4GLAC

Obody nl8 bound to hen egg-white lysozyme
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
89
Chain Sequence
LHGTEVVVAGWVASLGDYGRVKIVKVSDRGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
total genus 14
structure length 89
sequence length 90
chains with identical sequence D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glaC00
4IFDJ 5JEAJ 1UE5A 4BBSG 1E3PA 1YHBA 5M3FG 3J80c 3HKZG 3HOUH 1Y1VH 2Q2IA 2R6GA 3H0GH 1VQIA 5FJ8H 5C4JH 4RMFA 3E0EA 1P16A 1I6HH 1HR0Q 2ATWA 4DR3L 1CKOA 4H02A 4DUYL 2NVTH 4LUZA 3I4NH 4R4IA 1D7QA 4JI6L 3GTQH 4PMWA 2ZTDA 1YEZA 1BKBA 4OWTB 1IXRA 4O0AA 2GVAA 1B70B 3HOXH 3UE0A 3HOZH 3CD6A 3IRBA 5IP7G 1NMFA 4LFCQ 3JAMc 4DKAC 2Y0SG 2CKZB 3S17H 3T1YL 1C9OA 3HFZB 1R9TH 1Q1EA 2AWNA 4X64L 4P74A 4XIGS 1I5FA 1LYLA 3HKZE 4KLKA 1LUZA 4K0KQ 1VQ8A 5GQOA 4DUZL 1BVSA 3MEFA 3BZCA 4X6AH 5JJLA 4A3EG 1X55A 1N33L 4JI8Q 1PH3A 1VQHA 1N32L 1VQPA 1FL0A 1UEBA 2B29A 1UE6A 1I3QH 2F4VQ 4JG2A 1K73C 3CPFA 2RCNA 4APVA 3F2CA 4A3MG 3KDFA 1X3GA 3M7NA 4BBRG 3GD7A 4HIOA 2JQOA 2KCTA 4R4CA 2PI2E 5FLMG 4HJ7A 1HNXQ 3CC2A 2B3GA 3F1ZA 1VQKA 5IP9G 4BY7H 2UXCL 4BA1I 5M5XH 1EIYB 3A5UA 4DV6L 4POFA 3UDGA 3ICEA 1IZ6A 1P8LA 4YCVA 4HJ9A 2OQKA 3JC66 3I56A 1E1TA 4QGUA 4PG3A 4JYAL 1JJGA 4X65L 3CCRA 2YU9H 3HOWH 4LF9L 4WJ4A 2CFMA 4R1JA 1T9HA 4LFAQ 3CCLA 2N3SA 1X3EA 2E8GA 2VY3A 1CSQA 3CXCA 4HIMA 3RNUA 1D8LA 1JE5A 2K75A 5C3EH 1L1OB 1I94Q 3S2HH 1S3OA 4A3IH 4B3SL 2AWOA 1M90C 3NENA 4A3GG 3CAMA 3GTJH 1IBML 4NXNL 1E7ZA 1EOVA 2Z6KA 4AQYL 1QZHA 2KHIA 2JA6H 4RG1A 4EQ5A 4LF4L 1I50H 1EQRA 2MFIA 4JI4Q 4GLXA 3H15A 1VQAA 4JCVE 3KLWA 1XMQL 4DV5Q 4B3MQ 4GKJQ 4QIWE 2VS1A 1UE7A 4DR5L 1YITA 2IX0A 2GN5A 5IYBG 4AIMA 4LFBL 5M3FH 4X62Q 1OXXK 1SN8A 2VNUD 4ALPA 4GNXA 2CQOA 1EFWA 3F2DA 1N36L 4C3HH 1K3RA 4AYBG 5C4XG 3M4OH 4JI0Q 4KI0A 2XGTA 3A5ZB 4QJFA 4DR6L 1AH9A 1VQ4A 2YV5A 4C2MH 3M3YH 4P75A 2K50A 2OTLA 3CCJA 2I5LX 4QL5A 4DV4L 4LF7L 4A3KG 5GAHC 3CW2C 4DR2Q 2VQEQ 3RZDH 5IP7H 1L0WA 2E5LL 3CCUA 4DV0Q 1Q86C 4GOPB 1PFSA 1PH8A 1YI2A 1OXVA 2PNHA 1C0AA 2R7ZG 4DR4L 4KHZA 3BZKA 1IBLL 2KCMA 4OWXB 1VQNA 1V9PA 3PO3G 2V1CC 4OONA 2UXDL 2FXQA 4OWWB 1WYDA 1KAWA 4KHPQ 4AYBE 5EAYA 4A3EH 4IPHA 4TQUS 3KFUA 3PUVA 4BA2I 1CSPA 3UE1A 4HJAA 2OCEA 3CF5A 2JA6G 4IFDG 1J5EQ 4A3MH 2UUCL 2UXBQ 1NMGA 4BBRH 5FLMH 1HH2P 2HIVA 4IO9A 5IY0A 3L7ZC 3K81C 3WWVA 2QA4A 1JT8A 5IP9H 3TQYA 2PMZE 3RLNA 3T1HQ 1XPRA 4GKKL 4QQBX 2OTJA 1WI5A 3NBHB 1SE8A 5HY6A 1PH9A 5LMNQ 4IJLA 2ZTEA 3ER0A 2UU9Q 3STBC 4QY7A 4P72A 5C44G 1PH1A 1XJVA 4DV3Q 4DV7Q 2IT1A 4NXMQ 1XPUA 4OO1G 1MJEA 1BBUA 2UUBQ 4AH6A 3S14H 4IJHA 2H5XA 4JI2Q 4B3TQ 3S1QH 5IYDG 2IHEA 1XNRQ 3GTOH 1QVCA 1MIUA 4DAMA 3HOVG 1YJ9A 4A3LG 1PV4A 1VQFA 3AYHB 4LF8Q 3CMEA 1KQSA 1VQLA 4A3GH 2AHOB 2DUDA 1GM5A 2F4VL 2D0PA 3S24A 3SGIA 2QGQA 1WOCA 1TWAH 2NVYH 5J3BA 4DV1Q 3S2DH 1EIFA 3CC4A 4Y7NH 4LF6L 5ELNA 4OXPA 5GADC 3CCSA 3FKIG 1Q1BA 1A0IA 2R93G 1TWHH 3S1MH 1X54A 1L1OA 1NTGA 3G48A 1M1KC 1OXSC 4JI3Q 1X6OA 2CWPA 2BH2A 4IPDA 2HQLA 4JBKA 4LF5Q 5IYBH 3LGJA 3I55A 4DR1Q 3G4SA 2E2IH 3KOJA 4YHHL 4IFDI 3K7UC 2Z6KC 1AE2A 3D0FA 2MO0A 3U50C 5JJIA 1KL9A 1QUQB 2VW9A 2MO1A 2N49A 1LTLA 5C4XH 1Q46A 4JBMA 2UUAQ 3NEMA 1FJGL 1HZBA 4YWLA 1RIPA 2F52A 1VQ6A 3CP0A 1XTDA 1XMOL 1G6PA 4IOAA 4YWKA 3CQZH 2L15A 5HGQA 4GN4B 1K9MC 4JI5Q 2Q2HA 1XNQQ 3VDYA 4GKJL 2YTXA 3AQQA 4DUYQ 4A3KH 4DNIA 1JMCA 4B3RL 5BR8Q 1W2BA 4JI6Q 3TRZA 3BU2A 1GKHA 3K80C 1VQGA 1CUKA 4IPGA 4GNXC 2JA7G 5AJ3Q 4PZ7A 3OTOQ 4P71A 4JI7L 1PA6A 2HT1A 1GD7A 1E24A 2R7ZH 4BY1G 3E9HA 1PH7A 3GTMH 4YCWA 4YY3Q 2K5VA 4PZ8A 4JBWA 3PO3H 3DM3A 2NZHA 5M5WH 2WB1E 4DV5L 3AFPA 5GAEC 2OQ0A 3W5OA 5IWAL 4C3IH 1N8RC 4X64Q 3L2PA 2WP8J 3G71A 4X62L 2D62A 3BJUA 3PIOA 1Y1WG 1EUJA 3A74A 1GO3E 3PUWA 4DUZQ 2YYZA 4X66L 4GOPA 2I0QA 2Q2UA 2K4KA 1OXUA 2EXDA 2E2HH 1N33Q 2K5HA 4JI0L 2KENA 4L5QA 1KHIA 1V1QA 3CMAA 3PO2G 3K7AH 1UE1A 1JJCB 1A62A 4GS3A 1E22A 2C35B 1Y14B 3S1NH 3I4OA 5JJKA 2HIXA 2VQEL 1VS0A 2EQSA 1OTCA 1C7YA 4A4IA 3PCOB 5C44H 3F2BA 1FGUA 1PYSB 1N34L 2ZM6Q 1HNWL 2D0OA 4DV6Q 2A1AA 1YVCA 1HZCA 5IYCG 1VQBA 3CCQA 4Y52H 2JA8G 4JYAQ 5IYDH 2Z0SA 4X65Q 1VQMA 3HOVH 2R7DA 4LF9Q 4GLVB 1HJPA 1TXYA 4JI1L 5C0XJ 3CCMA 4KHPL 4A3LH 1K83H 2ASBA 2AMCB 2VQFL 4BXXG 1X3FA 2YTYA 2JE6I 3J81i 4JV5L 3M85A 3KF6B 2N8NA 4LW1A 3RLOA 2JA9A 1TWGH 4B3SQ 3RZOH 3TS0A 2UXBL 3FKIH 2BH8A 1IBKQ 1IBMQ 4AQYQ 1U5KA 2R93H 1QZGA 4OX9L 1ASYA 1VQ5A 2GVBA 1WJJA 2MQHA 4JC0A 2RHSB 4O2DA 4DV2Q 4LF4Q 3GTKH 3S16H 4FDBA 5LMNL 2XTIA 4HIDA 3J80i 3PUYA 4DV3L 3F8TA 5JEAG 2WFWA 4DR5Q 3PIPA 3PUXA 3EIVA 4POGA 1KXLA 2VUMG 2EIFA 5LMUQ 4JI2L 1MKHA 4EX5A 1HR0L 4B3TL 4LFBQ 4LNQA 1S40A 4GN5A 2CCZA 2BA0A 3S1RH 3CC7A 1L1OC 1RL2A 4A93G 1PHJA 2VL6A 3HKSA 4YWMA 4A3DG 1Q81C 2LXKA 3ULJA 1A63A 3RN5A 4DR6Q 2AKWB 4C3JH 4GN3B 1PH5A 4LFCL 4JOIA 4TVAB 3JAMi 5FLXc 2JA7H 1NBWA 4DV1L 1QUQA 4DV4Q 1HNZQ 1VCIA 2R7FA 4LF7Q 3I4MG 1FVIA 1N9WA 5M5YH 4BY1H 4MTNA 4UPAA 3U4ZA 4K0KL 2E5LQ 2RHQB 3GDEA 3UDIA 1HR0W 2NVXH 3ZJYC 1DGSA 3KJOA 5ELOA 4JI8L 4DK3C 4DR1L 1IBLQ 1V43A 2LXJA 1Y1WH 1QVGA 4R4QA 2WAQE 2K52A 4LWCA 2UXDQ 2ZTCA 4A3CG 1HZ9A 4HIKA 4DR7Q 1HNXL 2UUAL 3MXNB 4HJ8A 1HZAA 4A3JG 1EWIA 1X65A 3PO2H 3K8AA 1VQ7A 2F3IA 3TEHB 5IE8A 3OW2A 1XNQL 1YHQA 2UUCQ 4A3BG 4JI5L 4R4OA 4PZ6A 3J7A5 1CKNB 4GLAC 3I2ZA 5BR8L 2ID0A 4L5SA 2JA5G 2CWAA 2HHHQ 1VQDA 4GKKQ 2WB1G 5AJ3L 3OTOL 1CKMA 3PGZA 3RN2A 1XPOA 4GOPC 5IYCH 1MJCA 4LFAL 2JA8H 4YY3L 1EYGA 3PUZA 1I94L 3Q8DA 4A76A 3G6EA 1Z47A 4A3FG 4DR3Q 3M9BA 2B63G 4BXXH 1QVFA 2R92G 3S15H 1SFOH 1KD1C 2NN6I 2E2JH 1WCMG 5E7NA 4JI4L 4IOCA 3NELA 3STBD 3H3VI 2PQAA 2RF4A 5M3MG 2JK8A 5H1SE 2IY5B 2MNAA 3U58A 1TWFH 3FP9A 1K0RA 4B3ML 3T1YQ 4LF6Q 2Q2TA 2K5NA 1K8AC 4UY8C 1Q8KA 2QEXA 2NVQH 3AEVA 3FHWA 3HOYG 2ALYB 2ZJQA 2I5HA 1YJWA 2PI2A 3E9IA 5IT9c 2Y0SE 2ZM6L 1PH2A 4ME3A 2IX1A 1JJ2A 1SLJA 3KF6A 1B7YB 1UWVA 1IYJB 4MNOA 4IPCA 2KHJA 4LUVA 3B6YA 2KBNA 4DK6C 1VQEA 2JJQA 1Q82C 2VUMH 4MZ9A 3GTLH 3HOUG 1Y1VG 2YTVA 4L5TA 4DAYB 3H0GG 4YHHQ 1PYBA 2ZJRA 1N32Q 5FJ8G 1S72A 1KIXA 5K36G 2K14A 1SMXA 2BA1A 4NPSA 3KYHC 1K8GA 4A93H 4A3DH 1YBYA 1FJGQ 4L5RC 1OXTA 3PSIA 3CCEA 4DR2L 3I4NG 3U4VA 3A0JA 1L2FA 1W3SA 5C0XG 3J7ZC 3CCVA 1XMOQ 2UXCQ 1NY4A 4DV0L 3PV0A 5DLQE 3HOXG 3J81j 3HOZG 4JBJA 1IBKL 3I4MH 4B3RQ 2VZAA 1TWCH 3ULPA 4J15A 2PQAB 3H3VH 4LUOA 1YNXA 4P73A 1LM0A 4DV2L 1EQQA 2ES2A 4JI7Q 3GO5A 3KDFB 1BBWA 3RLFA 3TS2A 2N78A 1KRSA 1KC8C 1PVOA 2A19A 1B8AA 3M4PA 1J6QA 1J5EL 4JOIC 5IWAQ 3KF8B 4UP7A 4A3CH 5LMUL 4BBSH 1YJNA 1G291 3W1BA 4NXNQ 3UDFA 1ASZA 4A3JH 5GROA 1G51A 4OO1I 4X66Q 3KJPA 2OWOA 3T1HL 1VQ9A 2DGYA 1X56A 2ZJPA 3K0XA 4A3BH 1KRTA 1O7IA 1E1OA 4R4TA 3PF5A 2LSSA 1X9NA 3GTGH 4XTCS 2UU9L 2JA5H 4BY7G 1PH4A 4DV7L 4NXML 3L0OA 1XMQQ 4UP8A 2JEBI 1YHAA 3ULLA 1HNZL 3ERSX 2UUBL 1SRUA 3UDXA 1SR3A 4A75A 3CPWA 1VQOA 1SROA 1YIJA 1JB7A 1PH6A 1XNRL 2WAQG 1N34Q 1HNWQ 1N36Q 3HOWG 3PF4A 1NJIC 1Q12A 1YZ6A 1CKNA 1WFQA 3RR5A 3DLLA 1A8VA 3EN2A 2IHFA 4A3FH 4LF8L 2B63H 3AFQA 5C3EG 5C0XI 4YCUA 4HJ5A 3W1GA 2R92H 5LMNW 4A3IG 2NN6G 4JI1Q 1IL2A 5GAGC 4DR7L 3M4QA 2A8VA 1VQJA 1WCMH 2VQFQ 1Q7YC 2JEAI 4GNXB 3J81c 4WJ3M 1Z9FA 5M3MH 4JV5Q 1U0LA 3D31A 4NB3A 1VQCA 3TREA 4JI3L 3I7FA 3EBEA 4DPGA 2NZOA 4UP9A 4DR4Q 4LF5L 2I5MX 1NE3A 3OYYA 1H95A 3HOYH 2HHHL 4OX9Q 1AE3A 1GVPA 3GTPH
chains in the Genus database with same CATH superfamily
4IFDJ 5M3FG 1TY2A 4KKTA 4ME5A 4WJWA 1Y1VH 5EJWA 1Y1VB 5C4JH 1JWMD 4DFAA 2RCFA 5C4JB 5JVG3 5CBAE 4LUZA 4FF3A 5I2YA 4HN7A 1QNUA 3D4RA 5ELCA 5C0XH 3TN2A 1VMCA 1G91A 5IP7G 1NMFA 5KEEA 2Y0SG 2AUJD 2F0EA 2A6HC 1Q1EA 4X64L 3KLSX 4P74A 3HKZE 4KLKA 1LUZA 1F77A 1SMYD 5GQOA 3MEFA 3BZCA 4XYOA 1SFOB 2HD3A 2A69D 4PMCA 5CV8A 1N32L 1SNDA 1VQPA 1CFMA 1ESFA 1UE6A 1I3QH 4LK1C 3CPFA 1I3QB 1X3GA 3M7NA 1HNXQ 1G6ZA 2KCTA 4R4CA 5FLMG 2XRQD 2B3GA 4OHJA 2LKVA 5E4WC 5JPMC 4POFA 2F0HA 4YCVA 5DNFA 2OQKA 3I56A 1E1TA 2VUMB 2M9VA 4LF9L 3DUZA 4R1JA 1T9HA 3G7LA 1HQRD 3CCLA 1Z6HA 5J22A 1CSQA 1JC7A 1D8LA 4XQJA 1NUCA 1QB5D 2QILA 4A93B 1IW7D 1WD0A 1EY8A 2V4DA 4B3SL 1M90C 3NENA 3CAMA 4ZKCB 3SHLA 4ZK9B 3H91A 3E5SA 1SYDA 1ML0D 5CV6A 3M7GA 1STBA 1ZYRC 1VQAA 1D5ZC 4RH6A 4DA2A 2F0JA 4QIWE 1FR3A 3OOCA 3K6OA 1RJTA 4LFBL 1OXXK 2CQOA 1EFWA 3EQLC 1N36L 4C3HH 4ZCKA 1CQFA 4KI0A 1MSHA 1WVLA 3VR5A 4I65A 2OTLA 2I5LX 3U9SA 1J9OA 4A3KG 5GAHC 4OGQC 4U68A 1Q86C 1A2TA 5CV9A 1SYBA 1LT5D 2R7ZG 3BZKA 2B8FA 4OWXB 3V96A 2UXDL 3VYSA 4AYBE 4R8NA 1GJXA 2ZT9C 3SK8A 4IFDG 4E6IA 5EGTA 4OO1H 2L11A 3E3XA 4BBRH 1HH2P 2TMPA 2G9DA 3L7ZC 4BBRB 3CRKC 1HPCA 4GKKL 3CU7A 2OTJA 2ICEC 3KLSA 3NBHB 3MWYW 3STBC 4QY7A 5C6AA 1PH1A 1XJVA 4DV3Q 1MJEA 2K05A 4EQPA 3S14H 2D5DA 1CHPD 4TRDA 3HOVG 1QCBD 2F0TA 4DN4M 2HQEA 3LNNA 1PV4A 4RWSC 2H4OA 3HOZB 3SE0A 2QGQA 2SDFA 4DV1Q 2EZVA 2R3ZA 4OXPA 3CCSA 1SEBD 1Q1BA 4KY7A 4DK0A 3ND9A 1ONLA 4DR1Q 1X3QA 3KBGA 4IFDI 1K0SA 2Z6KC 1LT6D 1XWEA 4IURA 3U50C 1KL9A 2VW9A 2NTTA 4DK1A 2K28A 4JBMA 1FJGL 2F52A 3ZYYX 3CP0A 1XTDA 2FJ2A 2ZXOA 1ZEQX 3BYTB 4CDDC 2L15A 1XNQQ 4GN4B 4BY7B 2CW0D 3VDYA 4DUYQ 1EQVA 5BR8Q 4JI6Q 1WTHA 3BU2A 1GKHA 4IPGA 1PXUA 2JA7G 4Q5VA 1D5XC 1GD7A 5CBEE 4BY1G 3E9HA 1Q3LA 3MHBA 1PH7A 4FYDA 5M5WH 5GAEC 1LT3D 2OQ0A 5M5WB 1PFMA 1N8RC 2WP8J 3G71A 1Y1WG 1GOZA 1EUJA 3A74A 4X66L 2I0QA 1T5XD 2K4KA 1OXUA 2E2HH 5BN5A 1V1QA 5IIFA 3CMAA 1LABA 2C35B 5JJKA 1EIHA 1VS0A 1C7YA 2H1EA 4DV6Q 3W3AA 1EU4A 1JB3A 2L9HA 2KA7A 1LO5D 2F0NA 2AQ2B 2Z0SA 3RMHA 4X3SA 1FNVA 3M4YA 1SJED 5L37A 4C2MB 3BYYB 1PYWD 4BXXG 3VR4A 4IZ8A 1VMPA 3RZDB 3RZOH 3OMGA 4OX9L 4BWGB 2RHSB 4OELB 1EY7A 4FDBA 5CV4A 4DV3L 2PCFB 2Z4IA 5DM63 2B2WA 3UI2A 2IX3A 1MKHA 1HR0L 3I4LA 1AW7A 3DEOA 2PO4A 3H94A 4KK7A 1SMYC 4RKBA 4FXGC 5EPKA 3EJIA 5C5LA 2CCZA 1L1OC 1RL2A 3URYA 2A69C 5EKKA 4C3JH 1GXDC 3MVVA 2EOTA 2IWHA 5FLXc 4DV1L 4DV4Q 5C5MA 3LWUA 1BR9A 2RSOA 5M5YH 2B2YA 4MTNA 4K0KL 1S5ED 1HTLD 2RHQB 3GDEA 1HR0W 3OWFA 1DGSA 3KJOA 5ELOA 4JI8L 4DK3C 4DR1L 1AFPA 2LXJA 3EFXD 4R4QA 2K52A 2DJFC 1FGBD 4WFN3 1NR4A 3QG1A 2SEBD 3K8AA 3TEHB 1IW7C 5ELBA 3OW2A 1YHQA 2UUCQ 1XNQL 1RTNA 3J7A5 4PZ6A 3W2DA 1FNUA 3I2ZA 5BR8L 1EQTA 3R2TA 5JVH3 2WB1G 1CKMA 4PV1C 1XPOA 1MJCA 4LFAL 2JA8H 2EVBA 4I7AA 4A3FG 3A55A 4ODGA 1QVFA 3S15H 2PMZB 5E7NA 1IYUA 4IOCA 3P7JA 5M3MG 2IY5B 1D1IA 4GKJL 3PO3B 3AEVA 3HOYG 1LT4D 2HCCA 2I5HA 2ICIA 2PI2A 5IT9c 1BQQT 3WOEA 2IX1A 5JEAH 3KF6A 4MNOA 4DGZA 3B6YA 3GTLH 3NPPA 3HOUG 1RCVD 3H0GG 1PYBA 3CKIB 1KIXA 3Q23A 2RKSA 2BA1A 1CTMA 3K7AB 4CKCA 1K8GA 2A6HD 1D5MC 1QJOA 4A3DH 4DNTB 4DR2L 3QR8A 3T53B 1BNZA 3J7ZC 2EYPA 3C1EA 2UXCQ 3GV3A 4NDXA 1DXMA 3J81j 2LMCB 3I4MH 4B3RQ 3A7AB 3I3CA 2F0WA 4FXKC 4IUQA 3I4MB 3H3VH 2D2CC 2OXPA 3NQIA 1WD1A 2NZ1D 1B8AA 3G6JB 3SDZA 3E6ZX 5IWAQ 3NQTA 4TSSA 1ASZA 1F9PA 2LY7A 2OWOA 1LACA 1ET6A 3PF5A 3GTGH 4KD3A 5DAUA 1J8IA 2ZXPA 2JA5H 3GTGB 4DV7L 4NXML 2JEBI 3ULLA 2DNCA 1SRUA 4A75A 3KLRA 1PH6A 3OIPA 5D14A 3OSOA 1NJIC 3OMCA 3T16A 4OL7A 1A8VA 1ZYRD 2IHFA 2B63H 1EYCA 2R92H 2B63B 1TS2A 2R92B 1CA5A 1B1ZA 4JI1Q 5GAGC 4I7ZC 1SNPA 2VQFQ 1HTPA 1CZWA 4WJ3M 4JV5Q 1CI3M 2OEOA 4NB3A 1B3AA 4IUUA 4WRDA 1VQCA 4DPGA 2CW0C 4DR4Q 3OYYA 5LL6S 1QNKA 5D3DA 4CKBA 1V1PA 4XYQA 1YHBA 1B50A 1DJRD 3HKZG 4ZAIA 2CH4A 2Q2IA 2R6GA 2K1BA 5E3FA 5K36H 1HHVA 1VQIA 4RMFA 1H9RA 2Z1CA 2E74C 1YEZA 1BKBA 3DM1A 1IXRA 2F0FA 3ND8A 3HOXH 3UE0A 4DAYA 3HOXB 4LFCQ 2EJMA 3ERQA 2CKZB 3S17H 1WTRA 3HFZB 3FPUB 2AWNA 4XIGS 1I5FA 1LYLA 4C56C 5EQ0A 4DUZL 3J81L 3IKJA 5JJLA 3QIAA 1N33L 1PH3A 2B29A 1UEBA 1U4LA 1K28A 4JG2A 4A3MG 4RGOS 3KDFA 3GD7A 1IL8A 3DHQA 3QO2A 4HAEA 5FO7B 1SNMA 2EXZA 3A8KE 3U9OA 2UXCL 3SK6A 3UDGA 3ICEA 1P8LA 3KF8A 4KN4C 1BOSA 2EYFA 2K32A 5KNCA 4PG3A 4JYAL 3A54A 1DOMA 1KDBA 3NE5B 3HOWH 2WAQB 1E2VA 4IUNA 4FF1A 4WJ4A 2F3WA 3HOWB 4XT1B 2N3SA 4YIJA 5ISRA 3CXCA 1JE5A 5C3EH 1I94Q 3S2HH 5C3EB 2BCOA 1PZID 1S3OA 2NN6H 4A3IH 2AWOA 4A3GG 1HRJA 1IBML 1R4PB 4G7OC 2Z6KA 4AQYL 2KHIA 2L5TA 1H9SA 5EBCA 1E2ZA 4M8AA 3SVMA 3MFYA 1A3UA 3MXGA 3D8GA 1D2BA 3KLWA 1A15A 1YITA 3CHBD 5IYBG 1PRTB 4DNRB 5M3FH 4X62Q 5M3FB 3EROA 3F2DA 1K3RA 4AYBG 5C4XG 2L1BA 3M4OH 4HTHA 3M4OB 3TDQA 4J6HA 5ELDA 3MXUA 4LF7L 5KGUA 2F0KA 5C3WA 1SNOA 1DD2A 5IP7H 1L0WA 5DEHA 3CCUA 4DV0Q 1U4PA 1JORA 2Y0SB 2PNHA 4MN3A 5TSSA 4DR4L 1IBLL 2B39A 1AZPA 1KABA 2FXQA 4OWWB 4NW2A 4XQQA 4K5WA 1KAWA 4C3IG 4TQUS 3T13A 4C1NI 3PUVA 2K5WA 1GUSA 3SEBA 5FLMH 2HIVA 5G3LF 5IGEA 1JE4A 2PMZE 3T1HQ 1XPRA 3C46A 1A2UA 2EY2A 5LMNQ 4IJLA 5EPLA 5C44G 1MBYA 1X32A 2PYKA 4Z9CB 1NR2A 3T4AC 1BBUA 1F9QA 2N88A 3MXPA 2H5XA 4JI2Q 2F0MA 2MGSA 5IYDG 3GTOH 2HCIA 1MIUA 3TBIB 3GTOB 4A3LG 2KQ3A 1SSOA 3LWEA 2R61A 2AHOB 2DUDA 1GM5A 1TWAH 1JR0D 2KCNA 1TWAB 1PZJD 5GADC 3FKIG 5K5PA 2R93G 1TWHH 3S1MH 3K5OA 1X54A 1L1OA 1TWHB 1NTGA 5BN3A 3S1MB 1M1KC 4JI3Q 1X6OA 3LGJA 2EJGC 2EYLA 3G4SA 2E2IH 3Q6SA 3KOJA 2MO0A 2N49A 2F4IA 1WTOA 2UUAQ 2K5DA 2QDBA 3J7AV 2IW3A 1XMOL 3TP7A 2RDFA 4NMZA 5HURA 3AQQA 4A3KH 1JMCA 4RA8A 4A3KB 4PZ7A 1PA6A 1E24A 2R7ZH 2LS01 3GTMH 2R7ZB 4X3UA 4JBWA 3GTMB 2NZHA 2EJFC 4JVZA 4X62L 3BJUA 1LLRD 4IFDH 1K8OA 5CV7A 2YYZA 3FEWX 4L5QA 1KHIA 3Q24A 1HQMC 2B2VC 4GS3A 3I4OA 3PMFA 2L55A 2DY8A 5JAVA 1N34L 1A3TA 2FHTA 4CJ0B 1HZCA 5IYCG 3K5LA 4C3HB 4Y52H 4ABNA 3TSSA 4X65Q 4FF2A 1RODA 3HOVH 4CJ2C 5COYA 1LTID 3HOVB 3NTHA 3BDCA 2BE5D 1DM0B 3E0JA 1QOHA 2YTYA 2JE6I 4ZUJA 5NUCA 5M9OA 3M85A 3KF6B 1O7LA 2F1MA 3NP8A 3TS0A 1IBKQ 2BH8A 1C8CA 1U5KA 1UEAB 4J1MA 1QZGA 3SXHA 1WJJA 2MQHA 4JC0A 2A68D 4O2DA 4LF4Q 1EEID 3GTKH 3S16H 5LMNL 1F9SA 3S16B 1A6XA 4DR5Q 3PUXA 4POGA 2VUMG 2PPBC 4JI2L 2K7VA 3A7LA 4LNQA 1STHA 1S40A 1G2TA 1GHKA 3CC7A 3PIO3 1Z7TA 4A93G 5IODA 1PHJA 3HKSA 4R8IA 1ET9A 3ULJA 1A63A 4DR6Q 2AKWB 1PH5A 4TVAB 5HGTA 2DNEA 1KTKA 1NBWA 2JA7H 1UNSA 1QUQA 2F0OA 1VCIA 2R7FA 1GUOA 1N9WA 4BY1H 4UPAA 3U4ZA 2E5LQ 3D4DA 3S14B 4BY1B 3T56B 4S3SA 3QB3A 1MI2A 1ICFB 1V43A 1QVGA 1II3A 4IALA 1Y1WH 2WAQE 1BDOA 4LWCA 3NK9A 2B2UC 5KYLA 1HNXL 2UUAL 4HJ8A 4K5XA 4K5VA 1HZAA 4ZUIA 1X65A 5IE8A 1IKMA 2E75C 2K03A 4UDUC 2ID0A 2HHHQ 2EY5A 3PGZA 1S5DD 4GOPC 1SE2A 1EY4A 5DM73 1SAPA 3Q8DA 3DWPA 4DR3Q 1LTSD 3BDLA 3PIP3 4BXXH 3NTKA 1KD1C 1PTOF 1B2TA 4JPBW 3HGBA 2PQAA 2RF4A 2JK8A 2XWBB 2MNAA 5FO8B 2F0GA 1TWFH 2MP1A 3FP9A 3U58A 4LF6Q 4FVMA 1Q8IA 2K5NA 2QEXA 1TWFB 1HFNA 5KNBA 1PMRA 3VR3A 1YJWA 2Y0SE 1PH2A 1PTOD 3A8IE 4ME3A 2Z8LA 1JJ2A 2SOBA 4DK6C 4IPCA 4PMBA 3NUCA 5JOBA 2F0LA 2YTVA 1DOLA 1HFGA 4DAYB 4YHHQ 2E2HB 2ZJRA 3NWTA 5FJ8G 2XWJB 1BCPF 4NPSA 3I4NG 3PSIA 3CCEA 1W3SA 4IN3A 2DY7A 3HOZG 1CM9A 1IBKL 4DXFA 1I4XA 4LUOA 4P73A 1K3BC 2ES2A 3DEPA 4JI7Q 3KDFB 2N78A 1EOTA 1KRSA 1GUGA 3I70A 1KC8C 2WACA 1HA5A 4P2CB 4JOIC 5J39A 3KF8B 3KK7A 2CQAA 4BBSH 1TU2B 2Q8IB 3W1BA 4NXNQ 3RZOB 1TR5A 1BO0A 4OO1I 3MFGA 1F2ZA 1X56A 2DGYA 3K0XA 3LX0A 3VYTA 5KIXA 1O7IA 5CORA 4XTCS 3OW7A 4BY7G 4K6DA 3L0OA 3OIQA 1XMQQ 4CDEC 4UP8A 3K58A 1OO9B 2WB1B 1PFNA 1JOKA 3I8ZA 1BBXC 2F0DA 1YIJA 1SDFA 1DCZA 2CHBD 1JB7A 1HNWQ 1G8ZD 1H9SB 1B3QA 2PW7A 1Q12A 1VF7A 4KV6A 4A3FH 4C3JB 3HZXA 3F2UA 3M4QA 1GUWA 1EY0A 3J81c 2OT2A 5M3MH 5M5YB 5AFWA 2FMMA 1LTGD 3TREA 3I7FA 3EBEA 2I5MX 1NE3A 1H95A 3HOYH 2HHHL 2LFNA 3EA6A 3OWEB 1HCZA 1EWHA 3GTPH 3L3OC 1EIGA 3GTPB 5JEAJ 3BG3A 4L6TB 4BBSG 1E3PA 3K5MA 3J80c 1V8QA 3HOUH 4OEMB 3H0GH 2XSCA 2Z9HA 3H0GB 2L0CA 4DR3L 4DUYL 3DWAA 3N52A 1ICWA 3J7AF 4R4IA 1D7QA 4JI6L 2JP1A 3GTQH 2PZTA 4PMWA 2ZTDA 3GTQB 4OWTB 4O0AA 2GVAA 1B70B 3QWNA 3CD6A 3S9WA 3JAMc 4B9WA 4O42A 4DKAC 2EPBA 3HS0C 2JA8B 4KKSA 1R9TH 1R9TB 1VQ8A 3AB9A 3S15B 4X6AH 2EE1A 4A3EG 1EY6A 5IGDA 2D9UA 2QEJC 2F4VQ 1K73C 3F2CA 2RCNA 4APVA 4IUVA 4HJ7A 2PI2E 3MEHA 3CC2A 1QG7A 4ID6A 2BE5C 1B44D 3F1ZA 4G4KA 5I6YA 2ZXRA 1VQKA 5IP9G 2NB0A 4BA1I 2AUKA 5M5XH 1EIYB 2VB2X 3A5UA 4DV6L 1VF5C 4B9XA 1IZ6A 5M5XB 1B53A 1O7YA 3D4WA 4HJ9A 3JC66 1WTWA 3GTLB 3CCRA 3NSWA 2YU9H 2A68C 3V2TA 3IFDA 3ONAB 2O2LD 2B8GA 2EYHA 5E4XA 2E8GA 5IGGA 4HIMA 3RNUA 4A3DB 2A5HA 1L1OB 1TS5A 3KBXA 4LMQD 3K0YA 3L9AX 4NXNL 2JA6H 4CGYB 4RG1A 2F0PA 4KY5A 4EQ5A 1CT1D 5I4DA 1EYDA 1EQRA 4JI4Q 4GLXA 3H15A 1XXGA 1F9RA 3MA2B 1XMQL 4B3MQ 2VS1A 1YNJC 2SNMA 2IX0A 2GN5A 3BVZA 1F2LA 4AIMA 4B08A 4ALPA 2EYOA 2MJ8A 2NBFA 1RDPD 2F0VA 1DZ1A 2E2DC 1AN8A 1S5FD 4QJFA 1WTQA 1AH9A 4Q0FA 1ENFA 2K50A 2JA5B 3CCJA 4DV4L 2BOSA 4LAAA 2G9HD 2KEDA 2F0IA 2RA4A 1PFSA 1YI2A 3C3LA 2NYZD 4KHZA 1RTOA 2KCMA 3PO3G 4OONA 2B2VA 5I2XA 1WYDA 4KHPQ 4K14A 3C2PA 4IPHA 1U9RA 1SJHD 4BA2I 1CSPA 3UE1A 2OCEA 1RKNA 3CF5A 2JA6G 1J5EQ 2WKDA 4A3MH 2UUCL 4ZRZA 1ENCA 1E0BA 5BN4A 5IY0A 4A3MB 3K81C 4EQNA 1AP0A 4ZQ3A 2QA4A 1JT8A 3RLNA 4QQBX 1WI5A 1JICA 1SE8A 5HY6A 2ZTEA 4KHVA 2MHVA 3ER0A 2UU9Q 4P72A 1LTTD 1MGSA 2IT1A 2XIWA 4RFBA 2UUBQ 2L4NA 1FD7D 1AZQA 3S1QH 1KLUD 2IHEA 1XNRQ 3S1QB 2RSNA 1TY0A 4CDCC 1PTOC 1MHWC 5F2DA 2G5DA 2O5JC 1V1OA 1SNQA 3AYHB 4LF8Q 3TP6A 1O7ZA 3CMEA 1KQSA 1VQLA 4A3GH 2F4VL 2K6AA 3S24A 4A3GB 2NVYH 5J3BA 3S2DH 3CC4A 4Y7NH 2NVYB 5ELNA 3MTSA 3J81E 3S17B 1A0IA 3S2DB 2B2TA 2RVLA 4Y7NB 3T51B 1L0XB 2OF1A 2JN4A 2IJ0A 5CR3A 4LF5Q 2HQLA 5IYBH 1S5BD 3DWQA 1M4VA 3I55A 1SE4A 2KJXA 2RBMA 3D0FA 2E76C 5JJIA 1QUQB 4XT3B 3J80E 2MO1A 1BCPC 5C4XH 1Q46A 3VR2A 1Y69U 1HZBA 4AYBB 4YWLA 5C4XB 1RIPA 1DONA 4IUTA 4IOAA 3J80L 5HGQA 3A8JE 2YTXA 5D65A 4DNIA 2M2LA 4B3RL 1W2BA 3P20A 3GV6A 2PZUA 3KUPA 3TRZA 2B2UA 2KUMA 3K80C 1CUKA 4GNXC 5AJ3Q 4P71A 2HT1A 3JAME 1JWUD 4YY3Q 4PZ8A 2WB1E 3AFPA 3FVQA 5IWAL 4N8FA 4C3IH 3JAML 4X64Q 3C1FA 3S2HB 1EZ8A 4C3IB 4A3IB 2K33A 3PUWA 1GO3E 1R4QB 1HXYD 1UAPA 4GOPA 3QOJA 4H7BA 2K5HA 3VYUA 3PO2G 1ESRA 1HUMA 1DOKA 2BDNA 1A62A 1E22A 4UHVA 5KRUA 1STGA 2EQSA 3ITPA 4ULLA 5C44H 1PYSB 2ZM6Q 2QDLA 2D0OA 5C44B 1TVXA 2A1AA 1YVCA 1E2WA 2BDOA 5EKLA 4DAVA 1KDAA 1XYIA 5IYDH 4LF9Q 5EKIA 3FRPB 4QMGA 1HJPA 1S4ZA 4K2KA 4TKOB 4JI1L 5C0XJ 3CCMA 4KHPL 1K83H 2ASBA 4A3LH 4RGNA 3VA7A 2VQFL 1K83B 1X3FA 4JV5L 1IKLA 4KTAA 4HCSA 4IQZA 3QJYA 2N8NA 4B3SQ 2JA9A 1TWGH 3FKIH 2R93H 3FKIB 3V05A 1F2YA 1ASYA 1VQ5A 5KYIA 4DV2Q 1UUPA 2XTIA 4DXGA 1SYGA 2QW7A 2XNAC 4KD4A 3PUYA 3BZDB 3F8TA 2WFWA 5FKAC 5E1FA 2WIIB 3EIVA 1KXLA 2EIFA 4LFBQ 4EX5A 1ILQA 4GN5A 2BA0A 2EYMA 3I72A 4FXDA 3S1RH 2N55A 1ENAA 3S1RB 4YWMA 1Q81C 3OPOA 2MUYA 4LFCL 4JOIA 3BVGA 1HNZQ 1FVIA 1KAAA 3Q0AA 1DYQA 5G3LD 4GZYC 2DN8A 1H9JA 2NVXH 2NVXB 2KHSA 2UXDQ 1EWCA 5KNDA 4FO2A 4A3CG 3A56A 4HIKA 4DR7Q 1JOQA 1HA6A 4A3JG 4FNFA 1EWIA 2ENBA 2F3IA 1PZKD 4A3BG 5I9PA 1C4QA 4GLAC 4HR7B 1VQDA 3AMUA 4GKKQ 2M00A 5AJ3L 2E2IB 2NWGA 1RF2D 5IYCH 1Y8PB 4YY3L 4XQNA 2Q8TA 3PUZA 3TZDA 1I94L 2P5ZX 2RDGA 4U673 1GUTA 1SFOH 3X3MA 1I4QA 2NN6I 4RCOA 1I4HA 5EBDA 2E2JH 1TKWB 3K57A 1WCMG 2E2JB 3FPPA 4BS9A 1IYVA 5H1SE 2A6EC 3HG9A 3T1YQ 4UY8C 2J0TD 4IUPA 1Y8OB 2Q2TA 1Q8KA 2NVQH 4QUCA 1Y8NB 3FHWA 2NVQB 2ZJQA 4ZKBB 1PLFA 3E9IA 2ZM6L 3HRZC 4JK1C 3SR1A 1B7YB 1NCVA 1ILPA 2KHJA 1W6KA 2KBNA 2VUMH 1VQEA 4MZ9A 1Y1VG 4R9WA 1S72A 2K14A 1A3VA 1SMXA 3KYHC 3P1HA 4A93H 1YBYA 1FJGQ 3WDNA 4FP5D 4RGMA 3U4VA 1L2FA 5C0XG 1VDZA 4DV0L 3PV0A 1D1KA 4JBJA 4EQOA 4NKLA 2VZAA 2XRSD 1TWCH 3ULPA 3HP3A 4ILWA 4J15A 1TWCB 4DV2L 1BBWA 1FNWA 3TS2A 1KNEA 2KCCA 1PVOA 2A19A 1U4RA 1B9MA 2A73B 4UP7A 4X3TA 1GUNA 3IL8A 1G291 1S5CD 4ZLTF 2O4XA 4HSPA 4QF4A 4X66Q 3T1HL 1VQ9A 1XTCD 3EVQA 1RHPA 1KRTA 1CHQD 1E1OA 4R4TA 1X9NA 3GTKB 2Q8RE 2I07B 1PH4A 5ELEA 1IHZA 4V190 1YNND 1YHAA 1HNZL 2F0UA 1SR3A 3MXNA 4RAUC 3CPWA 2B2TC 4RCNA 1KNAA 3PF4A 5I9OA 1YZ6A 1CKNA 1WFQA 3RR5A 3DLLA 5C0XI 2KEEA 4YCUA 3W1GA 3TP8A 5LMNW 1EYAA 4DR7L 1YNJD 1SXTA 2A8VA 2JA7B 1VQJA 1Q7YC 2JEAI 4RGTA 4K2LA 2RDHA 4JI3L 3K5NA 4UP9A 2MPMA 4HMIA 4OX9Q 1AE3A 1Y1WB 1G2SA 1O80A 1UE5A 1ZXTA 1W6JA 1EU3A 1ZKOA 1I4RA 1SE3A 4H44C 5FJ8H 4C3HG 5C4HA 2J7ZA 3E0EA 1P16A 1I6HH 1U4MA 1HR0Q 2ATWA 3D6CA 1CKOA 4H02A 2NVTH 1I6HB 3I4NH 2NVTB 3I4NB 3HOZH 3IRBA 4QCLA 2AQ1B 3TZUA 4KKUA 5EPJA 3T1YL 1TQOA 1C9OA 4UAIA 4N9TA 1MD2D 4F87A 4K0KQ 1CA6A 1BVSA 3AU7A 3I90A 1X55A 1V1PB 4JI8Q 1B4OA 1PRTF 1VQHA 1FL0A 5A2QE 4OO1G 2JYOA 2QF7A 4BBRG 4HIOA 2JQOA 4HSVA 5A2QL 4BY7H 3TP5A 3GP7A 1PRTD 4QGUA 1LTBD 1JJGA 4X65L 1KLGD 1HUNA 4DF7A 2CFMA 3WOFA 4LFAQ 3Q22A 4F8MA 1X3EA 4OIJA 4G7ZC 2VY3A 3NXWA 2K75A 4QB4A 3O13A 1WTPA 1B9NA 1STEA 5FO9B 3GTJH 1E7ZA 1EOVA 1TS4A 3CRLC 3RUZA 2L12A 1QZHA 3GTJB 1H9KA 4LF4L 1I50H 2MFIA 3H09A 1BCPD 1I50B 4KMUC 1SBBB 4G57A 4JCVE 4MTKA 1NAPA 4DV5Q 1T5EA 4CBVA 4GKJQ 1UE7A 2XVSA 4DR5L 2HUGA 2X6GA 1BF4A 1SN8A 2VNUD 4GNXA 4BBSB 4ZYSA 2FFKB 4JI0Q 2XGTA 3OHXC 3A5ZB 4DR6L 1VQ4A 2YV5A 4C2MH 3M3YH 4P75A 1PFBA 4QL5A 3M3YB 3CW2C 1KDCA 4DR2Q 1NSNS 2VQEQ 3RZDH 1CK1A 2E5LL 1BUVT 5T1IA 1SYFA 4GOPB 1PH8A 1C0AA 1OXVA 3DMUA 5CV5A 5LHY1 5CGKA 1VQNA 1V9PA 2V1CC 4A3FB 1EL0A 5CC4A 4RHSA 4A3EH 5EAYA 4HCEA 4A3EB 3KFUA 3SK5A 4HJAA 5I6WA 2KOLA 3R3OA 5M3MB 2UXBQ 1NMGA 3IAYA 4IO9A 4DAPA 1JWSD 4CJ1B 3WWVA 5IP9H 3TQYA 3HOYB 1AEXA 1PH9A 3TMEA 4K8JA 4NP5A 2K01A 4DV7Q 4NXMQ 1XPUA 4PNYA 1JOOA 3HOUB 2F03A 3H3VC 4AH6A 4IJHA 4PQXA 4B3TQ 2F0SA 1SYCA 5FOBB 1QVCA 3NBIA 4DAMA 1TS3A 3MZ5A 1YJ9A 4EVOA 3D6WA 1WTVA 1VQFA 4MIUA 3P75A 2D0PA 4JW0A 1QE6A 3SGIA 1WOCA 1Q90A 1EIFA 4LF6L 4OIKA 3G48A 1OXSC 2CWPA 4MHEA 2BH2A 4IPDA 4JBKA 2EYJA 5ELFA 2C9OA 4H0LC 4YHHL 3K7UC 4XXEA 3MC0B 1AE2A 2O5IC 5J1ZA 1LTLA 3SK4A 4G7HC 3NEMA 1SNCA 3NTIA 1VQ6A 1G6PA 4YWKA 3CQZH 1K9MC 4JI5Q 2Q2HA 1TIID 3CQZB 1I6VC 4C3JG 4KJNA 4HMJA 2X69A 5FK9C 1VQGA 2F3VA 3OTOQ 4JI7L 2YU9B 4YCWA 4V0BA 2K5VA 3PO3H 3DM3A 4DV5L 1YNNC 3W5OA 4L8JA 5C4ZA 3L2PA 2D62A 3PIOA 4M1UB 2XN9C 4DUZQ 1TT2A 2Q2UA 2EXDA 1N33Q 2IPKD 2JA6B 5A35A 4JI0L 2KENA 4KN7C 1GHJA 3K7AH 1UE1A 1JJCB 3R2IA 1Y14B 3S1NH 2HIXA 2VQEL 3S1NB 1OTCA 2EY6A 4A4IA 3PCOB 3F2BA 1FGUA 1HNWL 2VXWA 3HKZB 3BVMA 1VQBA 3CCQA 3BS1A 2JA8G 4JYAQ 2A6ED 4L63B 1VQMA 2R7DA 2I46A 1EZ6A 5T1GA 3NBHA 1TXYA 4GLVB 1C48A 5D3IB 2AMCB 3I91A 4CKEA 3J81i 1XX8A 2PZWA 1X3PA 2HDMA 4F7XA 3RLOA 4LW1A 2UXBL 1PDQA 2VB3X 1IBMQ 4AQYQ 1D6EC 2GVBA 3N6RA 2EDGA 2WINB 4CDFC 1STAA 4HIDA 3K59A 3J80i 3MAQA 5JEAG 3QOLA 3PIPA 2TSSA 1EY9A 4O1NA 5LMUQ 4B3TL 4EGVA 4KJOA 1RD9D 3D3RA 3FDTA 2VL6A 3FMCA 4A3DG 2LXKA 1CZGA 3RN5A 4H13C 4GN3B 4RKLA 3PQIA 4K8IA 3JAMi 4LF7Q 3I4MG 4QIWB 2J4XA 4F88A 3UDIA 3ZJYC 4C1NK 4N8X1 2KECA 1IBLQ 1PRTC 2KVMA 2PQEA 2ZTCA 1HZ9A 4QUFA 3R93A 3R8BA 4XDXA 4RHRA 3MXNB 5C3XA 1L0YB 3PO2H 1EEFD 2X6LA 2RQXA 2CH4W 1VQ7A 3PO2B 5JPNC 1SYEA 3NHHA 4JI5L 4R4OA 5CMDA 1CKNB 4L5SA 2JA5G 2CWAA 3OTOL 4WORA 3RN2A 2HDLA 3VYRA 3DXJC 1FYCA 5FLXE 4DU9A 1BXTA 1EYGA 4A76A 3G6EA 1M8AA 1Z47A 4J8QA 5FLXL 3M9BA 1EY5A 2B63G 2EY1A 2R92G 3BDOA 4JI4L 1LTAD 2JSOA 3I73A 4KY6A 2GA4B 3NELA 3STBD 3H3VI 2JXMB 4B3ML 1K0RA 1K8AC 4FF4A 5LL6X 2ALYB 1WTXA 4HEDA 5IGBA 3X3NA 1SLJA 1UWVA 1IYJB 4LUVA 1Q82C 2JJQA 4K6LA 1MSGA 1I4GA 4L5TA 1N32Q 5K36G 3RD4A 2Z6BA 3IFTA 3GQBA 4L5RC 1OXTA 2F0QA 2Z4HA 5IGCA 3A0JA 3CCVA 1XMOQ 1NY4A 1H9MA 2IL8A 5DLQE 1QILA 2B2WC 3HOXG 2QCPX 2PQAB 4LJZC 1JQYD 1YNXA 2WV6D 1LM0A 1EQQA 3GO5A 3RLFA 2NUCA 3HEJA 1PTOH 1QWYA 1PTOB 3M4PA 2DJGC 1J6QA 1J5EL 1STYA 1STNA 4A3CH 5JJZA 5IGFA 5LMUL 2CVRA 5IT9E 1YJNA 2WKCA 3UDFA 1TWGB 2FINB 4A3JH 2B2YC 2K5QA 5GROA 2FMCA 1G51A 3KJPA 4A3JB 2R93B 4CHTB 2ZJPA 4A3BH 5IT9L 3J7YW 1K8MA 1I4PA 5CYUA 4A3BB 2LSSA 2NTSA 2UU9L 5IOCA 3H6MA 4N9PA 3ERSX 2UUBL 2A74C 3UDXA 1VQOA 1SROA 1NNXA 1XNRL 1JCKB 2WAQG 3VA5A 1N34Q 1N36Q 3HOWG 1BCPB 1F2MA 3EN2A 4LF8L 3AFQA 5C3EG 4HJ5A 1O78A 4X3KA 4A3IG 2AQ3B 2NN6G 1IL2A 2C5CA 1LTRD 1LV9A 2PNRC 1WCMH 3VR6A 4GNXB 1WCMB 1Z9FA 2K04A 1U0LA 3D31A 2PW5A 1CQVA 2QKIC 2SNSA 2NZOA 3NWSA 1EFID 4LF5L 1GVPA
chains in the Genus database with same CATH topology
4IFDJ 5JEAJ 1UE5A 4BBSG 1E3PA 1YHBA 5M3FG 3J80c 3HKZG 3HOUH 1Y1VH 2Q2IA 2R6GA 3H0GH 1VQIA 5FJ8H 5C4JH 4RMFA 3E0EA 1P16A 1I6HH 1HR0Q 2ATWA 4DR3L 1CKOA 4H02A 4DUYL 2NVTH 4LUZA 3I4NH 4R4IA 1D7QA 4JI6L 3GTQH 4PMWA 2ZTDA 1YEZA 1BKBA 4OWTB 1IXRA 4O0AA 2GVAA 1B70B 3HOXH 3UE0A 3HOZH 3CD6A 3IRBA 5IP7G 1NMFA 4LFCQ 3JAMc 4DKAC 2Y0SG 2CKZB 3S17H 3T1YL 1C9OA 3HFZB 1R9TH 1Q1EA 2AWNA 4X64L 4P74A 4XIGS 1I5FA 1LYLA 3HKZE 4KLKA 1LUZA 4K0KQ 1VQ8A 5GQOA 4DUZL 1BVSA 3MEFA 3BZCA 4X6AH 5JJLA 4A3EG 1X55A 1N33L 4JI8Q 1PH3A 1VQHA 1N32L 1VQPA 1FL0A 1UEBA 2B29A 1UE6A 1I3QH 2F4VQ 4JG2A 1K73C 3CPFA 2RCNA 4APVA 3F2CA 4A3MG 3KDFA 1X3GA 3M7NA 4BBRG 3GD7A 4HIOA 2JQOA 2KCTA 4R4CA 2PI2E 5FLMG 4HJ7A 1HNXQ 3CC2A 2B3GA 3F1ZA 1VQKA 5IP9G 4BY7H 2UXCL 4BA1I 5M5XH 1EIYB 3A5UA 4DV6L 4POFA 3UDGA 3ICEA 1IZ6A 1P8LA 4YCVA 4HJ9A 2OQKA 3JC66 3I56A 1E1TA 4QGUA 4PG3A 4JYAL 1JJGA 4X65L 3CCRA 2YU9H 3HOWH 4LF9L 4WJ4A 2CFMA 4R1JA 1T9HA 4LFAQ 3CCLA 2N3SA 1X3EA 2E8GA 2VY3A 1CSQA 3CXCA 4HIMA 3RNUA 1D8LA 1JE5A 2K75A 5C3EH 1L1OB 1I94Q 3S2HH 1S3OA 4A3IH 4B3SL 2AWOA 1M90C 3NENA 4A3GG 3CAMA 3GTJH 1IBML 4NXNL 1E7ZA 1EOVA 2Z6KA 4AQYL 1QZHA 2KHIA 2JA6H 4RG1A 4EQ5A 4LF4L 1I50H 1EQRA 2MFIA 4JI4Q 4GLXA 3H15A 1VQAA 4JCVE 3KLWA 1XMQL 4DV5Q 4B3MQ 4GKJQ 4QIWE 2VS1A 1UE7A 4DR5L 1YITA 2IX0A 2GN5A 5IYBG 4AIMA 4LFBL 5M3FH 4X62Q 1OXXK 1SN8A 2VNUD 4ALPA 4GNXA 2CQOA 1EFWA 3F2DA 1N36L 4C3HH 1K3RA 4AYBG 5C4XG 3M4OH 4JI0Q 4KI0A 2XGTA 3A5ZB 4QJFA 4DR6L 1AH9A 1VQ4A 2YV5A 4C2MH 3M3YH 4P75A 2K50A 2OTLA 3CCJA 2I5LX 4QL5A 4DV4L 4LF7L 4A3KG 5GAHC 3CW2C 4DR2Q 2VQEQ 3RZDH 5IP7H 1L0WA 2E5LL 3CCUA 4DV0Q 1Q86C 4GOPB 1PFSA 1PH8A 1YI2A 1OXVA 2PNHA 1C0AA 2R7ZG 4DR4L 4KHZA 3BZKA 1IBLL 2KCMA 4OWXB 1VQNA 1V9PA 3PO3G 2V1CC 4OONA 2UXDL 2FXQA 4OWWB 1WYDA 1KAWA 4KHPQ 4AYBE 5EAYA 4A3EH 4IPHA 4TQUS 3KFUA 3PUVA 4BA2I 1CSPA 3UE1A 4HJAA 2OCEA 3CF5A 2JA6G 4IFDG 1J5EQ 4A3MH 2UUCL 2UXBQ 1NMGA 4BBRH 5FLMH 1HH2P 2HIVA 4IO9A 5IY0A 3L7ZC 3K81C 3WWVA 2QA4A 1JT8A 5IP9H 3TQYA 2PMZE 3RLNA 3T1HQ 1XPRA 4GKKL 4QQBX 2OTJA 1WI5A 3NBHB 1SE8A 5HY6A 1PH9A 5LMNQ 4IJLA 2ZTEA 3ER0A 2UU9Q 3STBC 4QY7A 4P72A 5C44G 1PH1A 1XJVA 4DV3Q 4DV7Q 2IT1A 4NXMQ 1XPUA 4OO1G 1MJEA 1BBUA 2UUBQ 4AH6A 3S14H 4IJHA 2H5XA 4JI2Q 4B3TQ 3S1QH 5IYDG 2IHEA 1XNRQ 3GTOH 1QVCA 1MIUA 4DAMA 3HOVG 1YJ9A 4A3LG 1PV4A 1VQFA 3AYHB 4LF8Q 3CMEA 1KQSA 1VQLA 4A3GH 2AHOB 2DUDA 1GM5A 2F4VL 2D0PA 3S24A 3SGIA 2QGQA 1WOCA 1TWAH 2NVYH 5J3BA 4DV1Q 3S2DH 1EIFA 3CC4A 4Y7NH 4LF6L 5ELNA 4OXPA 5GADC 3CCSA 3FKIG 1Q1BA 1A0IA 2R93G 1TWHH 3S1MH 1X54A 1L1OA 1NTGA 3G48A 1M1KC 1OXSC 4JI3Q 1X6OA 2CWPA 2BH2A 4IPDA 2HQLA 4JBKA 4LF5Q 5IYBH 3LGJA 3I55A 4DR1Q 3G4SA 2E2IH 3KOJA 4YHHL 4IFDI 3K7UC 2Z6KC 1AE2A 3D0FA 2MO0A 3U50C 5JJIA 1KL9A 1QUQB 2VW9A 2MO1A 2N49A 1LTLA 5C4XH 1Q46A 4JBMA 2UUAQ 3NEMA 1FJGL 1HZBA 4YWLA 1RIPA 2F52A 1VQ6A 3CP0A 1XTDA 1XMOL 1G6PA 4IOAA 4YWKA 3CQZH 2L15A 5HGQA 4GN4B 1K9MC 4JI5Q 2Q2HA 1XNQQ 3VDYA 4GKJL 2YTXA 3AQQA 4DUYQ 4A3KH 4DNIA 1JMCA 4B3RL 5BR8Q 1W2BA 4JI6Q 3TRZA 3BU2A 1GKHA 3K80C 1VQGA 1CUKA 4IPGA 4GNXC 2JA7G 5AJ3Q 4PZ7A 3OTOQ 4P71A 4JI7L 1PA6A 2HT1A 1GD7A 1E24A 2R7ZH 4BY1G 3E9HA 1PH7A 3GTMH 4YCWA 4YY3Q 2K5VA 4PZ8A 4JBWA 3PO3H 3DM3A 2NZHA 5M5WH 2WB1E 4DV5L 3AFPA 5GAEC 2OQ0A 3W5OA 5IWAL 4C3IH 1N8RC 4X64Q 3L2PA 2WP8J 3G71A 4X62L 2D62A 3BJUA 3PIOA 1Y1WG 1EUJA 3A74A 1GO3E 3PUWA 4DUZQ 2YYZA 4X66L 4GOPA 2I0QA 2Q2UA 2K4KA 1OXUA 2EXDA 2E2HH 1N33Q 2K5HA 4JI0L 2KENA 4L5QA 1KHIA 1V1QA 3CMAA 3PO2G 3K7AH 1UE1A 1JJCB 1A62A 4GS3A 1E22A 2C35B 1Y14B 3S1NH 3I4OA 5JJKA 2HIXA 2VQEL 1VS0A 2EQSA 1OTCA 1C7YA 4A4IA 3PCOB 5C44H 3F2BA 1FGUA 1PYSB 1N34L 2ZM6Q 1HNWL 2D0OA 4DV6Q 2A1AA 1YVCA 1HZCA 5IYCG 1VQBA 3CCQA 4Y52H 2JA8G 4JYAQ 5IYDH 2Z0SA 4X65Q 1VQMA 3HOVH 2R7DA 4LF9Q 4GLVB 1HJPA 1TXYA 4JI1L 5C0XJ 3CCMA 4KHPL 4A3LH 1K83H 2ASBA 2AMCB 2VQFL 4BXXG 1X3FA 2YTYA 2JE6I 3J81i 4JV5L 3M85A 3KF6B 2N8NA 4LW1A 3RLOA 2JA9A 1TWGH 4B3SQ 3RZOH 3TS0A 2UXBL 3FKIH 2BH8A 1IBKQ 1IBMQ 4AQYQ 1U5KA 2R93H 1QZGA 4OX9L 1ASYA 1VQ5A 2GVBA 1WJJA 2MQHA 4JC0A 2RHSB 4O2DA 4DV2Q 4LF4Q 3GTKH 3S16H 4FDBA 5LMNL 2XTIA 4HIDA 3J80i 3PUYA 4DV3L 3F8TA 5JEAG 2WFWA 4DR5Q 3PIPA 3PUXA 3EIVA 4POGA 1KXLA 2VUMG 2EIFA 5LMUQ 4JI2L 1MKHA 4EX5A 1HR0L 4B3TL 4LFBQ 4LNQA 1S40A 4GN5A 2CCZA 2BA0A 3S1RH 3CC7A 1L1OC 1RL2A 4A93G 1PHJA 2VL6A 3HKSA 4YWMA 4A3DG 1Q81C 2LXKA 3ULJA 1A63A 3RN5A 4DR6Q 2AKWB 4C3JH 4GN3B 1PH5A 4LFCL 4JOIA 4TVAB 3JAMi 5FLXc 2JA7H 1NBWA 4DV1L 1QUQA 4DV4Q 1HNZQ 1VCIA 2R7FA 4LF7Q 3I4MG 1FVIA 1N9WA 5M5YH 4BY1H 4MTNA 4UPAA 3U4ZA 4K0KL 2E5LQ 2RHQB 3GDEA 3UDIA 1HR0W 2NVXH 3ZJYC 1DGSA 3KJOA 5ELOA 4JI8L 4DK3C 4DR1L 1IBLQ 1V43A 2LXJA 1Y1WH 1QVGA 4R4QA 2WAQE 2K52A 4LWCA 2UXDQ 2ZTCA 4A3CG 1HZ9A 4HIKA 4DR7Q 1HNXL 2UUAL 3MXNB 4HJ8A 1HZAA 4A3JG 1EWIA 1X65A 3PO2H 3K8AA 1VQ7A 2F3IA 3TEHB 5IE8A 3OW2A 1XNQL 1YHQA 2UUCQ 4A3BG 4JI5L 4R4OA 4PZ6A 3J7A5 1CKNB 4GLAC 3I2ZA 5BR8L 2ID0A 4L5SA 2JA5G 2CWAA 2HHHQ 1VQDA 4GKKQ 2WB1G 5AJ3L 3OTOL 1CKMA 3PGZA 3RN2A 1XPOA 4GOPC 5IYCH 1MJCA 4LFAL 2JA8H 4YY3L 1EYGA 3PUZA 1I94L 3Q8DA 4A76A 3G6EA 1Z47A 4A3FG 4DR3Q 3M9BA 2B63G 4BXXH 1QVFA 2R92G 3S15H 1SFOH 1KD1C 2NN6I 2E2JH 1WCMG 5E7NA 4JI4L 4IOCA 3NELA 3STBD 3H3VI 2PQAA 2RF4A 5M3MG 2JK8A 5H1SE 2IY5B 2MNAA 3U58A 1TWFH 3FP9A 1K0RA 4B3ML 3T1YQ 4LF6Q 2Q2TA 2K5NA 1K8AC 4UY8C 1Q8KA 2QEXA 2NVQH 3AEVA 3FHWA 3HOYG 2ALYB 2ZJQA 2I5HA 1YJWA 2PI2A 3E9IA 5IT9c 2Y0SE 2ZM6L 1PH2A 4ME3A 2IX1A 1JJ2A 1SLJA 3KF6A 1B7YB 1UWVA 1IYJB 4MNOA 4IPCA 2KHJA 4LUVA 3B6YA 2KBNA 4DK6C 1VQEA 2JJQA 1Q82C 2VUMH 4MZ9A 3GTLH 3HOUG 1Y1VG 2YTVA 4L5TA 4DAYB 3H0GG 4YHHQ 1PYBA 2ZJRA 1N32Q 5FJ8G 1S72A 1KIXA 5K36G 2K14A 1SMXA 2BA1A 4NPSA 3KYHC 1K8GA 4A93H 4A3DH 1YBYA 1FJGQ 4L5RC 1OXTA 3PSIA 3CCEA 4DR2L 3I4NG 3U4VA 3A0JA 1L2FA 1W3SA 5C0XG 3J7ZC 3CCVA 1XMOQ 2UXCQ 1NY4A 4DV0L 3PV0A 5DLQE 3HOXG 3J81j 3HOZG 4JBJA 1IBKL 3I4MH 4B3RQ 2VZAA 1TWCH 3ULPA 4J15A 2PQAB 3H3VH 4LUOA 1YNXA 4P73A 1LM0A 4DV2L 1EQQA 2ES2A 4JI7Q 3GO5A 3KDFB 1BBWA 3RLFA 3TS2A 2N78A 1KRSA 1KC8C 1PVOA 2A19A 1B8AA 3M4PA 1J6QA 1J5EL 4JOIC 5IWAQ 3KF8B 4UP7A 4A3CH 5LMUL 4BBSH 1YJNA 1G291 3W1BA 4NXNQ 3UDFA 1ASZA 4A3JH 5GROA 1G51A 4OO1I 4X66Q 3KJPA 2OWOA 3T1HL 1VQ9A 2DGYA 1X56A 2ZJPA 3K0XA 4A3BH 1KRTA 1O7IA 1E1OA 4R4TA 3PF5A 2LSSA 1X9NA 3GTGH 4XTCS 2UU9L 2JA5H 4BY7G 1PH4A 4DV7L 4NXML 3L0OA 1XMQQ 4UP8A 2JEBI 1YHAA 3ULLA 1HNZL 3ERSX 2UUBL 1SRUA 3UDXA 1SR3A 4A75A 3CPWA 1VQOA 1SROA 1YIJA 1JB7A 1PH6A 1XNRL 2WAQG 1N34Q 1HNWQ 1N36Q 3HOWG 3PF4A 1NJIC 1Q12A 1YZ6A 1CKNA 1WFQA 3RR5A 3DLLA 1A8VA 3EN2A 2IHFA 4A3FH 4LF8L 2B63H 3AFQA 5C3EG 5C0XI 4YCUA 4HJ5A 3W1GA 2R92H 5LMNW 4A3IG 2NN6G 4JI1Q 1IL2A 5GAGC 4DR7L 3M4QA 2A8VA 1VQJA 1WCMH 2VQFQ 1Q7YC 2JEAI 4GNXB 3J81c 4WJ3M 1Z9FA 5M3MH 4JV5Q 1U0LA 3D31A 4NB3A 1VQCA 3TREA 4JI3L 3I7FA 3EBEA 4DPGA 2NZOA 4UP9A 4DR4Q 4LF5L 2I5MX 1NE3A 3OYYA 1H95A 3HOYH 2HHHL 4OX9Q 1AE3A 1GVPA 3GTPH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD J;  5JEA J;  1UE5 A;  4BBS G;  1E3P A;  1YHB A;  5M3F G;  3J80 c;  3HKZ G;  3HOU H;  1Y1V H;  2Q2I A;  2R6G A;  3H0G H;  1VQI A;  5FJ8 H;  5C4J H;  4RMF A;  3E0E A;  1P16 A;  1I6H H;  1HR0 Q;  2ATW A;  4DR3 L;  1CKO A;  4H02 A;  4DUY L;  2NVT H;  4LUZ A;  3I4N H;  4R4I A;  1D7Q A;  4JI6 L;  3GTQ H;  4PMW A;  2ZTD A;  1YEZ A;  1BKB A;  4OWT B;  1IXR A;  4O0A A;  2GVA A;  1B70 B;  3HOX H;  3UE0 A;  3HOZ H;  3CD6 A;  3IRB A;  5IP7 G;  1NMF A;  4LFC Q;  3JAM c;  4DKA C;  2Y0S G;  2CKZ B;  3S17 H;  3T1Y L;  1C9O A;  3HFZ B;  1R9T H;  1Q1E A;  2AWN A;  4X64 L;  4P74 A;  4XIG S;  1I5F A;  1LYL A;  3HKZ E;  4KLK A;  1LUZ A;  4K0K Q;  1VQ8 A;  5GQO A;  4DUZ L;  1BVS A;  3MEF A;  3BZC A;  4X6A H;  5JJL A;  4A3E G;  1X55 A;  1N33 L;  4JI8 Q;  1PH3 A;  1VQH A;  1N32 L;  1VQP A;  1FL0 A;  1UEB A;  2B29 A;  1UE6 A;  1I3Q H;  2F4V Q;  4JG2 A;  1K73 C;  3CPF A;  2RCN A;  4APV A;  3F2C A;  4A3M G;  3KDF A;  1X3G A;  3M7N A;  4BBR G;  3GD7 A;  4HIO A;  2JQO A;  2KCT A;  4R4C A;  2PI2 E;  5FLM G;  4HJ7 A;  1HNX Q;  3CC2 A;  2B3G A;  3F1Z A;  1VQK A;  5IP9 G;  4BY7 H;  2UXC L;  4BA1 I;  5M5X H;  1EIY B;  3A5U A;  4DV6 L;  4POF A;  3UDG A;  3ICE A;  1IZ6 A;  1P8L A;  4YCV A;  4HJ9 A;  2OQK A;  3JC6 6;  3I56 A;  1E1T A;  4QGU A;  4PG3 A;  4JYA L;  1JJG A;  4X65 L;  3CCR A;  2YU9 H;  3HOW H;  4LF9 L;  4WJ4 A;  2CFM A;  4R1J A;  1T9H A;  4LFA Q;  3CCL A;  2N3S A;  1X3E A;  2E8G A;  2VY3 A;  1CSQ A;  3CXC A;  4HIM A;  3RNU A;  1D8L A;  1JE5 A;  2K75 A;  5C3E H;  1L1O B;  1I94 Q;  3S2H H;  1S3O A;  4A3I H;  4B3S L;  2AWO A;  1M90 C;  3NEN A;  4A3G G;  3CAM A;  3GTJ H;  1IBM L;  4NXN L;  1E7Z A;  1EOV A;  2Z6K A;  4AQY L;  1QZH A;  2KHI A;  2JA6 H;  4RG1 A;  4EQ5 A;  4LF4 L;  1I50 H;  1EQR A;  2MFI A;  4JI4 Q;  4GLX A;  3H15 A;  1VQA A;  4JCV E;  3KLW A;  1XMQ L;  4DV5 Q;  4B3M Q;  4GKJ Q;  4QIW E;  2VS1 A;  1UE7 A;  4DR5 L;  1YIT A;  2IX0 A;  2GN5 A;  5IYB G;  4AIM A;  4LFB L;  5M3F H;  4X62 Q;  1OXX K;  1SN8 A;  2VNU D;  4ALP A;  4GNX A;  2CQO A;  1EFW A;  3F2D A;  1N36 L;  4C3H H;  1K3R A;  4AYB G;  5C4X G;  3M4O H;  4JI0 Q;  4KI0 A;  2XGT A;  3A5Z B;  4QJF A;  4DR6 L;  1AH9 A;  1VQ4 A;  2YV5 A;  4C2M H;  3M3Y H;  4P75 A;  2K50 A;  2OTL A;  3CCJ A;  2I5L X;  4QL5 A;  4DV4 L;  4LF7 L;  4A3K G;  5GAH C;  3CW2 C;  4DR2 Q;  2VQE Q;  3RZD H;  5IP7 H;  1L0W A;  2E5L L;  3CCU A;  4DV0 Q;  1Q86 C;  4GOP B;  1PFS A;  1PH8 A;  1YI2 A;  1OXV A;  2PNH A;  1C0A A;  2R7Z G;  4DR4 L;  4KHZ A;  3BZK A;  1IBL L;  2KCM A;  4OWX B;  1VQN A;  1V9P A;  3PO3 G;  2V1C C;  4OON A;  2UXD L;  2FXQ A;  4OWW B;  1WYD A;  1KAW A;  4KHP Q;  4AYB E;  5EAY A;  4A3E H;  4IPH A;  4TQU S;  3KFU A;  3PUV A;  4BA2 I;  1CSP A;  3UE1 A;  4HJA A;  2OCE A;  3CF5 A;  2JA6 G;  4IFD G;  1J5E Q;  4A3M H;  2UUC L;  2UXB Q;  1NMG A;  4BBR H;  5FLM H;  1HH2 P;  2HIV A;  4IO9 A;  5IY0 A;  3L7Z C;  3K81 C;  3WWV A;  2QA4 A;  1JT8 A;  5IP9 H;  3TQY A;  2PMZ E;  3RLN A;  3T1H Q;  1XPR A;  4GKK L;  4QQB X;  2OTJ A;  1WI5 A;  3NBH B;  1SE8 A;  5HY6 A;  1PH9 A;  5LMN Q;  4IJL A;  2ZTE A;  3ER0 A;  2UU9 Q;  3STB C;  4QY7 A;  4P72 A;  5C44 G;  1PH1 A;  1XJV A;  4DV3 Q;  4DV7 Q;  2IT1 A;  4NXM Q;  1XPU A;  4OO1 G;  1MJE A;  1BBU A;  2UUB Q;  4AH6 A;  3S14 H;  4IJH A;  2H5X A;  4JI2 Q;  4B3T Q;  3S1Q H;  5IYD G;  2IHE A;  1XNR Q;  3GTO H;  1QVC A;  1MIU A;  4DAM A;  3HOV G;  1YJ9 A;  4A3L G;  1PV4 A;  1VQF A;  3AYH B;  4LF8 Q;  3CME A;  1KQS A;  1VQL A;  4A3G H;  2AHO B;  2DUD A;  1GM5 A;  2F4V L;  2D0P A;  3S24 A;  3SGI A;  2QGQ A;  1WOC A;  1TWA H;  2NVY H;  5J3B A;  4DV1 Q;  3S2D H;  1EIF A;  3CC4 A;  4Y7N H;  4LF6 L;  5ELN A;  4OXP A;  5GAD C;  3CCS A;  3FKI G;  1Q1B A;  1A0I A;  2R93 G;  1TWH H;  3S1M H;  1X54 A;  1L1O A;  1NTG A;  3G48 A;  1M1K C;  1OXS C;  4JI3 Q;  1X6O A;  2CWP A;  2BH2 A;  4IPD A;  2HQL A;  4JBK A;  4LF5 Q;  5IYB H;  3LGJ A;  3I55 A;  4DR1 Q;  3G4S A;  2E2I H;  3KOJ A;  4YHH L;  4IFD I;  3K7U C;  2Z6K C;  1AE2 A;  3D0F A;  2MO0 A;  3U50 C;  5JJI A;  1KL9 A;  1QUQ B;  2VW9 A;  2MO1 A;  2N49 A;  1LTL A;  5C4X H;  1Q46 A;  4JBM A;  2UUA Q;  3NEM A;  1FJG L;  1HZB A;  4YWL A;  1RIP A;  2F52 A;  1VQ6 A;  3CP0 A;  1XTD A;  1XMO L;  1G6P A;  4IOA A;  4YWK A;  3CQZ H;  2L15 A;  5HGQ A;  4GN4 B;  1K9M C;  4JI5 Q;  2Q2H A;  1XNQ Q;  3VDY A;  4GKJ L;  2YTX A;  3AQQ A;  4DUY Q;  4A3K H;  4DNI A;  1JMC A;  4B3R L;  5BR8 Q;  1W2B A;  4JI6 Q;  3TRZ A;  3BU2 A;  1GKH A;  3K80 C;  1VQG A;  1CUK A;  4IPG A;  4GNX C;  2JA7 G;  5AJ3 Q;  4PZ7 A;  3OTO Q;  4P71 A;  4JI7 L;  1PA6 A;  2HT1 A;  1GD7 A;  1E24 A;  2R7Z H;  4BY1 G;  3E9H A;  1PH7 A;  3GTM H;  4YCW A;  4YY3 Q;  2K5V A;  4PZ8 A;  4JBW A;  3PO3 H;  3DM3 A;  2NZH A;  5M5W H;  2WB1 E;  4DV5 L;  3AFP A;  5GAE C;  2OQ0 A;  3W5O A;  5IWA L;  4C3I H;  1N8R C;  4X64 Q;  3L2P A;  2WP8 J;  3G71 A;  4X62 L;  2D62 A;  3BJU A;  3PIO A;  1Y1W G;  1EUJ A;  3A74 A;  1GO3 E;  3PUW A;  4DUZ Q;  2YYZ A;  4X66 L;  4GOP A;  2I0Q A;  2Q2U A;  2K4K A;  1OXU A;  2EXD A;  2E2H H;  1N33 Q;  2K5H A;  4JI0 L;  2KEN A;  4L5Q A;  1KHI A;  1V1Q A;  3CMA A;  3PO2 G;  3K7A H;  1UE1 A;  1JJC B;  1A62 A;  4GS3 A;  1E22 A;  2C35 B;  1Y14 B;  3S1N H;  3I4O A;  5JJK A;  2HIX A;  2VQE L;  1VS0 A;  2EQS A;  1OTC A;  1C7Y A;  4A4I A;  3PCO B;  5C44 H;  3F2B A;  1FGU A;  1PYS B;  1N34 L;  2ZM6 Q;  1HNW L;  2D0O A;  4DV6 Q;  2A1A A;  1YVC A;  1HZC A;  5IYC G;  1VQB A;  3CCQ A;  4Y52 H;  2JA8 G;  4JYA Q;  5IYD H;  2Z0S A;  4X65 Q;  1VQM A;  3HOV H;  2R7D A;  4LF9 Q;  4GLV B;  1HJP A;  1TXY A;  4JI1 L;  5C0X J;  3CCM A;  4KHP L;  4A3L H;  1K83 H;  2ASB A;  2AMC B;  2VQF L;  4BXX G;  1X3F A;  2YTY A;  2JE6 I;  3J81 i;  4JV5 L;  3M85 A;  3KF6 B;  2N8N A;  4LW1 A;  3RLO A;  2JA9 A;  1TWG H;  4B3S Q;  3RZO H;  3TS0 A;  2UXB L;  3FKI H;  2BH8 A;  1IBK Q;  1IBM Q;  4AQY Q;  1U5K A;  2R93 H;  1QZG A;  4OX9 L;  1ASY A;  1VQ5 A;  2GVB A;  1WJJ A;  2MQH A;  4JC0 A;  2RHS B;  4O2D A;  4DV2 Q;  4LF4 Q;  3GTK H;  3S16 H;  4FDB A;  5LMN L;  2XTI A;  4HID A;  3J80 i;  3PUY A;  4DV3 L;  3F8T A;  5JEA G;  2WFW A;  4DR5 Q;  3PIP A;  3PUX A;  3EIV A;  4POG A;  1KXL A;  2VUM G;  2EIF A;  5LMU Q;  4JI2 L;  1MKH A;  4EX5 A;  1HR0 L;  4B3T L;  4LFB Q;  4LNQ A;  1S40 A;  4GN5 A;  2CCZ A;  2BA0 A;  3S1R H;  3CC7 A;  1L1O C;  1RL2 A;  4A93 G;  1PHJ A;  2VL6 A;  3HKS A;  4YWM A;  4A3D G;  1Q81 C;  2LXK A;  3ULJ A;  1A63 A;  3RN5 A;  4DR6 Q;  2AKW B;  4C3J H;  4GN3 B;  1PH5 A;  4LFC L;  4JOI A;  4TVA B;  3JAM i;  5FLX c;  2JA7 H;  1NBW A;  4DV1 L;  1QUQ A;  4DV4 Q;  1HNZ Q;  1VCI A;  2R7F A;  4LF7 Q;  3I4M G;  1FVI A;  1N9W A;  5M5Y H;  4BY1 H;  4MTN A;  4UPA A;  3U4Z A;  4K0K L;  2E5L Q;  2RHQ B;  3GDE A;  3UDI A;  1HR0 W;  2NVX H;  3ZJY C;  1DGS A;  3KJO A;  5ELO A;  4JI8 L;  4DK3 C;  4DR1 L;  1IBL Q;  1V43 A;  2LXJ A;  1Y1W H;  1QVG A;  4R4Q A;  2WAQ E;  2K52 A;  4LWC A;  2UXD Q;  2ZTC A;  4A3C G;  1HZ9 A;  4HIK A;  4DR7 Q;  1HNX L;  2UUA L;  3MXN B;  4HJ8 A;  1HZA A;  4A3J G;  1EWI A;  1X65 A;  3PO2 H;  3K8A A;  1VQ7 A;  2F3I A;  3TEH B;  5IE8 A;  3OW2 A;  1XNQ L;  1YHQ A;  2UUC Q;  4A3B G;  4JI5 L;  4R4O A;  4PZ6 A;  3J7A 5;  1CKN B;  4GLA C;  3I2Z A;  5BR8 L;  2ID0 A;  4L5S A;  2JA5 G;  2CWA A;  2HHH Q;  1VQD A;  4GKK Q;  2WB1 G;  5AJ3 L;  3OTO L;  1CKM A;  3PGZ A;  3RN2 A;  1XPO A;  4GOP C;  5IYC H;  1MJC A;  4LFA L;  2JA8 H;  4YY3 L;  1EYG A;  3PUZ A;  1I94 L;  3Q8D A;  4A76 A;  3G6E A;  1Z47 A;  4A3F G;  4DR3 Q;  3M9B A;  2B63 G;  4BXX H;  1QVF A;  2R92 G;  3S15 H;  1SFO H;  1KD1 C;  2NN6 I;  2E2J H;  1WCM G;  5E7N A;  4JI4 L;  4IOC A;  3NEL A;  3STB D;  3H3V I;  2PQA A;  2RF4 A;  5M3M G;  2JK8 A;  5H1S E;  2IY5 B;  2MNA A;  3U58 A;  1TWF H;  3FP9 A;  1K0R A;  4B3M L;  3T1Y Q;  4LF6 Q;  2Q2T A;  2K5N A;  1K8A C;  4UY8 C;  1Q8K A;  2QEX A;  2NVQ H;  3AEV A;  3FHW A;  3HOY G;  2ALY B;  2ZJQ A;  2I5H A;  1YJW A;  2PI2 A;  3E9I A;  5IT9 c;  2Y0S E;  2ZM6 L;  1PH2 A;  4ME3 A;  2IX1 A;  1JJ2 A;  1SLJ A;  3KF6 A;  1B7Y B;  1UWV A;  1IYJ B;  4MNO A;  4IPC A;  2KHJ A;  4LUV A;  3B6Y A;  2KBN A;  4DK6 C;  1VQE A;  2JJQ A;  1Q82 C;  2VUM H;  4MZ9 A;  3GTL H;  3HOU G;  1Y1V G;  2YTV A;  4L5T A;  4DAY B;  3H0G G;  4YHH Q;  1PYB A;  2ZJR A;  1N32 Q;  5FJ8 G;  1S72 A;  1KIX A;  5K36 G;  2K14 A;  1SMX A;  2BA1 A;  4NPS A;  3KYH C;  1K8G A;  4A93 H;  4A3D H;  1YBY A;  1FJG Q;  4L5R C;  1OXT A;  3PSI A;  3CCE A;  4DR2 L;  3I4N G;  3U4V A;  3A0J A;  1L2F A;  1W3S A;  5C0X G;  3J7Z C;  3CCV A;  1XMO Q;  2UXC Q;  1NY4 A;  4DV0 L;  3PV0 A;  5DLQ E;  3HOX G;  3J81 j;  3HOZ G;  4JBJ A;  1IBK L;  3I4M H;  4B3R Q;  2VZA A;  1TWC H;  3ULP A;  4J15 A;  2PQA B;  3H3V H;  4LUO A;  1YNX A;  4P73 A;  1LM0 A;  4DV2 L;  1EQQ A;  2ES2 A;  4JI7 Q;  3GO5 A;  3KDF B;  1BBW A;  3RLF A;  3TS2 A;  2N78 A;  1KRS A;  1KC8 C;  1PVO A;  2A19 A;  1B8A A;  3M4P A;  1J6Q A;  1J5E L;  4JOI C;  5IWA Q;  3KF8 B;  4UP7 A;  4A3C H;  5LMU L;  4BBS H;  1YJN A;  1G29 1;  3W1B A;  4NXN Q;  3UDF A;  1ASZ A;  4A3J H;  5GRO A;  1G51 A;  4OO1 I;  4X66 Q;  3KJP A;  2OWO A;  3T1H L;  1VQ9 A;  2DGY A;  1X56 A;  2ZJP A;  3K0X A;  4A3B H;  1KRT A;  1O7I A;  1E1O A;  4R4T A;  3PF5 A;  2LSS A;  1X9N A;  3GTG H;  4XTC S;  2UU9 L;  2JA5 H;  4BY7 G;  1PH4 A;  4DV7 L;  4NXM L;  3L0O A;  1XMQ Q;  4UP8 A;  2JEB I;  1YHA A;  3ULL A;  1HNZ L;  3ERS X;  2UUB L;  1SRU A;  3UDX A;  1SR3 A;  4A75 A;  3CPW A;  1VQO A;  1SRO A;  1YIJ A;  1JB7 A;  1PH6 A;  1XNR L;  2WAQ G;  1N34 Q;  1HNW Q;  1N36 Q;  3HOW G;  3PF4 A;  1NJI C;  1Q12 A;  1YZ6 A;  1CKN A;  1WFQ A;  3RR5 A;  3DLL A;  1A8V A;  3EN2 A;  2IHF A;  4A3F H;  4LF8 L;  2B63 H;  3AFQ A;  5C3E G;  5C0X I;  4YCU A;  4HJ5 A;  3W1G A;  2R92 H;  5LMN W;  4A3I G;  2NN6 G;  4JI1 Q;  1IL2 A;  5GAG C;  4DR7 L;  3M4Q A;  2A8V A;  1VQJ A;  1WCM H;  2VQF Q;  1Q7Y C;  2JEA I;  4GNX B;  3J81 c;  4WJ3 M;  1Z9F A;  5M3M H;  4JV5 Q;  1U0L A;  3D31 A;  4NB3 A;  1VQC A;  3TRE A;  4JI3 L;  3I7F A;  3EBE A;  4DPG A;  2NZO A;  4UP9 A;  4DR4 Q;  4LF5 L;  2I5M X;  1NE3 A;  3OYY A;  1H95 A;  3HOY H;  2HHH L;  4OX9 Q;  1AE3 A;  1GVP A;  3GTP H; 
#chains in the Genus database with same CATH topology
 4IFD J;  5M3F G;  1TY2 A;  4KKT A;  4ME5 A;  4WJW A;  1Y1V H;  5EJW A;  1Y1V B;  5C4J H;  1JWM D;  4DFA A;  2RCF A;  5C4J B;  5JVG 3;  5CBA E;  4LUZ A;  4FF3 A;  5I2Y A;  4HN7 A;  1QNU A;  3D4R A;  5ELC A;  5C0X H;  3TN2 A;  1VMC A;  1G91 A;  5IP7 G;  1NMF A;  5KEE A;  2Y0S G;  2AUJ D;  2F0E A;  2A6H C;  1Q1E A;  4X64 L;  3KLS X;  4P74 A;  3HKZ E;  4KLK A;  1LUZ A;  1F77 A;  1SMY D;  5GQO A;  3MEF A;  3BZC A;  4XYO A;  1SFO B;  2HD3 A;  2A69 D;  4PMC A;  5CV8 A;  1N32 L;  1SND A;  1VQP A;  1CFM A;  1ESF A;  1UE6 A;  1I3Q H;  4LK1 C;  3CPF A;  1I3Q B;  1X3G A;  3M7N A;  1HNX Q;  1G6Z A;  2KCT A;  4R4C A;  5FLM G;  2XRQ D;  2B3G A;  4OHJ A;  2LKV A;  5E4W C;  5JPM C;  4POF A;  2F0H A;  4YCV A;  5DNF A;  2OQK A;  3I56 A;  1E1T A;  2VUM B;  2M9V A;  4LF9 L;  3DUZ A;  4R1J A;  1T9H A;  3G7L A;  1HQR D;  3CCL A;  1Z6H A;  5J22 A;  1CSQ A;  1JC7 A;  1D8L A;  4XQJ A;  1NUC A;  1QB5 D;  2QIL A;  4A93 B;  1IW7 D;  1WD0 A;  1EY8 A;  2V4D A;  4B3S L;  1M90 C;  3NEN A;  3CAM A;  4ZKC B;  3SHL A;  4ZK9 B;  3H91 A;  3E5S A;  1SYD A;  1ML0 D;  5CV6 A;  3M7G A;  1STB A;  1ZYR C;  1VQA A;  1D5Z C;  4RH6 A;  4DA2 A;  2F0J A;  4QIW E;  1FR3 A;  3OOC A;  3K6O A;  1RJT A;  4LFB L;  1OXX K;  2CQO A;  1EFW A;  3EQL C;  1N36 L;  4C3H H;  4ZCK A;  1CQF A;  4KI0 A;  1MSH A;  1WVL A;  3VR5 A;  4I65 A;  2OTL A;  2I5L X;  3U9S A;  1J9O A;  4A3K G;  5GAH C;  4OGQ C;  4U68 A;  1Q86 C;  1A2T A;  5CV9 A;  1SYB A;  1LT5 D;  2R7Z G;  3BZK A;  2B8F A;  4OWX B;  3V96 A;  2UXD L;  3VYS A;  4AYB E;  4R8N A;  1GJX A;  2ZT9 C;  3SK8 A;  4IFD G;  4E6I A;  5EGT A;  4OO1 H;  2L11 A;  3E3X A;  4BBR H;  1HH2 P;  2TMP A;  2G9D A;  3L7Z C;  4BBR B;  3CRK C;  1HPC A;  4GKK L;  3CU7 A;  2OTJ A;  2ICE C;  3KLS A;  3NBH B;  3MWY W;  3STB C;  4QY7 A;  5C6A A;  1PH1 A;  1XJV A;  4DV3 Q;  1MJE A;  2K05 A;  4EQP A;  3S14 H;  2D5D A;  1CHP D;  4TRD A;  3HOV G;  1QCB D;  2F0T A;  4DN4 M;  2HQE A;  3LNN A;  1PV4 A;  4RWS C;  2H4O A;  3HOZ B;  3SE0 A;  2QGQ A;  2SDF A;  4DV1 Q;  2EZV A;  2R3Z A;  4OXP A;  3CCS A;  1SEB D;  1Q1B A;  4KY7 A;  4DK0 A;  3ND9 A;  1ONL A;  4DR1 Q;  1X3Q A;  3KBG A;  4IFD I;  1K0S A;  2Z6K C;  1LT6 D;  1XWE A;  4IUR A;  3U50 C;  1KL9 A;  2VW9 A;  2NTT A;  4DK1 A;  2K28 A;  4JBM A;  1FJG L;  2F52 A;  3ZYY X;  3CP0 A;  1XTD A;  2FJ2 A;  2ZXO A;  1ZEQ X;  3BYT B;  4CDD C;  2L15 A;  1XNQ Q;  4GN4 B;  4BY7 B;  2CW0 D;  3VDY A;  4DUY Q;  1EQV A;  5BR8 Q;  4JI6 Q;  1WTH A;  3BU2 A;  1GKH A;  4IPG A;  1PXU A;  2JA7 G;  4Q5V A;  1D5X C;  1GD7 A;  5CBE E;  4BY1 G;  3E9H A;  1Q3L A;  3MHB A;  1PH7 A;  4FYD A;  5M5W H;  5GAE C;  1LT3 D;  2OQ0 A;  5M5W B;  1PFM A;  1N8R C;  2WP8 J;  3G71 A;  1Y1W G;  1GOZ A;  1EUJ A;  3A74 A;  4X66 L;  2I0Q A;  1T5X D;  2K4K A;  1OXU A;  2E2H H;  5BN5 A;  1V1Q A;  5IIF A;  3CMA A;  1LAB A;  2C35 B;  5JJK A;  1EIH A;  1VS0 A;  1C7Y A;  2H1E A;  4DV6 Q;  3W3A A;  1EU4 A;  1JB3 A;  2L9H A;  2KA7 A;  1LO5 D;  2F0N A;  2AQ2 B;  2Z0S A;  3RMH A;  4X3S A;  1FNV A;  3M4Y A;  1SJE D;  5L37 A;  4C2M B;  3BYY B;  1PYW D;  4BXX G;  3VR4 A;  4IZ8 A;  1VMP A;  3RZD B;  3RZO H;  3OMG A;  4OX9 L;  4BWG B;  2RHS B;  4OEL B;  1EY7 A;  4FDB A;  5CV4 A;  4DV3 L;  2PCF B;  2Z4I A;  5DM6 3;  2B2W A;  3UI2 A;  2IX3 A;  1MKH A;  1HR0 L;  3I4L A;  1AW7 A;  3DEO A;  2PO4 A;  3H94 A;  4KK7 A;  1SMY C;  4RKB A;  4FXG C;  5EPK A;  3EJI A;  5C5L A;  2CCZ A;  1L1O C;  1RL2 A;  3URY A;  2A69 C;  5EKK A;  4C3J H;  1GXD C;  3MVV A;  2EOT A;  2IWH A;  5FLX c;  4DV1 L;  4DV4 Q;  5C5M A;  3LWU A;  1BR9 A;  2RSO A;  5M5Y H;  2B2Y A;  4MTN A;  4K0K L;  1S5E D;  1HTL D;  2RHQ B;  3GDE A;  1HR0 W;  3OWF A;  1DGS A;  3KJO A;  5ELO A;  4JI8 L;  4DK3 C;  4DR1 L;  1AFP A;  2LXJ A;  3EFX D;  4R4Q A;  2K52 A;  2DJF C;  1FGB D;  4WFN 3;  1NR4 A;  3QG1 A;  2SEB D;  3K8A A;  3TEH B;  1IW7 C;  5ELB A;  3OW2 A;  1YHQ A;  2UUC Q;  1XNQ L;  1RTN A;  3J7A 5;  4PZ6 A;  3W2D A;  1FNU A;  3I2Z A;  5BR8 L;  1EQT A;  3R2T A;  5JVH 3;  2WB1 G;  1CKM A;  4PV1 C;  1XPO A;  1MJC A;  4LFA L;  2JA8 H;  2EVB A;  4I7A A;  4A3F G;  3A55 A;  4ODG A;  1QVF A;  3S15 H;  2PMZ B;  5E7N A;  1IYU A;  4IOC A;  3P7J A;  5M3M G;  2IY5 B;  1D1I A;  4GKJ L;  3PO3 B;  3AEV A;  3HOY G;  1LT4 D;  2HCC A;  2I5H A;  2ICI A;  2PI2 A;  5IT9 c;  1BQQ T;  3WOE A;  2IX1 A;  5JEA H;  3KF6 A;  4MNO A;  4DGZ A;  3B6Y A;  3GTL H;  3NPP A;  3HOU G;  1RCV D;  3H0G G;  1PYB A;  3CKI B;  1KIX A;  3Q23 A;  2RKS A;  2BA1 A;  1CTM A;  3K7A B;  4CKC A;  1K8G A;  2A6H D;  1D5M C;  1QJO A;  4A3D H;  4DNT B;  4DR2 L;  3QR8 A;  3T53 B;  1BNZ A;  3J7Z C;  2EYP A;  3C1E A;  2UXC Q;  3GV3 A;  4NDX A;  1DXM A;  3J81 j;  2LMC B;  3I4M H;  4B3R Q;  3A7A B;  3I3C A;  2F0W A;  4FXK C;  4IUQ A;  3I4M B;  3H3V H;  2D2C C;  2OXP A;  3NQI A;  1WD1 A;  2NZ1 D;  1B8A A;  3G6J B;  3SDZ A;  3E6Z X;  5IWA Q;  3NQT A;  4TSS A;  1ASZ A;  1F9P A;  2LY7 A;  2OWO A;  1LAC A;  1ET6 A;  3PF5 A;  3GTG H;  4KD3 A;  5DAU A;  1J8I A;  2ZXP A;  2JA5 H;  3GTG B;  4DV7 L;  4NXM L;  2JEB I;  3ULL A;  2DNC A;  1SRU A;  4A75 A;  3KLR A;  1PH6 A;  3OIP A;  5D14 A;  3OSO A;  1NJI C;  3OMC A;  3T16 A;  4OL7 A;  1A8V A;  1ZYR D;  2IHF A;  2B63 H;  1EYC A;  2R92 H;  2B63 B;  1TS2 A;  2R92 B;  1CA5 A;  1B1Z A;  4JI1 Q;  5GAG C;  4I7Z C;  1SNP A;  2VQF Q;  1HTP A;  1CZW A;  4WJ3 M;  4JV5 Q;  1CI3 M;  2OEO A;  4NB3 A;  1B3A A;  4IUU A;  4WRD A;  1VQC A;  4DPG A;  2CW0 C;  4DR4 Q;  3OYY A;  5LL6 S;  1QNK A;  5D3D A;  4CKB A;  1V1P A;  4XYQ A;  1YHB A;  1B50 A;  1DJR D;  3HKZ G;  4ZAI A;  2CH4 A;  2Q2I A;  2R6G A;  2K1B A;  5E3F A;  5K36 H;  1HHV A;  1VQI A;  4RMF A;  1H9R A;  2Z1C A;  2E74 C;  1YEZ A;  1BKB A;  3DM1 A;  1IXR A;  2F0F A;  3ND8 A;  3HOX H;  3UE0 A;  4DAY A;  3HOX B;  4LFC Q;  2EJM A;  3ERQ A;  2CKZ B;  3S17 H;  1WTR A;  3HFZ B;  3FPU B;  2AWN A;  4XIG S;  1I5F A;  1LYL A;  4C56 C;  5EQ0 A;  4DUZ L;  3J81 L;  3IKJ A;  5JJL A;  3QIA A;  1N33 L;  1PH3 A;  2B29 A;  1UEB A;  1U4L A;  1K28 A;  4JG2 A;  4A3M G;  4RGO S;  3KDF A;  3GD7 A;  1IL8 A;  3DHQ A;  3QO2 A;  4HAE A;  5FO7 B;  1SNM A;  2EXZ A;  3A8K E;  3U9O A;  2UXC L;  3SK6 A;  3UDG A;  3ICE A;  1P8L A;  3KF8 A;  4KN4 C;  1BOS A;  2EYF A;  2K32 A;  5KNC A;  4PG3 A;  4JYA L;  3A54 A;  1DOM A;  1KDB A;  3NE5 B;  3HOW H;  2WAQ B;  1E2V A;  4IUN A;  4FF1 A;  4WJ4 A;  2F3W A;  3HOW B;  4XT1 B;  2N3S A;  4YIJ A;  5ISR A;  3CXC A;  1JE5 A;  5C3E H;  1I94 Q;  3S2H H;  5C3E B;  2BCO A;  1PZI D;  1S3O A;  2NN6 H;  4A3I H;  2AWO A;  4A3G G;  1HRJ A;  1IBM L;  1R4P B;  4G7O C;  2Z6K A;  4AQY L;  2KHI A;  2L5T A;  1H9S A;  5EBC A;  1E2Z A;  4M8A A;  3SVM A;  3MFY A;  1A3U A;  3MXG A;  3D8G A;  1D2B A;  3KLW A;  1A15 A;  1YIT A;  3CHB D;  5IYB G;  1PRT B;  4DNR B;  5M3F H;  4X62 Q;  5M3F B;  3ERO A;  3F2D A;  1K3R A;  4AYB G;  5C4X G;  2L1B A;  3M4O H;  4HTH A;  3M4O B;  3TDQ A;  4J6H A;  5ELD A;  3MXU A;  4LF7 L;  5KGU A;  2F0K A;  5C3W A;  1SNO A;  1DD2 A;  5IP7 H;  1L0W A;  5DEH A;  3CCU A;  4DV0 Q;  1U4P A;  1JOR A;  2Y0S B;  2PNH A;  4MN3 A;  5TSS A;  4DR4 L;  1IBL L;  2B39 A;  1AZP A;  1KAB A;  2FXQ A;  4OWW B;  4NW2 A;  4XQQ A;  4K5W A;  1KAW A;  4C3I G;  4TQU S;  3T13 A;  4C1N I;  3PUV A;  2K5W A;  1GUS A;  3SEB A;  5FLM H;  2HIV A;  5G3L F;  5IGE A;  1JE4 A;  2PMZ E;  3T1H Q;  1XPR A;  3C46 A;  1A2U A;  2EY2 A;  5LMN Q;  4IJL A;  5EPL A;  5C44 G;  1MBY A;  1X32 A;  2PYK A;  4Z9C B;  1NR2 A;  3T4A C;  1BBU A;  1F9Q A;  2N88 A;  3MXP A;  2H5X A;  4JI2 Q;  2F0M A;  2MGS A;  5IYD G;  3GTO H;  2HCI A;  1MIU A;  3TBI B;  3GTO B;  4A3L G;  2KQ3 A;  1SSO A;  3LWE A;  2R61 A;  2AHO B;  2DUD A;  1GM5 A;  1TWA H;  1JR0 D;  2KCN A;  1TWA B;  1PZJ D;  5GAD C;  3FKI G;  5K5P A;  2R93 G;  1TWH H;  3S1M H;  3K5O A;  1X54 A;  1L1O A;  1TWH B;  1NTG A;  5BN3 A;  3S1M B;  1M1K C;  4JI3 Q;  1X6O A;  3LGJ A;  2EJG C;  2EYL A;  3G4S A;  2E2I H;  3Q6S A;  3KOJ A;  2MO0 A;  2N49 A;  2F4I A;  1WTO A;  2UUA Q;  2K5D A;  2QDB A;  3J7A V;  2IW3 A;  1XMO L;  3TP7 A;  2RDF A;  4NMZ A;  5HUR A;  3AQQ A;  4A3K H;  1JMC A;  4RA8 A;  4A3K B;  4PZ7 A;  1PA6 A;  1E24 A;  2R7Z H;  2LS0 1;  3GTM H;  2R7Z B;  4X3U A;  4JBW A;  3GTM B;  2NZH A;  2EJF C;  4JVZ A;  4X62 L;  3BJU A;  1LLR D;  4IFD H;  1K8O A;  5CV7 A;  2YYZ A;  3FEW X;  4L5Q A;  1KHI A;  3Q24 A;  1HQM C;  2B2V C;  4GS3 A;  3I4O A;  3PMF A;  2L55 A;  2DY8 A;  5JAV A;  1N34 L;  1A3T A;  2FHT A;  4CJ0 B;  1HZC A;  5IYC G;  3K5L A;  4C3H B;  4Y52 H;  4ABN A;  3TSS A;  4X65 Q;  4FF2 A;  1ROD A;  3HOV H;  4CJ2 C;  5COY A;  1LTI D;  3HOV B;  3NTH A;  3BDC A;  2BE5 D;  1DM0 B;  3E0J A;  1QOH A;  2YTY A;  2JE6 I;  4ZUJ A;  5NUC A;  5M9O A;  3M85 A;  3KF6 B;  1O7L A;  2F1M A;  3NP8 A;  3TS0 A;  1IBK Q;  2BH8 A;  1C8C A;  1U5K A;  1UEA B;  4J1M A;  1QZG A;  3SXH A;  1WJJ A;  2MQH A;  4JC0 A;  2A68 D;  4O2D A;  4LF4 Q;  1EEI D;  3GTK H;  3S16 H;  5LMN L;  1F9S A;  3S16 B;  1A6X A;  4DR5 Q;  3PUX A;  4POG A;  2VUM G;  2PPB C;  4JI2 L;  2K7V A;  3A7L A;  4LNQ A;  1STH A;  1S40 A;  1G2T A;  1GHK A;  3CC7 A;  3PIO 3;  1Z7T A;  4A93 G;  5IOD A;  1PHJ A;  3HKS A;  4R8I A;  1ET9 A;  3ULJ A;  1A63 A;  4DR6 Q;  2AKW B;  1PH5 A;  4TVA B;  5HGT A;  2DNE A;  1KTK A;  1NBW A;  2JA7 H;  1UNS A;  1QUQ A;  2F0O A;  1VCI A;  2R7F A;  1GUO A;  1N9W A;  4BY1 H;  4UPA A;  3U4Z A;  2E5L Q;  3D4D A;  3S14 B;  4BY1 B;  3T56 B;  4S3S A;  3QB3 A;  1MI2 A;  1ICF B;  1V43 A;  1QVG A;  1II3 A;  4IAL A;  1Y1W H;  2WAQ E;  1BDO A;  4LWC A;  3NK9 A;  2B2U C;  5KYL A;  1HNX L;  2UUA L;  4HJ8 A;  4K5X A;  4K5V A;  1HZA A;  4ZUI A;  1X65 A;  5IE8 A;  1IKM A;  2E75 C;  2K03 A;  4UDU C;  2ID0 A;  2HHH Q;  2EY5 A;  3PGZ A;  1S5D D;  4GOP C;  1SE2 A;  1EY4 A;  5DM7 3;  1SAP A;  3Q8D A;  3DWP A;  4DR3 Q;  1LTS D;  3BDL A;  3PIP 3;  4BXX H;  3NTK A;  1KD1 C;  1PTO F;  1B2T A;  4JPB W;  3HGB A;  2PQA A;  2RF4 A;  2JK8 A;  2XWB B;  2MNA A;  5FO8 B;  2F0G A;  1TWF H;  2MP1 A;  3FP9 A;  3U58 A;  4LF6 Q;  4FVM A;  1Q8I A;  2K5N A;  2QEX A;  1TWF B;  1HFN A;  5KNB A;  1PMR A;  3VR3 A;  1YJW A;  2Y0S E;  1PH2 A;  1PTO D;  3A8I E;  4ME3 A;  2Z8L A;  1JJ2 A;  2SOB A;  4DK6 C;  4IPC A;  4PMB A;  3NUC A;  5JOB A;  2F0L A;  2YTV A;  1DOL A;  1HFG A;  4DAY B;  4YHH Q;  2E2H B;  2ZJR A;  3NWT A;  5FJ8 G;  2XWJ B;  1BCP F;  4NPS A;  3I4N G;  3PSI A;  3CCE A;  1W3S A;  4IN3 A;  2DY7 A;  3HOZ G;  1CM9 A;  1IBK L;  4DXF A;  1I4X A;  4LUO A;  4P73 A;  1K3B C;  2ES2 A;  3DEP A;  4JI7 Q;  3KDF B;  2N78 A;  1EOT A;  1KRS A;  1GUG A;  3I70 A;  1KC8 C;  2WAC A;  1HA5 A;  4P2C B;  4JOI C;  5J39 A;  3KF8 B;  3KK7 A;  2CQA A;  4BBS H;  1TU2 B;  2Q8I B;  3W1B A;  4NXN Q;  3RZO B;  1TR5 A;  1BO0 A;  4OO1 I;  3MFG A;  1F2Z A;  1X56 A;  2DGY A;  3K0X A;  3LX0 A;  3VYT A;  5KIX A;  1O7I A;  5COR A;  4XTC S;  3OW7 A;  4BY7 G;  4K6D A;  3L0O A;  3OIQ A;  1XMQ Q;  4CDE C;  4UP8 A;  3K58 A;  1OO9 B;  2WB1 B;  1PFN A;  1JOK A;  3I8Z A;  1BBX C;  2F0D A;  1YIJ A;  1SDF A;  1DCZ A;  2CHB D;  1JB7 A;  1HNW Q;  1G8Z D;  1H9S B;  1B3Q A;  2PW7 A;  1Q12 A;  1VF7 A;  4KV6 A;  4A3F H;  4C3J B;  3HZX A;  3F2U A;  3M4Q A;  1GUW A;  1EY0 A;  3J81 c;  2OT2 A;  5M3M H;  5M5Y B;  5AFW A;  2FMM A;  1LTG D;  3TRE A;  3I7F A;  3EBE A;  2I5M X;  1NE3 A;  1H95 A;  3HOY H;  2HHH L;  2LFN A;  3EA6 A;  3OWE B;  1HCZ A;  1EWH A;  3GTP H;  3L3O C;  1EIG A;  3GTP B;  5JEA J;  3BG3 A;  4L6T B;  4BBS G;  1E3P A;  3K5M A;  3J80 c;  1V8Q A;  3HOU H;  4OEM B;  3H0G H;  2XSC A;  2Z9H A;  3H0G B;  2L0C A;  4DR3 L;  4DUY L;  3DWA A;  3N52 A;  1ICW A;  3J7A F;  4R4I A;  1D7Q A;  4JI6 L;  2JP1 A;  3GTQ H;  2PZT A;  4PMW A;  2ZTD A;  3GTQ B;  4OWT B;  4O0A A;  2GVA A;  1B70 B;  3QWN A;  3CD6 A;  3S9W A;  3JAM c;  4B9W A;  4O42 A;  4DKA C;  2EPB A;  3HS0 C;  2JA8 B;  4KKS A;  1R9T H;  1R9T B;  1VQ8 A;  3AB9 A;  3S15 B;  4X6A H;  2EE1 A;  4A3E G;  1EY6 A;  5IGD A;  2D9U A;  2QEJ C;  2F4V Q;  1K73 C;  3F2C A;  2RCN A;  4APV A;  4IUV A;  4HJ7 A;  2PI2 E;  3MEH A;  3CC2 A;  1QG7 A;  4ID6 A;  2BE5 C;  1B44 D;  3F1Z A;  4G4K A;  5I6Y A;  2ZXR A;  1VQK A;  5IP9 G;  2NB0 A;  4BA1 I;  2AUK A;  5M5X H;  1EIY B;  2VB2 X;  3A5U A;  4DV6 L;  1VF5 C;  4B9X A;  1IZ6 A;  5M5X B;  1B53 A;  1O7Y A;  3D4W A;  4HJ9 A;  3JC6 6;  1WTW A;  3GTL B;  3CCR A;  3NSW A;  2YU9 H;  2A68 C;  3V2T A;  3IFD A;  3ONA B;  2O2L D;  2B8G A;  2EYH A;  5E4X A;  2E8G A;  5IGG A;  4HIM A;  3RNU A;  4A3D B;  2A5H A;  1L1O B;  1TS5 A;  3KBX A;  4LMQ D;  3K0Y A;  3L9A X;  4NXN L;  2JA6 H;  4CGY B;  4RG1 A;  2F0P A;  4KY5 A;  4EQ5 A;  1CT1 D;  5I4D A;  1EYD A;  1EQR A;  4JI4 Q;  4GLX A;  3H15 A;  1XXG A;  1F9R A;  3MA2 B;  1XMQ L;  4B3M Q;  2VS1 A;  1YNJ C;  2SNM A;  2IX0 A;  2GN5 A;  3BVZ A;  1F2L A;  4AIM A;  4B08 A;  4ALP A;  2EYO A;  2MJ8 A;  2NBF A;  1RDP D;  2F0V A;  1DZ1 A;  2E2D C;  1AN8 A;  1S5F D;  4QJF A;  1WTQ A;  1AH9 A;  4Q0F A;  1ENF A;  2K50 A;  2JA5 B;  3CCJ A;  4DV4 L;  2BOS A;  4LAA A;  2G9H D;  2KED A;  2F0I A;  2RA4 A;  1PFS A;  1YI2 A;  3C3L A;  2NYZ D;  4KHZ A;  1RTO A;  2KCM A;  3PO3 G;  4OON A;  2B2V A;  5I2X A;  1WYD A;  4KHP Q;  4K14 A;  3C2P A;  4IPH A;  1U9R A;  1SJH D;  4BA2 I;  1CSP A;  3UE1 A;  2OCE A;  1RKN A;  3CF5 A;  2JA6 G;  1J5E Q;  2WKD A;  4A3M H;  2UUC L;  4ZRZ A;  1ENC A;  1E0B A;  5BN4 A;  5IY0 A;  4A3M B;  3K81 C;  4EQN A;  1AP0 A;  4ZQ3 A;  2QA4 A;  1JT8 A;  3RLN A;  4QQB X;  1WI5 A;  1JIC A;  1SE8 A;  5HY6 A;  2ZTE A;  4KHV A;  2MHV A;  3ER0 A;  2UU9 Q;  4P72 A;  1LTT D;  1MGS A;  2IT1 A;  2XIW A;  4RFB A;  2UUB Q;  2L4N A;  1FD7 D;  1AZQ A;  3S1Q H;  1KLU D;  2IHE A;  1XNR Q;  3S1Q B;  2RSN A;  1TY0 A;  4CDC C;  1PTO C;  1MHW C;  5F2D A;  2G5D A;  2O5J C;  1V1O A;  1SNQ A;  3AYH B;  4LF8 Q;  3TP6 A;  1O7Z A;  3CME A;  1KQS A;  1VQL A;  4A3G H;  2F4V L;  2K6A A;  3S24 A;  4A3G B;  2NVY H;  5J3B A;  3S2D H;  3CC4 A;  4Y7N H;  2NVY B;  5ELN A;  3MTS A;  3J81 E;  3S17 B;  1A0I A;  3S2D B;  2B2T A;  2RVL A;  4Y7N B;  3T51 B;  1L0X B;  2OF1 A;  2JN4 A;  2IJ0 A;  5CR3 A;  4LF5 Q;  2HQL A;  5IYB H;  1S5B D;  3DWQ A;  1M4V A;  3I55 A;  1SE4 A;  2KJX A;  2RBM A;  3D0F A;  2E76 C;  5JJI A;  1QUQ B;  4XT3 B;  3J80 E;  2MO1 A;  1BCP C;  5C4X H;  1Q46 A;  3VR2 A;  1Y69 U;  1HZB A;  4AYB B;  4YWL A;  5C4X B;  1RIP A;  1DON A;  4IUT A;  4IOA A;  3J80 L;  5HGQ A;  3A8J E;  2YTX A;  5D65 A;  4DNI A;  2M2L A;  4B3R L;  1W2B A;  3P20 A;  3GV6 A;  2PZU A;  3KUP A;  3TRZ A;  2B2U A;  2KUM A;  3K80 C;  1CUK A;  4GNX C;  5AJ3 Q;  4P71 A;  2HT1 A;  3JAM E;  1JWU D;  4YY3 Q;  4PZ8 A;  2WB1 E;  3AFP A;  3FVQ A;  5IWA L;  4N8F A;  4C3I H;  3JAM L;  4X64 Q;  3C1F A;  3S2H B;  1EZ8 A;  4C3I B;  4A3I B;  2K33 A;  3PUW A;  1GO3 E;  1R4Q B;  1HXY D;  1UAP A;  4GOP A;  3QOJ A;  4H7B A;  2K5H A;  3VYU A;  3PO2 G;  1ESR A;  1HUM A;  1DOK A;  2BDN A;  1A62 A;  1E22 A;  4UHV A;  5KRU A;  1STG A;  2EQS A;  3ITP A;  4ULL A;  5C44 H;  1PYS B;  2ZM6 Q;  2QDL A;  2D0O A;  5C44 B;  1TVX A;  2A1A A;  1YVC A;  1E2W A;  2BDO A;  5EKL A;  4DAV A;  1KDA A;  1XYI A;  5IYD H;  4LF9 Q;  5EKI A;  3FRP B;  4QMG A;  1HJP A;  1S4Z A;  4K2K A;  4TKO B;  4JI1 L;  5C0X J;  3CCM A;  4KHP L;  1K83 H;  2ASB A;  4A3L H;  4RGN A;  3VA7 A;  2VQF L;  1K83 B;  1X3F A;  4JV5 L;  1IKL A;  4KTA A;  4HCS A;  4IQZ A;  3QJY A;  2N8N A;  4B3S Q;  2JA9 A;  1TWG H;  3FKI H;  2R93 H;  3FKI B;  3V05 A;  1F2Y A;  1ASY A;  1VQ5 A;  5KYI A;  4DV2 Q;  1UUP A;  2XTI A;  4DXG A;  1SYG A;  2QW7 A;  2XNA C;  4KD4 A;  3PUY A;  3BZD B;  3F8T A;  2WFW A;  5FKA C;  5E1F A;  2WII B;  3EIV A;  1KXL A;  2EIF A;  4LFB Q;  4EX5 A;  1ILQ A;  4GN5 A;  2BA0 A;  2EYM A;  3I72 A;  4FXD A;  3S1R H;  2N55 A;  1ENA A;  3S1R B;  4YWM A;  1Q81 C;  3OPO A;  2MUY A;  4LFC L;  4JOI A;  3BVG A;  1HNZ Q;  1FVI A;  1KAA A;  3Q0A A;  1DYQ A;  5G3L D;  4GZY C;  2DN8 A;  1H9J A;  2NVX H;  2NVX B;  2KHS A;  2UXD Q;  1EWC A;  5KND A;  4FO2 A;  4A3C G;  3A56 A;  4HIK A;  4DR7 Q;  1JOQ A;  1HA6 A;  4A3J G;  4FNF A;  1EWI A;  2ENB A;  2F3I A;  1PZK D;  4A3B G;  5I9P A;  1C4Q A;  4GLA C;  4HR7 B;  1VQD A;  3AMU A;  4GKK Q;  2M00 A;  5AJ3 L;  2E2I B;  2NWG A;  1RF2 D;  5IYC H;  1Y8P B;  4YY3 L;  4XQN A;  2Q8T A;  3PUZ A;  3TZD A;  1I94 L;  2P5Z X;  2RDG A;  4U67 3;  1GUT A;  1SFO H;  3X3M A;  1I4Q A;  2NN6 I;  4RCO A;  1I4H A;  5EBD A;  2E2J H;  1TKW B;  3K57 A;  1WCM G;  2E2J B;  3FPP A;  4BS9 A;  1IYV A;  5H1S E;  2A6E C;  3HG9 A;  3T1Y Q;  4UY8 C;  2J0T D;  4IUP A;  1Y8O B;  2Q2T A;  1Q8K A;  2NVQ H;  4QUC A;  1Y8N B;  3FHW A;  2NVQ B;  2ZJQ A;  4ZKB B;  1PLF A;  3E9I A;  2ZM6 L;  3HRZ C;  4JK1 C;  3SR1 A;  1B7Y B;  1NCV A;  1ILP A;  2KHJ A;  1W6K A;  2KBN A;  2VUM H;  1VQE A;  4MZ9 A;  1Y1V G;  4R9W A;  1S72 A;  2K14 A;  1A3V A;  1SMX A;  3KYH C;  3P1H A;  4A93 H;  1YBY A;  1FJG Q;  3WDN A;  4FP5 D;  4RGM A;  3U4V A;  1L2F A;  5C0X G;  1VDZ A;  4DV0 L;  3PV0 A;  1D1K A;  4JBJ A;  4EQO A;  4NKL A;  2VZA A;  2XRS D;  1TWC H;  3ULP A;  3HP3 A;  4ILW A;  4J15 A;  1TWC B;  4DV2 L;  1BBW A;  1FNW A;  3TS2 A;  1KNE A;  2KCC A;  1PVO A;  2A19 A;  1U4R A;  1B9M A;  2A73 B;  4UP7 A;  4X3T A;  1GUN A;  3IL8 A;  1G29 1;  1S5C D;  4ZLT F;  2O4X A;  4HSP A;  4QF4 A;  4X66 Q;  3T1H L;  1VQ9 A;  1XTC D;  3EVQ A;  1RHP A;  1KRT A;  1CHQ D;  1E1O A;  4R4T A;  1X9N A;  3GTK B;  2Q8R E;  2I07 B;  1PH4 A;  5ELE A;  1IHZ A;  4V19 0;  1YNN D;  1YHA A;  1HNZ L;  2F0U A;  1SR3 A;  3MXN A;  4RAU C;  3CPW A;  2B2T C;  4RCN A;  1KNA A;  3PF4 A;  5I9O A;  1YZ6 A;  1CKN A;  1WFQ A;  3RR5 A;  3DLL A;  5C0X I;  2KEE A;  4YCU A;  3W1G A;  3TP8 A;  5LMN W;  1EYA A;  4DR7 L;  1YNJ D;  1SXT A;  2A8V A;  2JA7 B;  1VQJ A;  1Q7Y C;  2JEA I;  4RGT A;  4K2L A;  2RDH A;  4JI3 L;  3K5N A;  4UP9 A;  2MPM A;  4HMI A;  4OX9 Q;  1AE3 A;  1Y1W B;  1G2S A;  1O80 A;  1UE5 A;  1ZXT A;  1W6J A;  1EU3 A;  1ZKO A;  1I4R A;  1SE3 A;  4H44 C;  5FJ8 H;  4C3H G;  5C4H A;  2J7Z A;  3E0E A;  1P16 A;  1I6H H;  1U4M A;  1HR0 Q;  2ATW A;  3D6C A;  1CKO A;  4H02 A;  2NVT H;  1I6H B;  3I4N H;  2NVT B;  3I4N B;  3HOZ H;  3IRB A;  4QCL A;  2AQ1 B;  3TZU A;  4KKU A;  5EPJ A;  3T1Y L;  1TQO A;  1C9O A;  4UAI A;  4N9T A;  1MD2 D;  4F87 A;  4K0K Q;  1CA6 A;  1BVS A;  3AU7 A;  3I90 A;  1X55 A;  1V1P B;  4JI8 Q;  1B4O A;  1PRT F;  1VQH A;  1FL0 A;  5A2Q E;  4OO1 G;  2JYO A;  2QF7 A;  4BBR G;  4HIO A;  2JQO A;  4HSV A;  5A2Q L;  4BY7 H;  3TP5 A;  3GP7 A;  1PRT D;  4QGU A;  1LTB D;  1JJG A;  4X65 L;  1KLG D;  1HUN A;  4DF7 A;  2CFM A;  3WOF A;  4LFA Q;  3Q22 A;  4F8M A;  1X3E A;  4OIJ A;  4G7Z C;  2VY3 A;  3NXW A;  2K75 A;  4QB4 A;  3O13 A;  1WTP A;  1B9N A;  1STE A;  5FO9 B;  3GTJ H;  1E7Z A;  1EOV A;  1TS4 A;  3CRL C;  3RUZ A;  2L12 A;  1QZH A;  3GTJ B;  1H9K A;  4LF4 L;  1I50 H;  2MFI A;  3H09 A;  1BCP D;  1I50 B;  4KMU C;  1SBB B;  4G57 A;  4JCV E;  4MTK A;  1NAP A;  4DV5 Q;  1T5E A;  4CBV A;  4GKJ Q;  1UE7 A;  2XVS A;  4DR5 L;  2HUG A;  2X6G A;  1BF4 A;  1SN8 A;  2VNU D;  4GNX A;  4BBS B;  4ZYS A;  2FFK B;  4JI0 Q;  2XGT A;  3OHX C;  3A5Z B;  4DR6 L;  1VQ4 A;  2YV5 A;  4C2M H;  3M3Y H;  4P75 A;  1PFB A;  4QL5 A;  3M3Y B;  3CW2 C;  1KDC A;  4DR2 Q;  1NSN S;  2VQE Q;  3RZD H;  1CK1 A;  2E5L L;  1BUV T;  5T1I A;  1SYF A;  4GOP B;  1PH8 A;  1C0A A;  1OXV A;  3DMU A;  5CV5 A;  5LHY 1;  5CGK A;  1VQN A;  1V9P A;  2V1C C;  4A3F B;  1EL0 A;  5CC4 A;  4RHS A;  4A3E H;  5EAY A;  4HCE A;  4A3E B;  3KFU A;  3SK5 A;  4HJA A;  5I6W A;  2KOL A;  3R3O A;  5M3M B;  2UXB Q;  1NMG A;  3IAY A;  4IO9 A;  4DAP A;  1JWS D;  4CJ1 B;  3WWV A;  5IP9 H;  3TQY A;  3HOY B;  1AEX A;  1PH9 A;  3TME A;  4K8J A;  4NP5 A;  2K01 A;  4DV7 Q;  4NXM Q;  1XPU A;  4PNY A;  1JOO A;  3HOU B;  2F03 A;  3H3V C;  4AH6 A;  4IJH A;  4PQX A;  4B3T Q;  2F0S A;  1SYC A;  5FOB B;  1QVC A;  3NBI A;  4DAM A;  1TS3 A;  3MZ5 A;  1YJ9 A;  4EVO A;  3D6W A;  1WTV A;  1VQF A;  4MIU A;  3P75 A;  2D0P A;  4JW0 A;  1QE6 A;  3SGI A;  1WOC A;  1Q90 A;  1EIF A;  4LF6 L;  4OIK A;  3G48 A;  1OXS C;  2CWP A;  4MHE A;  2BH2 A;  4IPD A;  4JBK A;  2EYJ A;  5ELF A;  2C9O A;  4H0L C;  4YHH L;  3K7U C;  4XXE A;  3MC0 B;  1AE2 A;  2O5I C;  5J1Z A;  1LTL A;  3SK4 A;  4G7H C;  3NEM A;  1SNC A;  3NTI A;  1VQ6 A;  1G6P A;  4YWK A;  3CQZ H;  1K9M C;  4JI5 Q;  2Q2H A;  1TII D;  3CQZ B;  1I6V C;  4C3J G;  4KJN A;  4HMJ A;  2X69 A;  5FK9 C;  1VQG A;  2F3V A;  3OTO Q;  4JI7 L;  2YU9 B;  4YCW A;  4V0B A;  2K5V A;  3PO3 H;  3DM3 A;  4DV5 L;  1YNN C;  3W5O A;  4L8J A;  5C4Z A;  3L2P A;  2D62 A;  3PIO A;  4M1U B;  2XN9 C;  4DUZ Q;  1TT2 A;  2Q2U A;  2EXD A;  1N33 Q;  2IPK D;  2JA6 B;  5A35 A;  4JI0 L;  2KEN A;  4KN7 C;  1GHJ A;  3K7A H;  1UE1 A;  1JJC B;  3R2I A;  1Y14 B;  3S1N H;  2HIX A;  2VQE L;  3S1N B;  1OTC A;  2EY6 A;  4A4I A;  3PCO B;  3F2B A;  1FGU A;  1HNW L;  2VXW A;  3HKZ B;  3BVM A;  1VQB A;  3CCQ A;  3BS1 A;  2JA8 G;  4JYA Q;  2A6E D;  4L63 B;  1VQM A;  2R7D A;  2I46 A;  1EZ6 A;  5T1G A;  3NBH A;  1TXY A;  4GLV B;  1C48 A;  5D3I B;  2AMC B;  3I91 A;  4CKE A;  3J81 i;  1XX8 A;  2PZW A;  1X3P A;  2HDM A;  4F7X A;  3RLO A;  4LW1 A;  2UXB L;  1PDQ A;  2VB3 X;  1IBM Q;  4AQY Q;  1D6E C;  2GVB A;  3N6R A;  2EDG A;  2WIN B;  4CDF C;  1STA A;  4HID A;  3K59 A;  3J80 i;  3MAQ A;  5JEA G;  3QOL A;  3PIP A;  2TSS A;  1EY9 A;  4O1N A;  5LMU Q;  4B3T L;  4EGV A;  4KJO A;  1RD9 D;  3D3R A;  3FDT A;  2VL6 A;  3FMC A;  4A3D G;  2LXK A;  1CZG A;  3RN5 A;  4H13 C;  4GN3 B;  4RKL A;  3PQI A;  4K8I A;  3JAM i;  4LF7 Q;  3I4M G;  4QIW B;  2J4X A;  4F88 A;  3UDI A;  3ZJY C;  4C1N K;  4N8X 1;  2KEC A;  1IBL Q;  1PRT C;  2KVM A;  2PQE A;  2ZTC A;  1HZ9 A;  4QUF A;  3R93 A;  3R8B A;  4XDX A;  4RHR A;  3MXN B;  5C3X A;  1L0Y B;  3PO2 H;  1EEF D;  2X6L A;  2RQX A;  2CH4 W;  1VQ7 A;  3PO2 B;  5JPN C;  1SYE A;  3NHH A;  4JI5 L;  4R4O A;  5CMD A;  1CKN B;  4L5S A;  2JA5 G;  2CWA A;  3OTO L;  4WOR A;  3RN2 A;  2HDL A;  3VYR A;  3DXJ C;  1FYC A;  5FLX E;  4DU9 A;  1BXT A;  1EYG A;  4A76 A;  3G6E A;  1M8A A;  1Z47 A;  4J8Q A;  5FLX L;  3M9B A;  1EY5 A;  2B63 G;  2EY1 A;  2R92 G;  3BDO A;  4JI4 L;  1LTA D;  2JSO A;  3I73 A;  4KY6 A;  2GA4 B;  3NEL A;  3STB D;  3H3V I;  2JXM B;  4B3M L;  1K0R A;  1K8A C;  4FF4 A;  5LL6 X;  2ALY B;  1WTX A;  4HED A;  5IGB A;  3X3N A;  1SLJ A;  1UWV A;  1IYJ B;  4LUV A;  1Q82 C;  2JJQ A;  4K6L A;  1MSG A;  1I4G A;  4L5T A;  1N32 Q;  5K36 G;  3RD4 A;  2Z6B A;  3IFT A;  3GQB A;  4L5R C;  1OXT A;  2F0Q A;  2Z4H A;  5IGC A;  3A0J A;  3CCV A;  1XMO Q;  1NY4 A;  1H9M A;  2IL8 A;  5DLQ E;  1QIL A;  2B2W C;  3HOX G;  2QCP X;  2PQA B;  4LJZ C;  1JQY D;  1YNX A;  2WV6 D;  1LM0 A;  1EQQ A;  3GO5 A;  3RLF A;  2NUC A;  3HEJ A;  1PTO H;  1QWY A;  1PTO B;  3M4P A;  2DJG C;  1J6Q A;  1J5E L;  1STY A;  1STN A;  4A3C H;  5JJZ A;  5IGF A;  5LMU L;  2CVR A;  5IT9 E;  1YJN A;  2WKC A;  3UDF A;  1TWG B;  2FIN B;  4A3J H;  2B2Y C;  2K5Q A;  5GRO A;  2FMC A;  1G51 A;  3KJP A;  4A3J B;  2R93 B;  4CHT B;  2ZJP A;  4A3B H;  5IT9 L;  3J7Y W;  1K8M A;  1I4P A;  5CYU A;  4A3B B;  2LSS A;  2NTS A;  2UU9 L;  5IOC A;  3H6M A;  4N9P A;  3ERS X;  2UUB L;  2A74 C;  3UDX A;  1VQO A;  1SRO A;  1NNX A;  1XNR L;  1JCK B;  2WAQ G;  3VA5 A;  1N34 Q;  1N36 Q;  3HOW G;  1BCP B;  1F2M A;  3EN2 A;  4LF8 L;  3AFQ A;  5C3E G;  4HJ5 A;  1O78 A;  4X3K A;  4A3I G;  2AQ3 B;  2NN6 G;  1IL2 A;  2C5C A;  1LTR D;  1LV9 A;  2PNR C;  1WCM H;  3VR6 A;  4GNX B;  1WCM B;  1Z9F A;  2K04 A;  1U0L A;  3D31 A;  2PW5 A;  1CQV A;  2QKI C;  2SNS A;  2NZO A;  3NWS A;  1EFI D;  4LF5 L;  1GVP A; 
#chains in the Genus database with same CATH homology
 4IFD J;  5JEA J;  1UE5 A;  4BBS G;  1E3P A;  1YHB A;  5M3F G;  3J80 c;  3HKZ G;  3HOU H;  1Y1V H;  2Q2I A;  2R6G A;  3H0G H;  1VQI A;  5FJ8 H;  5C4J H;  4RMF A;  3E0E A;  1P16 A;  1I6H H;  1HR0 Q;  2ATW A;  4DR3 L;  1CKO A;  4H02 A;  4DUY L;  2NVT H;  4LUZ A;  3I4N H;  4R4I A;  1D7Q A;  4JI6 L;  3GTQ H;  4PMW A;  2ZTD A;  1YEZ A;  1BKB A;  4OWT B;  1IXR A;  4O0A A;  2GVA A;  1B70 B;  3HOX H;  3UE0 A;  3HOZ H;  3CD6 A;  3IRB A;  5IP7 G;  1NMF A;  4LFC Q;  3JAM c;  4DKA C;  2Y0S G;  2CKZ B;  3S17 H;  3T1Y L;  1C9O A;  3HFZ B;  1R9T H;  1Q1E A;  2AWN A;  4X64 L;  4P74 A;  4XIG S;  1I5F A;  1LYL A;  3HKZ E;  4KLK A;  1LUZ A;  4K0K Q;  1VQ8 A;  5GQO A;  4DUZ L;  1BVS A;  3MEF A;  3BZC A;  4X6A H;  5JJL A;  4A3E G;  1X55 A;  1N33 L;  4JI8 Q;  1PH3 A;  1VQH A;  1N32 L;  1VQP A;  1FL0 A;  1UEB A;  2B29 A;  1UE6 A;  1I3Q H;  2F4V Q;  4JG2 A;  1K73 C;  3CPF A;  2RCN A;  4APV A;  3F2C A;  4A3M G;  3KDF A;  1X3G A;  3M7N A;  4BBR G;  3GD7 A;  4HIO A;  2JQO A;  2KCT A;  4R4C A;  2PI2 E;  5FLM G;  4HJ7 A;  1HNX Q;  3CC2 A;  2B3G A;  3F1Z A;  1VQK A;  5IP9 G;  4BY7 H;  2UXC L;  4BA1 I;  5M5X H;  1EIY B;  3A5U A;  4DV6 L;  4POF A;  3UDG A;  3ICE A;  1IZ6 A;  1P8L A;  4YCV A;  4HJ9 A;  2OQK A;  3JC6 6;  3I56 A;  1E1T A;  4QGU A;  4PG3 A;  4JYA L;  1JJG A;  4X65 L;  3CCR A;  2YU9 H;  3HOW H;  4LF9 L;  4WJ4 A;  2CFM A;  4R1J A;  1T9H A;  4LFA Q;  3CCL A;  2N3S A;  1X3E A;  2E8G A;  2VY3 A;  1CSQ A;  3CXC A;  4HIM A;  3RNU A;  1D8L A;  1JE5 A;  2K75 A;  5C3E H;  1L1O B;  1I94 Q;  3S2H H;  1S3O A;  4A3I H;  4B3S L;  2AWO A;  1M90 C;  3NEN A;  4A3G G;  3CAM A;  3GTJ H;  1IBM L;  4NXN L;  1E7Z A;  1EOV A;  2Z6K A;  4AQY L;  1QZH A;  2KHI A;  2JA6 H;  4RG1 A;  4EQ5 A;  4LF4 L;  1I50 H;  1EQR A;  2MFI A;  4JI4 Q;  4GLX A;  3H15 A;  1VQA A;  4JCV E;  3KLW A;  1XMQ L;  4DV5 Q;  4B3M Q;  4GKJ Q;  4QIW E;  2VS1 A;  1UE7 A;  4DR5 L;  1YIT A;  2IX0 A;  2GN5 A;  5IYB G;  4AIM A;  4LFB L;  5M3F H;  4X62 Q;  1OXX K;  1SN8 A;  2VNU D;  4ALP A;  4GNX A;  2CQO A;  1EFW A;  3F2D A;  1N36 L;  4C3H H;  1K3R A;  4AYB G;  5C4X G;  3M4O H;  4JI0 Q;  4KI0 A;  2XGT A;  3A5Z B;  4QJF A;  4DR6 L;  1AH9 A;  1VQ4 A;  2YV5 A;  4C2M H;  3M3Y H;  4P75 A;  2K50 A;  2OTL A;  3CCJ A;  2I5L X;  4QL5 A;  4DV4 L;  4LF7 L;  4A3K G;  5GAH C;  3CW2 C;  4DR2 Q;  2VQE Q;  3RZD H;  5IP7 H;  1L0W A;  2E5L L;  3CCU A;  4DV0 Q;  1Q86 C;  4GOP B;  1PFS A;  1PH8 A;  1YI2 A;  1OXV A;  2PNH A;  1C0A A;  2R7Z G;  4DR4 L;  4KHZ A;  3BZK A;  1IBL L;  2KCM A;  4OWX B;  1VQN A;  1V9P A;  3PO3 G;  2V1C C;  4OON A;  2UXD L;  2FXQ A;  4OWW B;  1WYD A;  1KAW A;  4KHP Q;  4AYB E;  5EAY A;  4A3E H;  4IPH A;  4TQU S;  3KFU A;  3PUV A;  4BA2 I;  1CSP A;  3UE1 A;  4HJA A;  2OCE A;  3CF5 A;  2JA6 G;  4IFD G;  1J5E Q;  4A3M H;  2UUC L;  2UXB Q;  1NMG A;  4BBR H;  5FLM H;  1HH2 P;  2HIV A;  4IO9 A;  5IY0 A;  3L7Z C;  3K81 C;  3WWV A;  2QA4 A;  1JT8 A;  5IP9 H;  3TQY A;  2PMZ E;  3RLN A;  3T1H Q;  1XPR A;  4GKK L;  4QQB X;  2OTJ A;  1WI5 A;  3NBH B;  1SE8 A;  5HY6 A;  1PH9 A;  5LMN Q;  4IJL A;  2ZTE A;  3ER0 A;  2UU9 Q;  3STB C;  4QY7 A;  4P72 A;  5C44 G;  1PH1 A;  1XJV A;  4DV3 Q;  4DV7 Q;  2IT1 A;  4NXM Q;  1XPU A;  4OO1 G;  1MJE A;  1BBU A;  2UUB Q;  4AH6 A;  3S14 H;  4IJH A;  2H5X A;  4JI2 Q;  4B3T Q;  3S1Q H;  5IYD G;  2IHE A;  1XNR Q;  3GTO H;  1QVC A;  1MIU A;  4DAM A;  3HOV G;  1YJ9 A;  4A3L G;  1PV4 A;  1VQF A;  3AYH B;  4LF8 Q;  3CME A;  1KQS A;  1VQL A;  4A3G H;  2AHO B;  2DUD A;  1GM5 A;  2F4V L;  2D0P A;  3S24 A;  3SGI A;  2QGQ A;  1WOC A;  1TWA H;  2NVY H;  5J3B A;  4DV1 Q;  3S2D H;  1EIF A;  3CC4 A;  4Y7N H;  4LF6 L;  5ELN A;  4OXP A;  5GAD C;  3CCS A;  3FKI G;  1Q1B A;  1A0I A;  2R93 G;  1TWH H;  3S1M H;  1X54 A;  1L1O A;  1NTG A;  3G48 A;  1M1K C;  1OXS C;  4JI3 Q;  1X6O A;  2CWP A;  2BH2 A;  4IPD A;  2HQL A;  4JBK A;  4LF5 Q;  5IYB H;  3LGJ A;  3I55 A;  4DR1 Q;  3G4S A;  2E2I H;  3KOJ A;  4YHH L;  4IFD I;  3K7U C;  2Z6K C;  1AE2 A;  3D0F A;  2MO0 A;  3U50 C;  5JJI A;  1KL9 A;  1QUQ B;  2VW9 A;  2MO1 A;  2N49 A;  1LTL A;  5C4X H;  1Q46 A;  4JBM A;  2UUA Q;  3NEM A;  1FJG L;  1HZB A;  4YWL A;  1RIP A;  2F52 A;  1VQ6 A;  3CP0 A;  1XTD A;  1XMO L;  1G6P A;  4IOA A;  4YWK A;  3CQZ H;  2L15 A;  5HGQ A;  4GN4 B;  1K9M C;  4JI5 Q;  2Q2H A;  1XNQ Q;  3VDY A;  4GKJ L;  2YTX A;  3AQQ A;  4DUY Q;  4A3K H;  4DNI A;  1JMC A;  4B3R L;  5BR8 Q;  1W2B A;  4JI6 Q;  3TRZ A;  3BU2 A;  1GKH A;  3K80 C;  1VQG A;  1CUK A;  4IPG A;  4GNX C;  2JA7 G;  5AJ3 Q;  4PZ7 A;  3OTO Q;  4P71 A;  4JI7 L;  1PA6 A;  2HT1 A;  1GD7 A;  1E24 A;  2R7Z H;  4BY1 G;  3E9H A;  1PH7 A;  3GTM H;  4YCW A;  4YY3 Q;  2K5V A;  4PZ8 A;  4JBW A;  3PO3 H;  3DM3 A;  2NZH A;  5M5W H;  2WB1 E;  4DV5 L;  3AFP A;  5GAE C;  2OQ0 A;  3W5O A;  5IWA L;  4C3I H;  1N8R C;  4X64 Q;  3L2P A;  2WP8 J;  3G71 A;  4X62 L;  2D62 A;  3BJU A;  3PIO A;  1Y1W G;  1EUJ A;  3A74 A;  1GO3 E;  3PUW A;  4DUZ Q;  2YYZ A;  4X66 L;  4GOP A;  2I0Q A;  2Q2U A;  2K4K A;  1OXU A;  2EXD A;  2E2H H;  1N33 Q;  2K5H A;  4JI0 L;  2KEN A;  4L5Q A;  1KHI A;  1V1Q A;  3CMA A;  3PO2 G;  3K7A H;  1UE1 A;  1JJC B;  1A62 A;  4GS3 A;  1E22 A;  2C35 B;  1Y14 B;  3S1N H;  3I4O A;  5JJK A;  2HIX A;  2VQE L;  1VS0 A;  2EQS A;  1OTC A;  1C7Y A;  4A4I A;  3PCO B;  5C44 H;  3F2B A;  1FGU A;  1PYS B;  1N34 L;  2ZM6 Q;  1HNW L;  2D0O A;  4DV6 Q;  2A1A A;  1YVC A;  1HZC A;  5IYC G;  1VQB A;  3CCQ A;  4Y52 H;  2JA8 G;  4JYA Q;  5IYD H;  2Z0S A;  4X65 Q;  1VQM A;  3HOV H;  2R7D A;  4LF9 Q;  4GLV B;  1HJP A;  1TXY A;  4JI1 L;  5C0X J;  3CCM A;  4KHP L;  4A3L H;  1K83 H;  2ASB A;  2AMC B;  2VQF L;  4BXX G;  1X3F A;  2YTY A;  2JE6 I;  3J81 i;  4JV5 L;  3M85 A;  3KF6 B;  2N8N A;  4LW1 A;  3RLO A;  2JA9 A;  1TWG H;  4B3S Q;  3RZO H;  3TS0 A;  2UXB L;  3FKI H;  2BH8 A;  1IBK Q;  1IBM Q;  4AQY Q;  1U5K A;  2R93 H;  1QZG A;  4OX9 L;  1ASY A;  1VQ5 A;  2GVB A;  1WJJ A;  2MQH A;  4JC0 A;  2RHS B;  4O2D A;  4DV2 Q;  4LF4 Q;  3GTK H;  3S16 H;  4FDB A;  5LMN L;  2XTI A;  4HID A;  3J80 i;  3PUY A;  4DV3 L;  3F8T A;  5JEA G;  2WFW A;  4DR5 Q;  3PIP A;  3PUX A;  3EIV A;  4POG A;  1KXL A;  2VUM G;  2EIF A;  5LMU Q;  4JI2 L;  1MKH A;  4EX5 A;  1HR0 L;  4B3T L;  4LFB Q;  4LNQ A;  1S40 A;  4GN5 A;  2CCZ A;  2BA0 A;  3S1R H;  3CC7 A;  1L1O C;  1RL2 A;  4A93 G;  1PHJ A;  2VL6 A;  3HKS A;  4YWM A;  4A3D G;  1Q81 C;  2LXK A;  3ULJ A;  1A63 A;  3RN5 A;  4DR6 Q;  2AKW B;  4C3J H;  4GN3 B;  1PH5 A;  4LFC L;  4JOI A;  4TVA B;  3JAM i;  5FLX c;  2JA7 H;  1NBW A;  4DV1 L;  1QUQ A;  4DV4 Q;  1HNZ Q;  1VCI A;  2R7F A;  4LF7 Q;  3I4M G;  1FVI A;  1N9W A;  5M5Y H;  4BY1 H;  4MTN A;  4UPA A;  3U4Z A;  4K0K L;  2E5L Q;  2RHQ B;  3GDE A;  3UDI A;  1HR0 W;  2NVX H;  3ZJY C;  1DGS A;  3KJO A;  5ELO A;  4JI8 L;  4DK3 C;  4DR1 L;  1IBL Q;  1V43 A;  2LXJ A;  1Y1W H;  1QVG A;  4R4Q A;  2WAQ E;  2K52 A;  4LWC A;  2UXD Q;  2ZTC A;  4A3C G;  1HZ9 A;  4HIK A;  4DR7 Q;  1HNX L;  2UUA L;  3MXN B;  4HJ8 A;  1HZA A;  4A3J G;  1EWI A;  1X65 A;  3PO2 H;  3K8A A;  1VQ7 A;  2F3I A;  3TEH B;  5IE8 A;  3OW2 A;  1XNQ L;  1YHQ A;  2UUC Q;  4A3B G;  4JI5 L;  4R4O A;  4PZ6 A;  3J7A 5;  1CKN B;  4GLA C;  3I2Z A;  5BR8 L;  2ID0 A;  4L5S A;  2JA5 G;  2CWA A;  2HHH Q;  1VQD A;  4GKK Q;  2WB1 G;  5AJ3 L;  3OTO L;  1CKM A;  3PGZ A;  3RN2 A;  1XPO A;  4GOP C;  5IYC H;  1MJC A;  4LFA L;  2JA8 H;  4YY3 L;  1EYG A;  3PUZ A;  1I94 L;  3Q8D A;  4A76 A;  3G6E A;  1Z47 A;  4A3F G;  4DR3 Q;  3M9B A;  2B63 G;  4BXX H;  1QVF A;  2R92 G;  3S15 H;  1SFO H;  1KD1 C;  2NN6 I;  2E2J H;  1WCM G;  5E7N A;  4JI4 L;  4IOC A;  3NEL A;  3STB D;  3H3V I;  2PQA A;  2RF4 A;  5M3M G;  2JK8 A;  5H1S E;  2IY5 B;  2MNA A;  3U58 A;  1TWF H;  3FP9 A;  1K0R A;  4B3M L;  3T1Y Q;  4LF6 Q;  2Q2T A;  2K5N A;  1K8A C;  4UY8 C;  1Q8K A;  2QEX A;  2NVQ H;  3AEV A;  3FHW A;  3HOY G;  2ALY B;  2ZJQ A;  2I5H A;  1YJW A;  2PI2 A;  3E9I A;  5IT9 c;  2Y0S E;  2ZM6 L;  1PH2 A;  4ME3 A;  2IX1 A;  1JJ2 A;  1SLJ A;  3KF6 A;  1B7Y B;  1UWV A;  1IYJ B;  4MNO A;  4IPC A;  2KHJ A;  4LUV A;  3B6Y A;  2KBN A;  4DK6 C;  1VQE A;  2JJQ A;  1Q82 C;  2VUM H;  4MZ9 A;  3GTL H;  3HOU G;  1Y1V G;  2YTV A;  4L5T A;  4DAY B;  3H0G G;  4YHH Q;  1PYB A;  2ZJR A;  1N32 Q;  5FJ8 G;  1S72 A;  1KIX A;  5K36 G;  2K14 A;  1SMX A;  2BA1 A;  4NPS A;  3KYH C;  1K8G A;  4A93 H;  4A3D H;  1YBY A;  1FJG Q;  4L5R C;  1OXT A;  3PSI A;  3CCE A;  4DR2 L;  3I4N G;  3U4V A;  3A0J A;  1L2F A;  1W3S A;  5C0X G;  3J7Z C;  3CCV A;  1XMO Q;  2UXC Q;  1NY4 A;  4DV0 L;  3PV0 A;  5DLQ E;  3HOX G;  3J81 j;  3HOZ G;  4JBJ A;  1IBK L;  3I4M H;  4B3R Q;  2VZA A;  1TWC H;  3ULP A;  4J15 A;  2PQA B;  3H3V H;  4LUO A;  1YNX A;  4P73 A;  1LM0 A;  4DV2 L;  1EQQ A;  2ES2 A;  4JI7 Q;  3GO5 A;  3KDF B;  1BBW A;  3RLF A;  3TS2 A;  2N78 A;  1KRS A;  1KC8 C;  1PVO A;  2A19 A;  1B8A A;  3M4P A;  1J6Q A;  1J5E L;  4JOI C;  5IWA Q;  3KF8 B;  4UP7 A;  4A3C H;  5LMU L;  4BBS H;  1YJN A;  1G29 1;  3W1B A;  4NXN Q;  3UDF A;  1ASZ A;  4A3J H;  5GRO A;  1G51 A;  4OO1 I;  4X66 Q;  3KJP A;  2OWO A;  3T1H L;  1VQ9 A;  2DGY A;  1X56 A;  2ZJP A;  3K0X A;  4A3B H;  1KRT A;  1O7I A;  1E1O A;  4R4T A;  3PF5 A;  2LSS A;  1X9N A;  3GTG H;  4XTC S;  2UU9 L;  2JA5 H;  4BY7 G;  1PH4 A;  4DV7 L;  4NXM L;  3L0O A;  1XMQ Q;  4UP8 A;  2JEB I;  1YHA A;  3ULL A;  1HNZ L;  3ERS X;  2UUB L;  1SRU A;  3UDX A;  1SR3 A;  4A75 A;  3CPW A;  1VQO A;  1SRO A;  1YIJ A;  1JB7 A;  1PH6 A;  1XNR L;  2WAQ G;  1N34 Q;  1HNW Q;  1N36 Q;  3HOW G;  3PF4 A;  1NJI C;  1Q12 A;  1YZ6 A;  1CKN A;  1WFQ A;  3RR5 A;  3DLL A;  1A8V A;  3EN2 A;  2IHF A;  4A3F H;  4LF8 L;  2B63 H;  3AFQ A;  5C3E G;  5C0X I;  4YCU A;  4HJ5 A;  3W1G A;  2R92 H;  5LMN W;  4A3I G;  2NN6 G;  4JI1 Q;  1IL2 A;  5GAG C;  4DR7 L;  3M4Q A;  2A8V A;  1VQJ A;  1WCM H;  2VQF Q;  1Q7Y C;  2JEA I;  4GNX B;  3J81 c;  4WJ3 M;  1Z9F A;  5M3M H;  4JV5 Q;  1U0L A;  3D31 A;  4NB3 A;  1VQC A;  3TRE A;  4JI3 L;  3I7F A;  3EBE A;  4DPG A;  2NZO A;  4UP9 A;  4DR4 Q;  4LF5 L;  2I5M X;  1NE3 A;  3OYY A;  1H95 A;  3HOY H;  2HHH L;  4OX9 Q;  1AE3 A;  1GVP A;  3GTP H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...