4GLAC

Obody nl8 bound to hen egg-white lysozyme
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
89
Chain Sequence
LHGTEVVVAGWVASLGDYGRVKIVKVSDRGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
molecule keywords Lysozyme C
total genus 14
structure length 89
sequence length 90
chains with identical sequence D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glaC00
5C4JH 3MXNB 4A3EH 3T1YQ 1PH8A 2ZTCA 3CAMA 3H0GG 4JI2L 1OXSC 2HHHQ 2KCTA 2R6GA 1X6OA 1KRTA 4ALPA 4BY1H 3HOUH 2VQEL 3M7NA 1TWGH 3S16H 3DM3A 1YITA 1HZAA 1S72A 4GOPA 3CC2A 3G48A 4OONA 4DV2L 4NXMQ 3CCRA 1IXRA 4L5TA 3AQQA 1HZ9A 1Y14B 1X55A 5AJ3L 4AH6A 1CKNB 4JI3L 1L1OA 2N78A 1Z9FA 2VQFQ 5AJ3Q 5C44G 4JC0A 4XTCS 3NENA 3I4NH 4BBSG 4JYAL 1LM0A 3ERSX 5M3FH 4LF4Q 1PH2A 1VQNA 4A3FH 1HZCA 1XMQL 1NTGA 5IYDG 1JE5A 4QL5A 4R4QA 5IYDH 5C0XI 2A19A 5C4XH 5J3BA 4DKAC 5DLQE 4L5RC 5GAGC 4A3CH 2R92H 1HNWL 4GLXA 1P8LA 4JG2A 3RNUA 3I4MH 5JJKA 2MQHA 1VQKA 2LXJA 4YWKA 2ZJRA 3HKZG 2IHEA 4DPGA 4BA1I 3U4ZA 1I6HH 3PUZA 4Y7NH 4B3MQ 4JOIA 3ICEA 3GO5A 2ID0A 1KXLA 1PH9A 2BA0A 2ZM6Q 2K52A 4PZ8A 4HIDA 4IFDG 3PIOA 5GAEC 2PI2A 3OTOQ 5M3MG 4JV5Q 3K7UC 3UDIA 3GTGH 3KF8B 3HOWH 3I4OA 1K0RA 2N8NA 2ZJQA 1YHQA 4A3JH 3M4QA 4LF8L 1IYJB 1UE7A 2K50A 2RHQB 3G71A 4NB3A 1EFWA 1VS0A 4LFCQ 5IT9c 3EIVA 1WFQA 1A63A 1Q1BA 3CMAA 1ASYA 4LFBL 1HNXL 2UUCL 2DUDA 3FKIH 1Q86C 1IL2A 2IY5B 3T1HQ 4AQYL 1SN8A 3RLFA 3H3VH 3EN2A 4POGA 3M4PA 4DV0L 4DV7L 1QZGA 4KHPL 3T1HL 4P75A 4IFDI 1EIYB 2Q2UA 1K8GA 4DV5L 1CKNA 1N32Q 4DV0Q 4R1JA 3PUYA 1LUZA 4HJ7A 2JA8H 4DUZQ 4EQ5A 3H3VI 2ZJPA 2BA1A 3A0JA 4OWTB 4DR1Q 5IP7G 4LF7Q 2L15A 1BKBA 1GKHA 4OXPA 4JI1Q 5HGQA 1PH5A 4X64L 1PHJA 1G51A 3W1BA 4A3IG 4GKJL 3CPFA 4X66L 2Q2HA 4LF7L 3AFQA 4MZ9A 2RF4A 2F3IA 1L0WA 2MFIA 1CSPA 1HZBA 4DAYB 2AKWB 1FGUA 3F1ZA 1WJJA 1NJIC 1CSQA 4DR6Q 1WCMH 3KYHC 1J5EL 4LWCA 3MEFA 2ATWA 3E9IA 2HIVA 1PH7A 2I0QA 4LUOA 3CCJA 4QJFA 4DV4L 4JI2Q 1J5EQ 2JA9A 4LF9Q 2K5VA 5K36G 4X6AH 1BBUA 5FLMG 3CCEA 1Y1WH 1VCIA 3E9HA 1G291 1MKHA 4IPHA 1WYDA 4JCVE 1I50H 5FLMH 4GOPC 4GKKQ 1PFSA 1IBKL 2IX1A 3I7FA 1X9NA 4LNQA 4UP7A 4BXXH 2YU9H 2D62A 1HNZQ 3S1NH 4DR4Q 2E5LQ 5ELNA 5C3EG 5JJLA 1H95A 3M4OH 4NXML 4A3BH 2VQFL 3A5UA 3CCVA 1TWFH 1N34Q 3I56A 1LTLA 4B3SL 1I5FA 3JAMc 4HJAA 5GADC 4LW1A 2VUMH 4HJ9A 3KF6A 2NVTH 3HOYH 4YWLA 4B3SQ 4DK3C 4B3TL 1E7ZA 3H0GH 3S1QH 4UPAA 5IP9G 3KDFB 4A3IH 4BY1G 5IP9H 1XPRA 5H1SE 4LF4L 3K0XA 4P73A 4KHZA 1TWHH 4DUYQ 3PF5A 1VQCA 1VQ6A 3S2DH 4PZ7A 2JE6I 2AWOA 2D0OA 3W5OA 4BA2I 4A93H 1AH9A 2JEBI 3HOVG 3AEVA 1VQBA 3EBEA 4GN4B 1L1OB 1L2FA 4GN5A 4JI8Q 3GD7A 2E2HH 2I5HA 2WFWA 3PO2G 4KLKA 1VQLA 3ER0A 1Q81C 4GN3B 3PUWA 2OQKA 4JBJA 3CF5A 1KAWA 1SFOH 4LF8Q 4BY7H 3H15A 1BBWA 4IJHA 3F2CA 2CWPA 4LF6Q 3J7A5 2WAQE 2WAQG 5ELOA 4NXNL 3G4SA 4C3HH 4JI6Q 5E7NA 4HJ5A 5FJ8G 2H5XA 3HKZE 4GNXA 4MNOA 4RG1A 4LFBQ 1HR0W 3GDEA 4R4CA 3M9BA 3U4VA 1QVCA 4HJ8A 4JI4Q 2OTJA 5IYBH 4A3EG 4HIKA 4OWXB 4QIWE 4A3GH 3CPWA 4A3GG 5M5YH 3HOUG 1PVOA 4O0AA 2E2IH 3WWVA 5C3EH 1O7IA 2I5LX 2YTYA 2JQOA 1OXUA 4HIMA 1VQ8A 2KCMA 1A62A 3I55A 3CCSA 3STBD 1VQEA 1GM5A 4JI0Q 2JA8G 4DR5Q 2ZTDA 1VQHA 3L7ZC 1PYSB 4RMFA 4A3MG 3S14H 4KHPQ 4JI0L 4A3KG 4OX9Q 4DV5Q 4P74A 4GKJQ 3CC7A 1VQDA 2NN6G 2NN6I 1YBYA 3CC4A 3CXCA 2WP8J 4DR1L 1X65A 3E0EA 2MO1A 2E2JH 3I4NG 1JJ2A 3TREA 5M3FG 3BZCA 2MNAA 2B29A 4C2MH 1NE3A 3PV0A 2RCNA 1Y1VG 1XMOQ 1C9OA 2KENA 2DGYA 3B6YA 1Y1VH 2VZAA 1KRSA 1YJWA 4LFAL 3D0FA 2F52A 3F8TA 4DV4Q 4A3LG 2E8GA 1SRUA 5IE8A 1XMOL 1XNRQ 1GD7A 4AYBE 1N36Q 2YTVA 5LMNW 2UUBQ 2K75A 2KHIA 4DR2Q 2N49A 1VQOA 4GKKL 3FP9A 1KQSA 1XNRL 2VNUD 1HR0L 3PO3H 2JJQA 1DGSA 3K81C 3M3YH 4X65L 3IRBA 2LSSA 1YIJA 2JA6G 3S24A 3KDFA 3CCQA 1HNZL 3RZOH 4DV6L 1PH3A 3L0OA 1PYBA 3J80i 4IOCA 2R7ZG 1XPOA 2PI2E 1UE6A 2BH8A 1Q12A 4DAMA 1PH1A 1KL9A 1YVCA 1PV4A 1IBKQ 2ES2A 2A8VA 1P16A 1Q7YC 4JI5Q 3KLWA 2ALYB 4YHHL 4AIMA 1OXXK 4UP8A 1AE2A 4LUVA 4B3TQ 3LGJA 1GVPA 4POFA 5IYBG 2Z6KA 1RL2A 3RN5A 1XPUA 3BJUA 3A74A 3PSIA 1VQFA 4IJLA 1FL0A 1N33Q 4QY7A 4UY8C 2ZTEA 2F4VL 3ZJYC 1SR3A 2YTXA 4JBWA 3J81c 4JYAQ 1EOVA 2EIFA 3HOWG 5M5XH 3G6EA 2QA4A 3PUXA 4A3MH 3TS0A 4PMWA 3J81j 4A93G 3U58A 1HNWQ 2A1AA 1CKMA 2AWNA 1TXYA 4LUZA 4YCWA 4YY3L 2B63G 4R4IA 1NY4A 1S40A 4A75A 2VY3A 4YY3Q 4TQUS 4A76A 4R4TA 5IYCG 4QGUA 3CMEA 3HOYG 4GLVB 2AHOB 1E22A 2GVBA 1C7YA 2NZOA 4OO1I 1SMXA 4JI8L 4JI7L 3I2ZA 4A3LH 4GS3A 1NMFA 4X62Q 3VDYA 1VQ7A 1L1OC 4A3CG 3ULJA 5C4XG 4GNXB 3L2PA 2R7ZH 3UDFA 1YJNA 3OTOL 4IPDA 4A4IA 4JI3Q 3JAMi 1X3EA 4IO9A 4JI7Q 3S17H 1JT8A 1N8RC 2R93G 1EYGA 1YNXA 4IPCA 2CQOA 3PF4A 1KC8C 1Z47A 1MJEA 1UEBA 1CUKA 2CKZB 3RR5A 2UXCQ 1EQQA 1QUQA 1UWVA 1EUJA 4DR3Q 4LFCL 1QVGA 2JEAI 5BR8Q 4DR7Q 1W2BA 4JI4L 3PO2H 2B3GA 2UXCL 4WJ3M 5GROA 4EX5A 5M3MH 4YCUA 2AMCB 2Y0SE 2V1CC 1V9PA 5BR8L 4DR5L 2QGQA 1K8AC 4R4OA 2WB1G 2EXDA 4GLAC 3CD6A 3KFUA 4XIGS 1X3FA 4DV7Q 4P72A 1JB7A 1V1QA 4B3ML 1YZ6A 4NPSA 3W1GA 5JEAG 4PG3A 1MIUA 3FKIG 3U50C 1YJ9A 1Y1WG 1TWCH 1ASZA 4AYBG 1Q8KA 1XJVA 5C0XJ 4JV5L 2Z0SA 1E24A 2K5HA 3GTMH 2JK8A 4LFAQ 1XTDA 4PZ6A 1YEZA 2D0PA 4YCVA 4HIOA 3GTJH 2KBNA 5HY6A 1N36L 2IT1A 1I94Q 1FJGQ 1D7QA 4WJ4A 3NELA 4B3RQ 2OTLA 4BBRH 3UDGA 2PQAB 5LMUQ 1HNXQ 2UUCQ 5C44H 3STBC 5IYCH 1AE3A 4C3JH 4JBMA 1EIFA 2KHJA 2K4KA 4DR2L 1PH4A 4A3DG 1IBML 2PMZE 1HR0Q 3UE1A 1C0AA 1VQJA 1X56A 2R7FA 4JI5L 1TWAH 1J6QA 3ULPA 4X65Q 1M1KC 4YHHQ 2EQSA 1PH6A 2Q2TA 1XNQL 2PNHA 2UXBQ 2OWOA 3TS2A 1UE5A 5FLXc 2FXQA 2NZHA 3J7ZC 2R7DA 3K80C 2JA7H 1M90C 4DR4L 3F2DA 4TVAB 1YHAA 2K14A 4JI1L 1OXVA 4DV1Q 4A3JG 1V43A 4J15A 5LMNQ 2JA5H 3AFPA 4X66Q 2I5MX 1N34L 1X3GA 3KOJA 2PQAA 3PIPA 4H02A 2JA5G 4IOAA 2BH2A 1G6PA 1HJPA 3D31A 3BZKA 2OCEA 1IBLL 2NVQH 3S1MH 4QQBX 3CCLA 4BY7G 1UE1A 4BXXG 4OWWB 1IZ6A 4Y52H 2F4VQ 4L5QA 1E3PA 1NBWA 1VQPA 5C0XG 3K8AA 3KJPA 3CQZH 3S1RH 5IY0A 2NVXH 3T1YL 2B63H 5JEAJ 4LF9L 4DUYL 5IWAQ 1K3RA 2VS1A 2XTIA 2XGTA 3GTLH 3HOZH 1K83H 2YYZA 5IWAL 2ASBA 1WOCA 4X62L 4DV2Q 3CCUA 1BVSA 3PGZA 1SLJA 4A3DH 4YWMA 2YV5A 3DLLA 2K5NA 2E5LL 5GAHC 1CKOA 3HOXH 1PA6A 3M85A 2HHHL 1A8VA 2QEXA 3HOXG 1VQ4A 3I4MG 2VQEQ 4IFDJ 1VQMA 2UU9Q 4BBRG 2UXDL 3PUVA 1I3QH 1KHIA 3AYHB 3GTOH 2CFMA 2C35B 1LYLA 1NMGA 3CP0A 3HOVH 2UU9L 2UXDQ 2JA7G 3CW2C 3UDXA 5M5WH 3RZDH 1U0LA 4GNXC 1YHBA 1K73C 4C3IH 1KD1C 2MO0A 4DR3L 1S3OA 2JA6H 4DR7L 3NBHB 1SE8A 1EWIA 1SROA 4L5SA 3S15H 1HH2P 1X54A 3TQYA 1XMQQ 4LF5L 2NVYH 1Q46A 2OQ0A 2UUAQ 3TEHB 4LF5Q 4JBKA 3PO3G 3KJOA 3RN2A 2CCZA 4IPGA 2ZM6L 2UUAL 1OXTA 2Q2IA 1VQAA 3PCOB 3RLOA 1RIPA 2HQLA 3OYYA 1JMCA 2VUMG 2GN5A 4JOIC 1T9HA 4LF6L 1MJCA 4FDBA 4NXNQ 1E1TA 3CCMA 3HOZG 4JI6L 1Q1EA 4B3RL 4A3BG 4ME3A 2LXKA 4GOPB 1W3SA 1OTCA 1QVFA 5EAYA 3ULLA 4A3KH 2VL6A 1A0IA 1N9WA 2GVAA 1WI5A 5IP7H 1YI2A 1I94L 3UE0A 1VQ9A 1FJGL 3HKSA 3GTKH 3S2HH 1FVIA 4O2DA 3Q8DA 4DNIA 5JJIA 1B70B 3J80c 2IHFA 5LMUL 4AQYQ 1KIXA 3TRZA 5GQOA 2WB1E 1B8AA 1JJCB 2CWAA 1XNQQ 1U5KA 4MTNA 2UXBL 2Y0SG 2RHSB 3SGIA 3F2BA 1IBMQ 2IX0A 4K0KL 4DV6Q 2N3SA 4DV1L 4OO1G 4APVA 4OX9L 1D8LA 3GTPH 1E1OA 2VW9A 3GTQH 1R9TH 4K0KQ 4BBSH 1N32L 1IBLQ 3RLNA 2HIXA 4P71A 1GO3E 3BU2A 3NEMA 3J81i 4DUZL 2HT1A 4A3FG 5LMNL 1VQGA 4UP9A 1VQIA 4DV3Q 1QUQB 4DK6C 1Q82C 2Z6KC 1K9MC 1N33L 4X64Q 3JC66 4DR6L 1VQ5A 2R92G 4DV3L 3HFZB 5FJ8H 3K7AH 1JJGA 2UUBL 1B7YB 2R93H 3A5ZB 1EQRA 4KI0A 1WCMG 3OW2A 1QZHA 3FHWA 3KF6B
chains in the Genus database with same CATH superfamily
5EPLA 3K59A 1VMPA 1A3TA 5CV9A 1F2YA 5M9OA 4ALPA 3BVGA 4A3KB 3DM3A 3S16H 1VDZA 1HZAA 4JK1C 1S72A 4R8NA 4OONA 4HMIA 1V1OA 4LMQD 1TT2A 2WV6D 4OEMB 2KHSA 4L5TA 1HZ9A 4UDUC 3HG9A 3SDZA 5AJ3L 4HN7A 1CKNB 3MHBA 1STNA 2KOLA 4BBSG 3NENA 3F2UA 3CKIB 3TP6A 3V05A 4LF4Q 1VQNA 4V190 1HZCA 1XMQL 1JE5A 5C0XI 1AW7A 2F1MA 1HNWL 5DLQE 5GAGC 3K5NA 1U4PA 3OWFA 1LTAD 3HGBA 4KN4C 2ZJRA 2IHEA 2VB2X 4DPGA 2L12A 1I6HH 4Y7NH 3SK8A 2ID0A 1DOKA 1PRTC 1B44D 2BA0A 2D9UA 2K52A 3W3AA 4HIDA 2RSOA 3BDCA 4JV5Q 2JSOA 3UDIA 3GTGH 3HOWH 1XTCD 4H7BA 1KLUD 4A3JH 3G71A 1VS0A 5D14A 4DXFA 2L4NA 3EIVA 1G8ZD 1A63A 3CMAA 1Q86C 3TBIB 2IY5B 3N52A 4AQYL 3EN2A 4POGA 3E6ZX 5C4JB 1PZID 4KHPL 4IFDI 4IUVA 4MN3A 3H94A 1K8GA 4DV5L 1CKNA 4DV0Q 1M8AA 4EQ5A 3H3VI 5EBDA 5KNBA 2BA1A 3A0JA 4DR1Q 2L15A 1BKBA 1PH5A 2Z9HA 1G51A 1I4RA 2Q8IB 4A3IG 3VR6A 2WB1B 4ID6A 2F3IA 2AQ1B 3QB3A 3CQZB 2R61A 4DAYB 1H9JA 4XQJA 2AKWB 5C4HA 4FNFA 5T1GA 1STYA 3F1ZA 5FK9C 3VR2A 1WCMH 1J5EL 4LWCA 2ATWA 5J1ZA 3A7LA 1I4GA 4DV4L 3V2TA 1RODA 1ZEQX 2L5TA 4XDXA 1IHZA 1B3AA 4JCVE 2SEBD 4DA2A 1QG7A 2K04A 1PFSA 3E3XA 4I65A 4UP7A 3R2TA 1ICWA 4DK1A 3PO2B 2E5LQ 5JJLA 4QB4A 1H95A 3NHHA 1II3A 4CDCC 1LTLA 2F0OA 3JAMc 5GADC 1AN8A 4LW1A 4ABNA 5BN4A 5FO8B 3KF6A 4IUPA 3KDFB 1XPRA 5A2QL 4OIJA 1SNMA 4P73A 4KHZA 5E1FA 1TWHH 1HTPA 1VQCA 3DM1A 1HCZA 3L9AX 1B53A 1S4ZA 3NP8A 4N9PA 3HOVG 4Y7NB 1DJRD 4KKUA 4GN4B 1S5FD 4GN5A 4QMGA 2B2VC 3GD7A 2E2HH 2I5HA 2B2WA 3BG3A 1K83B 1YNND 4GN3B 1EWCA 3J7AF 3CF5A 1KAWA 1SFOH 2HCCA 1SYGA 2CWPA 4NXNL 2K05A 1RDPD 4RG1A 1F9QA 3V96A 4JI4Q 4J6HA 4FVMA 4A3GH 3CPWA 4ZKBB 5I9OA 5M5YH 2HD3A 4O0AA 3WWVA 5C3EH 3NWSA 2JQOA 1VQ8A 1VQEA 1BF4A 4DN4M 2JA8G 3L7ZC 4RFBA 4RMFA 1WTPA 1JOKA 1EIGA 4RAUC 3EROA 1VQDA 1YBYA 1Y8NB 5DAUA 1RJTA 4JW0A 2MO1A 5IOCA 3TREA 5M3FG 2RKSA 3BZCA 4C2MH 3PV0A 2RCNA 1Y1VG 1LTSD 3K7AB 5ELCA 5FOBB 1LTID 3PMFA 3D0FA 2F52A 4DV4Q 2AUJD 2E8GA 1GD7A 1PZKD 2UUBQ 2KHIA 3GTKB 4C56C 2MPMA 2Z8LA 1HR0L 1NSNS 4HSPA 2A6HC 2BDOA 3H6MA 1YIJA 1CHQD 1QNUA 4C1NI 1SNCA 2R7ZG 3A7AB 5IT9E 3D8GA 2K5DA 1PH1A 3PIP3 2KJXA 5J39A 1WTWA 4YHHL 1GJXA 1OXXK 3D6WA 1SDFA 1NR2A 3NTIA 3QIAA 3I72A 4QY7A 4UY8C 1Z7TA 1WD0A 1H9RA 2F4VL 2EVBA 4F88A 1KDAA 4B9WA 4BY7B 3GP7A 2EIFA 1EY6A 5IGDA 4DXGA 1AZQA 5HURA 4YCWA 4LUZA 5F2DA 4A75A 1R4PB 1S5ED 2IWHA 4PQXA 4DNTB 5IGGA 2GVBA 5KGUA 4JI7L 1TY0A 3NWTA 2KEEA 3OWEB 1NMFA 2OXPA 1SYCA 3CU7A 2K6AA 1YJNA 3OTOL 1WTOA 3JAMi 1X3EA 4IO9A 1HA5A 4KKSA 3PF4A 2IL8A 1Z47A 3RR5A 2UXCQ 1EQQA 5M5WB 4DR3Q 1QVGA 4DR7Q 1W2BA 3PO2H 2CHBD 1V9PA 2QGQA 4R4OA 4A3IB 2WB1G 1ET9A 2WAQB 1X3FA 4DV7Q 2R93B 4P72A 4DAPA 1ZXTA 4ZLTF 2L0CA 1TWCH 4OGQC 1Q8KA 3QO2A 5C0XJ 4JV5L 1ICFB 1WTQA 4XXEA 4PZ6A 3L3OC 3GTJH 5CR3A 4X3TA 2IT1A 1STGA 3R3OA 4NP5A 4ZUJA 1Z6HA 2A5HA 3T16A 5CBAE 2F0VA 1EEID 1EIFA 4DR2L 2K4KA 2JA5B 1PTOB 4X65Q 4YHHQ 2Q2TA 1PH6A 2Z4HA 1T5XD 2OWOA 3TS2A 2O4XA 2FXQA 3G6JB 1K0SA 4X3SA 2R7DA 2B2UC 3K80C 1IW7C 1R4QB 5JVH3 3F2DA 4TVAB 2K14A 4DV1Q 4J15A 4ZK9B 1ILPA 1F9PA 3ZYYX 4H02A 1NAPA 1Q3LA 5I2YA 1HJPA 2R3ZA 3BZKA 4QQBX 5JVG3 2EOTA 4PNYA 1Y69U 1UE1A 1FYCA 4OWWB 2WACA 3I4LA 4Y52H 1E3PA 1STAA 4IUTA 1NBWA 1VQPA 5C0XG 3KLSA 3S1RH 3I91A 3T1YL 3ONAB 2B63H 2HDMA 5JEAJ 5IWAQ 2FHTA 1SYDA 3GTLH 1ESFA 1T5EA 4CJ1B 1QJOA 1H9MA 2K5NA 2E5LL 1F2MA 4CJ0B 5CV4A 1A8VA 1S5BD 3GTGB 4MIUA 2B39A 4BBRG 1JE4A 3AYHB 1GUTA 1TQOA 2UU9L 3CW2C 3UI2A 4XQNA 3S15B 5JAVA 3K6OA 3K5LA 1KD1C 1CK1A 2MO0A 4NKLA 5D65A 2E2HB 3NBHB 1EWIA 2EYFA 3S15H 1TIID 1LT6D 5M3FB 1AZPA 2OQ0A 5TSSA 3TEHB 4LF5Q 2EYMA 1SYFA 2ZM6L 3RLOA 1RIPA 4HTHA 2VUMG 1JMCA 1DD2A 2GN5A 1G91A 1A6XA 4NXNQ 1XYIA 3CRLC 3JAML 5C0XH 2LXKA 3OIQA 5C3WA 1JWMD 5EAYA 3ULLA 3BDLA 3SEBA 4A3KH 2VL6A 3S16B 1A0IA 5IP7H 1VQ9A 1TWHB 2A73B 5LMUL 3TRZA 2CWAA 1U5KA 4MTNA 2KVMA 2X6LA 1RHPA 3SGIA 4CKCA 2J0TD 3QJYA 2WIIB 4CKBA 4ZQ3A 4DV6Q 4DV1L 1D8LA 1STBA 2VW9A 3GTQH 1TS3A 1PLFA 1WCMB 3RLNA 3NEMA 3S1NB 2RA4A 4RGTA 5KYIA 5LMNL 4UP9A 4DV3Q 4DK6C 2Z6KC 1MSGA 3WDNA 5ELBA 2R92G 4F7XA 3HFZB 4HCEA 5FJ8H 2UUBL 3A8KE 3A5ZB 1EQRA 4KD3A 3EVQA 4DNRB 4DF7A 3MXNB 5FO9B 3CAMA 4XT3B 1IW7D 4K2LA 2NN6H 3HOUH 2KCTA 3NQTA 1KRTA 5IGBA 1HFGA 1YITA 3CC2A 4NXMQ 3CCRA 3S17B 1ENCA 3AQQA 1Y14B 1ENAA 1IL8A 4AH6A 1PTOF 1L1OA 2N78A 2AUKA 2K32A 4G4KA 2RDFA 3EJIA 5AJ3Q 4XTCS 3MXNA 3SVMA 3SK4A 4G7ZC 1AP0A 1NTGA 5IYDG 2K1BA 3TZDA 1SEBD 2A19A 4HMJA 5G3LF 4L5RC 2OT2A 3NTKA 2NTSA 3RNUA 5JJKA 1XXGA 3MEHA 2PYKA 3Q0AA 1O78A 3HKZG 2L55A 3SHLA 2O5JC 3ICEA 4B3MQ 3ND9A 1DONA 1KXLA 1RF2D 2F3WA 1V8QA 3HS0C 1DCZA 3OTOQ 3K7UC 3RD4A 5CYUA 3I4OA 2G9DA 4PMBA 2N8NA 1UE7A 2K50A 4HCSA 3NE5B 5IT9c 1Q1BA 4NDXA 4LFBL 1HNXL 3FKIH 1K8OA 3T1HQ 3H3VH 3RLFA 4FXDA 4DV7L 5EPKA 4EVOA 2BOSA 4L8JA 1B3QA 2JA8H 2MGSA 1EU4A 3NBIA 4OHJA 1KDBA 3W1BA 2K33A 4GKJL 1L0WA 1SSOA 1CSPA 1E2ZA 3T51B 1FGUA 1NJIC 4FO2A 3D3RA 4KJOA 2M9VA 3QWNA 4RA8A 2QKIC 3VR3A 2HIVA 1K28A 4LUOA 3CCJA 1IYVA 4H0LC 1J5EQ 2ENBA 4BBRB 1BBUA 1VCIA 1WYDA 1I50H 4GOPC 5EKKA 2IX1A 3RZOB 1CZGA 1XX8A 2F0UA 5T1IA 1JR0D 5ELNA 5C3EG 4A3BH 1JICA 1PZJD 4IQZA 3A5UA 1TWFH 1SNDA 2PZTA 3ERQA 3TMEA 3HOYH 4UPAA 1NNXA 4ILWA 5IP9G 4BY1G 5H1SE 2FJ2A 3MVVA 3SXHA 3WOFA 5FLXE 4TRDA 3PF5A 1LTBD 2HUGA 3S2DH 1KDCA 2AWOA 2D0OA 4E6IA 4A93H 1AH9A 4LAAA 2NBFA 1SFOB 3AEVA 1VQBA 1EZ8A 1L2FA 4JI8Q 1E0BA 2WFWA 1VQLA 3ER0A 2NWGA 4JBJA 4WJWA 3H15A 3F2CA 4LF6Q 2WAQE 2WAQG 3G4SA 2M00A 4JI6Q 1C4QA 1QOHA 2KQ3A 4GNXA 4MNOA 4LFBQ 1HR0W 2K03A 2XWBB 3D4DA 3M9BA 2A6HD 2QDLA 5DM73 1QVCA 5C3XA 4HJ8A 4HIKA 5K5PA 1A3VA 2EYJA 4QIWE 3HOXB 3A56A 4RH6A 1PTOD 1PVOA 3GTLB 2B2TA 4HIMA 3CCSA 3STBD 3S1RB 3EFXD 1VQHA 4A3MG 4A3KG 4OX9Q 1WTXA 4GKJQ 5EJWA 2YU9B 2SOBA 3H91A 2WP8J 1X65A 3E0EA 1JJ2A 3VR4A 2MNAA 1RKNA 2EYOA 4R9WA 2KENA 2JA8B 2VZAA 2F0IA 3MAQA 1SRUA 3C3LA 1XNRQ 4AYBE 3T13A 1N36Q 2B2YA 1FNUA 2K75A 1VQOA 1LTGD 3FP9A 1W6JA 4ZYSA 1EEFD 2JN4A 3IRBA 2LSSA 3KBGA 2JA6G 3KDFA 3CCQA 3RZOH 1Y1VB 4DV6L 1PH3A 2ZT9C 1XPOA 1UE6A 3P75A 4C3JB 2ES2A 1KL9A 1PV4A 1IBKQ 4GZYC 2M2LA 1Q7YC 3OMGA 4JI5Q 4UP8A 2SNSA 4POFA 5IYBG 3RN5A 1RL2A 1XPUA 3BJUA 3PSIA 4IJLA 1VQFA 1FL0A 4ZAIA 1H9SA 2V4DA 3ZJYC 3D4RA 2YTXA 4K5XA 5ELFA 1EOVA 3HOWG 5M5XH 2EYHA 3G6EA 3PUXA 4A3MH 4PMWA 3J80L 2ZXRA 2ZXPA 1TXYA 4YY3L 2B63G 5JEAH 1UUPA 4RGMA 1HTLD 2LKVA 4A76A 4QGUA 5IYCG 3CMEA 4NW2A 3K0YA 3IAYA 1C7YA 1SMXA 4RWSC 1HRJA 4UHVA 5IT9L 1ML0D 4GS3A 1CA5A 1VQ7A 4GNXB 4JI7Q 4A4IA 4KHVA 2JA6B 3NUCA 1JT8A 1ENFA 1YNXA 2AQ2B 3QOLA 1EYGA 2CQOA 1MHWC 2CKZB 1UWVA 2KCCA 1EUJA 1SE3A 4LFCL 1A3UA 1PRTB 4A93B 2EDGA 2UXCL 4EX5A 1PFBA 3P1HA 3CD6A 2XWJB 1V1QA 3HOYB 4DFAA 4B3ML 3MWYW 2XVSA 1H9SB 4DGZA 3KBXA 1ASZA 3FKIG 2Z0SA 1E24A 3OMCA 1EY5A 2B63B 4MTKA 4HIOA 2D0PA 4YCVA 1N36L 2KBNA 1I94Q 1HUMA 2EJFC 4CKEA 4K14A 4N9TA 4BBRH 1STEA 3ITPA 1HNXQ 1WVLA 3STBC 5IYCH 1AFPA 1PH4A 4A3DG 4FF4A 3UE1A 1C0AA 4JI5L 2KA7A 3ULPA 1XNQL 1QWYA 2UXBQ 3BYTB 1PMRA 1D1KA 4AYBB 3G7LA 1V43A 2L11A 3R8BA 2I5MX 1N34L 2JA5G 1LT5D 3PIPA 4QCLA 5IGCA 3WOEA 1SJED 2OCEA 1IBLL 3D4WA 2NVQH 3Q23A 1IKLA 1GHKA 1G2TA 1EQVA 4NMZA 4XQQA 2IW3A 2NVXH 5KRUA 4DUYL 4WRDA 4FF1A 2VS1A 2QW7A 1BOSA 5IWAL 4ODGA 3CCUA 1JOQA 2MUYA 4YWMA 3DLLA 1CKOA 1PA6A 2HHHL 3HOXG 4LJZC 3JAME 1VQ4A 2VQEQ 3AU7A 1LYLA 1NMGA 2D2CC 3FRPB 4U68A 4J1MA 3J7YW 1F9RA 1TWCB 5M5WH 3K58A 4K5VA 1U0LA 2F0QA 1YHBA 3P20A 4C3IH 3OSOA 1SROA 2E2DC 3TQYA 5C4XB 3C2PA 4A3FB 3MC0B 4K2KA 2EY5A 1Q46A 3PIO3 2B2WC 1ET6A 4G7HC 4IUNA 2Q2IA 4M8AA 4BWGB 2HQLA 2RVLA 1Y8OB 3CRKC 4LF6L 1MJCA 3X3NA 1Y8PB 3OIPA 4FDBA 3CCMA 3HOZG 4JI6L 2Q8RE 4GOPB 1QVFA 1TU2B 2HQEA 4U673 3TN2A 1N9WA 3NSWA 1WI5A 1YI2A 1FJGL 3UE0A 3S2HH 1EFID 1FVIA 4O2DA 3Q8DA 4RKLA 1F2ZA 3J80c 2IHFA 4AQYQ 3S1MB 1ZYRC 2WB1E 1SNQA 1XNQQ 3S9WA 1I50B 2UXBL 3NTHA 1IBMQ 2IX0A 1J8IA 4K0KL 2N3SA 4OO1G 3R93A 2DNCA 1QILA 5IIFA 4OX9L 1E2VA 1N32L 4KK7A 1IBLQ 4P71A 4A3FG 4FF3A 1VQIA 1QUQB 1CM9A 3JC66 1BCPB 5DM63 3Q24A 1MD2D 4C3HG 4DV3L 3K7AH 2JXMB 3GQBA 3VA7A 2PNRC 5CV5A 1EY8A 1WCMG 3KF8A 4KTAA 5C4JH 2IX3A 5M3MB 4A3EH 4ZUIA 3GV6A 5J22A 3J80E 4LK1C 4JI2L 3I3CA 1OXSC 2HHHQ 2R6GA 2JP1A 4M1UB 3M7NA 5JOBA 2VQEL 4GOPA 2E2IB 4DV2L 1PFNA 1LT3D 4TSSA 5C3EB 1D6EC 1IXRA 3SE0A 1I4PA 4I7ZC 1Q90A 4JI3L 1KNAA 2KUMA 4RCOA 1EZ6A 1G6ZA 5C44G 3I4NH 3I8ZA 4KY7A 5M3FH 3K57A 2J7ZA 3BS1A 5KNCA 2PW7A 4R4QA 4CGYB 5J3BA 2R92H 1A2TA 3FEWX 1U4LA 4GLXA 4JG2A 3I4MH 1VQKA 1WTVA 4YWKA 1F77A 4BA1I 1TVXA 1CQVA 5CV6A 4JOIA 3GO5A 3VYTA 3LWUA 3MFYA 1GOZA 1O7YA 2XNAC 5GAEC 2XRSD 1SNPA 1SYBA 5AFWA 2NZ1D 5M3MG 1IKMA 3HRZC 3FMCA 4N8FA 4A3DB 3I73A 1K0RA 2ZJQA 1YHQA 5E4WC 4A3MB 3MZ5A 1A2UA 2TSSA 1EFWA 4LFCQ 3T4AC 1X3QA 1YNJD 2XN9C 5ISRA 1ASYA 1IL2A 1AEXA 4MHEA 3M4PA 5KIXA 2J4XA 3T1HL 2F0TA 4KMUC 4P75A 2Q2UA 1N32Q 1JWUD 1LUZA 2DY7A 5BN5A 1E2WA 2LMCB 2ZJPA 1Y1WB 4OWTB 1XWEA 4LF7Q 5HGQA 1MBYA 4OXPA 1LACA 1SMYD 1GUNA 3FVQA 4MZ9A 3H09A 4ZRZA 2MFIA 3DMUA 3IFTA 3S2HB 5JPMC 4RHSA 1J9OA 1WJJA 1CSQA 4DR6Q 1B4OA 3MEFA 3E9IA 1RD9D 2E74C 2A69D 4JI2Q 2B2YC 1LTRD 2JA9A 3BVMA 1JCKB 4X6AH 3CCEA 1Y1WH 4IPHA 3E9HA 2FMCA 5FLMH 4GKKQ 1I4QA 2B2UA 1X9NA 4LNQA 2YU9H 2D62A 3S1NH 1RTOA 1FR3A 2NVYB 3T56B 2F4IA 1O7LA 2QCPX 1N34Q 3I56A 4B3SL 1DYQA 3RUZA 2VUMH 4CJ2C 1X32A 4HJ9A 1L0YB 2NVTH 1JC7A 3H0GH 5CBEE 1PYWD 4A3IH 1BXTA 5EKIA 4LF4L 2G5DA 3K0XA 1BO0A 3HOWB 4DUYQ 1I3QB 2DJGC 1MGSA 4PZ7A 4FYDA 4BA2I 4DK0A 5EBCA 1EYDA 3PO2G 4IALA 1NCVA 2PW5A 2RDGA 3PUWA 2VUMB 4A3JB 4C3IG 3I4MB 4A3GB 1TR5A 4KY6A 4BY7H 5ELOA 3W2DA 5E7NA 5FJ8G 1I4HA 2H5XA 3HKZE 4KJNA 3GDEA 5K36H 4R4CA 5BN3A 4DU9A 1OO9B 2OTJA 5IYBH 2E75C 4O42A 5CV7A 3LX0A 2E2IH 4KV6A 2I5LX 2YTYA 3HOZH 2GA4B 1A62A 2KCMA 3I55A 4JI0Q 3M3YB 2OF1A 4DR5Q 2F0KA 2Z6BA 3O13A 4KHPQ 3PO3B 3S14H 1SE4A 2AQ3B 4DV5Q 2NN6G 2NN6I 4RCNA 2NUCA 3T53B 2RCFA 5JPNC 3CXCA 4DR1L 1VMCA 2B29A 1FGBD 1NE3A 1C48A 1ESRA 4KN7C 1XMOQ 2DNEA 2DGYA 2CQAA 4LFAL 4A3LG 1IYUA 3F8TA 4O1NA 3AMUA 3DUZA 5E4XA 3X3MA 4H44C 4DR2Q 2BE5D 4GKKL 1EY4A 1ZYRD 2HDLA 4DAYA 1XNRL 3PO3H 2JJQA 2VNUD 1DGSA 4FF2A 3K81C 4K8IA 3M3YH 4X65L 3E0JA 4R8IA 1SNOA 4IOCA 5IGEA 5C44B 4TKOB 2I46A 3QOJA 2A8VA 1Q12A 1EYCA 2ICIA 4ULLA 1P16A 2ALYB 2EZVA 2K5QA 1GVPA 2Z6KA 4JPBW 2EY1A 2L1BA 4HR7B 5I4DA 1PFMA 1SR3A 3BZDB 2WKCA 4XYOA 1I6HB 4JYAQ 1CTMA 1UEAB 4ZKCB 1DM0B 2QA4A 4DAVA 3J81j 2JYOA 1G2SA 2A1AA 1CKMA 2NTTA 1F9SA 2E2JB 4I7AA 1B9NA 1LV9A 3TP5A 2VY3A 3GTOB 4YY3Q 3A55A 4TQUS 2X69A 4R4TA 3IKJA 2AHOB 3N6RA 4OO1I 2F0MA 4A3LH 2Q8TA 3VDYA 4A3CG 1L1OC 3SR1A 3ULJA 5C4XG 3L2PA 2R7ZH 3UDFA 1Q8IA 1CA6A 3H0GB 4JI3Q 5KYLA 1N8RC 1KC8C 1MJEA 1HUNA 1UEBA 1CUKA 2JEAI 1JOOA 5NUCA 5BR8Q 4JI4L 2B3GA 2DY8A 4WJ3M 1QE6A 5GROA 2EXZA 5M3MH 4A3EB 2AMCB 2Y0SE 2V1CC 4L6TB 4C1NK 4DR5L 3VA5A 4OIKA 2EYPA 4GLAC 3KFUA 1YNNC 1JB7A 2CH4A 2NVTB 2I07B 3HP3A 1YZ6A 3W1GA 5JEAG 4PG3A 4QIWB 1KNEA 2K5HA 4CHTB 4LFAQ 3HOUB 2F0EA 1XTDA 2F0PA 4L63B 1YEZA 3KLSX 5HY6A 1MI2A 2KEDA 1D7QA 3NELA 1CT1D 4B3RQ 1HPCA 3KK7A 3UDGA 5LMUQ 2P5ZX 3S1QB 1NUCA 1HFNA 1U4MA 4JBMA 3FDTA 1RTNA 3SK5A 1HR0Q 3GTJB 1X56A 2LFNA 3M4YA 1J6QA 1M1KC 2EQSA 1PXUA 2EYLA 1EYAA 1UE5A 2QILA 3J7ZC 3Q6SA 2JA7H 1M90C 4DR4L 1YHAA 1OXVA 5LMNQ 1SMYC 3AFPA 1CZWA 4IOAA 1PRTF 3KOJA 3NQIA 2K7VA 3D31A 2QEJC 4K5WA 1CHPD 3MFGA 2PPBC 3CCLA 5A35A 4BXXG 3U9OA 1IZ6A 2F4VQ 1EY7A 4L5QA 3KJPA 5IY0A 3S14B 1EIHA 1K3RA 2XTIA 1BDOA 2XGTA 3MXGA 1LLRD 5D3IB 2YYZA 5IGFA 4CBVA 4Q0FA 1WOCA 2KECA 4C2MB 2PZUA 4IURA 1SLJA 4EQNA 4A3DH 5GAHC 4FXKC 1JORA 4IN3A 1LT4D 2B2VA 3DWAA 1JB3A 2WINB 2QEXA 2ZXOA 3OHXC 4WFN3 1VQMA 2UXDL 3PUVA 4OO1H 1VF5C 3GTOH 2DJFC 3GTMB 3CP0A 2EE1A 3UDXA 1S5CD 1BNZA 2A74C 5M5YB 5FLXL 4DR3L 2JA6H 1S3OA 4DR7L 4RGOS 3BVZA 4L5SA 1HH2P 2ICEC 1SAPA 4A3BB 2VB3X 2UUAQ 1B50A 3K5OA 1S5DD 4JBKA 2SDFA 3OPOA 4B9XA 3KJOA 3RN2A 2CCZA 4IPGA 1OXTA 3PCOB 2A69C 3OYYA 4JOIC 1T9HA 4IUUA 1Q1EA 2Y0SB 3MA2B 4B3RL 3SK6A 3RMHA 1W3SA 2FMMA 4K8JA 3M4OB 1D5MC 2MP1A 1HA6A 5CORA 2F0HA 3HKSA 5EPJA 3GTKH 5JJIA 1B70B 4XYQA 1SYEA 2A6ED 5GQOA 1PTOC 2PQEA 1FNWA 2F0DA 4K6LA 3K5MA 2FINB 2F03A 4APVA 3EQLC 1E1OA 2IJ0A 2D5DA 1TWGB 1R9TH 4K0KQ 2WKDA 5EKLA 4BBSH 5EQ0A 3HEJA 1X3PA 3TSSA 4DUZL 1V1PB 1K9MC 1N33L 4X64Q 1GUOA 5KEEA 1QNKA 2EJGC 3C46A 4HAEA 1JJGA 2K28A 1B9MA 1SJHD 1VF7A 1DOLA 1BR9A 1QZHA 3OW2A 1D5ZC 1KQSA 3KF6B 1C8CA 1BCPC 4FXGC 4OELB 3T1YQ 1PH8A 2ZTCA 3H0GG 2RSNA 4BBSB 1M4VA 4BY1H 1X6OA 5D3DA 1TWGH 1R9TB 1HXYD 3G48A 2F0NA 1BUVT 1X55A 2FFKB 2XRQD 1Z9FA 2VQFQ 2LS01 5I6WA 1HQMC 2F0SA 4JC0A 4JYAL 2XIWA 1LM0A 3ERSX 1PH2A 2Z1CA 4A3FH 3R2IA 4H13C 5FKAC 3CHBD 4QL5A 5IYDH 5C4XH 4ME5A 4DKAC 1CI3M 4A3CH 1P8LA 2MQHA 4V0BA 2LXJA 1V1PA 2TMPA 2R7ZB 3MXUA 3U4ZA 3PUZA 1MSHA 3A8JE 1PH9A 1BCPD 4KKTA 2ZM6Q 4IFDG 4PZ8A 3PIOA 2PCFB 2PI2A 3KF8B 1UNSA 4LF8L 2EY2A 3M4QA 1IYJB 1WD1A 2RHQB 2F0FA 4NB3A 1UAPA 1HHVA 1WFQA 1GUGA 2UUCL 2DUDA 2PO4A 5C5MA 2N55A 1TWFB 1SN8A 4DV0L 1QZGA 3J7AV 4WORA 1EIYB 2C9OA 2O2LD 1TKWB 4R1JA 3PUYA 4HJ7A 5L37A 4DUZQ 3URYA 1JQYD 5IP7G 3LNNA 3ND8A 1GKHA 5G3LD 4JI1Q 1PHJA 4X64L 4HEDA 3TP7A 1GXDC 3CPFA 4X66L 2Q2HA 1GUSA 4LF7L 3AFQA 2RF4A 1HZBA 5CMDA 3KYHC 1K3BC 1PH7A 2I0QA 4QJFA 2LY7A 3DEPA 4LF9Q 2K5VA 3NK9A 1FNVA 2CH4W 5K36G 5FLMG 4BS9A 1G291 1MKHA 1STHA 1IBKL 3I7FA 5FO7B 4BXXH 1HNZQ 3MTSA 3MXPA 4FP5D 4DR4Q 3M4OH 4NXML 2VQFL 3CCVA 2A68C 3HOZB 1I5FA 4HJAA 2A68D 3GTPB 5CV8A 4YWLA 4B3SQ 4DK3C 4B3TL 1E7ZA 3S1QH 1BQQT 5IP9H 3BDOA 5IODA 3OOCA 2SNMA 4UAIA 5CGKA 1VQ6A 3I4NB 2JE6I 3W5OA 3U9SA 4JVZA 2JEBI 3EBEA 3A54A 1L1OB 5C5LA 3NPPA 4KLKA 1Q81C 4RGNA 1TS4A 2OQKA 1KTKA 4LF8Q 3J7A5 1BBWA 4IJHA 1W6KA 5I6YA 4C3HH 4QF4A 4HJ5A 4F87A 3FPPA 1TY2A 3U4VA 4C3HB 3NBHA 1GUWA 4OWXB 4EQOA 4G57A 2KCNA 4PV1C 2Z4IA 1FD7D 4C3IB 4A3GG 3TDQA 3HOUG 1O7IA 1OXUA 2JA7B 1PRTD 1SBBB 1GM5A 1I4XA 2ZTDA 1PYSB 1PDQA 3IL8A 4JI0L 2RQXA 4P74A 3IFDA 3CC7A 3I70A 3CC4A 2B8FA 2RDHA 3FPUB 3I4NG 2E2JH 2F0GA 3C1FA 3E5SA 1K8MA 2BDNA 1C9OA 1Y1VH 3B6YA 1SE2A 1KRSA 4IUQA 1YJWA 1BCPF 5IE8A 1KAAA 1TS5A 1XMOL 1L0XB 2YTVA 5LMNW 2N49A 2A6EC 3QR8A 3DWPA 3S24A 1HNZL 3L0OA 2CW0D 1PYBA 3J80i 2PI2E 4X3UA 2BH8A 2CW0C 2N88A 4DAMA 1YVCA 5KNDA 2EY6A 1TS2A 3D6CA 3KLWA 1DXMA 2NYZD 3KUPA 4AIMA 4EQPA 1AE2A 5DNFA 4LUVA 4B3TQ 3HZXA 2MHVA 3LGJA 3A74A 1N33Q 1U9RA 4P2CB 2ZTEA 3M7GA 4JBWA 1EWHA 3J81c 4N8X1 2BCOA 1EL0A 1CQFA 2G9HD 3TS0A 4A93G 1ILQA 3U58A 1HNWQ 2AWNA 2H1EA 3H3VC 1I6VC 4R4IA 2EPBA 4HSVA 3HOVB 1NY4A 1S40A 2RBMA 3HOYG 4GLVB 4C3JG 1E22A 2E76C 2NZOA 3TZUA 4F8MA 4JI8L 3I2ZA 2QDBA 3FKIB 4X62Q 4IPDA 3S17H 2R93G 4CDFC 2F0WA 4IPCA 2VXWA 4CDDC 2R92B 4K6DA 4S3SA 1QUQA 5E3FA 2NVXB 2B8GA 1DZ1A 5LHY1 4YCUA 5BR8L 1K8AC 5LL6S 2F0LA 2EXDA 4XIGS 5JJZA 1NR4A 2H4OA 2XSCA 5ELDA 5HGTA 3HKZB 3AB9A 5C6AA 1U4RA 4NPSA 3DEOA 1Y1WG 1MIUA 2K5WA 3U50C 1YJ9A 4AYBG 1XJVA 1D1IA 3GTMH 2JK8A 1LABA 3I90A 2MJ8A 1FJGQ 4WJ4A 4Z9CB 4CDEC 2OTLA 5EGTA 2PQAB 3Q22A 2UUCQ 5C44H 1EY0A 4QUCA 1AE3A 4C3JH 1RCVD 5M5XB 2KHJA 1O80A 1IBML 2PMZE 1VQJA 5DEHA 3VR5A 2R7FA 1F2LA 1TWAH 4G7OC 1LTTD 1B2TA 4X3KA 3DHQA 2PNHA 1QB5D 1PTOH 3C1EA 5FLXc 2NZHA 4JI1L 4A3JG 1GHJA 2JA5H 4X66Q 1X3GA 2PQAA 1G6PA 2BH2A 3VYRA 3J81E 3S1MH 2OEOA 4J8QA 1KLGD 2IPKD 1EY9A 4BY7G 5ELEA 1EQTA 1O7ZA 2O5IC 3LWEA 1BBXC 3K8AA 3CQZH 4KD4A 1WTHA 4LF9L 5LL6X 5I9PA 2PZWA 1EOTA 1K83H 2ASBA 4OL7A 3KLRA 4X62L 5CC4A 4DV2Q 1BVSA 3PGZA 4QUFA 2YV5A 3GV3A 5C4ZA 3TP8A 3HOXH 3M85A 3I4MG 1LO5D 3EA6A 4IFDJ 2UU9Q 1I3QH 1KHIA 3P7JA 2CFMA 2C35B 5I2XA 2HCIA 3HOVH 2UXDQ 1D2BA 2JA7G 3RZDH 1B1ZA 4GNXC 4IFDH 1K73C 1D5XC 4KY5A 2F0JA 2F3VA 4RHRA 2DN8A 1CFMA 1ZKOA 1SE8A 1EU3A 2K01A 1X54A 3DWQA 3RZDB 1XMQQ 4LF5L 1YNJC 2NVYH 1SXTA 3S2DB 1HQRD 1QCBD 2B2TC 3PO3G 4B08A 2UUAL 2CVRA 1VQAA 4RKBA 1E1TA 4Q5VA 1WTRA 4A3BG 4ME3A 1OTCA 4ZCKA 4YIJA 2C5CA 3J81L 2GVAA 1I94L 4BY1B 3PQIA 3A8IE 4DNIA 1KABA 4PMCA 2NVQB 1KIXA 5COYA 1B8AA 1JJCB 3DXJC 1H9KA 1A15A 2Y0SG 2RHSB 3F2BA 2L9HA 2X6GA 4XT1B 2NB0A 3NXWA 3GTPH 1JWSD 1ONLA 2HIXA 4EGVA 3J81i 1GO3E 3BU2A 2HT1A 1VQGA 1TWAB 2PMZB 1Q82C 3GTQB 4IZ8A 2QF7A 4DR6L 1VQ5A 3BYYB 3VYUA 3VYSA 3QG1A 5A2QE 1B7YB 2R93H 2EJMA 2BE5C 4KI0A 3OW7A 1DOMA 3FHWA 4A3EG
chains in the Genus database with same CATH topology
5C4JH 3MXNB 4A3EH 3T1YQ 1PH8A 2ZTCA 3CAMA 3H0GG 4JI2L 1OXSC 2HHHQ 2KCTA 2R6GA 1X6OA 1KRTA 4ALPA 4BY1H 3HOUH 2VQEL 3M7NA 1TWGH 3S16H 3DM3A 1YITA 1HZAA 1S72A 4GOPA 3CC2A 3G48A 4OONA 4DV2L 4NXMQ 3CCRA 1IXRA 4L5TA 3AQQA 1HZ9A 1Y14B 1X55A 5AJ3L 4AH6A 1CKNB 4JI3L 1L1OA 2N78A 1Z9FA 2VQFQ 5AJ3Q 5C44G 4JC0A 4XTCS 3NENA 3I4NH 4BBSG 4JYAL 1LM0A 3ERSX 5M3FH 4LF4Q 1PH2A 1VQNA 4A3FH 1HZCA 1XMQL 1NTGA 5IYDG 1JE5A 4QL5A 4R4QA 5IYDH 5C0XI 2A19A 5C4XH 5J3BA 4DKAC 5DLQE 4L5RC 5GAGC 4A3CH 2R92H 1HNWL 4GLXA 1P8LA 4JG2A 3RNUA 3I4MH 5JJKA 2MQHA 1VQKA 2LXJA 4YWKA 2ZJRA 3HKZG 2IHEA 4DPGA 4BA1I 3U4ZA 1I6HH 3PUZA 4Y7NH 4B3MQ 4JOIA 3ICEA 3GO5A 2ID0A 1KXLA 1PH9A 2BA0A 2ZM6Q 2K52A 4PZ8A 4HIDA 4IFDG 3PIOA 5GAEC 2PI2A 3OTOQ 5M3MG 4JV5Q 3K7UC 3UDIA 3GTGH 3KF8B 3HOWH 3I4OA 1K0RA 2N8NA 2ZJQA 1YHQA 4A3JH 3M4QA 4LF8L 1IYJB 1UE7A 2K50A 2RHQB 3G71A 4NB3A 1EFWA 1VS0A 4LFCQ 5IT9c 3EIVA 1WFQA 1A63A 1Q1BA 3CMAA 1ASYA 4LFBL 1HNXL 2UUCL 2DUDA 3FKIH 1Q86C 1IL2A 2IY5B 3T1HQ 4AQYL 1SN8A 3RLFA 3H3VH 3EN2A 4POGA 3M4PA 4DV0L 4DV7L 1QZGA 4KHPL 3T1HL 4P75A 4IFDI 1EIYB 2Q2UA 1K8GA 4DV5L 1CKNA 1N32Q 4DV0Q 4R1JA 3PUYA 1LUZA 4HJ7A 2JA8H 4DUZQ 4EQ5A 3H3VI 2ZJPA 2BA1A 3A0JA 4OWTB 4DR1Q 5IP7G 4LF7Q 2L15A 1BKBA 1GKHA 4OXPA 4JI1Q 5HGQA 1PH5A 4X64L 1PHJA 1G51A 3W1BA 4A3IG 4GKJL 3CPFA 4X66L 2Q2HA 4LF7L 3AFQA 4MZ9A 2RF4A 2F3IA 1L0WA 2MFIA 1CSPA 1HZBA 4DAYB 2AKWB 1FGUA 3F1ZA 1WJJA 1NJIC 1CSQA 4DR6Q 1WCMH 3KYHC 1J5EL 4LWCA 3MEFA 2ATWA 3E9IA 2HIVA 1PH7A 2I0QA 4LUOA 3CCJA 4QJFA 4DV4L 4JI2Q 1J5EQ 2JA9A 4LF9Q 2K5VA 5K36G 4X6AH 1BBUA 5FLMG 3CCEA 1Y1WH 1VCIA 3E9HA 1G291 1MKHA 4IPHA 1WYDA 4JCVE 1I50H 5FLMH 4GOPC 4GKKQ 1PFSA 1IBKL 2IX1A 3I7FA 1X9NA 4LNQA 4UP7A 4BXXH 2YU9H 2D62A 1HNZQ 3S1NH 4DR4Q 2E5LQ 5ELNA 5C3EG 5JJLA 1H95A 3M4OH 4NXML 4A3BH 2VQFL 3A5UA 3CCVA 1TWFH 1N34Q 3I56A 1LTLA 4B3SL 1I5FA 3JAMc 4HJAA 5GADC 4LW1A 2VUMH 4HJ9A 3KF6A 2NVTH 3HOYH 4YWLA 4B3SQ 4DK3C 4B3TL 1E7ZA 3H0GH 3S1QH 4UPAA 5IP9G 3KDFB 4A3IH 4BY1G 5IP9H 1XPRA 5H1SE 4LF4L 3K0XA 4P73A 4KHZA 1TWHH 4DUYQ 3PF5A 1VQCA 1VQ6A 3S2DH 4PZ7A 2JE6I 2AWOA 2D0OA 3W5OA 4BA2I 4A93H 1AH9A 2JEBI 3HOVG 3AEVA 1VQBA 3EBEA 4GN4B 1L1OB 1L2FA 4GN5A 4JI8Q 3GD7A 2E2HH 2I5HA 2WFWA 3PO2G 4KLKA 1VQLA 3ER0A 1Q81C 4GN3B 3PUWA 2OQKA 4JBJA 3CF5A 1KAWA 1SFOH 4LF8Q 4BY7H 3H15A 1BBWA 4IJHA 3F2CA 2CWPA 4LF6Q 3J7A5 2WAQE 2WAQG 5ELOA 4NXNL 3G4SA 4C3HH 4JI6Q 5E7NA 4HJ5A 5FJ8G 2H5XA 3HKZE 4GNXA 4MNOA 4RG1A 4LFBQ 1HR0W 3GDEA 4R4CA 3M9BA 3U4VA 1QVCA 4HJ8A 4JI4Q 2OTJA 5IYBH 4A3EG 4HIKA 4OWXB 4QIWE 4A3GH 3CPWA 4A3GG 5M5YH 3HOUG 1PVOA 4O0AA 2E2IH 3WWVA 5C3EH 1O7IA 2I5LX 2YTYA 2JQOA 1OXUA 4HIMA 1VQ8A 2KCMA 1A62A 3I55A 3CCSA 3STBD 1VQEA 1GM5A 4JI0Q 2JA8G 4DR5Q 2ZTDA 1VQHA 3L7ZC 1PYSB 4RMFA 4A3MG 3S14H 4KHPQ 4JI0L 4A3KG 4OX9Q 4DV5Q 4P74A 4GKJQ 3CC7A 1VQDA 2NN6G 2NN6I 1YBYA 3CC4A 3CXCA 2WP8J 4DR1L 1X65A 3E0EA 2MO1A 2E2JH 3I4NG 1JJ2A 3TREA 5M3FG 3BZCA 2MNAA 2B29A 4C2MH 1NE3A 3PV0A 2RCNA 1Y1VG 1XMOQ 1C9OA 2KENA 2DGYA 3B6YA 1Y1VH 2VZAA 1KRSA 1YJWA 4LFAL 3D0FA 2F52A 3F8TA 4DV4Q 4A3LG 2E8GA 1SRUA 5IE8A 1XMOL 1XNRQ 1GD7A 4AYBE 1N36Q 2YTVA 5LMNW 2UUBQ 2K75A 2KHIA 4DR2Q 2N49A 1VQOA 4GKKL 3FP9A 1KQSA 1XNRL 2VNUD 1HR0L 3PO3H 2JJQA 1DGSA 3K81C 3M3YH 4X65L 3IRBA 2LSSA 1YIJA 2JA6G 3S24A 3KDFA 3CCQA 1HNZL 3RZOH 4DV6L 1PH3A 3L0OA 1PYBA 3J80i 4IOCA 2R7ZG 1XPOA 2PI2E 1UE6A 2BH8A 1Q12A 4DAMA 1PH1A 1KL9A 1YVCA 1PV4A 1IBKQ 2ES2A 2A8VA 1P16A 1Q7YC 4JI5Q 3KLWA 2ALYB 4YHHL 4AIMA 1OXXK 4UP8A 1AE2A 4LUVA 4B3TQ 3LGJA 1GVPA 4POFA 5IYBG 2Z6KA 1RL2A 3RN5A 1XPUA 3BJUA 3A74A 3PSIA 1VQFA 4IJLA 1FL0A 1N33Q 4QY7A 4UY8C 2ZTEA 2F4VL 3ZJYC 1SR3A 2YTXA 4JBWA 3J81c 4JYAQ 1EOVA 2EIFA 3HOWG 5M5XH 3G6EA 2QA4A 3PUXA 4A3MH 3TS0A 4PMWA 3J81j 4A93G 3U58A 1HNWQ 2A1AA 1CKMA 2AWNA 1TXYA 4LUZA 4YCWA 4YY3L 2B63G 4R4IA 1NY4A 1S40A 4A75A 2VY3A 4YY3Q 4TQUS 4A76A 4R4TA 5IYCG 4QGUA 3CMEA 3HOYG 4GLVB 2AHOB 1E22A 2GVBA 1C7YA 2NZOA 4OO1I 1SMXA 4JI8L 4JI7L 3I2ZA 4A3LH 4GS3A 1NMFA 4X62Q 3VDYA 1VQ7A 1L1OC 4A3CG 3ULJA 5C4XG 4GNXB 3L2PA 2R7ZH 3UDFA 1YJNA 3OTOL 4IPDA 4A4IA 4JI3Q 3JAMi 1X3EA 4IO9A 4JI7Q 3S17H 1JT8A 1N8RC 2R93G 1EYGA 1YNXA 4IPCA 2CQOA 3PF4A 1KC8C 1Z47A 1MJEA 1UEBA 1CUKA 2CKZB 3RR5A 2UXCQ 1EQQA 1QUQA 1UWVA 1EUJA 4DR3Q 4LFCL 1QVGA 2JEAI 5BR8Q 4DR7Q 1W2BA 4JI4L 3PO2H 2B3GA 2UXCL 4WJ3M 5GROA 4EX5A 5M3MH 4YCUA 2AMCB 2Y0SE 2V1CC 1V9PA 5BR8L 4DR5L 2QGQA 1K8AC 4R4OA 2WB1G 2EXDA 4GLAC 3CD6A 3KFUA 4XIGS 1X3FA 4DV7Q 4P72A 1JB7A 1V1QA 4B3ML 1YZ6A 4NPSA 3W1GA 5JEAG 4PG3A 1MIUA 3FKIG 3U50C 1YJ9A 1Y1WG 1TWCH 1ASZA 4AYBG 1Q8KA 1XJVA 5C0XJ 4JV5L 2Z0SA 1E24A 2K5HA 3GTMH 2JK8A 4LFAQ 1XTDA 4PZ6A 1YEZA 2D0PA 4YCVA 4HIOA 3GTJH 2KBNA 5HY6A 1N36L 2IT1A 1I94Q 1FJGQ 1D7QA 4WJ4A 3NELA 4B3RQ 2OTLA 4BBRH 3UDGA 2PQAB 5LMUQ 1HNXQ 2UUCQ 5C44H 3STBC 5IYCH 1AE3A 4C3JH 4JBMA 1EIFA 2KHJA 2K4KA 4DR2L 1PH4A 4A3DG 1IBML 2PMZE 1HR0Q 3UE1A 1C0AA 1VQJA 1X56A 2R7FA 4JI5L 1TWAH 1J6QA 3ULPA 4X65Q 1M1KC 4YHHQ 2EQSA 1PH6A 2Q2TA 1XNQL 2PNHA 2UXBQ 2OWOA 3TS2A 1UE5A 5FLXc 2FXQA 2NZHA 3J7ZC 2R7DA 3K80C 2JA7H 1M90C 4DR4L 3F2DA 4TVAB 1YHAA 2K14A 4JI1L 1OXVA 4DV1Q 4A3JG 1V43A 4J15A 5LMNQ 2JA5H 3AFPA 4X66Q 2I5MX 1N34L 1X3GA 3KOJA 2PQAA 3PIPA 4H02A 2JA5G 4IOAA 2BH2A 1G6PA 1HJPA 3D31A 3BZKA 2OCEA 1IBLL 2NVQH 3S1MH 4QQBX 3CCLA 4BY7G 1UE1A 4BXXG 4OWWB 1IZ6A 4Y52H 2F4VQ 4L5QA 1E3PA 1NBWA 1VQPA 5C0XG 3K8AA 3KJPA 3CQZH 3S1RH 5IY0A 2NVXH 3T1YL 2B63H 5JEAJ 4LF9L 4DUYL 5IWAQ 1K3RA 2VS1A 2XTIA 2XGTA 3GTLH 3HOZH 1K83H 2YYZA 5IWAL 2ASBA 1WOCA 4X62L 4DV2Q 3CCUA 1BVSA 3PGZA 1SLJA 4A3DH 4YWMA 2YV5A 3DLLA 2K5NA 2E5LL 5GAHC 1CKOA 3HOXH 1PA6A 3M85A 2HHHL 1A8VA 2QEXA 3HOXG 1VQ4A 3I4MG 2VQEQ 4IFDJ 1VQMA 2UU9Q 4BBRG 2UXDL 3PUVA 1I3QH 1KHIA 3AYHB 3GTOH 2CFMA 2C35B 1LYLA 1NMGA 3CP0A 3HOVH 2UU9L 2UXDQ 2JA7G 3CW2C 3UDXA 5M5WH 3RZDH 1U0LA 4GNXC 1YHBA 1K73C 4C3IH 1KD1C 2MO0A 4DR3L 1S3OA 2JA6H 4DR7L 3NBHB 1SE8A 1EWIA 1SROA 4L5SA 3S15H 1HH2P 1X54A 3TQYA 1XMQQ 4LF5L 2NVYH 1Q46A 2OQ0A 2UUAQ 3TEHB 4LF5Q 4JBKA 3PO3G 3KJOA 3RN2A 2CCZA 4IPGA 2ZM6L 2UUAL 1OXTA 2Q2IA 1VQAA 3PCOB 3RLOA 1RIPA 2HQLA 3OYYA 1JMCA 2VUMG 2GN5A 4JOIC 1T9HA 4LF6L 1MJCA 4FDBA 4NXNQ 1E1TA 3CCMA 3HOZG 4JI6L 1Q1EA 4B3RL 4A3BG 4ME3A 2LXKA 4GOPB 1W3SA 1OTCA 1QVFA 5EAYA 3ULLA 4A3KH 2VL6A 1A0IA 1N9WA 2GVAA 1WI5A 5IP7H 1YI2A 1I94L 3UE0A 1VQ9A 1FJGL 3HKSA 3GTKH 3S2HH 1FVIA 4O2DA 3Q8DA 4DNIA 5JJIA 1B70B 3J80c 2IHFA 5LMUL 4AQYQ 1KIXA 3TRZA 5GQOA 2WB1E 1B8AA 1JJCB 2CWAA 1XNQQ 1U5KA 4MTNA 2UXBL 2Y0SG 2RHSB 3SGIA 3F2BA 1IBMQ 2IX0A 4K0KL 4DV6Q 2N3SA 4DV1L 4OO1G 4APVA 4OX9L 1D8LA 3GTPH 1E1OA 2VW9A 3GTQH 1R9TH 4K0KQ 4BBSH 1N32L 1IBLQ 3RLNA 2HIXA 4P71A 1GO3E 3BU2A 3NEMA 3J81i 4DUZL 2HT1A 4A3FG 5LMNL 1VQGA 4UP9A 1VQIA 4DV3Q 1QUQB 4DK6C 1Q82C 2Z6KC 1K9MC 1N33L 4X64Q 3JC66 4DR6L 1VQ5A 2R92G 4DV3L 3HFZB 5FJ8H 3K7AH 1JJGA 2UUBL 1B7YB 2R93H 3A5ZB 1EQRA 4KI0A 1WCMG 3OW2A 1QZHA 3FHWA 3KF6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4J H;  3MXN B;  4A3E H;  3T1Y Q;  1PH8 A;  2ZTC A;  3CAM A;  3H0G G;  4JI2 L;  1OXS C;  2HHH Q;  2KCT A;  2R6G A;  1X6O A;  1KRT A;  4ALP A;  4BY1 H;  3HOU H;  2VQE L;  3M7N A;  1TWG H;  3S16 H;  3DM3 A;  1YIT A;  1HZA A;  1S72 A;  4GOP A;  3CC2 A;  3G48 A;  4OON A;  4DV2 L;  4NXM Q;  3CCR A;  1IXR A;  4L5T A;  3AQQ A;  1HZ9 A;  1Y14 B;  1X55 A;  5AJ3 L;  4AH6 A;  1CKN B;  4JI3 L;  1L1O A;  2N78 A;  1Z9F A;  2VQF Q;  5AJ3 Q;  5C44 G;  4JC0 A;  4XTC S;  3NEN A;  3I4N H;  4BBS G;  4JYA L;  1LM0 A;  3ERS X;  5M3F H;  4LF4 Q;  1PH2 A;  1VQN A;  4A3F H;  1HZC A;  1XMQ L;  1NTG A;  5IYD G;  1JE5 A;  4QL5 A;  4R4Q A;  5IYD H;  5C0X I;  2A19 A;  5C4X H;  5J3B A;  4DKA C;  5DLQ E;  4L5R C;  5GAG C;  4A3C H;  2R92 H;  1HNW L;  4GLX A;  1P8L A;  4JG2 A;  3RNU A;  3I4M H;  5JJK A;  2MQH A;  1VQK A;  2LXJ A;  4YWK A;  2ZJR A;  3HKZ G;  2IHE A;  4DPG A;  4BA1 I;  3U4Z A;  1I6H H;  3PUZ A;  4Y7N H;  4B3M Q;  4JOI A;  3ICE A;  3GO5 A;  2ID0 A;  1KXL A;  1PH9 A;  2BA0 A;  2ZM6 Q;  2K52 A;  4PZ8 A;  4HID A;  4IFD G;  3PIO A;  5GAE C;  2PI2 A;  3OTO Q;  5M3M G;  4JV5 Q;  3K7U C;  3UDI A;  3GTG H;  3KF8 B;  3HOW H;  3I4O A;  1K0R A;  2N8N A;  2ZJQ A;  1YHQ A;  4A3J H;  3M4Q A;  4LF8 L;  1IYJ B;  1UE7 A;  2K50 A;  2RHQ B;  3G71 A;  4NB3 A;  1EFW A;  1VS0 A;  4LFC Q;  5IT9 c;  3EIV A;  1WFQ A;  1A63 A;  1Q1B A;  3CMA A;  1ASY A;  4LFB L;  1HNX L;  2UUC L;  2DUD A;  3FKI H;  1Q86 C;  1IL2 A;  2IY5 B;  3T1H Q;  4AQY L;  1SN8 A;  3RLF A;  3H3V H;  3EN2 A;  4POG A;  3M4P A;  4DV0 L;  4DV7 L;  1QZG A;  4KHP L;  3T1H L;  4P75 A;  4IFD I;  1EIY B;  2Q2U A;  1K8G A;  4DV5 L;  1CKN A;  1N32 Q;  4DV0 Q;  4R1J A;  3PUY A;  1LUZ A;  4HJ7 A;  2JA8 H;  4DUZ Q;  4EQ5 A;  3H3V I;  2ZJP A;  2BA1 A;  3A0J A;  4OWT B;  4DR1 Q;  5IP7 G;  4LF7 Q;  2L15 A;  1BKB A;  1GKH A;  4OXP A;  4JI1 Q;  5HGQ A;  1PH5 A;  4X64 L;  1PHJ A;  1G51 A;  3W1B A;  4A3I G;  4GKJ L;  3CPF A;  4X66 L;  2Q2H A;  4LF7 L;  3AFQ A;  4MZ9 A;  2RF4 A;  2F3I A;  1L0W A;  2MFI A;  1CSP A;  1HZB A;  4DAY B;  2AKW B;  1FGU A;  3F1Z A;  1WJJ A;  1NJI C;  1CSQ A;  4DR6 Q;  1WCM H;  3KYH C;  1J5E L;  4LWC A;  3MEF A;  2ATW A;  3E9I A;  2HIV A;  1PH7 A;  2I0Q A;  4LUO A;  3CCJ A;  4QJF A;  4DV4 L;  4JI2 Q;  1J5E Q;  2JA9 A;  4LF9 Q;  2K5V A;  5K36 G;  4X6A H;  1BBU A;  5FLM G;  3CCE A;  1Y1W H;  1VCI A;  3E9H A;  1G29 1;  1MKH A;  4IPH A;  1WYD A;  4JCV E;  1I50 H;  5FLM H;  4GOP C;  4GKK Q;  1PFS A;  1IBK L;  2IX1 A;  3I7F A;  1X9N A;  4LNQ A;  4UP7 A;  4BXX H;  2YU9 H;  2D62 A;  1HNZ Q;  3S1N H;  4DR4 Q;  2E5L Q;  5ELN A;  5C3E G;  5JJL A;  1H95 A;  3M4O H;  4NXM L;  4A3B H;  2VQF L;  3A5U A;  3CCV A;  1TWF H;  1N34 Q;  3I56 A;  1LTL A;  4B3S L;  1I5F A;  3JAM c;  4HJA A;  5GAD C;  4LW1 A;  2VUM H;  4HJ9 A;  3KF6 A;  2NVT H;  3HOY H;  4YWL A;  4B3S Q;  4DK3 C;  4B3T L;  1E7Z A;  3H0G H;  3S1Q H;  4UPA A;  5IP9 G;  3KDF B;  4A3I H;  4BY1 G;  5IP9 H;  1XPR A;  5H1S E;  4LF4 L;  3K0X A;  4P73 A;  4KHZ A;  1TWH H;  4DUY Q;  3PF5 A;  1VQC A;  1VQ6 A;  3S2D H;  4PZ7 A;  2JE6 I;  2AWO A;  2D0O A;  3W5O A;  4BA2 I;  4A93 H;  1AH9 A;  2JEB I;  3HOV G;  3AEV A;  1VQB A;  3EBE A;  4GN4 B;  1L1O B;  1L2F A;  4GN5 A;  4JI8 Q;  3GD7 A;  2E2H H;  2I5H A;  2WFW A;  3PO2 G;  4KLK A;  1VQL A;  3ER0 A;  1Q81 C;  4GN3 B;  3PUW A;  2OQK A;  4JBJ A;  3CF5 A;  1KAW A;  1SFO H;  4LF8 Q;  4BY7 H;  3H15 A;  1BBW A;  4IJH A;  3F2C A;  2CWP A;  4LF6 Q;  3J7A 5;  2WAQ E;  2WAQ G;  5ELO A;  4NXN L;  3G4S A;  4C3H H;  4JI6 Q;  5E7N A;  4HJ5 A;  5FJ8 G;  2H5X A;  3HKZ E;  4GNX A;  4MNO A;  4RG1 A;  4LFB Q;  1HR0 W;  3GDE A;  4R4C A;  3M9B A;  3U4V A;  1QVC A;  4HJ8 A;  4JI4 Q;  2OTJ A;  5IYB H;  4A3E G;  4HIK A;  4OWX B;  4QIW E;  4A3G H;  3CPW A;  4A3G G;  5M5Y H;  3HOU G;  1PVO A;  4O0A A;  2E2I H;  3WWV A;  5C3E H;  1O7I A;  2I5L X;  2YTY A;  2JQO A;  1OXU A;  4HIM A;  1VQ8 A;  2KCM A;  1A62 A;  3I55 A;  3CCS A;  3STB D;  1VQE A;  1GM5 A;  4JI0 Q;  2JA8 G;  4DR5 Q;  2ZTD A;  1VQH A;  3L7Z C;  1PYS B;  4RMF A;  4A3M G;  3S14 H;  4KHP Q;  4JI0 L;  4A3K G;  4OX9 Q;  4DV5 Q;  4P74 A;  4GKJ Q;  3CC7 A;  1VQD A;  2NN6 G;  2NN6 I;  1YBY A;  3CC4 A;  3CXC A;  2WP8 J;  4DR1 L;  1X65 A;  3E0E A;  2MO1 A;  2E2J H;  3I4N G;  1JJ2 A;  3TRE A;  5M3F G;  3BZC A;  2MNA A;  2B29 A;  4C2M H;  1NE3 A;  3PV0 A;  2RCN A;  1Y1V G;  1XMO Q;  1C9O A;  2KEN A;  2DGY A;  3B6Y A;  1Y1V H;  2VZA A;  1KRS A;  1YJW A;  4LFA L;  3D0F A;  2F52 A;  3F8T A;  4DV4 Q;  4A3L G;  2E8G A;  1SRU A;  5IE8 A;  1XMO L;  1XNR Q;  1GD7 A;  4AYB E;  1N36 Q;  2YTV A;  5LMN W;  2UUB Q;  2K75 A;  2KHI A;  4DR2 Q;  2N49 A;  1VQO A;  4GKK L;  3FP9 A;  1KQS A;  1XNR L;  2VNU D;  1HR0 L;  3PO3 H;  2JJQ A;  1DGS A;  3K81 C;  3M3Y H;  4X65 L;  3IRB A;  2LSS A;  1YIJ A;  2JA6 G;  3S24 A;  3KDF A;  3CCQ A;  1HNZ L;  3RZO H;  4DV6 L;  1PH3 A;  3L0O A;  1PYB A;  3J80 i;  4IOC A;  2R7Z G;  1XPO A;  2PI2 E;  1UE6 A;  2BH8 A;  1Q12 A;  4DAM A;  1PH1 A;  1KL9 A;  1YVC A;  1PV4 A;  1IBK Q;  2ES2 A;  2A8V A;  1P16 A;  1Q7Y C;  4JI5 Q;  3KLW A;  2ALY B;  4YHH L;  4AIM A;  1OXX K;  4UP8 A;  1AE2 A;  4LUV A;  4B3T Q;  3LGJ A;  1GVP A;  4POF A;  5IYB G;  2Z6K A;  1RL2 A;  3RN5 A;  1XPU A;  3BJU A;  3A74 A;  3PSI A;  1VQF A;  4IJL A;  1FL0 A;  1N33 Q;  4QY7 A;  4UY8 C;  2ZTE A;  2F4V L;  3ZJY C;  1SR3 A;  2YTX A;  4JBW A;  3J81 c;  4JYA Q;  1EOV A;  2EIF A;  3HOW G;  5M5X H;  3G6E A;  2QA4 A;  3PUX A;  4A3M H;  3TS0 A;  4PMW A;  3J81 j;  4A93 G;  3U58 A;  1HNW Q;  2A1A A;  1CKM A;  2AWN A;  1TXY A;  4LUZ A;  4YCW A;  4YY3 L;  2B63 G;  4R4I A;  1NY4 A;  1S40 A;  4A75 A;  2VY3 A;  4YY3 Q;  4TQU S;  4A76 A;  4R4T A;  5IYC G;  4QGU A;  3CME A;  3HOY G;  4GLV B;  2AHO B;  1E22 A;  2GVB A;  1C7Y A;  2NZO A;  4OO1 I;  1SMX A;  4JI8 L;  4JI7 L;  3I2Z A;  4A3L H;  4GS3 A;  1NMF A;  4X62 Q;  3VDY A;  1VQ7 A;  1L1O C;  4A3C G;  3ULJ A;  5C4X G;  4GNX B;  3L2P A;  2R7Z H;  3UDF A;  1YJN A;  3OTO L;  4IPD A;  4A4I A;  4JI3 Q;  3JAM i;  1X3E A;  4IO9 A;  4JI7 Q;  3S17 H;  1JT8 A;  1N8R C;  2R93 G;  1EYG A;  1YNX A;  4IPC A;  2CQO A;  3PF4 A;  1KC8 C;  1Z47 A;  1MJE A;  1UEB A;  1CUK A;  2CKZ B;  3RR5 A;  2UXC Q;  1EQQ A;  1QUQ A;  1UWV A;  1EUJ A;  4DR3 Q;  4LFC L;  1QVG A;  2JEA I;  5BR8 Q;  4DR7 Q;  1W2B A;  4JI4 L;  3PO2 H;  2B3G A;  2UXC L;  4WJ3 M;  5GRO A;  4EX5 A;  5M3M H;  4YCU A;  2AMC B;  2Y0S E;  2V1C C;  1V9P A;  5BR8 L;  4DR5 L;  2QGQ A;  1K8A C;  4R4O A;  2WB1 G;  2EXD A;  4GLA C;  3CD6 A;  3KFU A;  4XIG S;  1X3F A;  4DV7 Q;  4P72 A;  1JB7 A;  1V1Q A;  4B3M L;  1YZ6 A;  4NPS A;  3W1G A;  5JEA G;  4PG3 A;  1MIU A;  3FKI G;  3U50 C;  1YJ9 A;  1Y1W G;  1TWC H;  1ASZ A;  4AYB G;  1Q8K A;  1XJV A;  5C0X J;  4JV5 L;  2Z0S A;  1E24 A;  2K5H A;  3GTM H;  2JK8 A;  4LFA Q;  1XTD A;  4PZ6 A;  1YEZ A;  2D0P A;  4YCV A;  4HIO A;  3GTJ H;  2KBN A;  5HY6 A;  1N36 L;  2IT1 A;  1I94 Q;  1FJG Q;  1D7Q A;  4WJ4 A;  3NEL A;  4B3R Q;  2OTL A;  4BBR H;  3UDG A;  2PQA B;  5LMU Q;  1HNX Q;  2UUC Q;  5C44 H;  3STB C;  5IYC H;  1AE3 A;  4C3J H;  4JBM A;  1EIF A;  2KHJ A;  2K4K A;  4DR2 L;  1PH4 A;  4A3D G;  1IBM L;  2PMZ E;  1HR0 Q;  3UE1 A;  1C0A A;  1VQJ A;  1X56 A;  2R7F A;  4JI5 L;  1TWA H;  1J6Q A;  3ULP A;  4X65 Q;  1M1K C;  4YHH Q;  2EQS A;  1PH6 A;  2Q2T A;  1XNQ L;  2PNH A;  2UXB Q;  2OWO A;  3TS2 A;  1UE5 A;  5FLX c;  2FXQ A;  2NZH A;  3J7Z C;  2R7D A;  3K80 C;  2JA7 H;  1M90 C;  4DR4 L;  3F2D A;  4TVA B;  1YHA A;  2K14 A;  4JI1 L;  1OXV A;  4DV1 Q;  4A3J G;  1V43 A;  4J15 A;  5LMN Q;  2JA5 H;  3AFP A;  4X66 Q;  2I5M X;  1N34 L;  1X3G A;  3KOJ A;  2PQA A;  3PIP A;  4H02 A;  2JA5 G;  4IOA A;  2BH2 A;  1G6P A;  1HJP A;  3D31 A;  3BZK A;  2OCE A;  1IBL L;  2NVQ H;  3S1M H;  4QQB X;  3CCL A;  4BY7 G;  1UE1 A;  4BXX G;  4OWW B;  1IZ6 A;  4Y52 H;  2F4V Q;  4L5Q A;  1E3P A;  1NBW A;  1VQP A;  5C0X G;  3K8A A;  3KJP A;  3CQZ H;  3S1R H;  5IY0 A;  2NVX H;  3T1Y L;  2B63 H;  5JEA J;  4LF9 L;  4DUY L;  5IWA Q;  1K3R A;  2VS1 A;  2XTI A;  2XGT A;  3GTL H;  3HOZ H;  1K83 H;  2YYZ A;  5IWA L;  2ASB A;  1WOC A;  4X62 L;  4DV2 Q;  3CCU A;  1BVS A;  3PGZ A;  1SLJ A;  4A3D H;  4YWM A;  2YV5 A;  3DLL A;  2K5N A;  2E5L L;  5GAH C;  1CKO A;  3HOX H;  1PA6 A;  3M85 A;  2HHH L;  1A8V A;  2QEX A;  3HOX G;  1VQ4 A;  3I4M G;  2VQE Q;  4IFD J;  1VQM A;  2UU9 Q;  4BBR G;  2UXD L;  3PUV A;  1I3Q H;  1KHI A;  3AYH B;  3GTO H;  2CFM A;  2C35 B;  1LYL A;  1NMG A;  3CP0 A;  3HOV H;  2UU9 L;  2UXD Q;  2JA7 G;  3CW2 C;  3UDX A;  5M5W H;  3RZD H;  1U0L A;  4GNX C;  1YHB A;  1K73 C;  4C3I H;  1KD1 C;  2MO0 A;  4DR3 L;  1S3O A;  2JA6 H;  4DR7 L;  3NBH B;  1SE8 A;  1EWI A;  1SRO A;  4L5S A;  3S15 H;  1HH2 P;  1X54 A;  3TQY A;  1XMQ Q;  4LF5 L;  2NVY H;  1Q46 A;  2OQ0 A;  2UUA Q;  3TEH B;  4LF5 Q;  4JBK A;  3PO3 G;  3KJO A;  3RN2 A;  2CCZ A;  4IPG A;  2ZM6 L;  2UUA L;  1OXT A;  2Q2I A;  1VQA A;  3PCO B;  3RLO A;  1RIP A;  2HQL A;  3OYY A;  1JMC A;  2VUM G;  2GN5 A;  4JOI C;  1T9H A;  4LF6 L;  1MJC A;  4FDB A;  4NXN Q;  1E1T A;  3CCM A;  3HOZ G;  4JI6 L;  1Q1E A;  4B3R L;  4A3B G;  4ME3 A;  2LXK A;  4GOP B;  1W3S A;  1OTC A;  1QVF A;  5EAY A;  3ULL A;  4A3K H;  2VL6 A;  1A0I A;  1N9W A;  2GVA A;  1WI5 A;  5IP7 H;  1YI2 A;  1I94 L;  3UE0 A;  1VQ9 A;  1FJG L;  3HKS A;  3GTK H;  3S2H H;  1FVI A;  4O2D A;  3Q8D A;  4DNI A;  5JJI A;  1B70 B;  3J80 c;  2IHF A;  5LMU L;  4AQY Q;  1KIX A;  3TRZ A;  5GQO A;  2WB1 E;  1B8A A;  1JJC B;  2CWA A;  1XNQ Q;  1U5K A;  4MTN A;  2UXB L;  2Y0S G;  2RHS B;  3SGI A;  3F2B A;  1IBM Q;  2IX0 A;  4K0K L;  4DV6 Q;  2N3S A;  4DV1 L;  4OO1 G;  4APV A;  4OX9 L;  1D8L A;  3GTP H;  1E1O A;  2VW9 A;  3GTQ H;  1R9T H;  4K0K Q;  4BBS H;  1N32 L;  1IBL Q;  3RLN A;  2HIX A;  4P71 A;  1GO3 E;  3BU2 A;  3NEM A;  3J81 i;  4DUZ L;  2HT1 A;  4A3F G;  5LMN L;  1VQG A;  4UP9 A;  1VQI A;  4DV3 Q;  1QUQ B;  4DK6 C;  1Q82 C;  2Z6K C;  1K9M C;  1N33 L;  4X64 Q;  3JC6 6;  4DR6 L;  1VQ5 A;  2R92 G;  4DV3 L;  3HFZ B;  5FJ8 H;  3K7A H;  1JJG A;  2UUB L;  1B7Y B;  2R93 H;  3A5Z B;  1EQR A;  4KI0 A;  1WCM G;  3OW2 A;  1QZH A;  3FHW A;  3KF6 B; 
#chains in the Genus database with same CATH topology
 5EPL A;  3K59 A;  1VMP A;  1A3T A;  5CV9 A;  1F2Y A;  5M9O A;  4ALP A;  3BVG A;  4A3K B;  3DM3 A;  3S16 H;  1VDZ A;  1HZA A;  4JK1 C;  1S72 A;  4R8N A;  4OON A;  4HMI A;  1V1O A;  4LMQ D;  1TT2 A;  2WV6 D;  4OEM B;  2KHS A;  4L5T A;  1HZ9 A;  4UDU C;  3HG9 A;  3SDZ A;  5AJ3 L;  4HN7 A;  1CKN B;  3MHB A;  1STN A;  2KOL A;  4BBS G;  3NEN A;  3F2U A;  3CKI B;  3TP6 A;  3V05 A;  4LF4 Q;  1VQN A;  4V19 0;  1HZC A;  1XMQ L;  1JE5 A;  5C0X I;  1AW7 A;  2F1M A;  1HNW L;  5DLQ E;  5GAG C;  3K5N A;  1U4P A;  3OWF A;  1LTA D;  3HGB A;  4KN4 C;  2ZJR A;  2IHE A;  2VB2 X;  4DPG A;  2L12 A;  1I6H H;  4Y7N H;  3SK8 A;  2ID0 A;  1DOK A;  1PRT C;  1B44 D;  2BA0 A;  2D9U A;  2K52 A;  3W3A A;  4HID A;  2RSO A;  3BDC A;  4JV5 Q;  2JSO A;  3UDI A;  3GTG H;  3HOW H;  1XTC D;  4H7B A;  1KLU D;  4A3J H;  3G71 A;  1VS0 A;  5D14 A;  4DXF A;  2L4N A;  3EIV A;  1G8Z D;  1A63 A;  3CMA A;  1Q86 C;  3TBI B;  2IY5 B;  3N52 A;  4AQY L;  3EN2 A;  4POG A;  3E6Z X;  5C4J B;  1PZI D;  4KHP L;  4IFD I;  4IUV A;  4MN3 A;  3H94 A;  1K8G A;  4DV5 L;  1CKN A;  4DV0 Q;  1M8A A;  4EQ5 A;  3H3V I;  5EBD A;  5KNB A;  2BA1 A;  3A0J A;  4DR1 Q;  2L15 A;  1BKB A;  1PH5 A;  2Z9H A;  1G51 A;  1I4R A;  2Q8I B;  4A3I G;  3VR6 A;  2WB1 B;  4ID6 A;  2F3I A;  2AQ1 B;  3QB3 A;  3CQZ B;  2R61 A;  4DAY B;  1H9J A;  4XQJ A;  2AKW B;  5C4H A;  4FNF A;  5T1G A;  1STY A;  3F1Z A;  5FK9 C;  3VR2 A;  1WCM H;  1J5E L;  4LWC A;  2ATW A;  5J1Z A;  3A7L A;  1I4G A;  4DV4 L;  3V2T A;  1ROD A;  1ZEQ X;  2L5T A;  4XDX A;  1IHZ A;  1B3A A;  4JCV E;  2SEB D;  4DA2 A;  1QG7 A;  2K04 A;  1PFS A;  3E3X A;  4I65 A;  4UP7 A;  3R2T A;  1ICW A;  4DK1 A;  3PO2 B;  2E5L Q;  5JJL A;  4QB4 A;  1H95 A;  3NHH A;  1II3 A;  4CDC C;  1LTL A;  2F0O A;  3JAM c;  5GAD C;  1AN8 A;  4LW1 A;  4ABN A;  5BN4 A;  5FO8 B;  3KF6 A;  4IUP A;  3KDF B;  1XPR A;  5A2Q L;  4OIJ A;  1SNM A;  4P73 A;  4KHZ A;  5E1F A;  1TWH H;  1HTP A;  1VQC A;  3DM1 A;  1HCZ A;  3L9A X;  1B53 A;  1S4Z A;  3NP8 A;  4N9P A;  3HOV G;  4Y7N B;  1DJR D;  4KKU A;  4GN4 B;  1S5F D;  4GN5 A;  4QMG A;  2B2V C;  3GD7 A;  2E2H H;  2I5H A;  2B2W A;  3BG3 A;  1K83 B;  1YNN D;  4GN3 B;  1EWC A;  3J7A F;  3CF5 A;  1KAW A;  1SFO H;  2HCC A;  1SYG A;  2CWP A;  4NXN L;  2K05 A;  1RDP D;  4RG1 A;  1F9Q A;  3V96 A;  4JI4 Q;  4J6H A;  4FVM A;  4A3G H;  3CPW A;  4ZKB B;  5I9O A;  5M5Y H;  2HD3 A;  4O0A A;  3WWV A;  5C3E H;  3NWS A;  2JQO A;  1VQ8 A;  1VQE A;  1BF4 A;  4DN4 M;  2JA8 G;  3L7Z C;  4RFB A;  4RMF A;  1WTP A;  1JOK A;  1EIG A;  4RAU C;  3ERO A;  1VQD A;  1YBY A;  1Y8N B;  5DAU A;  1RJT A;  4JW0 A;  2MO1 A;  5IOC A;  3TRE A;  5M3F G;  2RKS A;  3BZC A;  4C2M H;  3PV0 A;  2RCN A;  1Y1V G;  1LTS D;  3K7A B;  5ELC A;  5FOB B;  1LTI D;  3PMF A;  3D0F A;  2F52 A;  4DV4 Q;  2AUJ D;  2E8G A;  1GD7 A;  1PZK D;  2UUB Q;  2KHI A;  3GTK B;  4C56 C;  2MPM A;  2Z8L A;  1HR0 L;  1NSN S;  4HSP A;  2A6H C;  2BDO A;  3H6M A;  1YIJ A;  1CHQ D;  1QNU A;  4C1N I;  1SNC A;  2R7Z G;  3A7A B;  5IT9 E;  3D8G A;  2K5D A;  1PH1 A;  3PIP 3;  2KJX A;  5J39 A;  1WTW A;  4YHH L;  1GJX A;  1OXX K;  3D6W A;  1SDF A;  1NR2 A;  3NTI A;  3QIA A;  3I72 A;  4QY7 A;  4UY8 C;  1Z7T A;  1WD0 A;  1H9R A;  2F4V L;  2EVB A;  4F88 A;  1KDA A;  4B9W A;  4BY7 B;  3GP7 A;  2EIF A;  1EY6 A;  5IGD A;  4DXG A;  1AZQ A;  5HUR A;  4YCW A;  4LUZ A;  5F2D A;  4A75 A;  1R4P B;  1S5E D;  2IWH A;  4PQX A;  4DNT B;  5IGG A;  2GVB A;  5KGU A;  4JI7 L;  1TY0 A;  3NWT A;  2KEE A;  3OWE B;  1NMF A;  2OXP A;  1SYC A;  3CU7 A;  2K6A A;  1YJN A;  3OTO L;  1WTO A;  3JAM i;  1X3E A;  4IO9 A;  1HA5 A;  4KKS A;  3PF4 A;  2IL8 A;  1Z47 A;  3RR5 A;  2UXC Q;  1EQQ A;  5M5W B;  4DR3 Q;  1QVG A;  4DR7 Q;  1W2B A;  3PO2 H;  2CHB D;  1V9P A;  2QGQ A;  4R4O A;  4A3I B;  2WB1 G;  1ET9 A;  2WAQ B;  1X3F A;  4DV7 Q;  2R93 B;  4P72 A;  4DAP A;  1ZXT A;  4ZLT F;  2L0C A;  1TWC H;  4OGQ C;  1Q8K A;  3QO2 A;  5C0X J;  4JV5 L;  1ICF B;  1WTQ A;  4XXE A;  4PZ6 A;  3L3O C;  3GTJ H;  5CR3 A;  4X3T A;  2IT1 A;  1STG A;  3R3O A;  4NP5 A;  4ZUJ A;  1Z6H A;  2A5H A;  3T16 A;  5CBA E;  2F0V A;  1EEI D;  1EIF A;  4DR2 L;  2K4K A;  2JA5 B;  1PTO B;  4X65 Q;  4YHH Q;  2Q2T A;  1PH6 A;  2Z4H A;  1T5X D;  2OWO A;  3TS2 A;  2O4X A;  2FXQ A;  3G6J B;  1K0S A;  4X3S A;  2R7D A;  2B2U C;  3K80 C;  1IW7 C;  1R4Q B;  5JVH 3;  3F2D A;  4TVA B;  2K14 A;  4DV1 Q;  4J15 A;  4ZK9 B;  1ILP A;  1F9P A;  3ZYY X;  4H02 A;  1NAP A;  1Q3L A;  5I2Y A;  1HJP A;  2R3Z A;  3BZK A;  4QQB X;  5JVG 3;  2EOT A;  4PNY A;  1Y69 U;  1UE1 A;  1FYC A;  4OWW B;  2WAC A;  3I4L A;  4Y52 H;  1E3P A;  1STA A;  4IUT A;  1NBW A;  1VQP A;  5C0X G;  3KLS A;  3S1R H;  3I91 A;  3T1Y L;  3ONA B;  2B63 H;  2HDM A;  5JEA J;  5IWA Q;  2FHT A;  1SYD A;  3GTL H;  1ESF A;  1T5E A;  4CJ1 B;  1QJO A;  1H9M A;  2K5N A;  2E5L L;  1F2M A;  4CJ0 B;  5CV4 A;  1A8V A;  1S5B D;  3GTG B;  4MIU A;  2B39 A;  4BBR G;  1JE4 A;  3AYH B;  1GUT A;  1TQO A;  2UU9 L;  3CW2 C;  3UI2 A;  4XQN A;  3S15 B;  5JAV A;  3K6O A;  3K5L A;  1KD1 C;  1CK1 A;  2MO0 A;  4NKL A;  5D65 A;  2E2H B;  3NBH B;  1EWI A;  2EYF A;  3S15 H;  1TII D;  1LT6 D;  5M3F B;  1AZP A;  2OQ0 A;  5TSS A;  3TEH B;  4LF5 Q;  2EYM A;  1SYF A;  2ZM6 L;  3RLO A;  1RIP A;  4HTH A;  2VUM G;  1JMC A;  1DD2 A;  2GN5 A;  1G91 A;  1A6X A;  4NXN Q;  1XYI A;  3CRL C;  3JAM L;  5C0X H;  2LXK A;  3OIQ A;  5C3W A;  1JWM D;  5EAY A;  3ULL A;  3BDL A;  3SEB A;  4A3K H;  2VL6 A;  3S16 B;  1A0I A;  5IP7 H;  1VQ9 A;  1TWH B;  2A73 B;  5LMU L;  3TRZ A;  2CWA A;  1U5K A;  4MTN A;  2KVM A;  2X6L A;  1RHP A;  3SGI A;  4CKC A;  2J0T D;  3QJY A;  2WII B;  4CKB A;  4ZQ3 A;  4DV6 Q;  4DV1 L;  1D8L A;  1STB A;  2VW9 A;  3GTQ H;  1TS3 A;  1PLF A;  1WCM B;  3RLN A;  3NEM A;  3S1N B;  2RA4 A;  4RGT A;  5KYI A;  5LMN L;  4UP9 A;  4DV3 Q;  4DK6 C;  2Z6K C;  1MSG A;  3WDN A;  5ELB A;  2R92 G;  4F7X A;  3HFZ B;  4HCE A;  5FJ8 H;  2UUB L;  3A8K E;  3A5Z B;  1EQR A;  4KD3 A;  3EVQ A;  4DNR B;  4DF7 A;  3MXN B;  5FO9 B;  3CAM A;  4XT3 B;  1IW7 D;  4K2L A;  2NN6 H;  3HOU H;  2KCT A;  3NQT A;  1KRT A;  5IGB A;  1HFG A;  1YIT A;  3CC2 A;  4NXM Q;  3CCR A;  3S17 B;  1ENC A;  3AQQ A;  1Y14 B;  1ENA A;  1IL8 A;  4AH6 A;  1PTO F;  1L1O A;  2N78 A;  2AUK A;  2K32 A;  4G4K A;  2RDF A;  3EJI A;  5AJ3 Q;  4XTC S;  3MXN A;  3SVM A;  3SK4 A;  4G7Z C;  1AP0 A;  1NTG A;  5IYD G;  2K1B A;  3TZD A;  1SEB D;  2A19 A;  4HMJ A;  5G3L F;  4L5R C;  2OT2 A;  3NTK A;  2NTS A;  3RNU A;  5JJK A;  1XXG A;  3MEH A;  2PYK A;  3Q0A A;  1O78 A;  3HKZ G;  2L55 A;  3SHL A;  2O5J C;  3ICE A;  4B3M Q;  3ND9 A;  1DON A;  1KXL A;  1RF2 D;  2F3W A;  1V8Q A;  3HS0 C;  1DCZ A;  3OTO Q;  3K7U C;  3RD4 A;  5CYU A;  3I4O A;  2G9D A;  4PMB A;  2N8N A;  1UE7 A;  2K50 A;  4HCS A;  3NE5 B;  5IT9 c;  1Q1B A;  4NDX A;  4LFB L;  1HNX L;  3FKI H;  1K8O A;  3T1H Q;  3H3V H;  3RLF A;  4FXD A;  4DV7 L;  5EPK A;  4EVO A;  2BOS A;  4L8J A;  1B3Q A;  2JA8 H;  2MGS A;  1EU4 A;  3NBI A;  4OHJ A;  1KDB A;  3W1B A;  2K33 A;  4GKJ L;  1L0W A;  1SSO A;  1CSP A;  1E2Z A;  3T51 B;  1FGU A;  1NJI C;  4FO2 A;  3D3R A;  4KJO A;  2M9V A;  3QWN A;  4RA8 A;  2QKI C;  3VR3 A;  2HIV A;  1K28 A;  4LUO A;  3CCJ A;  1IYV A;  4H0L C;  1J5E Q;  2ENB A;  4BBR B;  1BBU A;  1VCI A;  1WYD A;  1I50 H;  4GOP C;  5EKK A;  2IX1 A;  3RZO B;  1CZG A;  1XX8 A;  2F0U A;  5T1I A;  1JR0 D;  5ELN A;  5C3E G;  4A3B H;  1JIC A;  1PZJ D;  4IQZ A;  3A5U A;  1TWF H;  1SND A;  2PZT A;  3ERQ A;  3TME A;  3HOY H;  4UPA A;  1NNX A;  4ILW A;  5IP9 G;  4BY1 G;  5H1S E;  2FJ2 A;  3MVV A;  3SXH A;  3WOF A;  5FLX E;  4TRD A;  3PF5 A;  1LTB D;  2HUG A;  3S2D H;  1KDC A;  2AWO A;  2D0O A;  4E6I A;  4A93 H;  1AH9 A;  4LAA A;  2NBF A;  1SFO B;  3AEV A;  1VQB A;  1EZ8 A;  1L2F A;  4JI8 Q;  1E0B A;  2WFW A;  1VQL A;  3ER0 A;  2NWG A;  4JBJ A;  4WJW A;  3H15 A;  3F2C A;  4LF6 Q;  2WAQ E;  2WAQ G;  3G4S A;  2M00 A;  4JI6 Q;  1C4Q A;  1QOH A;  2KQ3 A;  4GNX A;  4MNO A;  4LFB Q;  1HR0 W;  2K03 A;  2XWB B;  3D4D A;  3M9B A;  2A6H D;  2QDL A;  5DM7 3;  1QVC A;  5C3X A;  4HJ8 A;  4HIK A;  5K5P A;  1A3V A;  2EYJ A;  4QIW E;  3HOX B;  3A56 A;  4RH6 A;  1PTO D;  1PVO A;  3GTL B;  2B2T A;  4HIM A;  3CCS A;  3STB D;  3S1R B;  3EFX D;  1VQH A;  4A3M G;  4A3K G;  4OX9 Q;  1WTX A;  4GKJ Q;  5EJW A;  2YU9 B;  2SOB A;  3H91 A;  2WP8 J;  1X65 A;  3E0E A;  1JJ2 A;  3VR4 A;  2MNA A;  1RKN A;  2EYO A;  4R9W A;  2KEN A;  2JA8 B;  2VZA A;  2F0I A;  3MAQ A;  1SRU A;  3C3L A;  1XNR Q;  4AYB E;  3T13 A;  1N36 Q;  2B2Y A;  1FNU A;  2K75 A;  1VQO A;  1LTG D;  3FP9 A;  1W6J A;  4ZYS A;  1EEF D;  2JN4 A;  3IRB A;  2LSS A;  3KBG A;  2JA6 G;  3KDF A;  3CCQ A;  3RZO H;  1Y1V B;  4DV6 L;  1PH3 A;  2ZT9 C;  1XPO A;  1UE6 A;  3P75 A;  4C3J B;  2ES2 A;  1KL9 A;  1PV4 A;  1IBK Q;  4GZY C;  2M2L A;  1Q7Y C;  3OMG A;  4JI5 Q;  4UP8 A;  2SNS A;  4POF A;  5IYB G;  3RN5 A;  1RL2 A;  1XPU A;  3BJU A;  3PSI A;  4IJL A;  1VQF A;  1FL0 A;  4ZAI A;  1H9S A;  2V4D A;  3ZJY C;  3D4R A;  2YTX A;  4K5X A;  5ELF A;  1EOV A;  3HOW G;  5M5X H;  2EYH A;  3G6E A;  3PUX A;  4A3M H;  4PMW A;  3J80 L;  2ZXR A;  2ZXP A;  1TXY A;  4YY3 L;  2B63 G;  5JEA H;  1UUP A;  4RGM A;  1HTL D;  2LKV A;  4A76 A;  4QGU A;  5IYC G;  3CME A;  4NW2 A;  3K0Y A;  3IAY A;  1C7Y A;  1SMX A;  4RWS C;  1HRJ A;  4UHV A;  5IT9 L;  1ML0 D;  4GS3 A;  1CA5 A;  1VQ7 A;  4GNX B;  4JI7 Q;  4A4I A;  4KHV A;  2JA6 B;  3NUC A;  1JT8 A;  1ENF A;  1YNX A;  2AQ2 B;  3QOL A;  1EYG A;  2CQO A;  1MHW C;  2CKZ B;  1UWV A;  2KCC A;  1EUJ A;  1SE3 A;  4LFC L;  1A3U A;  1PRT B;  4A93 B;  2EDG A;  2UXC L;  4EX5 A;  1PFB A;  3P1H A;  3CD6 A;  2XWJ B;  1V1Q A;  3HOY B;  4DFA A;  4B3M L;  3MWY W;  2XVS A;  1H9S B;  4DGZ A;  3KBX A;  1ASZ A;  3FKI G;  2Z0S A;  1E24 A;  3OMC A;  1EY5 A;  2B63 B;  4MTK A;  4HIO A;  2D0P A;  4YCV A;  1N36 L;  2KBN A;  1I94 Q;  1HUM A;  2EJF C;  4CKE A;  4K14 A;  4N9T A;  4BBR H;  1STE A;  3ITP A;  1HNX Q;  1WVL A;  3STB C;  5IYC H;  1AFP A;  1PH4 A;  4A3D G;  4FF4 A;  3UE1 A;  1C0A A;  4JI5 L;  2KA7 A;  3ULP A;  1XNQ L;  1QWY A;  2UXB Q;  3BYT B;  1PMR A;  1D1K A;  4AYB B;  3G7L A;  1V43 A;  2L11 A;  3R8B A;  2I5M X;  1N34 L;  2JA5 G;  1LT5 D;  3PIP A;  4QCL A;  5IGC A;  3WOE A;  1SJE D;  2OCE A;  1IBL L;  3D4W A;  2NVQ H;  3Q23 A;  1IKL A;  1GHK A;  1G2T A;  1EQV A;  4NMZ A;  4XQQ A;  2IW3 A;  2NVX H;  5KRU A;  4DUY L;  4WRD A;  4FF1 A;  2VS1 A;  2QW7 A;  1BOS A;  5IWA L;  4ODG A;  3CCU A;  1JOQ A;  2MUY A;  4YWM A;  3DLL A;  1CKO A;  1PA6 A;  2HHH L;  3HOX G;  4LJZ C;  3JAM E;  1VQ4 A;  2VQE Q;  3AU7 A;  1LYL A;  1NMG A;  2D2C C;  3FRP B;  4U68 A;  4J1M A;  3J7Y W;  1F9R A;  1TWC B;  5M5W H;  3K58 A;  4K5V A;  1U0L A;  2F0Q A;  1YHB A;  3P20 A;  4C3I H;  3OSO A;  1SRO A;  2E2D C;  3TQY A;  5C4X B;  3C2P A;  4A3F B;  3MC0 B;  4K2K A;  2EY5 A;  1Q46 A;  3PIO 3;  2B2W C;  1ET6 A;  4G7H C;  4IUN A;  2Q2I A;  4M8A A;  4BWG B;  2HQL A;  2RVL A;  1Y8O B;  3CRK C;  4LF6 L;  1MJC A;  3X3N A;  1Y8P B;  3OIP A;  4FDB A;  3CCM A;  3HOZ G;  4JI6 L;  2Q8R E;  4GOP B;  1QVF A;  1TU2 B;  2HQE A;  4U67 3;  3TN2 A;  1N9W A;  3NSW A;  1WI5 A;  1YI2 A;  1FJG L;  3UE0 A;  3S2H H;  1EFI D;  1FVI A;  4O2D A;  3Q8D A;  4RKL A;  1F2Z A;  3J80 c;  2IHF A;  4AQY Q;  3S1M B;  1ZYR C;  2WB1 E;  1SNQ A;  1XNQ Q;  3S9W A;  1I50 B;  2UXB L;  3NTH A;  1IBM Q;  2IX0 A;  1J8I A;  4K0K L;  2N3S A;  4OO1 G;  3R93 A;  2DNC A;  1QIL A;  5IIF A;  4OX9 L;  1E2V A;  1N32 L;  4KK7 A;  1IBL Q;  4P71 A;  4A3F G;  4FF3 A;  1VQI A;  1QUQ B;  1CM9 A;  3JC6 6;  1BCP B;  5DM6 3;  3Q24 A;  1MD2 D;  4C3H G;  4DV3 L;  3K7A H;  2JXM B;  3GQB A;  3VA7 A;  2PNR C;  5CV5 A;  1EY8 A;  1WCM G;  3KF8 A;  4KTA A;  5C4J H;  2IX3 A;  5M3M B;  4A3E H;  4ZUI A;  3GV6 A;  5J22 A;  3J80 E;  4LK1 C;  4JI2 L;  3I3C A;  1OXS C;  2HHH Q;  2R6G A;  2JP1 A;  4M1U B;  3M7N A;  5JOB A;  2VQE L;  4GOP A;  2E2I B;  4DV2 L;  1PFN A;  1LT3 D;  4TSS A;  5C3E B;  1D6E C;  1IXR A;  3SE0 A;  1I4P A;  4I7Z C;  1Q90 A;  4JI3 L;  1KNA A;  2KUM A;  4RCO A;  1EZ6 A;  1G6Z A;  5C44 G;  3I4N H;  3I8Z A;  4KY7 A;  5M3F H;  3K57 A;  2J7Z A;  3BS1 A;  5KNC A;  2PW7 A;  4R4Q A;  4CGY B;  5J3B A;  2R92 H;  1A2T A;  3FEW X;  1U4L A;  4GLX A;  4JG2 A;  3I4M H;  1VQK A;  1WTV A;  4YWK A;  1F77 A;  4BA1 I;  1TVX A;  1CQV A;  5CV6 A;  4JOI A;  3GO5 A;  3VYT A;  3LWU A;  3MFY A;  1GOZ A;  1O7Y A;  2XNA C;  5GAE C;  2XRS D;  1SNP A;  1SYB A;  5AFW A;  2NZ1 D;  5M3M G;  1IKM A;  3HRZ C;  3FMC A;  4N8F A;  4A3D B;  3I73 A;  1K0R A;  2ZJQ A;  1YHQ A;  5E4W C;  4A3M B;  3MZ5 A;  1A2U A;  2TSS A;  1EFW A;  4LFC Q;  3T4A C;  1X3Q A;  1YNJ D;  2XN9 C;  5ISR A;  1ASY A;  1IL2 A;  1AEX A;  4MHE A;  3M4P A;  5KIX A;  2J4X A;  3T1H L;  2F0T A;  4KMU C;  4P75 A;  2Q2U A;  1N32 Q;  1JWU D;  1LUZ A;  2DY7 A;  5BN5 A;  1E2W A;  2LMC B;  2ZJP A;  1Y1W B;  4OWT B;  1XWE A;  4LF7 Q;  5HGQ A;  1MBY A;  4OXP A;  1LAC A;  1SMY D;  1GUN A;  3FVQ A;  4MZ9 A;  3H09 A;  4ZRZ A;  2MFI A;  3DMU A;  3IFT A;  3S2H B;  5JPM C;  4RHS A;  1J9O A;  1WJJ A;  1CSQ A;  4DR6 Q;  1B4O A;  3MEF A;  3E9I A;  1RD9 D;  2E74 C;  2A69 D;  4JI2 Q;  2B2Y C;  1LTR D;  2JA9 A;  3BVM A;  1JCK B;  4X6A H;  3CCE A;  1Y1W H;  4IPH A;  3E9H A;  2FMC A;  5FLM H;  4GKK Q;  1I4Q A;  2B2U A;  1X9N A;  4LNQ A;  2YU9 H;  2D62 A;  3S1N H;  1RTO A;  1FR3 A;  2NVY B;  3T56 B;  2F4I A;  1O7L A;  2QCP X;  1N34 Q;  3I56 A;  4B3S L;  1DYQ A;  3RUZ A;  2VUM H;  4CJ2 C;  1X32 A;  4HJ9 A;  1L0Y B;  2NVT H;  1JC7 A;  3H0G H;  5CBE E;  1PYW D;  4A3I H;  1BXT A;  5EKI A;  4LF4 L;  2G5D A;  3K0X A;  1BO0 A;  3HOW B;  4DUY Q;  1I3Q B;  2DJG C;  1MGS A;  4PZ7 A;  4FYD A;  4BA2 I;  4DK0 A;  5EBC A;  1EYD A;  3PO2 G;  4IAL A;  1NCV A;  2PW5 A;  2RDG A;  3PUW A;  2VUM B;  4A3J B;  4C3I G;  3I4M B;  4A3G B;  1TR5 A;  4KY6 A;  4BY7 H;  5ELO A;  3W2D A;  5E7N A;  5FJ8 G;  1I4H A;  2H5X A;  3HKZ E;  4KJN A;  3GDE A;  5K36 H;  4R4C A;  5BN3 A;  4DU9 A;  1OO9 B;  2OTJ A;  5IYB H;  2E75 C;  4O42 A;  5CV7 A;  3LX0 A;  2E2I H;  4KV6 A;  2I5L X;  2YTY A;  3HOZ H;  2GA4 B;  1A62 A;  2KCM A;  3I55 A;  4JI0 Q;  3M3Y B;  2OF1 A;  4DR5 Q;  2F0K A;  2Z6B A;  3O13 A;  4KHP Q;  3PO3 B;  3S14 H;  1SE4 A;  2AQ3 B;  4DV5 Q;  2NN6 G;  2NN6 I;  4RCN A;  2NUC A;  3T53 B;  2RCF A;  5JPN C;  3CXC A;  4DR1 L;  1VMC A;  2B29 A;  1FGB D;  1NE3 A;  1C48 A;  1ESR A;  4KN7 C;  1XMO Q;  2DNE A;  2DGY A;  2CQA A;  4LFA L;  4A3L G;  1IYU A;  3F8T A;  4O1N A;  3AMU A;  3DUZ A;  5E4X A;  3X3M A;  4H44 C;  4DR2 Q;  2BE5 D;  4GKK L;  1EY4 A;  1ZYR D;  2HDL A;  4DAY A;  1XNR L;  3PO3 H;  2JJQ A;  2VNU D;  1DGS A;  4FF2 A;  3K81 C;  4K8I A;  3M3Y H;  4X65 L;  3E0J A;  4R8I A;  1SNO A;  4IOC A;  5IGE A;  5C44 B;  4TKO B;  2I46 A;  3QOJ A;  2A8V A;  1Q12 A;  1EYC A;  2ICI A;  4ULL A;  1P16 A;  2ALY B;  2EZV A;  2K5Q A;  1GVP A;  2Z6K A;  4JPB W;  2EY1 A;  2L1B A;  4HR7 B;  5I4D A;  1PFM A;  1SR3 A;  3BZD B;  2WKC A;  4XYO A;  1I6H B;  4JYA Q;  1CTM A;  1UEA B;  4ZKC B;  1DM0 B;  2QA4 A;  4DAV A;  3J81 j;  2JYO A;  1G2S A;  2A1A A;  1CKM A;  2NTT A;  1F9S A;  2E2J B;  4I7A A;  1B9N A;  1LV9 A;  3TP5 A;  2VY3 A;  3GTO B;  4YY3 Q;  3A55 A;  4TQU S;  2X69 A;  4R4T A;  3IKJ A;  2AHO B;  3N6R A;  4OO1 I;  2F0M A;  4A3L H;  2Q8T A;  3VDY A;  4A3C G;  1L1O C;  3SR1 A;  3ULJ A;  5C4X G;  3L2P A;  2R7Z H;  3UDF A;  1Q8I A;  1CA6 A;  3H0G B;  4JI3 Q;  5KYL A;  1N8R C;  1KC8 C;  1MJE A;  1HUN A;  1UEB A;  1CUK A;  2JEA I;  1JOO A;  5NUC A;  5BR8 Q;  4JI4 L;  2B3G A;  2DY8 A;  4WJ3 M;  1QE6 A;  5GRO A;  2EXZ A;  5M3M H;  4A3E B;  2AMC B;  2Y0S E;  2V1C C;  4L6T B;  4C1N K;  4DR5 L;  3VA5 A;  4OIK A;  2EYP A;  4GLA C;  3KFU A;  1YNN C;  1JB7 A;  2CH4 A;  2NVT B;  2I07 B;  3HP3 A;  1YZ6 A;  3W1G A;  5JEA G;  4PG3 A;  4QIW B;  1KNE A;  2K5H A;  4CHT B;  4LFA Q;  3HOU B;  2F0E A;  1XTD A;  2F0P A;  4L63 B;  1YEZ A;  3KLS X;  5HY6 A;  1MI2 A;  2KED A;  1D7Q A;  3NEL A;  1CT1 D;  4B3R Q;  1HPC A;  3KK7 A;  3UDG A;  5LMU Q;  2P5Z X;  3S1Q B;  1NUC A;  1HFN A;  1U4M A;  4JBM A;  3FDT A;  1RTN A;  3SK5 A;  1HR0 Q;  3GTJ B;  1X56 A;  2LFN A;  3M4Y A;  1J6Q A;  1M1K C;  2EQS A;  1PXU A;  2EYL A;  1EYA A;  1UE5 A;  2QIL A;  3J7Z C;  3Q6S A;  2JA7 H;  1M90 C;  4DR4 L;  1YHA A;  1OXV A;  5LMN Q;  1SMY C;  3AFP A;  1CZW A;  4IOA A;  1PRT F;  3KOJ A;  3NQI A;  2K7V A;  3D31 A;  2QEJ C;  4K5W A;  1CHP D;  3MFG A;  2PPB C;  3CCL A;  5A35 A;  4BXX G;  3U9O A;  1IZ6 A;  2F4V Q;  1EY7 A;  4L5Q A;  3KJP A;  5IY0 A;  3S14 B;  1EIH A;  1K3R A;  2XTI A;  1BDO A;  2XGT A;  3MXG A;  1LLR D;  5D3I B;  2YYZ A;  5IGF A;  4CBV A;  4Q0F A;  1WOC A;  2KEC A;  4C2M B;  2PZU A;  4IUR A;  1SLJ A;  4EQN A;  4A3D H;  5GAH C;  4FXK C;  1JOR A;  4IN3 A;  1LT4 D;  2B2V A;  3DWA A;  1JB3 A;  2WIN B;  2QEX A;  2ZXO A;  3OHX C;  4WFN 3;  1VQM A;  2UXD L;  3PUV A;  4OO1 H;  1VF5 C;  3GTO H;  2DJF C;  3GTM B;  3CP0 A;  2EE1 A;  3UDX A;  1S5C D;  1BNZ A;  2A74 C;  5M5Y B;  5FLX L;  4DR3 L;  2JA6 H;  1S3O A;  4DR7 L;  4RGO S;  3BVZ A;  4L5S A;  1HH2 P;  2ICE C;  1SAP A;  4A3B B;  2VB3 X;  2UUA Q;  1B50 A;  3K5O A;  1S5D D;  4JBK A;  2SDF A;  3OPO A;  4B9X A;  3KJO A;  3RN2 A;  2CCZ A;  4IPG A;  1OXT A;  3PCO B;  2A69 C;  3OYY A;  4JOI C;  1T9H A;  4IUU A;  1Q1E A;  2Y0S B;  3MA2 B;  4B3R L;  3SK6 A;  3RMH A;  1W3S A;  2FMM A;  4K8J A;  3M4O B;  1D5M C;  2MP1 A;  1HA6 A;  5COR A;  2F0H A;  3HKS A;  5EPJ A;  3GTK H;  5JJI A;  1B70 B;  4XYQ A;  1SYE A;  2A6E D;  5GQO A;  1PTO C;  2PQE A;  1FNW A;  2F0D A;  4K6L A;  3K5M A;  2FIN B;  2F03 A;  4APV A;  3EQL C;  1E1O A;  2IJ0 A;  2D5D A;  1TWG B;  1R9T H;  4K0K Q;  2WKD A;  5EKL A;  4BBS H;  5EQ0 A;  3HEJ A;  1X3P A;  3TSS A;  4DUZ L;  1V1P B;  1K9M C;  1N33 L;  4X64 Q;  1GUO A;  5KEE A;  1QNK A;  2EJG C;  3C46 A;  4HAE A;  1JJG A;  2K28 A;  1B9M A;  1SJH D;  1VF7 A;  1DOL A;  1BR9 A;  1QZH A;  3OW2 A;  1D5Z C;  1KQS A;  3KF6 B;  1C8C A;  1BCP C;  4FXG C;  4OEL B;  3T1Y Q;  1PH8 A;  2ZTC A;  3H0G G;  2RSN A;  4BBS B;  1M4V A;  4BY1 H;  1X6O A;  5D3D A;  1TWG H;  1R9T B;  1HXY D;  3G48 A;  2F0N A;  1BUV T;  1X55 A;  2FFK B;  2XRQ D;  1Z9F A;  2VQF Q;  2LS0 1;  5I6W A;  1HQM C;  2F0S A;  4JC0 A;  4JYA L;  2XIW A;  1LM0 A;  3ERS X;  1PH2 A;  2Z1C A;  4A3F H;  3R2I A;  4H13 C;  5FKA C;  3CHB D;  4QL5 A;  5IYD H;  5C4X H;  4ME5 A;  4DKA C;  1CI3 M;  4A3C H;  1P8L A;  2MQH A;  4V0B A;  2LXJ A;  1V1P A;  2TMP A;  2R7Z B;  3MXU A;  3U4Z A;  3PUZ A;  1MSH A;  3A8J E;  1PH9 A;  1BCP D;  4KKT A;  2ZM6 Q;  4IFD G;  4PZ8 A;  3PIO A;  2PCF B;  2PI2 A;  3KF8 B;  1UNS A;  4LF8 L;  2EY2 A;  3M4Q A;  1IYJ B;  1WD1 A;  2RHQ B;  2F0F A;  4NB3 A;  1UAP A;  1HHV A;  1WFQ A;  1GUG A;  2UUC L;  2DUD A;  2PO4 A;  5C5M A;  2N55 A;  1TWF B;  1SN8 A;  4DV0 L;  1QZG A;  3J7A V;  4WOR A;  1EIY B;  2C9O A;  2O2L D;  1TKW B;  4R1J A;  3PUY A;  4HJ7 A;  5L37 A;  4DUZ Q;  3URY A;  1JQY D;  5IP7 G;  3LNN A;  3ND8 A;  1GKH A;  5G3L D;  4JI1 Q;  1PHJ A;  4X64 L;  4HED A;  3TP7 A;  1GXD C;  3CPF A;  4X66 L;  2Q2H A;  1GUS A;  4LF7 L;  3AFQ A;  2RF4 A;  1HZB A;  5CMD A;  3KYH C;  1K3B C;  1PH7 A;  2I0Q A;  4QJF A;  2LY7 A;  3DEP A;  4LF9 Q;  2K5V A;  3NK9 A;  1FNV A;  2CH4 W;  5K36 G;  5FLM G;  4BS9 A;  1G29 1;  1MKH A;  1STH A;  1IBK L;  3I7F A;  5FO7 B;  4BXX H;  1HNZ Q;  3MTS A;  3MXP A;  4FP5 D;  4DR4 Q;  3M4O H;  4NXM L;  2VQF L;  3CCV A;  2A68 C;  3HOZ B;  1I5F A;  4HJA A;  2A68 D;  3GTP B;  5CV8 A;  4YWL A;  4B3S Q;  4DK3 C;  4B3T L;  1E7Z A;  3S1Q H;  1BQQ T;  5IP9 H;  3BDO A;  5IOD A;  3OOC A;  2SNM A;  4UAI A;  5CGK A;  1VQ6 A;  3I4N B;  2JE6 I;  3W5O A;  3U9S A;  4JVZ A;  2JEB I;  3EBE A;  3A54 A;  1L1O B;  5C5L A;  3NPP A;  4KLK A;  1Q81 C;  4RGN A;  1TS4 A;  2OQK A;  1KTK A;  4LF8 Q;  3J7A 5;  1BBW A;  4IJH A;  1W6K A;  5I6Y A;  4C3H H;  4QF4 A;  4HJ5 A;  4F87 A;  3FPP A;  1TY2 A;  3U4V A;  4C3H B;  3NBH A;  1GUW A;  4OWX B;  4EQO A;  4G57 A;  2KCN A;  4PV1 C;  2Z4I A;  1FD7 D;  4C3I B;  4A3G G;  3TDQ A;  3HOU G;  1O7I A;  1OXU A;  2JA7 B;  1PRT D;  1SBB B;  1GM5 A;  1I4X A;  2ZTD A;  1PYS B;  1PDQ A;  3IL8 A;  4JI0 L;  2RQX A;  4P74 A;  3IFD A;  3CC7 A;  3I70 A;  3CC4 A;  2B8F A;  2RDH A;  3FPU B;  3I4N G;  2E2J H;  2F0G A;  3C1F A;  3E5S A;  1K8M A;  2BDN A;  1C9O A;  1Y1V H;  3B6Y A;  1SE2 A;  1KRS A;  4IUQ A;  1YJW A;  1BCP F;  5IE8 A;  1KAA A;  1TS5 A;  1XMO L;  1L0X B;  2YTV A;  5LMN W;  2N49 A;  2A6E C;  3QR8 A;  3DWP A;  3S24 A;  1HNZ L;  3L0O A;  2CW0 D;  1PYB A;  3J80 i;  2PI2 E;  4X3U A;  2BH8 A;  2CW0 C;  2N88 A;  4DAM A;  1YVC A;  5KND A;  2EY6 A;  1TS2 A;  3D6C A;  3KLW A;  1DXM A;  2NYZ D;  3KUP A;  4AIM A;  4EQP A;  1AE2 A;  5DNF A;  4LUV A;  4B3T Q;  3HZX A;  2MHV A;  3LGJ A;  3A74 A;  1N33 Q;  1U9R A;  4P2C B;  2ZTE A;  3M7G A;  4JBW A;  1EWH A;  3J81 c;  4N8X 1;  2BCO A;  1EL0 A;  1CQF A;  2G9H D;  3TS0 A;  4A93 G;  1ILQ A;  3U58 A;  1HNW Q;  2AWN A;  2H1E A;  3H3V C;  1I6V C;  4R4I A;  2EPB A;  4HSV A;  3HOV B;  1NY4 A;  1S40 A;  2RBM A;  3HOY G;  4GLV B;  4C3J G;  1E22 A;  2E76 C;  2NZO A;  3TZU A;  4F8M A;  4JI8 L;  3I2Z A;  2QDB A;  3FKI B;  4X62 Q;  4IPD A;  3S17 H;  2R93 G;  4CDF C;  2F0W A;  4IPC A;  2VXW A;  4CDD C;  2R92 B;  4K6D A;  4S3S A;  1QUQ A;  5E3F A;  2NVX B;  2B8G A;  1DZ1 A;  5LHY 1;  4YCU A;  5BR8 L;  1K8A C;  5LL6 S;  2F0L A;  2EXD A;  4XIG S;  5JJZ A;  1NR4 A;  2H4O A;  2XSC A;  5ELD A;  5HGT A;  3HKZ B;  3AB9 A;  5C6A A;  1U4R A;  4NPS A;  3DEO A;  1Y1W G;  1MIU A;  2K5W A;  3U50 C;  1YJ9 A;  4AYB G;  1XJV A;  1D1I A;  3GTM H;  2JK8 A;  1LAB A;  3I90 A;  2MJ8 A;  1FJG Q;  4WJ4 A;  4Z9C B;  4CDE C;  2OTL A;  5EGT A;  2PQA B;  3Q22 A;  2UUC Q;  5C44 H;  1EY0 A;  4QUC A;  1AE3 A;  4C3J H;  1RCV D;  5M5X B;  2KHJ A;  1O80 A;  1IBM L;  2PMZ E;  1VQJ A;  5DEH A;  3VR5 A;  2R7F A;  1F2L A;  1TWA H;  4G7O C;  1LTT D;  1B2T A;  4X3K A;  3DHQ A;  2PNH A;  1QB5 D;  1PTO H;  3C1E A;  5FLX c;  2NZH A;  4JI1 L;  4A3J G;  1GHJ A;  2JA5 H;  4X66 Q;  1X3G A;  2PQA A;  1G6P A;  2BH2 A;  3VYR A;  3J81 E;  3S1M H;  2OEO A;  4J8Q A;  1KLG D;  2IPK D;  1EY9 A;  4BY7 G;  5ELE A;  1EQT A;  1O7Z A;  2O5I C;  3LWE A;  1BBX C;  3K8A A;  3CQZ H;  4KD4 A;  1WTH A;  4LF9 L;  5LL6 X;  5I9P A;  2PZW A;  1EOT A;  1K83 H;  2ASB A;  4OL7 A;  3KLR A;  4X62 L;  5CC4 A;  4DV2 Q;  1BVS A;  3PGZ A;  4QUF A;  2YV5 A;  3GV3 A;  5C4Z A;  3TP8 A;  3HOX H;  3M85 A;  3I4M G;  1LO5 D;  3EA6 A;  4IFD J;  2UU9 Q;  1I3Q H;  1KHI A;  3P7J A;  2CFM A;  2C35 B;  5I2X A;  2HCI A;  3HOV H;  2UXD Q;  1D2B A;  2JA7 G;  3RZD H;  1B1Z A;  4GNX C;  4IFD H;  1K73 C;  1D5X C;  4KY5 A;  2F0J A;  2F3V A;  4RHR A;  2DN8 A;  1CFM A;  1ZKO A;  1SE8 A;  1EU3 A;  2K01 A;  1X54 A;  3DWQ A;  3RZD B;  1XMQ Q;  4LF5 L;  1YNJ C;  2NVY H;  1SXT A;  3S2D B;  1HQR D;  1QCB D;  2B2T C;  3PO3 G;  4B08 A;  2UUA L;  2CVR A;  1VQA A;  4RKB A;  1E1T A;  4Q5V A;  1WTR A;  4A3B G;  4ME3 A;  1OTC A;  4ZCK A;  4YIJ A;  2C5C A;  3J81 L;  2GVA A;  1I94 L;  4BY1 B;  3PQI A;  3A8I E;  4DNI A;  1KAB A;  4PMC A;  2NVQ B;  1KIX A;  5COY A;  1B8A A;  1JJC B;  3DXJ C;  1H9K A;  1A15 A;  2Y0S G;  2RHS B;  3F2B A;  2L9H A;  2X6G A;  4XT1 B;  2NB0 A;  3NXW A;  3GTP H;  1JWS D;  1ONL A;  2HIX A;  4EGV A;  3J81 i;  1GO3 E;  3BU2 A;  2HT1 A;  1VQG A;  1TWA B;  2PMZ B;  1Q82 C;  3GTQ B;  4IZ8 A;  2QF7 A;  4DR6 L;  1VQ5 A;  3BYY B;  3VYU A;  3VYS A;  3QG1 A;  5A2Q E;  1B7Y B;  2R93 H;  2EJM A;  2BE5 C;  4KI0 A;  3OW7 A;  1DOM A;  3FHW A;  4A3E G; 
#chains in the Genus database with same CATH homology
 5C4J H;  3MXN B;  4A3E H;  3T1Y Q;  1PH8 A;  2ZTC A;  3CAM A;  3H0G G;  4JI2 L;  1OXS C;  2HHH Q;  2KCT A;  2R6G A;  1X6O A;  1KRT A;  4ALP A;  4BY1 H;  3HOU H;  2VQE L;  3M7N A;  1TWG H;  3S16 H;  3DM3 A;  1YIT A;  1HZA A;  1S72 A;  4GOP A;  3CC2 A;  3G48 A;  4OON A;  4DV2 L;  4NXM Q;  3CCR A;  1IXR A;  4L5T A;  3AQQ A;  1HZ9 A;  1Y14 B;  1X55 A;  5AJ3 L;  4AH6 A;  1CKN B;  4JI3 L;  1L1O A;  2N78 A;  1Z9F A;  2VQF Q;  5AJ3 Q;  5C44 G;  4JC0 A;  4XTC S;  3NEN A;  3I4N H;  4BBS G;  4JYA L;  1LM0 A;  3ERS X;  5M3F H;  4LF4 Q;  1PH2 A;  1VQN A;  4A3F H;  1HZC A;  1XMQ L;  1NTG A;  5IYD G;  1JE5 A;  4QL5 A;  4R4Q A;  5IYD H;  5C0X I;  2A19 A;  5C4X H;  5J3B A;  4DKA C;  5DLQ E;  4L5R C;  5GAG C;  4A3C H;  2R92 H;  1HNW L;  4GLX A;  1P8L A;  4JG2 A;  3RNU A;  3I4M H;  5JJK A;  2MQH A;  1VQK A;  2LXJ A;  4YWK A;  2ZJR A;  3HKZ G;  2IHE A;  4DPG A;  4BA1 I;  3U4Z A;  1I6H H;  3PUZ A;  4Y7N H;  4B3M Q;  4JOI A;  3ICE A;  3GO5 A;  2ID0 A;  1KXL A;  1PH9 A;  2BA0 A;  2ZM6 Q;  2K52 A;  4PZ8 A;  4HID A;  4IFD G;  3PIO A;  5GAE C;  2PI2 A;  3OTO Q;  5M3M G;  4JV5 Q;  3K7U C;  3UDI A;  3GTG H;  3KF8 B;  3HOW H;  3I4O A;  1K0R A;  2N8N A;  2ZJQ A;  1YHQ A;  4A3J H;  3M4Q A;  4LF8 L;  1IYJ B;  1UE7 A;  2K50 A;  2RHQ B;  3G71 A;  4NB3 A;  1EFW A;  1VS0 A;  4LFC Q;  5IT9 c;  3EIV A;  1WFQ A;  1A63 A;  1Q1B A;  3CMA A;  1ASY A;  4LFB L;  1HNX L;  2UUC L;  2DUD A;  3FKI H;  1Q86 C;  1IL2 A;  2IY5 B;  3T1H Q;  4AQY L;  1SN8 A;  3RLF A;  3H3V H;  3EN2 A;  4POG A;  3M4P A;  4DV0 L;  4DV7 L;  1QZG A;  4KHP L;  3T1H L;  4P75 A;  4IFD I;  1EIY B;  2Q2U A;  1K8G A;  4DV5 L;  1CKN A;  1N32 Q;  4DV0 Q;  4R1J A;  3PUY A;  1LUZ A;  4HJ7 A;  2JA8 H;  4DUZ Q;  4EQ5 A;  3H3V I;  2ZJP A;  2BA1 A;  3A0J A;  4OWT B;  4DR1 Q;  5IP7 G;  4LF7 Q;  2L15 A;  1BKB A;  1GKH A;  4OXP A;  4JI1 Q;  5HGQ A;  1PH5 A;  4X64 L;  1PHJ A;  1G51 A;  3W1B A;  4A3I G;  4GKJ L;  3CPF A;  4X66 L;  2Q2H A;  4LF7 L;  3AFQ A;  4MZ9 A;  2RF4 A;  2F3I A;  1L0W A;  2MFI A;  1CSP A;  1HZB A;  4DAY B;  2AKW B;  1FGU A;  3F1Z A;  1WJJ A;  1NJI C;  1CSQ A;  4DR6 Q;  1WCM H;  3KYH C;  1J5E L;  4LWC A;  3MEF A;  2ATW A;  3E9I A;  2HIV A;  1PH7 A;  2I0Q A;  4LUO A;  3CCJ A;  4QJF A;  4DV4 L;  4JI2 Q;  1J5E Q;  2JA9 A;  4LF9 Q;  2K5V A;  5K36 G;  4X6A H;  1BBU A;  5FLM G;  3CCE A;  1Y1W H;  1VCI A;  3E9H A;  1G29 1;  1MKH A;  4IPH A;  1WYD A;  4JCV E;  1I50 H;  5FLM H;  4GOP C;  4GKK Q;  1PFS A;  1IBK L;  2IX1 A;  3I7F A;  1X9N A;  4LNQ A;  4UP7 A;  4BXX H;  2YU9 H;  2D62 A;  1HNZ Q;  3S1N H;  4DR4 Q;  2E5L Q;  5ELN A;  5C3E G;  5JJL A;  1H95 A;  3M4O H;  4NXM L;  4A3B H;  2VQF L;  3A5U A;  3CCV A;  1TWF H;  1N34 Q;  3I56 A;  1LTL A;  4B3S L;  1I5F A;  3JAM c;  4HJA A;  5GAD C;  4LW1 A;  2VUM H;  4HJ9 A;  3KF6 A;  2NVT H;  3HOY H;  4YWL A;  4B3S Q;  4DK3 C;  4B3T L;  1E7Z A;  3H0G H;  3S1Q H;  4UPA A;  5IP9 G;  3KDF B;  4A3I H;  4BY1 G;  5IP9 H;  1XPR A;  5H1S E;  4LF4 L;  3K0X A;  4P73 A;  4KHZ A;  1TWH H;  4DUY Q;  3PF5 A;  1VQC A;  1VQ6 A;  3S2D H;  4PZ7 A;  2JE6 I;  2AWO A;  2D0O A;  3W5O A;  4BA2 I;  4A93 H;  1AH9 A;  2JEB I;  3HOV G;  3AEV A;  1VQB A;  3EBE A;  4GN4 B;  1L1O B;  1L2F A;  4GN5 A;  4JI8 Q;  3GD7 A;  2E2H H;  2I5H A;  2WFW A;  3PO2 G;  4KLK A;  1VQL A;  3ER0 A;  1Q81 C;  4GN3 B;  3PUW A;  2OQK A;  4JBJ A;  3CF5 A;  1KAW A;  1SFO H;  4LF8 Q;  4BY7 H;  3H15 A;  1BBW A;  4IJH A;  3F2C A;  2CWP A;  4LF6 Q;  3J7A 5;  2WAQ E;  2WAQ G;  5ELO A;  4NXN L;  3G4S A;  4C3H H;  4JI6 Q;  5E7N A;  4HJ5 A;  5FJ8 G;  2H5X A;  3HKZ E;  4GNX A;  4MNO A;  4RG1 A;  4LFB Q;  1HR0 W;  3GDE A;  4R4C A;  3M9B A;  3U4V A;  1QVC A;  4HJ8 A;  4JI4 Q;  2OTJ A;  5IYB H;  4A3E G;  4HIK A;  4OWX B;  4QIW E;  4A3G H;  3CPW A;  4A3G G;  5M5Y H;  3HOU G;  1PVO A;  4O0A A;  2E2I H;  3WWV A;  5C3E H;  1O7I A;  2I5L X;  2YTY A;  2JQO A;  1OXU A;  4HIM A;  1VQ8 A;  2KCM A;  1A62 A;  3I55 A;  3CCS A;  3STB D;  1VQE A;  1GM5 A;  4JI0 Q;  2JA8 G;  4DR5 Q;  2ZTD A;  1VQH A;  3L7Z C;  1PYS B;  4RMF A;  4A3M G;  3S14 H;  4KHP Q;  4JI0 L;  4A3K G;  4OX9 Q;  4DV5 Q;  4P74 A;  4GKJ Q;  3CC7 A;  1VQD A;  2NN6 G;  2NN6 I;  1YBY A;  3CC4 A;  3CXC A;  2WP8 J;  4DR1 L;  1X65 A;  3E0E A;  2MO1 A;  2E2J H;  3I4N G;  1JJ2 A;  3TRE A;  5M3F G;  3BZC A;  2MNA A;  2B29 A;  4C2M H;  1NE3 A;  3PV0 A;  2RCN A;  1Y1V G;  1XMO Q;  1C9O A;  2KEN A;  2DGY A;  3B6Y A;  1Y1V H;  2VZA A;  1KRS A;  1YJW A;  4LFA L;  3D0F A;  2F52 A;  3F8T A;  4DV4 Q;  4A3L G;  2E8G A;  1SRU A;  5IE8 A;  1XMO L;  1XNR Q;  1GD7 A;  4AYB E;  1N36 Q;  2YTV A;  5LMN W;  2UUB Q;  2K75 A;  2KHI A;  4DR2 Q;  2N49 A;  1VQO A;  4GKK L;  3FP9 A;  1KQS A;  1XNR L;  2VNU D;  1HR0 L;  3PO3 H;  2JJQ A;  1DGS A;  3K81 C;  3M3Y H;  4X65 L;  3IRB A;  2LSS A;  1YIJ A;  2JA6 G;  3S24 A;  3KDF A;  3CCQ A;  1HNZ L;  3RZO H;  4DV6 L;  1PH3 A;  3L0O A;  1PYB A;  3J80 i;  4IOC A;  2R7Z G;  1XPO A;  2PI2 E;  1UE6 A;  2BH8 A;  1Q12 A;  4DAM A;  1PH1 A;  1KL9 A;  1YVC A;  1PV4 A;  1IBK Q;  2ES2 A;  2A8V A;  1P16 A;  1Q7Y C;  4JI5 Q;  3KLW A;  2ALY B;  4YHH L;  4AIM A;  1OXX K;  4UP8 A;  1AE2 A;  4LUV A;  4B3T Q;  3LGJ A;  1GVP A;  4POF A;  5IYB G;  2Z6K A;  1RL2 A;  3RN5 A;  1XPU A;  3BJU A;  3A74 A;  3PSI A;  1VQF A;  4IJL A;  1FL0 A;  1N33 Q;  4QY7 A;  4UY8 C;  2ZTE A;  2F4V L;  3ZJY C;  1SR3 A;  2YTX A;  4JBW A;  3J81 c;  4JYA Q;  1EOV A;  2EIF A;  3HOW G;  5M5X H;  3G6E A;  2QA4 A;  3PUX A;  4A3M H;  3TS0 A;  4PMW A;  3J81 j;  4A93 G;  3U58 A;  1HNW Q;  2A1A A;  1CKM A;  2AWN A;  1TXY A;  4LUZ A;  4YCW A;  4YY3 L;  2B63 G;  4R4I A;  1NY4 A;  1S40 A;  4A75 A;  2VY3 A;  4YY3 Q;  4TQU S;  4A76 A;  4R4T A;  5IYC G;  4QGU A;  3CME A;  3HOY G;  4GLV B;  2AHO B;  1E22 A;  2GVB A;  1C7Y A;  2NZO A;  4OO1 I;  1SMX A;  4JI8 L;  4JI7 L;  3I2Z A;  4A3L H;  4GS3 A;  1NMF A;  4X62 Q;  3VDY A;  1VQ7 A;  1L1O C;  4A3C G;  3ULJ A;  5C4X G;  4GNX B;  3L2P A;  2R7Z H;  3UDF A;  1YJN A;  3OTO L;  4IPD A;  4A4I A;  4JI3 Q;  3JAM i;  1X3E A;  4IO9 A;  4JI7 Q;  3S17 H;  1JT8 A;  1N8R C;  2R93 G;  1EYG A;  1YNX A;  4IPC A;  2CQO A;  3PF4 A;  1KC8 C;  1Z47 A;  1MJE A;  1UEB A;  1CUK A;  2CKZ B;  3RR5 A;  2UXC Q;  1EQQ A;  1QUQ A;  1UWV A;  1EUJ A;  4DR3 Q;  4LFC L;  1QVG A;  2JEA I;  5BR8 Q;  4DR7 Q;  1W2B A;  4JI4 L;  3PO2 H;  2B3G A;  2UXC L;  4WJ3 M;  5GRO A;  4EX5 A;  5M3M H;  4YCU A;  2AMC B;  2Y0S E;  2V1C C;  1V9P A;  5BR8 L;  4DR5 L;  2QGQ A;  1K8A C;  4R4O A;  2WB1 G;  2EXD A;  4GLA C;  3CD6 A;  3KFU A;  4XIG S;  1X3F A;  4DV7 Q;  4P72 A;  1JB7 A;  1V1Q A;  4B3M L;  1YZ6 A;  4NPS A;  3W1G A;  5JEA G;  4PG3 A;  1MIU A;  3FKI G;  3U50 C;  1YJ9 A;  1Y1W G;  1TWC H;  1ASZ A;  4AYB G;  1Q8K A;  1XJV A;  5C0X J;  4JV5 L;  2Z0S A;  1E24 A;  2K5H A;  3GTM H;  2JK8 A;  4LFA Q;  1XTD A;  4PZ6 A;  1YEZ A;  2D0P A;  4YCV A;  4HIO A;  3GTJ H;  2KBN A;  5HY6 A;  1N36 L;  2IT1 A;  1I94 Q;  1FJG Q;  1D7Q A;  4WJ4 A;  3NEL A;  4B3R Q;  2OTL A;  4BBR H;  3UDG A;  2PQA B;  5LMU Q;  1HNX Q;  2UUC Q;  5C44 H;  3STB C;  5IYC H;  1AE3 A;  4C3J H;  4JBM A;  1EIF A;  2KHJ A;  2K4K A;  4DR2 L;  1PH4 A;  4A3D G;  1IBM L;  2PMZ E;  1HR0 Q;  3UE1 A;  1C0A A;  1VQJ A;  1X56 A;  2R7F A;  4JI5 L;  1TWA H;  1J6Q A;  3ULP A;  4X65 Q;  1M1K C;  4YHH Q;  2EQS A;  1PH6 A;  2Q2T A;  1XNQ L;  2PNH A;  2UXB Q;  2OWO A;  3TS2 A;  1UE5 A;  5FLX c;  2FXQ A;  2NZH A;  3J7Z C;  2R7D A;  3K80 C;  2JA7 H;  1M90 C;  4DR4 L;  3F2D A;  4TVA B;  1YHA A;  2K14 A;  4JI1 L;  1OXV A;  4DV1 Q;  4A3J G;  1V43 A;  4J15 A;  5LMN Q;  2JA5 H;  3AFP A;  4X66 Q;  2I5M X;  1N34 L;  1X3G A;  3KOJ A;  2PQA A;  3PIP A;  4H02 A;  2JA5 G;  4IOA A;  2BH2 A;  1G6P A;  1HJP A;  3D31 A;  3BZK A;  2OCE A;  1IBL L;  2NVQ H;  3S1M H;  4QQB X;  3CCL A;  4BY7 G;  1UE1 A;  4BXX G;  4OWW B;  1IZ6 A;  4Y52 H;  2F4V Q;  4L5Q A;  1E3P A;  1NBW A;  1VQP A;  5C0X G;  3K8A A;  3KJP A;  3CQZ H;  3S1R H;  5IY0 A;  2NVX H;  3T1Y L;  2B63 H;  5JEA J;  4LF9 L;  4DUY L;  5IWA Q;  1K3R A;  2VS1 A;  2XTI A;  2XGT A;  3GTL H;  3HOZ H;  1K83 H;  2YYZ A;  5IWA L;  2ASB A;  1WOC A;  4X62 L;  4DV2 Q;  3CCU A;  1BVS A;  3PGZ A;  1SLJ A;  4A3D H;  4YWM A;  2YV5 A;  3DLL A;  2K5N A;  2E5L L;  5GAH C;  1CKO A;  3HOX H;  1PA6 A;  3M85 A;  2HHH L;  1A8V A;  2QEX A;  3HOX G;  1VQ4 A;  3I4M G;  2VQE Q;  4IFD J;  1VQM A;  2UU9 Q;  4BBR G;  2UXD L;  3PUV A;  1I3Q H;  1KHI A;  3AYH B;  3GTO H;  2CFM A;  2C35 B;  1LYL A;  1NMG A;  3CP0 A;  3HOV H;  2UU9 L;  2UXD Q;  2JA7 G;  3CW2 C;  3UDX A;  5M5W H;  3RZD H;  1U0L A;  4GNX C;  1YHB A;  1K73 C;  4C3I H;  1KD1 C;  2MO0 A;  4DR3 L;  1S3O A;  2JA6 H;  4DR7 L;  3NBH B;  1SE8 A;  1EWI A;  1SRO A;  4L5S A;  3S15 H;  1HH2 P;  1X54 A;  3TQY A;  1XMQ Q;  4LF5 L;  2NVY H;  1Q46 A;  2OQ0 A;  2UUA Q;  3TEH B;  4LF5 Q;  4JBK A;  3PO3 G;  3KJO A;  3RN2 A;  2CCZ A;  4IPG A;  2ZM6 L;  2UUA L;  1OXT A;  2Q2I A;  1VQA A;  3PCO B;  3RLO A;  1RIP A;  2HQL A;  3OYY A;  1JMC A;  2VUM G;  2GN5 A;  4JOI C;  1T9H A;  4LF6 L;  1MJC A;  4FDB A;  4NXN Q;  1E1T A;  3CCM A;  3HOZ G;  4JI6 L;  1Q1E A;  4B3R L;  4A3B G;  4ME3 A;  2LXK A;  4GOP B;  1W3S A;  1OTC A;  1QVF A;  5EAY A;  3ULL A;  4A3K H;  2VL6 A;  1A0I A;  1N9W A;  2GVA A;  1WI5 A;  5IP7 H;  1YI2 A;  1I94 L;  3UE0 A;  1VQ9 A;  1FJG L;  3HKS A;  3GTK H;  3S2H H;  1FVI A;  4O2D A;  3Q8D A;  4DNI A;  5JJI A;  1B70 B;  3J80 c;  2IHF A;  5LMU L;  4AQY Q;  1KIX A;  3TRZ A;  5GQO A;  2WB1 E;  1B8A A;  1JJC B;  2CWA A;  1XNQ Q;  1U5K A;  4MTN A;  2UXB L;  2Y0S G;  2RHS B;  3SGI A;  3F2B A;  1IBM Q;  2IX0 A;  4K0K L;  4DV6 Q;  2N3S A;  4DV1 L;  4OO1 G;  4APV A;  4OX9 L;  1D8L A;  3GTP H;  1E1O A;  2VW9 A;  3GTQ H;  1R9T H;  4K0K Q;  4BBS H;  1N32 L;  1IBL Q;  3RLN A;  2HIX A;  4P71 A;  1GO3 E;  3BU2 A;  3NEM A;  3J81 i;  4DUZ L;  2HT1 A;  4A3F G;  5LMN L;  1VQG A;  4UP9 A;  1VQI A;  4DV3 Q;  1QUQ B;  4DK6 C;  1Q82 C;  2Z6K C;  1K9M C;  1N33 L;  4X64 Q;  3JC6 6;  4DR6 L;  1VQ5 A;  2R92 G;  4DV3 L;  3HFZ B;  5FJ8 H;  3K7A H;  1JJG A;  2UUB L;  1B7Y B;  2R93 H;  3A5Z B;  1EQR A;  4KI0 A;  1WCM G;  3OW2 A;  1QZH A;  3FHW A;  3KF6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...