IAI A;  3B6W A;  4LVQ A;  1PB8 A;  1KWH A;  4X9T A;  4IY6 A;  1SBP A;  3VE1 B;  4OEU A;  2DYX A;  3ILT B;  4H5F A;  4U4X A;  3DP8 A;  4FJP A;  3U94 A;  5BWJ A;  3U72 A;  2WKY A;  3OEM A;  1SI0 A;  4GWO A;  4KFQ A;  3TEP A;  4QFN A;  2YPN A;  1AH5 A;  3BBR A;  4R72 A;  2F78 A;  4BDR A;  1SW1 A;  4ELP A;  3OEK A;  3TCG A;  1LB9 A;  4PET A;  4ECF A;  5DT6 A;  1LAF E;  1LBC A;  2DOJ A;  3ZKL A;  1JNF A;  3T9H B;  4BDN A;  4R6K A;  2M8C A;  3ZS6 A;  1USY H;  1MQI A;  3CG1 A;  3KEI A;  4NWC A;  4YKI A;  3C33 A;  5I57 A;  2Q88 A;  1A8E A;  4OMB A;  1FQB A;  3TKD A;  2RCA A;  4IGR A;  4YKK A;  2ONS A;  3ECR A;  2QRY A;  1NFT A;  1SDX A;  2REJ A;  4Q30 B;  3GXA A;  3SEW A;  3VLV A;  1LB8 A;  4R2B A;  1MY0 A;  4F2O A;  5AA2 A;  4G68 C;  1B58 A;  2OWS A;  2O68 A;  4GD5 A;  2WOL A;  1LCF A;  2XX9 A;  3O6H A;  3G3G A;  4IO7 A;  3BKI B;  4NMY A;  2ZMB A;  2P2A A;  1B46 A;  3K2D A;  4JSD A;  1ZMG A;  2X26 A;  3PMV A;  4OWD A;  1B0L A;  3TDJ A;  4R9F A;  4E0X A;  1MPC A;  2P1S A;  1B5I A;  1RKM A;  4NF8 A;  5FTI A;  1MQJ A;  3U1O A;  3IJX B;  1O63 A;  2V93 A;  2AYS A;  2R6G E;  1H3D A;  3JYR A;  3O2A A;  4LZ8 A;  1TT1 A;  2DQV A;  3E4R A;  3VLU A;  4F3P A;  3MVY A;  3EPE A;  3MC2 A;  5TU0 A;  2LAO A;  3D4C A;  4WKM A;  3T96 B;  3MP1 A;  1NNP A;  4NWD A;  2AL5 A;  1ZBM A;  1ZIU A;  4JDF A;  4ESX A;  5JK4 A;  4H67 A;  4OHN A;  3E9X A;  1MH3 A;  3DRK A;  2CMO A;  2B4L A;  1DPP A;  2O1M A;  3FIR A;  3FVN A;  1UQW A;  3EQ1 A;  3FUZ A;  3EHT A;  3K6X A;  4LA9 A;  5L9M A;  3FJM A;  5CMK A;  3H3G A;  3R7X A;  3QIM A;  3T66 A;  1A40 A;  4PFY A;  2IEE A;  4H0W A;  4KPT A;  2F6P A;  2XXV A;  3H6U A;  4ZDM A;  2RF1 A;  1MPB A;  2X7P A;  4Q0C A;  5LOM A;  1XS5 A;  4KQP A;  3QUJ A;  5DEX B;  1S7Y A;  3MZ9 A;  3PAM A;  1FTK A;  1MQH A;  4O3A A;  3FZV A;  3G7W A;  4RK2 A;  3USD A;  1MM7 A;  3K1P A;  2QMW A;  4JWO A;  4OVJ A;  3B6T A;  4R6Y A;  3F11 A;  3PPQ A;  4N6P A;  3B6Q A;  4UA8 A;  3FV1 A;  1CB6 A;  4DIG A;  4RJZ A;  3GBA A;  4KCC A;  4XKR A;  3RYA A;  2I58 A;  4DCY A;  1LFI A;  1EH3 A;  3EHS A;  3HST A;  4IY5 A;  3FJ7 A;  1N0T A;  2UVG A;  3VLW A;  1I69 A;  5AA2 D;  3FTO A;  5FHO A;  4QFK A;  3KN3 A;  3Q27 A;  3HCQ A;  3TTK A;  2HXW A;  3IR1 A;  1DSN A;  1FQC A;  4GFR A;  2D21 A;  5I57 B;  4FE8 A;  1DPE A;  5F7V A;  1FTM A;  1H44 A;  3IB1 A;  1Y3P A;  2ONR A;  4XIG Q;  1MY3 A;  2F5X A;  4KR5 A;  4ZEB A;  1MRP A;  3SEY A;  4OQO A;  3OXN A;  5FHN A;  3KOT A;  3SES A;  5FTH A;  2V84 A;  3W9W A;  2D3I A;  1HSL A;  1B3L A;  2RC8 A;  3CFZ A;  4FEC A;  3P7I A;  4BDL A;  1LGB C;  2GHA A;  4POX A;  5CBR A;  2PX1 A;  4GQO A;  1FW0 A;  1I6B A;  3KN7 A;  2B4M A;  5ISU A;  4OZ9 A;  5CMB A;  2PT2 A;  1DTZ A;  2XXW A;  2Y7P A;  3JZJ A;  4U4S A;  3SEX A;  4F3S A;  3AXF A;  3Q28 A;  1MG1 A;  2PMS A;  3CSG A;  4H6D A;  3RUM A;  2V3U A;  4DXU A;  1PBQ A;  3TYH A;  5A5X B;  4JWX A;  5I56 B;  3T9U A;  2ZYK A;  1B3G A;  2H9B A;  1SI1 A;  2DVC A;  2I3W A;  3K1M A;  3C36 A;  4XKQ A;  3S2V A;  1HSJ A;  2O51 A;  5H8N A;  4FAT A;  1MXZ A;  2GH9 A;  1B7U A;  1YPN A;  3PPP A;  2ZYN A;  3A09 A;  5H8N B;  4POW A;  2UVH A;  2UVJ A;  2I3V A;  1R1N A;  4KYS A;  1JQF A;  1B9J A;  2DWJ A;  3C9H A;  1Y1M A;  1N3X A;  4U1O A;  5FHM A;  2DE4 A;  4ONY A;  3K6V A;  4F3G A;  4ZEK A;  2W7Y A;  3IOU A;  1MXX A;  1XVX A;  2XX7 A;  4NED A;  3FVK A;  5H8Q A;  1JET A;  3SER A;  4DCX A;  1WVJ A;  5EHS A;  4DXC A;  3MQ9 A;  3KJ7 A;  2ZYO A;  4GF8 A;  2Q89 A;  5CMC A;  1QUK A;  2DVZ A;  1PB7 A;  3HO7 A;  1UIU A;  1B40 A;  3PD8 A;  1D9V A;  4M1V A;  4TLL B;  3EF7 A;  1CE2 A;  3FXU A;  4PE5 B;  2OBG A;  1I6A A;  3LBS A;  4P0I A;  3G3H A;  3CFX A;  2ANJ A;  1JW1 A;  3V8X B;  1FQE A;  2WOK A;  4QSD A;  5HBC A;  3T9X B;  3V89 B;  2A5S A;  2DE3 A;  2XXT A;  2BJJ X;  3TAJ A;  3PUV E;  5HPQ A;  4IO4 A;  4GL8 A;  1N84 A;  3K1N A;  2ZYM A;  3DRH A;  4ZEI A;  3RT6 B;  1GVC A;  3DP4 A;  3GZG A;  5K2Y A;  3RPW A;  1XOC A;  3CG3 A;  3BFT A;  4Q5T A;  4DXB A;  3FVG A;  5TP9 B;  1A8F A;  1NNF A;  2RC7 A;  4F1U A;  4THI A;  2OZZ A;  2NVU B;  3W9V A;  4O3C A;  3S4U A;  2UYF A;  4C1T A;  3Q25 A;  4JSO A;  4ESW A;  1UTB B;  2YLN A;  1B3E A;  3K4U A;  3RN8 A;  1Y1Z A;  3K6W A;  5DTB A;  2H4I A;  4MLV A;  1II5 A;  2H25 A;  2XXI A;  3H7M A;  2RKM A;  3QSL A;  1UTB A;  2FYI A;  4MFI A;  4Z0I A;  3UOR A;  3VVD A;  1IXI A;  3PPN A;  4ND9 A;  3UP9 A;  2VHA A;  2F36 A;  1OLC A;  3DRJ A;  4Z7E A;  1ELJ A;  5JTY A;  1SW4 A;  3BFU A;  4F22 A;  2HAV A;  3CI8 A;  4F19 A;  3RNN A;  3RTW B;  1PDA A;  2VD2 A;  4QHQ A;  3O97 A;  4EDP A;  1R6Z A;  4OEV A;  2XXY A;  1OIB A;  5KCJ A;  2QL3 A;  3PUZ E;  3TCF A;  5EHM A;  3CHG A;  3DLN A;  3UIF A;  5JEI A;  1ZJL A;  4HTG A;  1J1N A;  3K6U A;  2OK2 A;  2QSX A;  1IQ7 A;  3KGC A;  4L17 A;  3RT8 A;  4RXL A;  4KD5 A;  2O1L A;  4OES A;  1P99 A;  1IEJ A;  1H43 A;  3FV2 A;  4M4G A;  1DOT A;  3D4G A;  3VXC A;  4O3B A;  4I8C A;  3TQW A;  2O69 A;  3N94 A;  3PU5 A;  2REG A;  3M3F A;  1XHY A;  3ONM A;  3OO9 A;  4NF4 A;  4U23 A;  3S9N C;  2G29 A;  2Y84 A;  3LSW A;  5ELV A;  3O28 A;  3SEU A;  5I2K A;  1BLF A;  4MF3 A;  4NF4 B;  1YCJ A;  3TTN A;  5AA4 A;  5KDT B;  3UK4 A;  5I59 A;  1MY2 A;  4FIM A;  3G3J A;  4RA1 A;  1NL5 A;  1B6H A;  3LC8 A;  2ZXT A;  4FEB A;  1B3F A;  5CM6 A;  4R6H A;  3Q26 A;  1XVY A;  3K01 A;  2XXH A;  3TMG A;  5CBS A;  1M5B A;  2QS1 A;  3A3U A;  3WAE A;  4E0W A;  1LBB A;  1LAH E;  2Y7W A;  5H8Q B;  4BDO A;  2DS9 A;  2QPQ A;  4X48 A;  5AA3 A;  3TPA A;  1GR2 A;  1Y3N A;  2F7B A;  2KLF A;  2O7U A;  3IK6 B;  3IX1 A;  4WXJ A;  4ZEF A;  3VVF A;  5IKB A;  2H99 A;  2V3Q A;  1B5H A;  5I58 B;  3Q29 A;  4ZE9 A;  3O66 A;  5I2N A;  4PFT A;  4F2Q A;  1MQG A;  4PFU A;  3H6V A;  2XD3 A;  3H6W A;  1YAE A;  3WAF A;  3QUF A;  4F18 A;  4Q8R A;  1B5J A;  2GFE A;  3TTL A;  4EF2 A;  2FA7 A;  1UTH A;  4JXI A;  2Z23 A;  1ZLQ A;  1OVB A;  2IA4 A;  5B70 A;  2HQ0 A;  4GXS B;  1NH8 A;  2I0B A;  2DXY A;  2F7A A;  2HEU A;  3TZA A;  4DLD A;  4GIZ A;  3FVO A;  1UTH B;  3VDF A;  1LCT A;  1QUI A;  4C0R A;  5BUU A;  3T93 B;  1Y20 A;  3ZKK A;  2HZL A;  2Z22 A;  3S9E A;  3OO6 A;  1NMU A;  3MZ1 A;  1JVY A;  3U93 A;  3MZB A;  1Q35 A;  2XHD A;  5ICQ A;  3C32 A;  4I62 A;  4RPO A;  2F6G A;  2QMX A;  3DRG A;  2ABH A;  2I0C A;  2O6A A;  3KBR A;  4XTC Q;  1HSE A;  4KCD A;  1I6Q A;  3OSQ A;  4F1Y A;  2Q8J A;  3HPI A;  3DRI A;  4N07 A;  1IIW A;  4QFP A;  5TPA A;  1EZP A;  3W15 C;  2NOO A;  4U21 A;  1AIV A;  1N7X A;  3LVU A;  1P1O A;  2G93 A;  2VOZ A;  1JVX A;  3DEL B;  2ALU A;  2RC9 A;  4GOT A;  1B52 A;  2XXQ A;  4NF5 B;  3O6G A;  4YZZ A;  1B05 A;  4ZS9 A;  3DM0 A;  1XT8 A;  2NXO A;  3SEV A;  5DVF A;  3HHF A;  5ITO A;  2XXU A;  4H5G A;  5A5X A;  1JW4 A;  5I56 A;  3LUY A;  2GHB A;  4F39 A;  4ZZA A;  4EQ9 A;  1O7T A;  1LFH A;  3A3C A;  5JTY B;  3OOA A;  1TFA A;  4OET A;  4BDQ A;  4GL0 A;  1B3H A;  3LSL A;  3RYB A;  1SQY A;  3OEN A;  3CSB A;  2I4C A;  3G3K A;  3GBB A;  1QKA A;  1ZTY A;  1N76 A;  3O6I A;  2YJP A;  4JB7 A;  5J1D A;  2UYE A;  3SKP A;  3UN6 A;  3VVE A;  4FAJ A;  1LLS A;  1PEB A;  4H8J A;  1RYO A;  4OYV A;  3PUW E;  4TOZ A;  3N5L A;  3PD9 A;  4MLQ A;  4RK9 A;  4BDM A;  1SYH A;  3PV0 E;  3OSR A;  2F97 A;  5H8H B;  3ILU B;  3MPK A;  4GXA A;  4NF5 A;  4NF8 B;  4XKP A;  1QJM A;  1B51 A;  3E13 X;  4ISU A;  4U2R A;  3ODB A;  1RYX A;  3IB2 A;  4P0G A;  5DYH A;  1SVX B;  5CC2 A;  4C1U A;  1ATG A;  2Y7R A;  4H65 A;  1B4Z A;  3MVX A;  2H98 A;  2OWT A;  1A55 A;  1POY 1;  5AA2 B;  3IB0 A;  2B3F A;  2O7I A;  4LQ2 A;  5H8S A;  1JW5 A;  5KZT A;  2UXA A;  1B32 A;  4PP0 A;  5L8D A;  1AL3 A;  1LAG E;  2RCB A;  1IXH A;  1ZKB A;  5H8F B;  1SW5 A;  3U8Q A;  3MJN A;  1FQF A;  3B7D A;  4ELO A;  4H8I A;  4R74 A;  3IAZ A;  3IOW A;  4K3F A;  1M5F A;  1B4H A;  1EZ9 A;  2B65 A;  2OCU A;  3CFL A;  3N6T A;  4KYD A;  1B1X A;  1TWY A;  4BLA A;  4DZ1 A;  1Y4C A;  4XKN A;  3PMX A;  1IZ1 A;  4ZE8 A;  1MXU A;  4YU0 A;  5DEX A;  1P1Q A;  3HN0 A;  4F3B A;  1BTJ A;  4RYA A;  4YMB A;  1POT A;  3I3V A;  2HFB A;  4XXU A;  3I5O A;  5KCJ B;  5ICT A;  3C35 A;  2AL4 A;  4GVO A;  1MPD A;  1FTJ A;  1O64 A;  2E0S A;  4GRK A;  4I1D A;  3IOV A;  3EN3 A;  1Z7N E;  4YB6 A;  4YAH X;  2R9J A;  1Y9U A;  4AB6 A;  4OFJ A;  4WED A;  2OJT A;  4HCW A;  4LAT A;  2NUV A;  3N26 A;  4QFL A;  4R73 A; 
#chains in the Genus database with same CATH topology
 1F9B A;  1B7H A;  2Z8F A;  2ONK E;  2V3T A;  2DE2 A;  4MNI A;  3TTR A;  3UA8 A;  1S9T A;  2A5T B;  4EXK A;  1VFE A;  3NOH A;  1H76 A;  2CEX A;  4NGU A;  3CIJ A;  4LON B;  2F35 A;  5AA4 B;  3HFU A;  1FPL A;  5H8F A;  3FXQ A;  4HXV A;  2QS4 A;  3TFL A;  4PF8 A;  2Y7K A;  2DSF A;  4G68 A;  4FBP A;  4MH5 A;  3MUQ A;  1EYJ A;  1TXF A;  2I48 A;  2VPN A;  5CRY A;  3OD7 A;  1FRP A;  1D4N A;  1H45 A;  2V25 A;  3TCH A;  4LZ7 A;  1D9Y A;  2KR0 A;  4G8M A;  1JEU A;  1IXC A;  3QXM A;  1P1W A;  2WBD A;  3TUS A;  1GV8 A;  2ESN A;  5KCJ B;  1FTL A;  4RPN A;  5IGA A;  3LV0 A;  1B7Z A;  3I6V A;  3BIG A;  1VE4 A;  2THI A;  3EHU A;  4F1V A;  3M3K A;  3PPO A;  1L5T A;  1YTV A;  4N15 A;  5HM4 B;  2ZNS A;  2DWI A;  4N13 A;  2FIE A;  4AS5 A;  3UP9 A;  4NF6 B;  2I6E A;  2VD3 A;  4DDD A;  4IB2 A;  1OQG A;  4GX3 A;  2GRV A;  4N8G A;  3KOS A;  3N6U A;  1D3K A;  1MM6 A;  3M8U A;  2FNC A;  2RIN A;  3TQL A;  4X1B A;  4EQB A;  4G8N A;  4HS7 A;  1GTK A;  3G3F A;  4U1Z A;  2QS3 A;  3OEL A;  4RY1 A;  3CRB A;  2PFZ A;  3B8B A;  1BKA A;  3E3K A;  4LVQ A;  4IY6 A;  3U94 A;  2WKY A;  4QFN A;  3BBR A;  2F78 A;  1SW1 A;  3TCG A;  4PET A;  4X8R A;  4PFI A;  3ZKL A;  1USY H;  4YKI A;  2Q88 A;  1SDX A;  4IR8 A;  4O8M A;  4Q30 B;  3VLV A;  1YYZ A;  1LB8 A;  4PF6 A;  4G68 C;  2O68 A;  2WOL A;  1BK4 A;  2XX9 A;  4PAK A;  4JVI A;  2ZMB A;  2P2A A;  1B46 A;  3K2D A;  4OWD A;  4ELP A;  4JVD A;  4R9F A;  4NF8 A;  4MHF A;  3IJX B;  1O63 A;  1H3D A;  3VLU A;  3MVY A;  3EPE A;  1NNP A;  2AL5 A;  4JDF A;  5JK4 A;  3DRK A;  3FVN A;  2B4L A;  1DPP A;  3FIR A;  3IFA A;  1JP4 A;  5CMK A;  3QIM A;  3T66 A;  2RF1 A;  1MPB A;  4KQP A;  1FTK A;  3FZV A;  1G0I A;  4DIG A;  4N6P A;  3T1B A;  4KCC A;  3EHS A;  4PAI A;  3FJ7 A;  1N0T A;  2UVG A;  3FBP A;  3FTO A;  3TTK A;  4QFK A;  3Q27 A;  2HXW A;  2D21 A;  5I57 B;  4FE8 A;  5F7V A;  2F5X A;  4KR5 A;  4OQO A;  3KOT A;  5FTH A;  1B3L A;  2RC8 A;  3CFZ A;  4POX A;  4GQO A;  1FW0 A;  2L5V A;  2Y7P A;  4U4S A;  3SEX A;  3Q28 A;  1MG1 A;  3CSG A;  4DXU A;  5A5X B;  3T9U A;  2I3W A;  4PE3 A;  3S2V A;  1MXZ A;  1YPN A;  1R1N A;  4KYS A;  4MEV A;  1B9J A;  4NF0 A;  3RYD A;  4N17 A;  2QFL A;  4F3G A;  2W7Y A;  2XX7 A;  5CMC A;  3HO7 A;  1PB7 A;  5IM2 A;  1UIU A;  4TLL B;  3EF7 A;  3G3H A;  2ANJ A;  1JW1 A;  3V8X B;  2GQ1 A;  2A5S A;  2XXT A;  1DCU A;  1N84 A;  2ZYM A;  4ZEI A;  3RT6 B;  3BFT A;  4THI A;  3MYU A;  2NVU B;  4O3C A;  3S4U A;  3QSL A;  4MFI A;  2XXI A;  2RKM A;  2FYI A;  2CZI A;  3VVD A;  2F36 A;  4Z7E A;  1ELJ A;  2HAV A;  3RTW B;  1PDA A;  4EDP A;  1OIB A;  3TCF A;  3CHG A;  5JEI A;  1ZJL A;  5IZ3 A;  3KGC A;  2OX3 A;  4OES A;  1P99 A;  1H43 A;  4O3B A;  4NF4 A;  4U23 A;  1XHY A;  2G29 A;  3LSW A;  3SEU A;  3TTN A;  3G3J A;  4RA1 A;  2ZXT A;  3Q26 A;  4QBA A;  1XVY A;  5LDZ A;  3TMG A;  5CBS A;  2QS1 A;  3WAE A;  4E0W A;  4BDO A;  4X48 A;  3TPA A;  2KLF A;  1Q9D A;  2F7B A;  3IX1 A;  4WXJ A;  3Q29 A;  4ZE9 A;  1MQG A;  4PFU A;  4Q8R A;  3TTL A;  1ZLQ A;  2IA4 A;  2HQ0 A;  1UTH B;  5BUU A;  3T93 B;  2HZL A;  2Z22 A;  1JVY A;  1Q35 A;  4GWS A;  2XWV A;  2I0C A;  2O6A A;  4KCD A;  3HPI A;  5TPA A;  4U21 A;  1N7X A;  2G93 A;  2RC9 A;  5ITO A;  2XXU A;  1NI9 A;  1O7T A;  1LBW A;  5JTY B;  4GBW A;  4BDQ A;  1NV7 A;  3LSL A;  3CSB A;  3O6I A;  3A29 A;  3N5L A;  4BDM A;  1SYH A;  3PV0 E;  5H8H B;  3ILU B;  3MPK A;  4OVP A;  3E13 X;  3ODB A;  5DYH A;  1SVX B;  4H65 A;  2H98 A;  2OWT A;  1A55 A;  4LQ2 A;  5KZT A;  1B32 A;  4PP0 A;  4O7I A;  5H8F B;  1IXH A;  1SW5 A;  1FQF A;  3B7D A;  4ELO A;  1EZ9 A;  4KYD A;  1IZ1 A;  2FHY A;  4ZE8 A;  1NUX A;  3HN0 A;  3I5O A;  1FBF A;  1D9Q A;  2E0S A;  1NUZ A;  1Z7N E;  4N91 A;  1IMA A;  4OFJ A;  4WED A;  1FBP A;  5EQ7 A;  2DP8 A;  3VFJ A;  1MXY A;  3GLB A;  3RPL A;  1MDP 1;  1R9Q A;  5L9O A;  2CZL A;  4OFO A;  3DP6 A;  2Z8E A;  1OLA A;  1MS7 A;  2DWH A;  1N04 A;  1KA1 A;  4O94 A;  3MW0 A;  3H4Z A;  1BP5 A;  4LQ5 A;  4NN3 A;  1FQD A;  3KG2 A;  1KZ8 A;  4OVQ A;  2XX8 A;  2Z8D A;  4H45 A;  5DVJ A;  1FBH A;  5ET8 A;  4MBP A;  2QS2 A;  2ZNT A;  1SW2 A;  4YIC A;  2Q2A A;  3RY3 A;  2DXR A;  4NX1 A;  2I49 A;  4G68 B;  3U92 A;  3MP6 A;  3S9M C;  1B1H A;  4GWW A;  2DWA A;  4P56 A;  4QRZ A;  3TTM A;  5I2N B;  1LBZ A;  3R26 A;  4IO3 A;  4HW8 A;  1N7W A;  4XF5 A;  4NE4 A;  4JVC A;  4ELR A;  4F29 A;  3THI A;  5KDT A;  1NV0 A;  5I84 A;  1P1N A;  1FTO A;  1NH7 A;  3IOR A;  1MH4 A;  4YKJ A;  5ITP A;  1JEV A;  2F8D A;  1EYI A;  1FPG A;  3TOD A;  3IO4 A;  1S50 A;  4QSE A;  1NNK A;  1XC1 A;  4G8H A;  2HAU A;  2VGQ A;  2ZZX A;  3QAX A;  3G3I A;  4EF1 A;  1MXV A;  3O29 A;  1US4 A;  4OEN A;  1DTG A;  5I59 B;  5EYF A;  3H06 B;  3MP8 A;  3LSX A;  2NWJ A;  1FQA A;  2B3B A;  3KFM A;  4OVR A;  4MIJ A;  5AE4 A;  5L9S A;  1SD3 A;  3O6P A;  2XXK A;  1QKB A;  3H6T A;  1A54 A;  1FPB A;  4IO6 A;  4AB5 A;  1SBP A;  5BWJ A;  3ILT B;  4FJP A;  3TEP A;  5DW8 A;  4R72 A;  4BDR A;  1LB9 A;  2ZZW A;  4ECF A;  5DT6 A;  1LAF E;  5A5L A;  1JNF A;  4BDN A;  4R6K A;  3CG1 A;  4NWC A;  4P1L A;  1A8E A;  1FQB A;  3TKD A;  3GXA A;  4PC9 A;  1B58 A;  2OWS A;  4GD5 A;  2Q8M A;  4IO7 A;  2R8T A;  2WBB A;  2F3D A;  2X26 A;  3TDJ A;  1B0L A;  1MPC A;  4PGN A;  1RKM A;  3U1O A;  3JYR A;  2V93 A;  2AYS A;  2R6G E;  3MST A;  4N6K A;  5TU0 A;  5I7I A;  2QVR A;  4PDH A;  3K6X A;  3EQ1 A;  3FUZ A;  4PFY A;  4H0W A;  2X7P A;  4UAB A;  5DEX B;  3USD A;  1MM7 A;  4R6Y A;  4UA8 A;  3FV1 A;  3RYA A;  1LFI A;  4IY5 A;  1EH3 A;  5AA2 D;  2WYP A;  5FHO A;  4DI4 B;  1LEV A;  1DPE A;  4NHB A;  1Y3P A;  2ONR A;  3SEY A;  2D3I A;  1HSL A;  5CBR A;  2GHA A;  4OZ9 A;  2B4M A;  5ISU A;  5IZ3 B;  2PT2 A;  5ESY A;  2CZH A;  2PMS A;  2V3U A;  2XWI A;  4PFB A;  1SI1 A;  4XKQ A;  4FAT A;  5H8N A;  2O51 A;  2GH9 A;  1NV2 A;  3PPP A;  2ZYN A;  3A09 A;  2UVH A;  2I3V A;  3C9H A;  1Y1M A;  1N3X A;  3K6V A;  3IOU A;  1MXX A;  1XVX A;  5H8Q A;  3FVK A;  1JET A;  5EHS A;  2FVZ A;  1B40 A;  1D9V A;  4M1V A;  3FXU A;  4PE5 B;  2OBG A;  3LBS A;  1FQE A;  4QSD A;  2DE3 A;  4GWU A;  3PUV E;  4H46 A;  3K1N A;  1XOC A;  4Q5T A;  3FVG A;  4F1U A;  1A8F A;  1NNF A;  3W9V A;  4C1T A;  4F39 A;  4ESW A;  3Q25 A;  4JSO A;  1UTB B;  3K4U A;  1Y1Z A;  5DTB A;  4MLV A;  1II5 A;  1KA0 A;  3PPN A;  2VHA A;  5JTY A;  1SW4 A;  4QHQ A;  1R6Z A;  4OEV A;  3UIF A;  1J1N A;  3K6U A;  1IQ7 A;  2O1L A;  3FV2 A;  1IEJ A;  4M4G A;  1QGX A;  2O69 A;  2PFY A;  3M3F A;  3OO9 A;  4NF4 B;  1YCJ A;  5I59 A;  1MY2 A;  4X04 A;  1DBZ A;  5CM6 A;  5J16 A;  1M5B A;  2JJK A;  3A3U A;  2DS9 A;  2O7U A;  2H99 A;  2V3Q A;  5I58 B;  3O66 A;  4F2Q A;  3QUF A;  4F18 A;  4GXS B;  1NH8 A;  3TZA A;  2P3V A;  4GIZ A;  4O7M A;  3ZKK A;  1NMU A;  3U93 A;  3MZB A;  3C32 A;  2F6G A;  2QMX A;  3DRG A;  4XTC Q;  4OA4 A;  1EZP A;  3W15 C;  1YXI A;  3LVU A;  4YZZ A;  5DVF A;  3HHF A;  4H5G A;  5I56 A;  2GHB A;  1TFA A;  4GL0 A;  1B3H A;  3RYB A;  3GBB A;  1ZTY A;  1N76 A;  4JB7 A;  3UN6 A;  3VVE A;  1PEB A;  3PUW E;  4TOZ A;  1B51 A;  1RYX A;  3IB2 A;  4P0G A;  1ATG A;  2Y7R A;  1POY 1;  3IB0 A;  2B3F A;  2UXA A;  1ZKB A;  3U8Q A;  3EKI A;  3MJN A;  4H8I A;  3IOW A;  4K3F A;  2OCU A;  1TWY A;  4XKN A;  1P1Q A;  1BTJ A;  1POT A;  4XXU A;  2HFB A;  3C35 A;  4YB6 A;  3IOV A;  3EN3 A;  4I3Y A;  2OJT A;  4HCW A;  3H7M A;  1FJ9 A;  1ANF A;  2R71 A;  4NTL A;  4F31 B;  2FBP A;  1LBX A;  1MXW A;  2P0S A;  1M5D A;  3TEL A;  1QVS A;  2KQZ A;  1TFD A;  4G2Z A;  4IO5 A;  4KYE A;  1A7L A;  3KSX A;  3PPR A;  4U22 A;  3OMB A;  1IMF A;  1UIV A;  1M5E A;  2PVU A;  2XXP A;  4N8Y A;  3O9P A;  3ZSF A;  1A99 A;  3KJT A;  4JWY A;  3IO6 A;  4NQ8 A;  1SPI A;  2XXR A;  4GX4 A;  2F34 A;  4NAP A;  2PBW A;  3MAM A;  4IGT A;  3T0J A;  1T0K A;  2OLB A;  3V83 A;  4NF6 A;  1VFD A;  3PGF A;  1MY4 A;  4HE1 A;  3L6H A;  2QJE A;  2Q2C A;  3QYT A;  4G4P A;  3IOT A;  2E1S A;  1PB9 A;  3MPL A;  5CMM A;  2VP1 A;  2HZK A;  3HV1 A;  3RQT A;  3T22 A;  2FIX A;  2I4B A;  5CI5 A;  1QUL A;  1N3W A;  1NKX A;  4QFO A;  1EZO A;  1Y4T A;  3FAT A;  1SYI A;  3MBP A;  3FGS A;  3SET A;  3KZG A;  4ZZE A;  1Y3Q A;  4ZEC A;  1AOV A;  4PFW A;  4NG7 A;  3QK6 A;  1QUJ A;  3T9V A;  4P9K A;  4YB7 A;  4RNS A;  3DRF A;  3C31 A;  3FXR A;  1IXG A;  4DE8 A;  2V4C A;  1FTA A;  4PQJ A;  3VXB A;  4OER A;  3E79 A;  3M3L A;  4LP2 B;  3CVG A;  4FOR A;  5M2V A;  4FED A;  2XD2 A;  1LFG A;  4EQ7 A;  5AA4 A;  4OXV A;  5F1Q A;  2O84 X;  4MMP A;  1LAX A;  4P11 A;  1OVT A;  5TPA B;  1NNT A;  4KHZ E;  4DI3 D;  1FBE A;  2Y5L A;  4YB5 A;  4R75 A;  2BJI A;  1US5 A;  3JV9 A;  1LST A;  1MY1 A;  3VV5 A;  1FPE A;  5IAI A;  4X9T A;  1IMD A;  4OEU A;  2DYX A;  3VE1 B;  2XA5 A;  1SI0 A;  1AH5 A;  1VDW A;  4I40 A;  3OEK A;  1LBC A;  4GWX A;  2M8C A;  3ZS6 A;  1MQI A;  5I57 A;  1FSA A;  1FJ6 A;  2RCA A;  4IGR A;  4PBQ A;  1NUW A;  3ECR A;  1NFT A;  3GYY A;  1MY0 A;  3O6H A;  3G3G A;  4P1E A;  4NMY A;  4JSD A;  1ZMG A;  1RDX A;  2F3B A;  5FTI A;  1MQJ A;  4LZ8 A;  3O2A A;  1TT1 A;  4N4U A;  3MC2 A;  2LAO A;  3D4C A;  3T96 B;  4NWD A;  1ZBM A;  4ESX A;  4OHN A;  3E9X A;  1MH3 A;  2CMO A;  2O1M A;  1FPF A;  4LA9 A;  3FJM A;  1RDY A;  3R7X A;  1A40 A;  2IEE A;  4KPT A;  2F6P A;  3QUJ A;  3E78 A;  3PAM A;  1NV6 A;  1MQH A;  4O3A A;  3K1P A;  4JWO A;  3B6T A;  3B6Q A;  1CB6 A;  1FBD A;  4LN5 A;  3GBA A;  4XKR A;  5IZ1 A;  4KXP A;  3HCQ A;  3IFC A;  4GFR A;  1H44 A;  3IB1 A;  4ZEB A;  1MRP A;  5FHN A;  2V84 A;  1LGB C;  2PX1 A;  1I6B A;  3KN7 A;  4PGP A;  1DTZ A;  2XXW A;  1K9Y A;  4H6D A;  3RUM A;  5I56 B;  1B3G A;  4XEQ A;  2H9B A;  2DVC A;  3C36 A;  1HSJ A;  5IZZ A;  4POW A;  1JQF A;  4U1O A;  4ONY A;  4ZEK A;  4C0R A;  3SER A;  4DCX A;  1WVJ A;  4DXC A;  3MQ9 A;  2ZYO A;  4GF8 A;  2Q89 A;  1QUK A;  2DVZ A;  3U65 A;  3PD8 A;  1CE2 A;  4P0I A;  3CFX A;  2WOK A;  5HBC A;  3T9X B;  3V89 B;  5HPQ A;  4GL8 A;  3DP4 A;  3RPW A;  3CG3 A;  4DXB A;  5TP9 B;  2RC7 A;  2OZZ A;  1B3E A;  3K6W A;  4Z0I A;  4QXD A;  4ND9 A;  1INP A;  1OLC A;  3DRJ A;  3CI8 A;  4F19 A;  3O97 A;  5KCJ A;  4MJO A;  5EHM A;  5FBP A;  4HTG A;  1IMB A;  2OK2 A;  4L17 A;  3RT8 A;  4I8C A;  3ONM A;  3S9N C;  2Y84 A;  1NV4 A;  3O28 A;  4MF3 A;  3UK4 A;  1B6H A;  3LC8 A;  3K01 A;  1LBB A;  1LAH E;  2Y7W A;  4PBH A;  5AA3 A;  5K2Y A;  1GR2 A;  5IKB A;  5I2N A;  3H6V A;  2XD3 A;  3WAF A;  2MKZ A;  1B5J A;  2FA7 A;  1OVB A;  2DXY A;  3VDF A;  1LCT A;  1QUI A;  1Y20 A;  3S9E A;  2HHM A;  2XHD A;  5ICQ A;  4RPO A;  3KBR A;  1FPI A;  2Q8J A;  1IIW A;  4QFP A;  1AIV A;  2NOO A;  1P1O A;  3DEL B;  2ALU A;  4ZS9 A;  3O6G A;  5ET5 A;  1B05 A;  3DM0 A;  1XT8 A;  2NXO A;  1JW4 A;  3LUY A;  4ZZA A;  4EQ9 A;  1LFH A;  3A3C A;  3OOA A;  1IME A;  4OET A;  1SQY A;  3OEN A;  3RPL B;  2I4C A;  1QKA A;  5J1D A;  4MNC A;  1LLS A;  4H8J A;  3OSR A;  2F97 A;  3B50 A;  1K9Z A;  4NF8 B;  4U2R A;  1B4Z A;  5ET6 A;  5AA2 B;  2O7I A;  5H8S A;  4MCO A;  4R74 A;  1M5F A;  1B4H A;  2B65 A;  3N6T A;  1B1X A;  4BLA A;  1Y4C A;  4RYA A;  5I3S A;  4GVO A;  1MPD A;  1FTJ A;  4GRK A;  4I1D A;  4YAH X;  5I5P A;  4AB6 A;  4LAT A;  2NUV A;  3N26 A;  4R73 A;  1CNQ A;  4MNP A;  4H1X A;  2OWZ A;  3FAS A;  4WEP A;  3OO8 A;  4GLI A;  1NV5 A;  4OVT A;  1PC3 A;  1B0H A;  1URD A;  3MWB A;  4R9G A;  3PUY E;  3MVZ A;  3PUX E;  1WOD A;  1MDQ A;  4LZ5 A;  5H8H A;  1R9L A;  4PCD A;  1IUD A;  2PT1 A;  1FCK A;  2VT5 A;  3LUZ A;  5B7D A;  2WEF A;  3C4M A;  1GGG A;  2UVI A;  1DMB A;  4QF9 A;  3SDF A;  4QSC A;  5TP9 A;  4TLM B;  1VR5 A;  2X7Q A;  4X1D A;  4ZED A;  4R2F A;  5DVI A;  1MQD A;  3IL1 B;  2QVV A;  4YMA A;  4LUB A;  3KC0 A;  1USY E;  3V5A A;  4UAC A;  3OO7 A;  2A5T A;  3MVW A;  3K02 A;  2AIX A;  1IIT A;  2HCA A;  3K0V A;  1VSO A;  4OFL A;  2F7C A;  2H5Y A;  2XXX A;  3S9L C;  1EU8 A;  3FD3 A;  1M5C A;  3RLF E;  3QMF A;  1WDN A;  4OTE A;  2Y7I A;  2PYY A;  4OVS A;  3K00 A;  2ZZV A;  1AWB A;  3IJO B;  1OQH A;  3UGW A;  1Z7M E;  2ZNU A;  3RTF B;  5AA1 A;  1URS A;  4I9D A;  3H03 A;  4KI0 E;  3R6U A;  4HCY A;  4G77 A;  3LSF B;  1ZU0 A;  4AQ4 A;  2D5W A;  1LBV A;  5I58 A;  1OMP A;  3KN8 A;  3CR9 A;  3HHG A;  4PAF A;  1BIY A;  3L6G A;  1URG A;  4IO2 A;  3LR1 A;  3C34 A;  4XFE A;  3FJG A;  5K2X A;  4JBZ A;  1LBY A;  1QW0 A;  4YKP A;  1FBC A;  1PBP A;  1B2H A;  4TQU Q;  1Q1K A;  2WOP A;  4EXL A;  2PCR A;  3KSJ A;  5I2K B;  4EUO A;  1P1U A;  1AMF A;  1G0H A;  4GBV A;  2Q9T A;  3PMW A;  3B6W A;  1PB8 A;  1KWH A;  4H5F A;  4U4X A;  3DP8 A;  2CEY A;  3OEM A;  4GWO A;  3U72 A;  4KFQ A;  2YPN A;  2Y5K A;  2DOJ A;  3T9H B;  3KEI A;  3C33 A;  4OMB A;  4YKK A;  1EYK A;  4HE2 A;  2ONS A;  3SEW A;  2QRY A;  2REJ A;  4P47 A;  4R2B A;  5AA2 A;  4F2O A;  1LCF A;  3BKI B;  1YZ0 A;  3PMV A;  1NV1 A;  4E0X A;  2P1S A;  1B5I A;  1XI6 A;  2DQV A;  3E4R A;  4F3P A;  4WKM A;  3MP1 A;  1ZIU A;  4H67 A;  4ELQ A;  1UQW A;  5L9M A;  3EHT A;  3H3G A;  4ZDM A;  2XXV A;  3H6U A;  4Q0C A;  5LOM A;  5LTC A;  1XS5 A;  3MZ9 A;  1S7Y A;  4RK2 A;  3G7W A;  2QMW A;  4OVJ A;  3F11 A;  3PPQ A;  4MX6 A;  4RJZ A;  2I58 A;  3HST A;  4DCY A;  2HXR A;  4P3L A;  1IMC A;  3SZP A;  3VLW A;  1I69 A;  3KN3 A;  3PTY A;  3IR1 A;  3KBZ A;  1DSN A;  1FQC A;  1FTM A;  4XIG Q;  1MY3 A;  3OXN A;  3SES A;  3W9W A;  5EQ8 A;  4FEC A;  3P7I A;  4BDL A;  5CMB A;  3KC1 A;  3JZJ A;  4F3S A;  3AXF A;  5EYG A;  1PBQ A;  3TYH A;  4JWX A;  2ZYK A;  3K1M A;  1B7U A;  5EQ9 A;  5H8N B;  2UVJ A;  3FXB A;  2DWJ A;  5FHM A;  2DE4 A;  4N6D A;  2WYK A;  4NED A;  3KJ7 A;  4PTK A;  4GX6 A;  1I6A A;  5T3J A;  3TAJ A;  2BJJ X;  4IO4 A;  3DRH A;  4AS4 A;  1GVC A;  3GZG A;  2UYF A;  2YLN A;  3RN8 A;  2H4I A;  4PDD A;  2H25 A;  1FPK A;  1UTB A;  1FPD A;  3UOR A;  1IXI A;  4N81 A;  2QVU A;  5F24 A;  2CZK A;  3BFU A;  4F22 A;  3RNN A;  2VD2 A;  2XXY A;  2QL3 A;  4HE0 A;  3PUZ E;  3DLN A;  2QSX A;  4RXL A;  2HPG A;  4KD5 A;  1DOT A;  3D4G A;  3VXC A;  3TQW A;  2Q74 A;  3N94 A;  3PU5 A;  2REG A;  2VPO A;  5ELV A;  5I2K A;  5EQA A;  1BLF A;  5KDT B;  4FIM A;  4I3E A;  1NL5 A;  4FEB A;  1B3F A;  4R6H A;  2XXH A;  5H8Q B;  2QPQ A;  4ZEF A;  1Y3N A;  3IK6 B;  3ISP A;  3VVF A;  5EYH A;  1B5H A;  1NUY A;  4PFT A;  4GWY A;  3H6W A;  1YAE A;  3D1R A;  2XWO A;  2GFE A;  4EF2 A;  4JXI A;  1UTH A;  4MAG A;  4P8B A;  2Z23 A;  4GWZ A;  5B70 A;  2I0B A;  4DLD A;  2F7A A;  2HEU A;  3FVO A;  4OAN A;  3OO6 A;  3MZ1 A;  4I62 A;  2ABH A;  2P3N A;  1RDZ A;  1HSE A;  1I6Q A;  3OSQ A;  4F1Y A;  3DRI A;  4N07 A;  4PFR A;  2VOZ A;  1JVX A;  3RGY A;  4GOT A;  1B52 A;  4NF5 B;  3SEV A;  5A5X A;  1NV3 A;  3G3K A;  2YJP A;  2UYE A;  3SKP A;  4FAJ A;  1RYO A;  4OYV A;  4RK9 A;  3PD9 A;  4MLQ A;  5ET7 A;  4GXA A;  2XWK A;  4NF5 A;  4XKP A;  1QJM A;  4ISU A;  5CC2 A;  4C1U A;  2WX9 A;  3MVX A;  1JW5 A;  5L8D A;  1AL3 A;  1LAG E;  2RCB A;  1FPJ A;  3IAZ A;  2DDK A;  3CFL A;  4DZ1 A;  3PMX A;  1DK4 A;  1MXU A;  4YU0 A;  5DEX A;  4F3B A;  4YMB A;  3ROJ A;  3I3V A;  3BIH A;  5ICT A;  2AL4 A;  1FBG A;  1O64 A;  2R9J A;  1Y9U A;  4G61 A;  2XXQ A;  4QFL A; 
#chains in the Genus database with same CATH homology
 1ANF A;  1F9B A;  2R71 A;  4NTL A;  4F31 B;  1B7H A;  2DP8 A;  2ONK E;  2Z8F A;  1MXW A;  2P0S A;  4H1X A;  1M5D A;  2V3T A;  2DE2 A;  3TEL A;  1QVS A;  3RGY A;  3TTR A;  3UA8 A;  3VFJ A;  3FAS A;  4WEP A;  3OO8 A;  4GLI A;  1MXY A;  1S9T A;  3GLB A;  1TFD A;  4G2Z A;  4IO5 A;  1MDP 1;  1R9Q A;  2A5T B;  4KYE A;  1A7L A;  5L9O A;  1PC3 A;  2CZL A;  4OFO A;  1B0H A;  1URD A;  3MWB A;  4R9G A;  3KSX A;  3PUY E;  3MVZ A;  3PUX E;  1WOD A;  2Z8E A;  3DP6 A;  4EXK A;  1OLA A;  1MS7 A;  3PPR A;  1MDQ A;  4LZ5 A;  4U22 A;  1VFE A;  1R9L A;  3OMB A;  5H8H A;  1UIV A;  1IUD A;  2PT1 A;  2DWH A;  1M5E A;  2PVU A;  2XXP A;  1FCK A;  3O9P A;  3ZSF A;  1A99 A;  1N04 A;  1H76 A;  3KJT A;  5B7D A;  3MW0 A;  4JWY A;  3H4Z A;  3IO6 A;  1BP5 A;  3C4M A;  3CIJ A;  4LQ5 A;  1FQD A;  3KG2 A;  4LON B;  1GGG A;  2UVI A;  2F35 A;  5AA4 B;  1DMB A;  5H8F A;  3FXQ A;  4QF9 A;  2XXR A;  2XX8 A;  2Z8D A;  3SDF A;  2F34 A;  2PBW A;  3MAM A;  4IGT A;  4QSC A;  5DVJ A;  5TP9 A;  4TLM B;  4MBP A;  2QS4 A;  2OLB A;  3TFL A;  1VR5 A;  3V83 A;  2QS2 A;  1VFD A;  2ZNT A;  4NF6 A;  3PGF A;  1MY4 A;  1SW2 A;  2X7Q A;  2Y7K A;  4YIC A;  2DSF A;  4X1D A;  2Q2A A;  4ZED A;  4G68 A;  4MH5 A;  3MUQ A;  1TXF A;  3L6H A;  4R2F A;  3RY3 A;  2I48 A;  2Q2C A;  2QJE A;  2DXR A;  3OD7 A;  5CRY A;  2I49 A;  4G68 B;  3U92 A;  3MP6 A;  3QYT A;  3IOT A;  4G4P A;  5DVI A;  3S9M C;  2E1S A;  1MQD A;  1PB9 A;  3IL1 B;  1D4N A;  1H45 A;  3MPL A;  5CMM A;  1B1H A;  2VP1 A;  4YMA A;  2V25 A;  2DWA A;  3TCH A;  2HZK A;  4LUB A;  3HV1 A;  4QRZ A;  4LZ7 A;  1D9Y A;  1USY E;  3V5A A;  3RQT A;  5KDT A;  3TTM A;  4UAC A;  4G8M A;  3T22 A;  3OO7 A;  2I4B A;  5I2N B;  2A5T A;  3MVW A;  3K02 A;  2AIX A;  1IIT A;  1JEU A;  2HCA A;  5CI5 A;  3K0V A;  1QUL A;  4ELQ A;  1VSO A;  1N3W A;  4OFL A;  3R26 A;  1IXC A;  2F7C A;  2H5Y A;  4IO3 A;  1NKX A;  4HW8 A;  2XXX A;  4QFO A;  3QXM A;  3S9L C;  1N7W A;  1EZO A;  1Y4T A;  3FAT A;  1EU8 A;  1P1W A;  3FD3 A;  1M5C A;  3RLF E;  1SYI A;  4NE4 A;  1WDN A;  4OTE A;  2Y7I A;  2PYY A;  1GV8 A;  3TUS A;  4ELR A;  2ESN A;  3FGS A;  3K00 A;  1FTL A;  3MBP A;  4RPN A;  3IJO B;  3KZG A;  1OQH A;  3SET A;  3THI A;  1B7Z A;  4ZZE A;  1Y3Q A;  4ZEC A;  1Z7M E;  2ZNU A;  3I6V A;  1P1N A;  3RTF B;  5I84 A;  5AA1 A;  1AOV A;  1FTO A;  1NH7 A;  1URS A;  4PFW A;  3IOR A;  3UGW A;  1VE4 A;  3QK6 A;  1QUJ A;  1MH4 A;  4YKJ A;  4I9D A;  3H03 A;  3T9V A;  2THI A;  4KI0 E;  3EHU A;  3R6U A;  4F1V A;  3M3K A;  3PPO A;  4YB7 A;  4RNS A;  3DRF A;  1L5T A;  5ITP A;  1YTV A;  3C31 A;  1JEV A;  2F8D A;  3FXR A;  1IXG A;  5HM4 B;  4G77 A;  2ZNS A;  4HCY A;  4DE8 A;  3LSF B;  1ZU0 A;  3TOD A;  3IO4 A;  2DWI A;  4PQJ A;  2D5W A;  1S50 A;  4N13 A;  3VXB A;  4QSE A;  4AQ4 A;  5I58 A;  4OER A;  1NNK A;  1OMP A;  1XC1 A;  3KN8 A;  3CR9 A;  3HHG A;  3M3L A;  4G8H A;  1BIY A;  4LP2 B;  3L6G A;  2HAU A;  2I6E A;  2VGQ A;  3CVG A;  4FOR A;  3QAX A;  1URG A;  2VD3 A;  3G3I A;  4IO2 A;  1MXV A;  4EF1 A;  3LR1 A;  4DDD A;  3C34 A;  4IB2 A;  1OQG A;  5M2V A;  2GRV A;  4FED A;  2XD2 A;  1LFG A;  4EQ7 A;  4F29 A;  3KOS A;  3N6U A;  1US4 A;  3FJG A;  3O29 A;  4OEN A;  4OXV A;  1D3K A;  1DTG A;  5K2X A;  1MM6 A;  3M8U A;  4JBZ A;  5EYF A;  5I59 B;  5F1Q A;  3H06 B;  2O84 X;  1LAX A;  2FNC A;  2RIN A;  1QW0 A;  3MP8 A;  3TQL A;  3LSX A;  4X1B A;  4P11 A;  2NWJ A;  4YKP A;  1FQA A;  1PBP A;  2B3B A;  1OVT A;  4EQB A;  3KFM A;  5TPA B;  4G8N A;  4HS7 A;  1GTK A;  1B2H A;  3G3F A;  4U1Z A;  5AE4 A;  1NNT A;  1SD3 A;  2QS3 A;  3O6P A;  3OEL A;  5L9S A;  4KHZ E;  4TQU Q;  4RY1 A;  1Q1K A;  3CRB A;  2WOP A;  1QKB A;  4YB5 A;  3H6T A;  1T0K A;  1A54 A;  1BKA A;  4IO6 A;  4R75 A;  4EXL A;  3KSJ A;  5I2K B;  3E3K A;  1US5 A;  4EUO A;  1P1U A;  1AMF A;  3JV9 A;  4NF6 B;  1LST A;  1MY1 A;  4AB5 A;  2Q9T A;  3VV5 A;  3PMW A;  5IAI A;  3B6W A;  4LVQ A;  1PB8 A;  1KWH A;  4X9T A;  4IY6 A;  1SBP A;  3VE1 B;  4OEU A;  2DYX A;  3ILT B;  4H5F A;  4U4X A;  3DP8 A;  4FJP A;  3U94 A;  5BWJ A;  3U72 A;  2WKY A;  3OEM A;  1SI0 A;  4GWO A;  4KFQ A;  3TEP A;  4QFN A;  2YPN A;  1AH5 A;  3BBR A;  4R72 A;  2F78 A;  4BDR A;  1SW1 A;  4ELP A;  3OEK A;  3TCG A;  1LB9 A;  4PET A;  4ECF A;  5DT6 A;  1LAF E;  1LBC A;  2DOJ A;  3ZKL A;  1JNF A;  3T9H B;  4BDN A;  4R6K A;  2M8C A;  3ZS6 A;  1USY H;  1MQI A;  3CG1 A;  3KEI A;  4NWC A;  4YKI A;  3C33 A;  5I57 A;  2Q88 A;  1A8E A;  4OMB A;  1FQB A;  3TKD A;  2RCA A;  4IGR A;  4YKK A;  2ONS A;  3ECR A;  2QRY A;  1NFT A;  1SDX A;  2REJ A;  4Q30 B;  3GXA A;  3SEW A;  3VLV A;  1LB8 A;  4R2B A;  1MY0 A;  4F2O A;  5AA2 A;  4G68 C;  1B58 A;  2OWS A;  2O68 A;  4GD5 A;  2WOL A;  1LCF A;  2XX9 A;  3O6H A;  3G3G A;  4IO7 A;  3BKI B;  4NMY A;  2ZMB A;  2P2A A;  1B46 A;  3K2D A;  4JSD A;  1ZMG A;  2X26 A;  3PMV A;  4OWD A;  1B0L A;  3TDJ A;  4R9F A;  4E0X A;  1MPC A;  2P1S A;  1B5I A;  1RKM A;  4NF8 A;  5FTI A;  1MQJ A;  3U1O A;  3IJX B;  1O63 A;  2V93 A;  2AYS A;  2R6G E;  1H3D A;  3JYR A;  3O2A A;  4LZ8 A;  1TT1 A;  2DQV A;  3E4R A;  3VLU A;  4F3P A;  3MVY A;  3EPE A;  3MC2 A;  5TU0 A;  2LAO A;  3D4C A;  4WKM A;  3T96 B;  3MP1 A;  1NNP A;  4NWD A;  2AL5 A;  1ZBM A;  1ZIU A;  4JDF A;  4ESX A;  5JK4 A;  4H67 A;  4OHN A;  3E9X A;  1MH3 A;  3DRK A;  2CMO A;  2B4L A;  1DPP A;  2O1M A;  3FIR A;  3FVN A;  1UQW A;  3EQ1 A;  3FUZ A;  3EHT A;  3K6X A;  4LA9 A;  5L9M A;  3FJM A;  5CMK A;  3H3G A;  3R7X A;  3QIM A;  3T66 A;  1A40 A;  4PFY A;  2IEE A;  4H0W A;  4KPT A;  2F6P A;  2XXV A;  3H6U A;  4ZDM A;  2RF1 A;  1MPB A;  2X7P A;  4Q0C A;  5LOM A;  1XS5 A;  4KQP A;  3QUJ A;  5DEX B;  1S7Y A;  3MZ9 A;  3PAM A;  1FTK A;  1MQH A;  4O3A A;  3FZV A;  3G7W A;  4RK2 A;  3USD A;  1MM7 A;  3K1P A;  2QMW A;  4JWO A;  4OVJ A;  3B6T A;  4R6Y A;  3F11 A;  3PPQ A;  4N6P A;  3B6Q A;  4UA8 A;  3FV1 A;  1CB6 A;  4DIG A;  4RJZ A;  3GBA A;  4KCC A;  4XKR A;  3RYA A;  2I58 A;  4DCY A;  1LFI A;  1EH3 A;  3EHS A;  3HST A;  4IY5 A;  3FJ7 A;  1N0T A;  2UVG A;  3VLW A;  1I69 A;  5AA2 D;  3FTO A;  5FHO A;  4QFK A;  3KN3 A;  3Q27 A;  3HCQ A;  3TTK A;  2HXW A;  3IR1 A;  1DSN A;  1FQC A;  4GFR A;  2D21 A;  5I57 B;  4FE8 A;  1DPE A;  5F7V A;  1FTM A;  1H44 A;  3IB1 A;  1Y3P A;  2ONR A;  4XIG Q;  1MY3 A;  2F5X A;  4KR5 A;  4ZEB A;  1MRP A;  3SEY A;  4OQO A;  3OXN A;  5FHN A;  3KOT A;  3SES A;  5FTH A;  2V84 A;  3W9W A;  2D3I A;  1HSL A;  1B3L A;  2RC8 A;  3CFZ A;  4FEC A;  3P7I A;  4BDL A;  1LGB C;  2GHA A;  4POX A;  5CBR A;  2PX1 A;  4GQO A;  1FW0 A;  1I6B A;  3KN7 A;  2B4M A;  5ISU A;  4OZ9 A;  5CMB A;  2PT2 A;  1DTZ A;  2XXW A;  2Y7P A;  3JZJ A;  4U4S A;  3SEX A;  4F3S A;  3AXF A;  3Q28 A;  1MG1 A;  2PMS A;  3CSG A;  4H6D A;  3RUM A;  2V3U A;  4DXU A;  1PBQ A;  3TYH A;  5A5X B;  4JWX A;  5I56 B;  3T9U A;  2ZYK A;  1B3G A;  2H9B A;  1SI1 A;  2DVC A;  2I3W A;  3K1M A;  3C36 A;  4XKQ A;  3S2V A;  1HSJ A;  2O51 A;  5H8N A;  4FAT A;  1MXZ A;  2GH9 A;  1B7U A;  1YPN A;  3PPP A;  2ZYN A;  3A09 A;  5H8N B;  4POW A;  2UVH A;  2UVJ A;  2I3V A;  1R1N A;  4KYS A;  1JQF A;  1B9J A;  2DWJ A;  3C9H A;  1Y1M A;  1N3X A;  4U1O A;  5FHM A;  2DE4 A;  4ONY A;  3K6V A;  4F3G A;  4ZEK A;  2W7Y A;  3IOU A;  1MXX A;  1XVX A;  2XX7 A;  4NED A;  3FVK A;  5H8Q A;  1JET A;  3SER A;  4DCX A;  1WVJ A;  5EHS A;  4DXC A;  3MQ9 A;  3KJ7 A;  2ZYO A;  4GF8 A;  2Q89 A;  5CMC A;  1QUK A;  2DVZ A;  1PB7 A;  3HO7 A;  1UIU A;  1B40 A;  3PD8 A;  1D9V A;  4M1V A;  4TLL B;  3EF7 A;  1CE2 A;  3FXU A;  4PE5 B;  2OBG A;  1I6A A;  3LBS A;  4P0I A;  3G3H A;  3CFX A;  2ANJ A;  1JW1 A;  3V8X B;  1FQE A;  2WOK A;  4QSD A;  5HBC A;  3T9X B;  3V89 B;  2A5S A;  2DE3 A;  2XXT A;  2BJJ X;  3TAJ A;  3PUV E;  5HPQ A;  4IO4 A;  4GL8 A;  1N84 A;  3K1N A;  2ZYM A;  3DRH A;  4ZEI A;  3RT6 B;  1GVC A;  3DP4 A;  3GZG A;  5K2Y A;  3RPW A;  1XOC A;  3CG3 A;  3BFT A;  4Q5T A;  4DXB A;  3FVG A;  5TP9 B;  1A8F A;  1NNF A;  2RC7 A;  4F1U A;  4THI A;  2OZZ A;  2NVU B;  3W9V A;  4O3C A;  3S4U A;  2UYF A;  4C1T A;  3Q25 A;  4JSO A;  4ESW A;  1UTB B;  2YLN A;  1B3E A;  3K4U A;  3RN8 A;  1Y1Z A;  3K6W A;  5DTB A;  2H4I A;  4MLV A;  1II5 A;  2H25 A;  2XXI A;  3H7M A;  2RKM A;  3QSL A;  1UTB A;  2FYI A;  4MFI A;  4Z0I A;  3UOR A;  3VVD A;  1IXI A;  3PPN A;  4ND9 A;  3UP9 A;  2VHA A;  2F36 A;  1OLC A;  3DRJ A;  4Z7E A;  1ELJ A;  5JTY A;  1SW4 A;  3BFU A;  4F22 A;  2HAV A;  3CI8 A;  4F19 A;  3RNN A;  3RTW B;  1PDA A;  2VD2 A;  4QHQ A;  3O97 A;  4EDP A;  1R6Z A;  4OEV A;  2XXY A;  1OIB A;  5KCJ A;  2QL3 A;  3PUZ E;  3TCF A;  5EHM A;  3CHG A;  3DLN A;  3UIF A;  5JEI A;  1ZJL A;  4HTG A;  1J1N A;  3K6U A;  2OK2 A;  2QSX A;  1IQ7 A;  3KGC A;  4L17 A;  3RT8 A;  4RXL A;  4KD5 A;  2O1L A;  4OES A;  1P99 A;  1IEJ A;  1H43 A;  3FV2 A;  4M4G A;  1DOT A;  3D4G A;  3VXC A;  4O3B A;  4I8C A;  3TQW A;  2O69 A;  3N94 A;  3PU5 A;  2REG A;  3M3F A;  1XHY A;  3ONM A;  3OO9 A;  4NF4 A;  4U23 A;  3S9N C;  2G29 A;  2Y84 A;  3LSW A;  5ELV A;  3O28 A;  3SEU A;  5I2K A;  1BLF A;  4MF3 A;  4NF4 B;  1YCJ A;  3TTN A;  5AA4 A;  5KDT B;  3UK4 A;  5I59 A;  1MY2 A;  4FIM A;  3G3J A;  4RA1 A;  1NL5 A;  1B6H A;  3LC8 A;  2ZXT A;  4FEB A;  1B3F A;  5CM6 A;  4R6H A;  3Q26 A;  1XVY A;  3K01 A;  2XXH A;  3TMG A;  5CBS A;  1M5B A;  2QS1 A;  3A3U A;  3WAE A;  4E0W A;  1LBB A;  1LAH E;  2Y7W A;  5H8Q B;  4BDO A;  2DS9 A;  2QPQ A;  4X48 A;  5AA3 A;  3TPA A;  1GR2 A;  1Y3N A;  2F7B A;  2KLF A;  2O7U A;  3IK6 B;  3IX1 A;  4WXJ A;  4ZEF A;  3VVF A;  5IKB A;  2H99 A;  2V3Q A;  1B5H A;  5I58 B;  3Q29 A;  4ZE9 A;  3O66 A;  5I2N A;  4PFT A;  4F2Q A;  1MQG A;  4PFU A;  3H6V A;  2XD3 A;  3H6W A;  1YAE A;  3WAF A;  3QUF A;  4F18 A;  4Q8R A;  1B5J A;  2GFE A;  3TTL A;  4EF2 A;  2FA7 A;  1UTH A;  4JXI A;  2Z23 A;  1ZLQ A;  1OVB A;  2IA4 A;  5B70 A;  2HQ0 A;  4GXS B;  1NH8 A;  2I0B A;  2DXY A;  2F7A A;  2HEU A;  3TZA A;  4DLD A;  4GIZ A;  3FVO A;  1UTH B;  3VDF A;  1LCT A;  1QUI A;  4C0R A;  5BUU A;  3T93 B;  1Y20 A;  3ZKK A;  2HZL A;  2Z22 A;  3S9E A;  3OO6 A;  1NMU A;  3MZ1 A;  1JVY A;  3U93 A;  3MZB A;  1Q35 A;  2XHD A;  5ICQ A;  3C32 A;  4I62 A;  4RPO A;  2F6G A;  2QMX A;  3DRG A;  2ABH A;  2I0C A;  2O6A A;  3KBR A;  4XTC Q;  1HSE A;  4KCD A;  1I6Q A;  3OSQ A;  4F1Y A;  2Q8J A;  3HPI A;  3DRI A;  4N07 A;  1IIW A;  4QFP A;  5TPA A;  1EZP A;  3W15 C;  2NOO A;  4U21 A;  1AIV A;  1N7X A;  3LVU A;  1P1O A;  2G93 A;  2VOZ A;  1JVX A;  3DEL B;  2ALU A;  2RC9 A;  4GOT A;  1B52 A;  2XXQ A;  4NF5 B;  3O6G A;  4YZZ A;  1B05 A;  4ZS9 A;  3DM0 A;  1XT8 A;  2NXO A;  3SEV A;  5DVF A;  3HHF A;  5ITO A;  2XXU A;  4H5G A;  5A5X A;  1JW4 A;  5I56 A;  3LUY A;  2GHB A;  4F39 A;  4ZZA A;  4EQ9 A;  1O7T A;  1LFH A;  3A3C A;  5JTY B;  3OOA A;  1TFA A;  4OET A;  4BDQ A;  4GL0 A;  1B3H A;  3LSL A;  3RYB A;  1SQY A;  3OEN A;  3CSB A;  2I4C A;  3G3K A;  3GBB A;  1QKA A;  1ZTY A;  1N76 A;  3O6I A;  2YJP A;  4JB7 A;  5J1D A;  2UYE A;  3SKP A;  3UN6 A;  3VVE A;  4FAJ A;  1LLS A;  1PEB A;  4H8J A;  1RYO A;  4OYV A;  3PUW E;  4TOZ A;  3N5L A;  3PD9 A;  4MLQ A;  4RK9 A;  4BDM A;  1SYH A;  3PV0 E;  3OSR A;  2F97 A;  5H8H B;  3ILU B;  3MPK A;  4GXA A;  4NF5 A;  4NF8 B;  4XKP A;  1QJM A;  1B51 A;  3E13 X;  4ISU A;  4U2R A;  3ODB A;  1RYX A;  3IB2 A;  4P0G A;  5DYH A;  1SVX B;  5CC2 A;  4C1U A;  1ATG A;  2Y7R A;  4H65 A;  1B4Z A;  3MVX A;  2H98 A;  2OWT A;  1A55 A;  1POY 1;  5AA2 B;  3IB0 A;  2B3F A;  2O7I A;  4LQ2 A;  5H8S A;  1JW5 A;  5KZT A;  2UXA A;  1B32 A;  4PP0 A;  5L8D A;  1AL3 A;  1LAG E;  2RCB A;  1IXH A;  1ZKB A;  5H8F B;  1SW5 A;  3U8Q A;  3MJN A;  1FQF A;  3B7D A;  4ELO A;  4H8I A;  4R74 A;  3IAZ A;  3IOW A;  4K3F A;  1M5F A;  1B4H A;  1EZ9 A;  2B65 A;  2OCU A;  3CFL A;  3N6T A;  4KYD A;  1B1X A;  1TWY A;  4BLA A;  4DZ1 A;  1Y4C A;  4XKN A;  3PMX A;  1IZ1 A;  4ZE8 A;  1MXU A;  4YU0 A;  5DEX A;  1P1Q A;  3HN0 A;  4F3B A;  1BTJ A;  4RYA A;  4YMB A;  1POT A;  3I3V A;  2HFB A;  4XXU A;  3I5O A;  5KCJ B;  5ICT A;  3C35 A;  2AL4 A;  4GVO A;  1MPD A;  1FTJ A;  1O64 A;  2E0S A;  4GRK A;  4I1D A;  3IOV A;  3EN3 A;  1Z7N E;  4YB6 A;  4YAH X;  2R9J A;  1Y9U A;  4AB6 A;  4OFJ A;  4WED A;  2OJT A;  4HCW A;  4LAT A;  2NUV A;  3N26 A;  4QFL A;  4R73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...