4GLAC

Obody nl8 bound to hen egg-white lysozyme
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
89
Chain Sequence
LHGTEVVVAGWVASLGDYGRVKIVKVSDRGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
molecule keywords Lysozyme C
total genus 14
structure length 89
sequence length 90
chains with identical sequence D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glaC00
1N34Q 4JOIC 1P16A 3CQZH 4GN4B 1IBML 1TWGH 2PNHA 4IJLA 1B8AA 1VQCA 1L1OC 1C0AA 1OXSC 3RLFA 1NMFA 1VQAA 4NPSA 1YEZA 2K5HA 5M5XH 4QY7A 2I5HA 4X64L 4DR4Q 1Q12A 2D62A 4YY3L 4DV1L 4B3TQ 3NENA 4DV3Q 5DLQE 2N8NA 2BA1A 4A3KG 1VQ5A 4GKJL 3SGIA 1M90C 4BBSH 3E0EA 4Y7NH 4P74A 4LF6L 1JT8A 3KDFA 2EQSA 3S1QH 2UXBQ 4WJ3M 4OWTB 1FVIA 3E9IA 5HY6A 3M4OH 1YZ6A 2YTXA 1QVCA 5C3EH 1XTDA 2EIFA 3I2ZA 4YWLA 5JEAJ 1MJEA 3TQYA 3K81C 3J80i 3CCJA 4GOPB 2NVXH 4JC0A 1YITA 2Q2IA 3KJOA 5JJIA 3GTGH 4JI3L 1DGSA 1SMXA 3RLNA 1Q46A 2B3GA 4JI4L 2IX0A 1YI2A 4BY7G 4IFDJ 3KF6B 1XPRA 3RNUA 1CKMA 4BY7H 4OX9Q 2CCZA 1QVFA 2I5LX 4A3GH 4IOCA 2DUDA 1VQDA 1VCIA 2JE6I 3I56A 5LMNW 1IBMQ 1E7ZA 1PVOA 2NVQH 2RF4A 2YU9H 3S1RH 4A3IH 1S72A 2JEBI 4R4IA 3PO2G 1QZHA 1HNZL 2K50A 1AE2A 2A19A 4GS3A 4DV2L 3T1YQ 4C3IH 1KIXA 3CAMA 1EIYB 3PF5A 4JI8Q 1AH9A 2KCMA 4B3RL 1XPOA 2FXQA 2KENA 1WOCA 3K7AH 3J81c 4DR6L 4A3FG 4BA1I 4X62Q 5C0XG 2ZTCA 3HOVH 4JI0L 2HIXA 3ER0A 1H95A 2K75A 3F2CA 2I0QA 1BBWA 2ASBA 3PUXA 3HOWG 2JEAI 1CKNA 3G4SA 4JCVE 3GTKH 1LTLA 1CUKA 1TXYA 3AQQA 2ATWA 1VQBA 5JJLA 3ERSX 5FJ8H 4B3MQ 1FJGQ 4POFA 3BZKA 1KQSA 3M4PA 3BU2A 5IP7H 3I4NH 4RG1A 1QUQB 4GLXA 1L1OB 2ZM6Q 3D31A 4LF7Q 2LXKA 1MIUA 4JI3Q 5IP9G 4JI7Q 3BJUA 1VQPA 3STBC 4DR1L 3D0FA 1XNQQ 2UUBQ 3MEFA 4A75A 2N49A 5HGQA 3KYHC 1NBWA 3T1HL 1B7YB 1CSPA 5LMNL 1V43A 1PH4A 1N34L 3MXNB 4K0KQ 1XPUA 2YTYA 4O0AA 1NTGA 4DR3Q 4BXXG 3K8AA 2CFMA 5M5YH 3KDFB 2ZTDA 5M3FH 1UE1A 1PFSA 2IT1A 4LFAQ 2UXCQ 4X64Q 2E8GA 4NXNL 3J7ZC 1AE3A 4NXMQ 1JJGA 4QJFA 2D0PA 2VY3A 5IYBG 2YYZA 2B63G 4JYAL 5IYBH 1YJNA 3M3YH 5H1SE 4UP8A 1SROA 4DUYQ 2UXDL 1CKNB 2R93G 4IPDA 1VS0A 3EIVA 2F3IA 2YTVA 2Z6KC 4ME3A 1HR0L 4A3CG 4HJ9A 4AIMA 1OTCA 2NZHA 4DV6Q 4DR2L 2KHJA 4P75A 4GKKQ 2JJQA 1TWAH 4BY1H 3UE1A 1VQ7A 2UUAL 3PUVA 1K73C 4KHPL 3OW2A 2WAQE 1PV4A 3ZJYC 4POGA 3I4OA 1N8RC 3CCSA 2JA5H 1HZAA 3CF5A 3RN2A 2ZJPA 1EQQA 4DNIA 1PH5A 3U58A 1PH8A 4R4OA 2VUMG 1X3EA 1J6QA 4LF8Q 2VUMH 1S40A 4XTCS 2UU9Q 3GTLH 1HZBA 1XMOQ 3T1HQ 4AQYQ 1UE5A 5C4JH 1I94Q 2E5LQ 1X55A 1JB7A 2DGYA 2MQHA 3DLLA 4JI1Q 4DAYB 3KLWA 5IWAL 3J80c 2QEXA 1NJIC 3H3VI 5AJ3Q 4JV5L 4PZ7A 1HR0W 4DK6C 2MNAA 3FKIH 4IFDG 2UXCL 1NMGA 3GD7A 1HZ9A 1XNRL 3PO3G 1SN8A 3WWVA 4KHZA 3CP0A 5FLXc 3OTOQ 4PG3A 2UUCQ 3HOVG 2R6GA 1I3QH 4X65Q 2HT1A 2ZJRA 2VL6A 4L5TA 3FP9A 4C3HH 1GO3E 3M7NA 1N36Q 4DR5Q 1J5EL 4LF5Q 2AMCB 1YHQA 4J15A 2VNUD 1HNXQ 4A3LH 4QIWE 2IHFA 3EBEA 3STBD 5IYCG 5C0XJ 4A3KH 4JBKA 4QGUA 5C44G 3S24A 5C44H 1K83H 1WYDA 5FLMH 3J81i 4TVAB 2R7DA 3KF8B 4HIOA 4A3BH 1GD7A 3W1BA 5K36G 4UY8C 4LNQA 4LFBL 2K5NA 2ZJQA 3M9BA 3F1ZA 1N9WA 4LF4Q 5C3EG 1HNWQ 4B3SL 1XMOL 1Z9FA 4OX9L 2NN6I 3H0GG 4P73A 4X66Q 4FDBA 1IBLL 4H02A 3H0GH 4DK3C 1I6HH 2C35B 2VQFL 1EWIA 5E7NA 3PV0A 4A93H 3HOZH 1I5FA 1E24A 1WCMH 4A93G 3PSIA 1HNZQ 4JBJA 2K4KA 2ZTEA 1Q8KA 1W2BA 1PYSB 1A63A 3EN2A 4BBRH 2XTIA 4NXNQ 1VQKA 2WFWA 3CXCA 3HOYH 3PGZA 2PQAB 3S16H 1TWFH 3AFPA 2JA7G 4Y52H 2UUCL 3CW2C 4PZ8A 3U50C 4GNXA 2HHHQ 4JI5Q 3CCVA 2LSSA 3GTPH 3J7A5 1V9PA 1IBKL 4DR4L 4A3CH 1EOVA 1GVPA 5JEAG 4YWKA 4OO1I 4DAMA 1IZ6A 4JI6L 1EQRA 4WJ4A 1B70B 1SLJA 4JI2L 4BY1G 2N3SA 4C3JH 1VQFA 4R4QA 5IY0A 4DR7L 4LF6Q 3U4VA 1VQMA 4IPGA 3HOWH 3UDGA 4JI7L 4HIDA 4GN3B 1BBUA 4AYBE 2JA6H 1VQLA 2JA6G 1RL2A 1K9MC 1V1QA 2YV5A 1YVCA 1Y1VG 4YCVA 3JAMi 4AQYL 1XMQQ 3GTOH 3HOUH 1KRSA 2PQAA 4JG2A 4DV4L 3CCMA 4JI1L 3KOJA 2AWNA 2Y0SE 3U4ZA 1PA6A 3L0OA 2BH2A 1JMCA 5J3BA 5BR8Q 1FL0A 4HJ8A 1Q82C 2RHSB 1A62A 2E2IH 2Z0SA 3AEVA 4UPAA 1IBKQ 4IOAA 4JI8L 1JE5A 4GNXC 4DPGA 4LFCQ 4HJ7A 1VQGA 2MO0A 1OXTA 2JA8H 1IL2A 3H15A 2AWOA 4LF9L 4GLAC 4AYBG 4DUYL 1M1KC 4P72A 3NBHB 1RIPA 1D7QA 3GTJH 2R7ZG 2R7ZH 4R4TA 4B3RQ 2WB1E 4DV5Q 4DV0Q 1E3PA 1Q1BA 1XJVA 2OTLA 3I7FA 1BKBA 1KC8C 4YY3Q 4DV1Q 1PH7A 1GKHA 2UXDQ 1KHIA 2K5VA 3S2HH 1Z47A 1EFWA 5LMUQ 1K0RA 2UXBL 4YWMA 2L15A 1Q86C 2H5XA 1VQ8A 2ZM6L 1R9TH 4B3ML 1K3RA 3DM3A 1T9HA 4O2DA 5ELOA 1KL9A 2IHEA 4L5SA 1JJCB 4DR3L 3UDIA 2BH8A 4AH6A 1VQOA 1ASYA 3ICEA 4IFDI 1E1OA 4JV5Q 5IYDH 4HIKA 4RMFA 5GAEC 1SRUA 2HQLA 5LMNQ 3CD6A 4LF8L 4A3GG 3W5OA 2WP8J 1N32Q 3GTQH 4LF9Q 1PH6A 4IPHA 4JI5L 2HHHL 4QQBX 2D0OA 3S14H 3S1NH 3ULLA 3W1GA 4DV0L 3AFQA 1YNXA 4DV3L 4GKJQ 3PO3H 3FHWA 3CC2A 4YHHQ 4A3FH 2VS1A 1UE6A 1WJJA 4A3JG 1QVGA 2VW9A 3I55A 1PH3A 4A3JH 4OXPA 4JBMA 1L1OA 3NELA 4NB3A 2JA9A 3UDFA 1HR0Q 3M85A 1YJ9A 2R92H 3RN5A 4BA2I 5GAHC 4QL5A 5IYCH 1KAWA 1XMQL 5FJ8G 4JOIA 5IP7G 1K8AC 1JJ2A 4OWXB 1HNXL 4HJ5A 3I4NG 1U0LA 2A1AA 4DR1Q 1BVSA 3F2DA 2F4VQ 3S17H 3BZCA 4LW1A 2OQKA 3Q8DA 4LF7L 4LWCA 2UU9L 4OWWB 1X3FA 3GTMH 1YHAA 4DKAC 2PMZE 3B6YA 1YHBA 2UUBL 3HOXG 3J81j 1LUZA 3CCQA 2Q2UA 3HOXH 2KHIA 4XIGS 5IT9c 1OXVA 1N33L 1UEBA 3S15H 3S1MH 3K7UC 1W3SA 1CSQA 4DV7Q 1X56A 3RZOH 1Y14B 3PUWA 4BXXH 4A76A 3PCOB 3TREA 3TRZA 1VQHA 1HH2P 2WB1G 5IWAQ 5M3FG 4IO9A 1Q7YC 3RZDH 2GVAA 2GN5A 2VQEQ 5M5WH 4IPCA 2JA7H 1TWHH 2KBNA 2R7FA 1VQIA 1QUQA 3UDXA 4JYAQ 1C7YA 3PIOA 1J5EQ 4LF5L 1IXRA 2R93H 1X6OA 1HZCA 1K8GA 4DV6L 5GROA 3LGJA 4DV2Q 1IYJB 3T1YL 1VQ9A 2ES2A 1PH2A 1N36L 2N78A 3KJPA 2UUAQ 2OTJA 4X66L 1WI5A 1IBLQ 3ULPA 2OCEA 1C9OA 3CCUA 4JI0Q 1S3OA 3H3VH 4DR7Q 3G71A 5BR8L 2V1CC 4L5RC 2JA5G 5IYDG 2OWOA 4UP7A 2ID0A 3M4QA 4P71A 3TEHB 5JJKA 4OO1G 4R4CA 1E22A 1EYGA 2BA0A 1G6PA 4EX5A 2Y0SG 4DV7L 4TQUS 3CC7A 3E9HA 1SE8A 3KFUA 4HJAA 4KLKA 4A3IG 3PO2H 1KD1C 3HKZE 1Y1WH 4X6AH 3TS2A 1Y1WG 2XGTA 1SFOH 1XNQL 1E1TA 4DV5L 1VQ6A 4JI4Q 3AYHB 3PUZA 3GO5A 4X62L 1Q81C 1L2FA 1FGUA 1X65A 4GLVB 3CCRA 4NXML 1PHJA 2JA8G 4PZ6A 4APVA 2WAQG 1TWCH 1NE3A 2Q2HA 2CKZB 1MKHA 2QGQA 1VQNA 3OTOL 1LYLA 4GOPA 1U5KA 2RCNA 2JK8A 4A3MH 4A3MG 1X3GA 4GKKL 4UP9A 5LMUL 2F52A 2NN6G 3JC66 1Q1EA 4A4IA 3CPWA 3TS0A 4LUZA 5GAGC 1I50H 1SR3A 4LUVA 4DV4Q 1PH9A 4B3TL 4JI6Q 4A3LG 5EAYA 4DR6Q 4GNXB 2IY5B 4BBSG 3L7ZC 5C0XI 3CMEA 2B29A 4A3BG 1UWVA 5FLMG 4JBWA 1X9NA 3G48A 4YCWA 4GOPC 5ELNA 4LF4L 2LXJA 4KI0A 5M3MH 1YIJA 2HIVA 5M3MG 2GVBA 1YBYA 1G291 1KRTA 4DR2Q 1P8LA 1I94L 5GQOA 5IE8A 4LFCL 1FJGL 1NY4A 2NVYH 2QA4A 1N33Q 4K0KL 4HIMA 4B3SQ 3K0XA 1CKOA 3HOZG 4LUOA 1WCMG 2Z6KA 4DUZL 3UE0A 1A8VA 4BBRG 1EIFA 3K80C 4R1JA 3F8TA 4IJHA 2VQEL 3HOYG 3A74A 3HKSA 2VZAA 3CC4A 1VQ4A 1D8LA 3CMAA 3KF6A 3VDYA 1MJCA 2NZOA 4X65L 1EUJA 1G51A 2E5LL 2A8VA 5C4XG 1WFQA 2B63H 5C4XH 2CWAA 4A3EG 1N32L 2OQ0A 3G6EA 4A3EH 4YCUA 3CCEA 3OYYA 1VQJA 1OXUA 2PI2E 4OONA 2K52A 5AJ3L 3PIPA 1PH1A 1GM5A 4JI2Q 3F2BA 1QZGA 2JQOA 3PF4A 4MTNA 4LFAL 3A0JA 4DR5L 2Q2TA 3NEMA 1A0IA 2IX1A 1KXLA 4MNOA 1XNRQ 5GADC 1O7IA 1PYBA 3CPFA 4YHHL 4MZ9A 3RLOA 3JAMc 2MFIA 2K14A 3GDEA 4LFBQ 4ALPA 2F4VL 2R92G 2CWPA 1LM0A 1ASZA 2NVTH 3CCLA 3S2DH 3A5UA 4GN5A 3PUYA 4L5QA 1YJWA 3L2PA 2E2HH 1Y1VH 2ALYB 2E2JH 3HOUG 4KHPQ 3HKZG 2AKWB 2KCTA 1OXXK 2CQOA 2EXDA 3A5ZB 3HFZB 2MO1A 4C2MH 5IP9H 2VQFQ 2AHOB 4DUZQ 3IRBA 4EQ5A 4A3DH 2I5MX 4A3DG 1L0WA 4PMWA 1UE7A 1X54A 1HJPA 3FKIG 3ULJA 3I4MH 1HNWL 3RR5A 2RHQB 3I4MG 1VQEA 2PI2A
chains in the Genus database with same CATH superfamily
4GN4B 1CK1A 4ID6A 1JB3A 1VQCA 3K57A 4DAVA 1LTGD 3RLFA 1VQAA 4A3BB 2K5HA 5M5XH 1RF2D 1Q12A 2D62A 3PMFA 4DV3Q 4GKJL 1A2TA 2BA1A 3I4MB 4DGZA 2F0PA 4Y7NH 4P74A 4LF6L 1JT8A 1O80A 2EYPA 4OWTB 3E9IA 5HY6A 2JA7B 1RKNA 1CHPD 5LL6X 1QVCA 2E2IB 1XTDA 2EIFA 1CZGA 1QG7A 3K81C 1G91A 1IHZA 3CCJA 4GOPB 4JC0A 2NVXH 2F0UA 4CJ1B 1EY7A 3GTGH 1SMXA 1DD2A 3KLRA 4JI4L 4RHSA 4OIJA 2BDOA 4DK1A 4K6DA 4OX9Q 1NSNS 1VQDA 1VCIA 1E7ZA 2YU9H 3PO2G 1GXDC 4LAAA 2K50A 1D6EC 4K5VA 1AE2A 2DJGC 1KIXA 4DV2L 3CAMA 3S1MB 2KOLA 2FXQA 4QB4A 1WTWA 4A3FG 3PO2B 2ZTCA 4EQPA 2I0QA 3A56A 2I46A 2EY6A 3GTKH 1LTLA 3S1RB 1CUKA 1TXYA 1BCPD 3A55A 3AQQA 3ERSX 5FJ8H 4POFA 3BU2A 4TKOB 1DONA 1QUQB 1QNUA 1L1OB 5G3LF 2LXKA 1B9MA 4DR1L 1XNQQ 3NE5B 2UUBQ 3MEFA 4A75A 4G7OC 1NBWA 2F0IA 2F0OA 1PH4A 1CSPA 1H9SA 3MXNB 3OPOA 4DR3Q 4N8FA 2CFMA 3KDFB 2EPBA 5D3IB 3Q22A 5M3FH 2RQXA 4X64Q 3S2HB 2YYZA 1WTVA 5H1SE 1SROA 4DUYQ 3EIVA 2Z6KC 3MXUA 4HJ9A 1EQVA 2JJQA 2WKCA 1SSOA 2UUAL 4RGMA 4KHPL 3OW2A 4POGA 3ZJYC 1N8RC 3CF5A 3RN2A 1PH5A 1HA6A 1F2ZA 4R4OA 1SBBB 2BE5C 4AYBB 1C8CA 2UU9Q 1AW7A 1J8IA 4K5XA 4AQYQ 1F77A 2E5LQ 5C4JH 1STEA 1X55A 3K5LA 1Z7TA 4JV5L 3EROA 4PZ7A 3J7YW 2MNAA 1NMGA 3ND8A 5D3DA 4C3IG 2R92B 5CV4A 3RMHA 1SN8A 1G6ZA 3OTOQ 2O4XA 3HOVG 4DAYA 1I3QH 4X65Q 3LNNA 5IGBA 5EBCA 2VL6A 4ILWA 4CDEC 4C3HH 1GO3E 3K6OA 2VB2X 1N36Q 4DR5Q 1J5EL 1LTRD 3TP7A 3E0JA 4J15A 3T4AC 2VNUD 4QIWE 2IHFA 3EBEA 2IPKD 4BBRB 5C0XJ 4JBKA 2Q8IB 1BOSA 4QGUA 1BNZA 4V0BA 3R8BA 5C44H 3J81i 1EZ6A 2RBMA 4LFBL 2ZJQA 3S16B 4NKLA 2B2TA 5KYLA 3DWPA 3TP8A 2GA4B 4X66Q 4NP5A 4DK3C 1E24A 1WCMH 4J8QA 2K4KA 3TZUA 4KK7A 1PYSB 1A63A 3NUCA 5C5MA 1U4LA 1VQKA 2CHBD 4MTKA 1WTXA 3J7A5 3LX0A 1LT3D 2PQEA 2KVMA 3QG1A 3HOZB 1CQVA 5JEAG 4YWKA 4R8NA 4JI6L 4PQXA 4JI2L 1MBYA 2N3SA 4A3IB 3MFGA 3D4RA 5IY0A 4DR7L 3VA5A 3RD4A 1VQMA 4IPGA 3HOWH 4HIDA 5IT9L 1VQLA 5J22A 1RL2A 3C1FA 2MHVA 1V1QA 4KD4A 1U4RA 3DMUA 1WD0A 1KRSA 4JG2A 3KBXA 1JMCA 2MJ8A 5BR8Q 2RHSB 1A62A 5C3EB 3HG9A 5CBAE 3AEVA 4IOAA 2FFKB 1JE5A 1MHWC 4GNXC 4DPGA 4LFCQ 2D5DA 1OO9B 1VQGA 2F0QA 3H15A 1B4OA 1TS2A 2EYLA 2SNMA 4P72A 1JC7A 3NBHB 5LL6S 5EPKA 1KC8C 4YY3Q 4DV1Q 1PH7A 3VA7A 2F0JA 3NTKA 3BVGA 2L9HA 3DWQA 2N88A 2K5VA 1Z47A 5IT9E 1EFWA 1K0RA 4YWMA 4KY5A 1Q86C 1I4QA 4RCNA 2RA4A 2IHEA 4L5SA 1JJCB 2A73B 4PMBA 4AH6A 4KN4C 4ZYSA 4RMFA 5IODA 4A3GG 2LMCB 1JOKA 1PTOF 3S14H 4KV6A 3MWYW 1RCVD 5EPLA 3IAYA 3AFQA 3SR1A 4A3FH 2VS1A 1FGBD 1RDPD 2VW9A 4A3JH 4OXPA 1SNMA 4JBMA 3GTMB 3FKIB 1HR0Q 4C3HG 1AZPA 3K5OA 5FOBB 3GTQB 4QL5A 3VR6A 1JJ2A 1KAWA 1XMQL 5IP7G 2IX3A 1U0LA 2FMMA 4DAPA 4DR1Q 2F4VQ 4LF7L 3C46A 4DKAC 3B6YA 2QF7A 3J80L 2K5QA 3HOXH 5IT9c 1TY0A 1UEBA 4TSSA 3K5MA 4HCSA 4DV7Q 3N6RA 1Y14B 4BXXH 3TREA 1VQHA 5M3FG 4CJ0B 1Q7YC 2B2WA 2GVAA 1VMCA 4IUTA 3S1QB 5M5WH 1UNSA 1K8OA 2LY7A 1W6JA 4HMIA 1VQIA 4OEMB 1PFBA 4JYAQ 5FKAC 5I4DA 4IUVA 1K8GA 1O78A 5GROA 3LGJA 3T1YL 3E5SA 1N36L 2N78A 2UUAQ 2OTJA 2K5DA 4LJZC 4OHJA 1KNEA 3CCUA 5CR3A 3DWAA 1S3OA 4XYQA 4L5RC 4UP7A 2ID0A 1BR9A 3OWFA 2EYJA 3IKJA 1D5ZC 2Y0SG 4DV7L 4I65A 3E9HA 3KFUA 4HJAA 1EIGA 2P5ZX 4KKUA 2F0HA 4X6AH 1BUVT 1E1TA 3PUZA 1BQQT 1UEAB 2JA8G 4NXML 1PHJA 2WAQG 1NE3A 3D4DA 2CKZB 1MKHA 4WORA 2E76C 4BY1B 2RDHA 2CVRA 3H6MA 3BZDB 1VQNA 3I4NB 1U5KA 3Q23A 4A3MG 1JQYD 4UP9A 5LMUL 3JC66 3CPWA 4A4IA 4KY6A 1ILPA 4FXDA 2PPBC 4A3LG 1I50H 4LUVA 2LFNA 4JI6Q 3GTPB 3MHBA 4GNXB 3FEWX 1EIHA 3L7ZC 2B29A 1X9NA 5F2DA 4LF4L 2LXJA 1YIJA 2X6GA 5DM63 3NSWA 3BVZA 1KRTA 1STGA 1F2MA 1YBYA 5KNBA 1I94L 5C4XB 4K0KL 1FJGL 4LFCL 1NY4A 1TIID 5KYIA 2QA4A 1CKOA 3Q24A 2EJGC 1I4GA 3O13A 1T5EA 3M3YB 1HTPA 1EIFA 3DUZA 3F8TA 4IJHA 2VQEL 3HOYG 3CC4A 1VQ4A 3V96A 3VYUA 1VF5C 2A8VA 5C4XG 5I2XA 2B63H 2EXZA 1IBKQ 4A3EH 4YCUA 1JOQA 3PIPA 3IFDA 1GM5A 2JQOA 4MTNA 4LFAL 3A0JA 4L63B 4Q5VA 2Q2TA 1A0IA 2B8GA 1XNRQ 1MGSA 1PYBA 3CPFA 1XYIA 4MZ9A 3RLOA 3JAMc 3GTJB 2WIIB 4LMQD 1D2BA 4LFBQ 4X3UA 2CWPA 3S2DH 1DXMA 2NVTH 2IWHA 3PUYA 3ZYYX 1PTOH 1LACA 2E2HH 1O7YA 3HGBA 1F2YA 1CHQD 5C4ZA 2PMZB 1OXXK 2EXDA 2MO1A 3IRBA 4EQ5A 2I5MX 2EY1A 1HJPA 3I4MG 1NAPA 2KQ3A 5IGCA 1P16A 4G7HC 1IBML 1K8MA 1ZEQX 1B8AA 1L1OC 4RGNA 1OXSC 1NMFA 1Y1VB 3X3NA 1BBXC 2PNRC 3F2UA 4X64L 4DR4Q 4YY3L 4ZLTF 4DV1L 4B3TQ 3NENA 2N8NA 1EYDA 1BXTA 4BBSH 3E0EA 2ENBA 2EQSA 1QJOA 2UXBQ 4WJ3M 2L5TA 3M4OH 1YZ6A 2YTXA 2SOBA 3ITPA 1I4RA 3I2ZA 3MFYA 1GOZA 3MXGA 3BYTB 3KLSA 4WJWA 4EGVA 5JJIA 4JI3L 1DGSA 3FPUB 5FLXL 1Q46A 1Y8NB 3HP3A 2ZXPA 4F7XA 1ENFA 4IFDJ 3KF6B 4BY7H 2I5LX 3OWEB 4IOCA 1IBMQ 2XSCA 2WV6D 1PVOA 4C3JB 1G2SA 2A19A 3T1YQ 1EIYB 3AB9A 4JI8Q 4RHRA 2KENA 3T13A 4DR6L 1RTOA 5C0XG 2CH4A 1H95A 4CKCA 3N52A 3F2CA 3PUXA 4JCVE 1G2TA 1E2WA 4B3MQ 2KEEA 4C3IB 4QUCA 4GLXA 5M5YB 2ZM6Q 1PXUA 1MIUA 1TY2A 4JI3Q 3BJUA 3NBIA 1SEBD 3STBC 3D0FA 1IYVA 3MZ5A 1X3QA 3I73A 2MUYA 3KYHC 1HFNA 1X3PA 4FF4A 4RKBA 1B7YB 1N34L 4XQNA 1TT2A 5A35A 4K0KQ 1XWEA 4O0AA 3D6WA 5I2YA 1NTGA 1NUCA 5KRUA 4I7ZC 3K8AA 4BXXG 4XYOA 2BDNA 4FO2A 1PFSA 2IT1A 4CBVA 1PTOD 1Y8OB 1YJNA 1ZYRD 2DNCA 2UXDL 1H9RA 3H94A 2R93G 4A3CG 4ME3A 4H13C 5JEAH 2OF1A 4PV1C 2HUGA 2D2CC 1TWAH 1HA5A 3PUVA 1PRTD 3K5NA 2A74C 3I4OA 4ZUIA 1HPCA 1HZAA 2ZJPA 4DNIA 4LK1C 2VUMG 1ICWA 1X3EA 1S40A 3GTLH 3BDLA 1T5XD 1ESRA 1UE5A 1I94Q 4UAIA 1EY4A 4DAYB 1PDQA 4CHTB 5IWAL 3J80c 1DZ1A 4BWGB 3WDNA 5AJ3Q 3EVQA 4DK6C 2UXCL 3FMCA 4FYDA 1XNRL 3WWVA 5JPMC 2Z8LA 5FLXc 1DOLA 2R6GA 1BCPB 1V8QA 2B2UA 3FP9A 1G8ZD 3M7NA 2AMCB 4IURA 3H0GB 1JICA 1HNXQ 4JW0A 5IGFA 5IYCG 3M4YA 1ML0D 4O42A 4H0LC 1K83H 3J81E 1B44D 1TWFB 3ND9A 3HOYB 1GD7A 3W1BA 5K36G 4LNQA 2K5NA 3M9BA 1TU2B 5C3EG 4G7ZC 1KLGD 2JP1A 1KABA 1IBLL 4H02A 1MSGA 1I6HH 1EWIA 5E7NA 4A93H 2K32A 4A93G 1HNZQ 1SYBA 4JBJA 4BBRH 2K28A 1CM9A 2JA7G 2UUCL 4PZ8A 4ODGA 4BS9A 3OMGA 2KA7A 2KEDA 3EFXD 5CV8A 4OO1I 1KLUD 4WJ4A 4HTHA 4BY1G 1DYQA 4LF6Q 5C6AA 2JA8B 3UDGA 2F0LA 5DAUA 4JI7L 1CFMA 1K9MC 3D4WA 2RDGA 2YV5A 3HOVB 1YVCA 1XMQQ 3GTOH 3HOUH 4HR7B 5DNFA 4JI1L 2AWNA 1BDOA 1JE4A 4F87A 3U4ZA 3QWNA 3L0OA 1FNWA 2QKIC 1A3VA 4KKSA 2E2IH 1EU3A 2Z0SA 5E1FA 4K6LA 4OGQC 4HJ7A 2MO0A 2QDBA 4AYBG 1L0YB 3RUZA 1GUGA 3VR4A 3CRKC 2R7ZG 4B3RQ 2WB1E 1LTSD 1NR4A 2J4XA 1E3PA 3SK5A 5EGTA 1JWUD 1ESFA 2NVYB 1GKHA 3L3OC 1KHIA 1WTOA 2L15A 1HRJA 4HMJA 1R9TH 4B3ML 3DM3A 3PO3B 1KL9A 1IKLA 5C3WA 3UDIA 2BH8A 4EQOA 3D3RA 4DR3L 1XX8A 3ICEA 1E1OA 4IFDI 4OO1H 1D1IA 1SRUA 2HQLA 2QEJC 3CD6A 3GP7A 1HTLD 1N32Q 1BO0A 2PZWA 1PH6A 4JI5L 4QQBX 4X3KA 1SJED 1EQTA 5JJZA 4U673 4NMZA 3ULLA 1KTKA 2O2LD 4CKEA 4DF7A 3I55A 2KHSA 4KKTA 3NELA 2KCCA 2NTSA 3VYRA 3M85A 1YJ9A 2G9HD 3RN5A 2PCFB 3MTSA 2PYKA 3S15B 1IL8A 4JOIA 1CTMA 1K28A 3RZOB 1HNXL 1EFID 3FPPA 2A1AA 4A3GB 1IKMA 2CW0D 3F2DA 2EYHA 3EA6A 1SNQA 3Q8DA 1BCPC 1X3FA 4A3KB 2PMZE 1KNAA 4A3JB 1SNPA 3J81j 1LUZA 2KHIA 1N33L 1OXVA 5M5XB 1W3SA 2JSOA 4RGTA 1TQOA 3K7AB 4QCLA 1GHKA 1Q3LA 1V1PB 4U68A 3PCOB 4A76A 2M2LA 3TRZA 3KBGA 1HH2P 2WB1G 5IWAQ 3R93A 2F0GA 2JA7H 4J1MA 2R7FA 3QIAA 2OEOA 3GQBA 1EEID 1C7YA 3PIOA 5CV6A 1J5EQ 1IXRA 1WD1A 2R93H 4X3TA 2B2VA 3KJPA 3FVQA 1WI5A 3H09A 4X66L 4JPBW 3MVVA 2RSNA 3SK6A 1ET9A 4ZKBB 5CC4A 1Z6HA 3BG3A 4DR7Q 3G71A 5BR8L 5IYDG 5M5WB 4TRDA 4XQJA 3M4QA 3TEHB 1E22A 2H4OA 4MN3A 3DEOA 1EZ8A 1EYGA 3CC7A 1DOMA 1SJHD 3NK9A 4DNRB 1RJTA 2HCCA 3PO2H 1Y1WH 4DV5L 4JI4Q 3HKZB 2NB0A 1Q8IA 3GO5A 2Z4IA 1Q81C 1FGUA 4GLVB 4O1NA 2AUKA 1TWCH 2QGQA 5CGKA 1H9KA 4QIWB 1LTBD 3EJIA 2NN6G 2NYZD 1PZID 3TS0A 2NN6H 4LUZA 4B3TL 1F9PA 4KD3A 4L8JA 2IY5B 4BBSG 2XWJB 4ZQ3A 2A6EC 3CMEA 1M8AA 3NTIA 3MXPA 4XT1B 5M3MH 3A7LA 4DR2Q 1P8LA 3R2TA 3NQIA 4B3SQ 4ABNA 2H1EA 4WRDA 1SDFA 1WCMG 4M1UB 1A8VA 2QCPX 2F0EA 4R1JA 3HKSA 3CMAA 3VDYA 2K1BA 1QNKA 1U9RA 4A3EG 1N32L 3G6EA 3CCEA 3KF8A 3NQTA 1VMPA 2K52A 4JI2Q 4JVZA 1QZGA 4DR5L 2IX1A 4MNOA 2B2VC 3BVMA 3S1NB 5E3FA 1CI3M 2MFIA 4ALPA 2F4VL 2R92G 1ASZA 3VR3A 3U9SA 1SYCA 4ZCKA 3L9AX 3L2PA 2ALYB 3HOUG 1EYCA 4KHPQ 2L0CA 2KCTA 4KJOA 2CQOA 3A5ZB 2DJFC 5KGUA 2AHOB 4DUZQ 2B2TC 1HHVA 4A3DG 1L0WA 1SAPA 2CQAA 3TBIB 4B9WA 3ULJA 3I4MH 1HNWL 3RR5A 5BN5A 2LSSA 1VQEA 1N34Q 5BN4A 3CQZH 3S17B 1TWGH 4RA8A 2NVTB 4IJLA 1AN8A 1YNND 3R3OA 1TKWB 2NVXB 1F9RA 1LT5D 1KDAA 5CORA 4DFAA 5DLQE 2EYOA 3GTGB 1VQ5A 1LTAD 4YIJA 1M90C 4X3SA 3KDFA 3D8GA 5IGDA 1TWHB 1E0BA 1D5XC 1S5ED 5DM73 5JEAJ 4YWLA 3TQYA 3J80E 5LHY1 1YITA 2Q2IA 4RAUC 1DCZA 2B3GA 3QO2A 2BCOA 2IX0A 1YI2A 4NW2A 3MC0B 4BY7G 3RNUA 1QVFA 4KY7A 5LMNW 3I56A 2JE6I 2E75C 2NVQH 2RF4A 4RWSC 3S1RH 4A3IH 2JEBI 5KEEA 3PIO3 1SYDA 2MGSA 4GS3A 5EKIA 1AH9A 3CU7A 2Z6BA 1XPOA 1I4HA 1WOCA 3J81c 5CBEE 1LT4D 1RD9D 2CH4W 2HIXA 3ER0A 3KUPA 1SFOB 1BBWA 3HOWG 1CKNA 2F4IA 5AFWA 2PW5A 4BY7B 3Q6SA 3SHLA 3BZKA 2Z1CA 1KQSA 1FNVA 3I72A 2R61A 2FJ2A 3D31A 2K04A 2L1BA 4CDFC 4LF7Q 4IUUA 5IP9G 2K33A 1VQPA 1PFNA 1CQFA 2N49A 5HGQA 4OL7A 1WVLA 3GTKB 3IFTA 5LMNL 1V43A 4F88A 1XPUA 4FP5D 5E4WC 1S4ZA 2ZTDA 1UE1A 2L12A 4FF1A 4LFAQ 1XTCD 2UXCQ 3J7ZC 1AE3A 3DHQA 2VY3A 2VUMB 2Y0SB 5IYBG 4JYAL 1JORA 3HZXA 1CKNB 4IPDA 2YTVA 1CA6A 1HR0L 5C5LA 4AIMA 1OTCA 2NZHA 4DV6Q 2KHJA 4GKKQ 1LV9A 4BY1H 3UE1A 1GUTA 3AU7A 1K73C 1PV4A 3BDOA 5A2QL 5FO7B 3CCSA 3OIQA 1PRTC 2JA5H 1EQQA 2EY5A 3U58A 1PH8A 1J6QA 4CDDC 1S5FD 5KIXA 2SDFA 5I9PA 1HZBA 1FYCA 2C9OA 3C3LA 1JB7A 3KLWA 1SMYC 3NBHA 1SXTA 3FKIH 4IFDG 3GD7A 3D6CA 3QJYA 5I6WA 3PO3G 4KHZA 3CP0A 2TSSA 4R8IA 4PG3A 2UUCQ 5C0XH 4B08A 4A3DB 1JR0D 1QB5D 1QE6A 3I70A 2OXPA 4K2LA 5K5PA 4LF5Q 1B53A 1SNOA 1D1KA 1ZXTA 4A3LH 3J7AV 3STBD 2EOTA 1WCMB 5C44G 4N8X1 1H9SB 1WYDA 2RCFA 1S5CD 3MXNA 2VXWA 1B2TA 4HIOA 4A3BH 1R4PB 1B50A 1HQRD 3C2PA 4UY8C 2G5DA 3T51B 4DK0A 1N9WA 4K14A 5EKLA 1HNWQ 4C3HB 4B3SL 4EQNA 2Q8TA 4DA2A 1XMOL 3WOEA 4OX9L 2NN6I 4Y7NB 2D9UA 4FDBA 2C35B 4I7AA 4N9PA 2VQFL 3HOZH 5BN3A 2EZVA 1HUNA 1H9MA 1PTOB 5T1GA 4NXNQ 2JA6B 2A69D 3TP6A 1K83B 2PQAB 2DY7A 3S16H 1TWFH 4Y52H 3CW2C 3U50C 4JI5Q 1I4PA 1KDBA 1GUOA 3R2IA 3BYYB 1SE4A 4A3CH 4DR4L 1GVPA 3OMCA 4DAMA 1EQRA 1B70B 1SLJA 2E74C 2F0VA 2QDLA 5J1ZA 2A5HA 2IW3A 3I4LA 4RKLA 1VQFA 1IW7D 3HS0C 4QUFA 1A15A 1B3QA 1II3A 1NCVA 4MIUA 5FO8B 1Y1VG 3JAME 1EY9A 2B2YA 4DV4L 4C56C 4OELB 3CHBD 5IIFA 4QMGA 3CKIB 3KOJA 2Y0SE 2KUMA 5J3BA 1FL0A 4HJ8A 1Q82C 5D65A 1AP0A 4UPAA 5IGEA 3HOWB 1NR2A 4JI8L 5I9OA 1SYFA 3S9WA 1OXTA 2JA8H 1UUPA 1IL2A 1E2ZA 3A7AB 3FDTA 1QOHA 4DUYL 3T56B 1M1KC 2R7ZH 4R4TA 1UAPA 3VR5A 1C4QA 4DV0Q 3HEJA 1HFGA 2AQ2B 1Q1BA 2RVLA 1STAA 1XJVA 3I7FA 1BKBA 1PZKD 2C5CA 2E2JB 1SNCA 2UXDQ 4C2MB 3I91A 3S2HH 1SE2A 1SNDA 4S3SA 1TS4A 2LKVA 3P20A 2ZM6L 1VQ8A 1F9SA 1T9HA 4FVMA 1U4PA 5ELOA 3QOLA 4JV5Q 4RH6A 4HIKA 5GAEC 2G9DA 5DEHA 2V4DA 2NWGA 1PZJD 2WP8J 4KHVA 2QW7A 4UDUC 4LF9Q 2HHHL 1Y69U 5ISRA 5NUCA 4FF3A 3I8ZA 4DV0L 1YNXA 4DN4M 3PO3H 3FHWA 3CC2A 1WJJA 4A3JG 1QVGA 4UHVA 2XRQD 1L1OA 4NB3A 2JA9A 2IL8A 2R92H 4N9TA 3S14B 4BA2I 3HOXB 5GAHC 2N55A 5IYCH 5FJ8G 1K8AC 1WTQA 1ONLA 3I4NG 1BVSA 3BZCA 4LW1A 2OQKA 3GTMH 4LWCA 3SEBA 2UU9L 3J7AF 2ZXRA 3G6JB 1E2VA 1YHBA 2UUBL 1SYEA 5C44B 3CCQA 3S1MH 3W3AA 3K7UC 1CSQA 3NP8A 4HN7A 1HCZA 1X56A 1A3TA 5FLXE 4IO9A 3RZDH 2GN5A 2VQEQ 4RFBA 2K6AA 1EOTA 3K58A 1RODA 1QUQA 3UDXA 4K2KA 3A8JE 1X6OA 1HZCA 4IN3A 4DV6L 4HSVA 2NBFA 1VQ9A 2WAQB 1IBLQ 2BOSA 2F0MA 5C3XA 5EPJA 4HAEA 4JI0Q 3H3VH 5ELCA 3SE0A 1V1PA 2V1CC 2OWOA 4P71A 2F0SA 4R4CA 1STHA 5EBDA 3ONAB 5D14A 5M3FB 2FHTA 1TS3A 3SDZA 1G6PA 4TQUS 3Q0AA 1SE8A 4KLKA 1PFMA 3OIPA 3HKZE 4KJNA 1KD1C 1RTNA 2XGTA 1XNQL 3LWUA 4IUNA 1PRTB 3AYHB 3V05A 2A69C 4X62L 3CCRA 1B9NA 3OTOL 4GOPA 2JXMB 4A3MH 1S5DD 3NXWA 4GKKL 4XDXA 2F52A 2LS01 3OW7A 1Q1EA 3OHXC 1D5MC 1EY5A 5GAGC 3P1HA 1SR3A 3CRLC 4C1NK 4DV4Q 4DR6Q 5L37A 3H3VC 1W6KA 1ZKOA 4IALA 1UWVA 2B39A 3G48A 4JK1C 5TSSA 2HIVA 5M3MG 3TN2A 1G291 1CT1D 5IE8A 2F0TA 1EY0A 4HIMA 3K0XA 2XWBB 2JYOA 1LLRD 4LUOA 2ZT9C 2Z6KA 4DUZL 1I3QB 3K80C 2A6HC 5J39A 2VZAA 1D8LA 3KF6A 1MJCA 2E5LL 5C4XH 2CWAA 5M3MB 2OQ0A 3OYYA 1VQJA 1OXUA 4OONA 4QF4A 4CKBA 4C1NI 4IQZA 2E2HB 4Z9CB 2A6HD 3PF4A 3F2BA 2F0NA 3NEMA 1SE3A 1KXLA 1F9QA 4H7BA 2SEBD 2K14A 3GDEA 5M9OA 1HUMA 4KN7C 4K8JA 1LM0A 4A3FB 3CCLA 1PRTF 4GN5A 1J9OA 1LABA 3TSSA 1YJWA 4E6IA 2B8FA 5E4XA 2AKWB 2L4NA 1JCKB 3HFZB 5IP9H 2M9VA 1VF7A 1GUWA 4PMCA 4PMWA 1UE7A 1X54A 2NZ1D 2RHQB 2X69A 2ZXOA 2PI2A 5HGTA 4JOIC 2PNHA 3KLSX 3NWTA 1H9JA 1HXYD 2DY8A 2O5JC 1C0AA 2B2WC 2NUCA 3E3XA 1L0XB 1QCBD 4NPSA 1YEZA 4QY7A 2I5HA 1WTPA 1Q90A 1R4QB 4A3KG 4CJ2C 3SGIA 4WFN3 3NTHA 2L55A 4J6HA 3S1QH 2YU9B 3E6ZX 1FVIA 4G4KA 4MHEA 2EJMA 5C3EH 1MJEA 1TWGB 1CA5A 1VDZA 1STYA 3J80i 1O7LA 1DM0B 1ENAA 3KJOA 2J0TD 4ZKCB 5C4HA 3RLNA 5ELEA 1I4XA 3TDQA 3BDCA 1XPRA 2M00A 1CKMA 2CCZA 2AQ3B 4A3GH 1B3AA 2DUDA 2R3ZA 2EDGA 3C1EA 3EQLC 1S72A 1QILA 4R4IA 1QZHA 1HNZL 4IFDH 4ZAIA 4C3IH 4HSPA 4FXKC 3PF5A 2KCMA 4B3RL 3K7AH 1WTHA 4BA1I 4X62Q 3VYTA 4FXGC 4C3JG 3HOVH 4R9WA 1LT6D 4JI0L 3GTOB 3HOUB 2K75A 2ASBA 2HQEA 2JEAI 2OT2A 3G4SA 2ATWA 3T16A 1VQBA 5JJLA 1FJGQ 3M4PA 1LTID 5IP7H 3I4NH 4RG1A 1S5BD 3NHHA 5EJWA 5I6YA 5KNDA 1EY6A 2AUJD 4JI7Q 2O5IC 4DXFA 1I50B 1MI2A 3MEHA 1ICFB 3T1HL 2NTTA 2XIWA 3QB3A 2KECA 4IUQA 2EVBA 2YTYA 2DNEA 2J7ZA 1EL0A 2EJFC 5M5YH 2E8GA 4NXNL 4NXMQ 1JJGA 3HRZC 1A6XA 4QJFA 2D0PA 1M4VA 2B63G 5IYBH 3M3YH 4EVOA 1B1ZA 4UP8A 1QWYA 5C4JB 1RHPA 1R9TB 1VS0A 2F3IA 3GTLB 2QILA 4H44C 4DR2L 4P75A 3GV3A 1VQ7A 3URYA 1BF4A 2WAQE 4M8AA 3WOFA 3SVMA 3TMEA 4DXGA 3VR2A 1NNXA 2VUMH 4LF8Q 2MP1A 4XTCS 1XMOQ 3T1HQ 1EEFD 2WACA 1A3UA 2DGYA 2MQHA 3DLLA 4JI1Q 3P75A 2QEXA 1ILQA 1NJIC 3H3VI 2Q8RE 1HR0W 2IJ0A 2K05A 1HZ9A 5JVG3 4K8IA 1I6VC 1A2UA 2WKDA 5EKKA 2JA5B 4CDCC 2XN9C 1STBA 1Y8PB 2HT1A 2ZJRA 5HURA 2AQ1B 2Z4HA 4L5TA 3IL8A 4RCOA 1YHQA 4XXEA 4A3KH 5EQ0A 1PLFA 3S24A 5FLMH 4TVAB 2R7DA 3KF8B 4K5WA 3A54A 1TR5A 3F1ZA 1TS5A 4LF4Q 1Z9FA 3H0GG 1IW7C 4P73A 1PYWD 3H0GH 3PV0A 1I5FA 3M4OB 3PSIA 2K5WA 2ZTEA 1Q8KA 1W2BA 3M7GA 2FINB 3EN2A 3V2TA 2XTIA 2R93B 3HOYH 2WFWA 4DNTB 4ZK9B 3CXCA 3PGZA 3AFPA 3MAQA 4GNXA 2HHHQ 3CCVA 3GTPH 5JAVA 1V9PA 5ELFA 1PMRA 4F8MA 1IBKL 1EOVA 4B9XA 1IZ6A 3I90A 2JN4A 4C3JH 4R4QA 3U4VA 4L6TB 1V1OA 2JA6H 4GN3B 1BBUA 4AYBE 1DOKA 2JA6G 3W2DA 1EWHA 5G3LD 2F0KA 4YCVA 3JAMi 3NWSA 1XXGA 4AQYL 2PQAA 2TMPA 1GUSA 3CCMA 5FO9B 1PA6A 2BH2A 5A2QE 1HQMC 1GJXA 1JOOA 3DM1A 3I3CA 2F0WA 1MSHA 2Z9HA 2RSOA 2AWOA 4LF9L 4GLAC 4ME5A 3J81L 1RIPA 1D7QA 3GTJH 2XNAC 4DV5Q 1O7ZA 3KK7A 1SMYD 3SK4A 2OTLA 2CW0C 4PNYA 1YNJC 5K36H 3QR8A 1LTTD 3JAML 5LMUQ 2UXBL 3K0YA 1ET6A 2H5XA 4RGOS 1K3RA 4O2DA 4KMUC 1F2LA 1VQOA 5IYDH 1ASYA 3TZDA 1KAAA 3T53B 5LMNQ 1C48A 4LF8L 3W5OA 2RDFA 4ZRZA 3GTQH 4IPHA 2X6LA 2D0OA 5JVH3 3PIP3 5JOBA 3S1NH 2F0FA 2RKSA 2ICIA 4BBSB 3W1GA 3SXHA 4FF2A 4DV3L 4GKJQ 2ICEC 4YHHQ 1UE6A 1PH3A 1FR3A 5ELDA 3VYSA 3UDFA 2B2UC 2K01A 1LO5D 4G57A 1FNUA 2XVSA 2L11A 4DU9A 4OWXB 4HJ5A 5KNCA 2PW7A 1AZQA 1K3BC 1BCPF 3CQZB 3S17H 3K59A 4OWWB 1YHAA 1SYGA 2PZUA 3HOXG 2Q2UA 3ERQA 4ZUJA 4XIGS 4FNFA 5CV5A 3LWEA 5T1IA 3S15H 3BS1A 3NPPA 2HDMA 2SNSA 1JWMD 3RZOH 3PUWA 4NDXA 4IPCA 4A93B 1TWHH 2KBNA 1WTRA 4HCEA 4LF5L 4P2CB 4DV2Q 1IYJB 2ES2A 4XT3B 1PH2A 2A68D 1TVXA 3ULPA 2OCEA 1C9OA 2WB1B 3UI2A 5IGGA 1Y1WB 2F3WA 3X3MA 3RZDB 2KJXA 3FRPB 2JA5G 2NVQB 2A68C 4XQQA 3DEPA 5FK9C 3U9OA 5JJKA 4OO1G 3A8KE 1EY8A 1K0SA 2EY2A 2BA0A 4EX5A 1JWSD 4A3IG 1IYUA 4KTAA 3TS2A 1Y1WG 1SFOH 1VQ6A 2PZTA 4HEDA 2HDLA 1YNNC 1L2FA 1X65A 5JPNC 3OSOA 4PZ6A 2EYFA 4APVA 2F1MA 4IUPA 2Q2HA 1TWAB 2WINB 3GV6A 3SK8A 1LYLA 3H91A 2EYMA 2RCNA 2JK8A 3AMUA 1X3GA 1X32A 1FD7D 2F03A 5CMDA 3DXJC 4CGYB 4IZ8A 3TP5A 4OIKA 4V190 1CZWA 2KCNA 1PH9A 5EAYA 2HCIA 1ENCA 2F0DA 5C0XI 4A3BG 5FLMG 3A8IE 4JBWA 1TWCB 4YCWA 2BE5D 4GOPC 5ELNA 2B63B 3P7JA 4KI0A 5IOCA 4GZYC 1EU4A 4A3EB 1STNA 2GVBA 4ULLA 1GUNA 5GQOA 2NVYH 2PO4A 1N33Q 4A3MB 3HOZG 2FMCA 2DN8A 2K03A 2VB3X 3UE0A 4BBRG 1EWCA 2B2YC 3A74A 3OOCA 3S2DB 5CV9A 2HD3A 2NZOA 4X65L 1EUJA 1G51A 1DJRD 1WFQA 5CV7A 2F3VA 2PI2E 1AFPA 5ELBA 5AJ3L 1PH1A 1EYAA 4Q0FA 5GADC 1O7IA 4YHHL 2R7ZB 2K7VA 1I6HB 2XRSD 1AEXA 3QOJA 2E2DC 2EE1A 3A5UA 4L5QA 1KDCA 2I07B 3MA2B 1Y1VH 5COYA 2E2JH 2A6ED 1YNJD 1GHJA 3HKZG 4C2MH 2VQFQ 5CYUA 1ZYRC 1U4MA 4A3DH 3PQIA 3FKIG 1PTOC 2MPMA 3G7LA 1MD2D
chains in the Genus database with same CATH topology
1N34Q 4JOIC 1P16A 3CQZH 4GN4B 1IBML 1TWGH 2PNHA 4IJLA 1B8AA 1VQCA 1L1OC 1C0AA 1OXSC 3RLFA 1NMFA 1VQAA 4NPSA 1YEZA 2K5HA 5M5XH 4QY7A 2I5HA 4X64L 4DR4Q 1Q12A 2D62A 4YY3L 4DV1L 4B3TQ 3NENA 4DV3Q 5DLQE 2N8NA 2BA1A 4A3KG 1VQ5A 4GKJL 3SGIA 1M90C 4BBSH 3E0EA 4Y7NH 4P74A 4LF6L 1JT8A 3KDFA 2EQSA 3S1QH 2UXBQ 4WJ3M 4OWTB 1FVIA 3E9IA 5HY6A 3M4OH 1YZ6A 2YTXA 1QVCA 5C3EH 1XTDA 2EIFA 3I2ZA 4YWLA 5JEAJ 1MJEA 3TQYA 3K81C 3J80i 3CCJA 4GOPB 2NVXH 4JC0A 1YITA 2Q2IA 3KJOA 5JJIA 3GTGH 4JI3L 1DGSA 1SMXA 3RLNA 1Q46A 2B3GA 4JI4L 2IX0A 1YI2A 4BY7G 4IFDJ 3KF6B 1XPRA 3RNUA 1CKMA 4BY7H 4OX9Q 2CCZA 1QVFA 2I5LX 4A3GH 4IOCA 2DUDA 1VQDA 1VCIA 2JE6I 3I56A 5LMNW 1IBMQ 1E7ZA 1PVOA 2NVQH 2RF4A 2YU9H 3S1RH 4A3IH 1S72A 2JEBI 4R4IA 3PO2G 1QZHA 1HNZL 2K50A 1AE2A 2A19A 4GS3A 4DV2L 3T1YQ 4C3IH 1KIXA 3CAMA 1EIYB 3PF5A 4JI8Q 1AH9A 2KCMA 4B3RL 1XPOA 2FXQA 2KENA 1WOCA 3K7AH 3J81c 4DR6L 4A3FG 4BA1I 4X62Q 5C0XG 2ZTCA 3HOVH 4JI0L 2HIXA 3ER0A 1H95A 2K75A 3F2CA 2I0QA 1BBWA 2ASBA 3PUXA 3HOWG 2JEAI 1CKNA 3G4SA 4JCVE 3GTKH 1LTLA 1CUKA 1TXYA 3AQQA 2ATWA 1VQBA 5JJLA 3ERSX 5FJ8H 4B3MQ 1FJGQ 4POFA 3BZKA 1KQSA 3M4PA 3BU2A 5IP7H 3I4NH 4RG1A 1QUQB 4GLXA 1L1OB 2ZM6Q 3D31A 4LF7Q 2LXKA 1MIUA 4JI3Q 5IP9G 4JI7Q 3BJUA 1VQPA 3STBC 4DR1L 3D0FA 1XNQQ 2UUBQ 3MEFA 4A75A 2N49A 5HGQA 3KYHC 1NBWA 3T1HL 1B7YB 1CSPA 5LMNL 1V43A 1PH4A 1N34L 3MXNB 4K0KQ 1XPUA 2YTYA 4O0AA 1NTGA 4DR3Q 4BXXG 3K8AA 2CFMA 5M5YH 3KDFB 2ZTDA 5M3FH 1UE1A 1PFSA 2IT1A 4LFAQ 2UXCQ 4X64Q 2E8GA 4NXNL 3J7ZC 1AE3A 4NXMQ 1JJGA 4QJFA 2D0PA 2VY3A 5IYBG 2YYZA 2B63G 4JYAL 5IYBH 1YJNA 3M3YH 5H1SE 4UP8A 1SROA 4DUYQ 2UXDL 1CKNB 2R93G 4IPDA 1VS0A 3EIVA 2F3IA 2YTVA 2Z6KC 4ME3A 1HR0L 4A3CG 4HJ9A 4AIMA 1OTCA 2NZHA 4DV6Q 4DR2L 2KHJA 4P75A 4GKKQ 2JJQA 1TWAH 4BY1H 3UE1A 1VQ7A 2UUAL 3PUVA 1K73C 4KHPL 3OW2A 2WAQE 1PV4A 3ZJYC 4POGA 3I4OA 1N8RC 3CCSA 2JA5H 1HZAA 3CF5A 3RN2A 2ZJPA 1EQQA 4DNIA 1PH5A 3U58A 1PH8A 4R4OA 2VUMG 1X3EA 1J6QA 4LF8Q 2VUMH 1S40A 4XTCS 2UU9Q 3GTLH 1HZBA 1XMOQ 3T1HQ 4AQYQ 1UE5A 5C4JH 1I94Q 2E5LQ 1X55A 1JB7A 2DGYA 2MQHA 3DLLA 4JI1Q 4DAYB 3KLWA 5IWAL 3J80c 2QEXA 1NJIC 3H3VI 5AJ3Q 4JV5L 4PZ7A 1HR0W 4DK6C 2MNAA 3FKIH 4IFDG 2UXCL 1NMGA 3GD7A 1HZ9A 1XNRL 3PO3G 1SN8A 3WWVA 4KHZA 3CP0A 5FLXc 3OTOQ 4PG3A 2UUCQ 3HOVG 2R6GA 1I3QH 4X65Q 2HT1A 2ZJRA 2VL6A 4L5TA 3FP9A 4C3HH 1GO3E 3M7NA 1N36Q 4DR5Q 1J5EL 4LF5Q 2AMCB 1YHQA 4J15A 2VNUD 1HNXQ 4A3LH 4QIWE 2IHFA 3EBEA 3STBD 5IYCG 5C0XJ 4A3KH 4JBKA 4QGUA 5C44G 3S24A 5C44H 1K83H 1WYDA 5FLMH 3J81i 4TVAB 2R7DA 3KF8B 4HIOA 4A3BH 1GD7A 3W1BA 5K36G 4UY8C 4LNQA 4LFBL 2K5NA 2ZJQA 3M9BA 3F1ZA 1N9WA 4LF4Q 5C3EG 1HNWQ 4B3SL 1XMOL 1Z9FA 4OX9L 2NN6I 3H0GG 4P73A 4X66Q 4FDBA 1IBLL 4H02A 3H0GH 4DK3C 1I6HH 2C35B 2VQFL 1EWIA 5E7NA 3PV0A 4A93H 3HOZH 1I5FA 1E24A 1WCMH 4A93G 3PSIA 1HNZQ 4JBJA 2K4KA 2ZTEA 1Q8KA 1W2BA 1PYSB 1A63A 3EN2A 4BBRH 2XTIA 4NXNQ 1VQKA 2WFWA 3CXCA 3HOYH 3PGZA 2PQAB 3S16H 1TWFH 3AFPA 2JA7G 4Y52H 2UUCL 3CW2C 4PZ8A 3U50C 4GNXA 2HHHQ 4JI5Q 3CCVA 2LSSA 3GTPH 3J7A5 1V9PA 1IBKL 4DR4L 4A3CH 1EOVA 1GVPA 5JEAG 4YWKA 4OO1I 4DAMA 1IZ6A 4JI6L 1EQRA 4WJ4A 1B70B 1SLJA 4JI2L 4BY1G 2N3SA 4C3JH 1VQFA 4R4QA 5IY0A 4DR7L 4LF6Q 3U4VA 1VQMA 4IPGA 3HOWH 3UDGA 4JI7L 4HIDA 4GN3B 1BBUA 4AYBE 2JA6H 1VQLA 2JA6G 1RL2A 1K9MC 1V1QA 2YV5A 1YVCA 1Y1VG 4YCVA 3JAMi 4AQYL 1XMQQ 3GTOH 3HOUH 1KRSA 2PQAA 4JG2A 4DV4L 3CCMA 4JI1L 3KOJA 2AWNA 2Y0SE 3U4ZA 1PA6A 3L0OA 2BH2A 1JMCA 5J3BA 5BR8Q 1FL0A 4HJ8A 1Q82C 2RHSB 1A62A 2E2IH 2Z0SA 3AEVA 4UPAA 1IBKQ 4IOAA 4JI8L 1JE5A 4GNXC 4DPGA 4LFCQ 4HJ7A 1VQGA 2MO0A 1OXTA 2JA8H 1IL2A 3H15A 2AWOA 4LF9L 4GLAC 4AYBG 4DUYL 1M1KC 4P72A 3NBHB 1RIPA 1D7QA 3GTJH 2R7ZG 2R7ZH 4R4TA 4B3RQ 2WB1E 4DV5Q 4DV0Q 1E3PA 1Q1BA 1XJVA 2OTLA 3I7FA 1BKBA 1KC8C 4YY3Q 4DV1Q 1PH7A 1GKHA 2UXDQ 1KHIA 2K5VA 3S2HH 1Z47A 1EFWA 5LMUQ 1K0RA 2UXBL 4YWMA 2L15A 1Q86C 2H5XA 1VQ8A 2ZM6L 1R9TH 4B3ML 1K3RA 3DM3A 1T9HA 4O2DA 5ELOA 1KL9A 2IHEA 4L5SA 1JJCB 4DR3L 3UDIA 2BH8A 4AH6A 1VQOA 1ASYA 3ICEA 4IFDI 1E1OA 4JV5Q 5IYDH 4HIKA 4RMFA 5GAEC 1SRUA 2HQLA 5LMNQ 3CD6A 4LF8L 4A3GG 3W5OA 2WP8J 1N32Q 3GTQH 4LF9Q 1PH6A 4IPHA 4JI5L 2HHHL 4QQBX 2D0OA 3S14H 3S1NH 3ULLA 3W1GA 4DV0L 3AFQA 1YNXA 4DV3L 4GKJQ 3PO3H 3FHWA 3CC2A 4YHHQ 4A3FH 2VS1A 1UE6A 1WJJA 4A3JG 1QVGA 2VW9A 3I55A 1PH3A 4A3JH 4OXPA 4JBMA 1L1OA 3NELA 4NB3A 2JA9A 3UDFA 1HR0Q 3M85A 1YJ9A 2R92H 3RN5A 4BA2I 5GAHC 4QL5A 5IYCH 1KAWA 1XMQL 5FJ8G 4JOIA 5IP7G 1K8AC 1JJ2A 4OWXB 1HNXL 4HJ5A 3I4NG 1U0LA 2A1AA 4DR1Q 1BVSA 3F2DA 2F4VQ 3S17H 3BZCA 4LW1A 2OQKA 3Q8DA 4LF7L 4LWCA 2UU9L 4OWWB 1X3FA 3GTMH 1YHAA 4DKAC 2PMZE 3B6YA 1YHBA 2UUBL 3HOXG 3J81j 1LUZA 3CCQA 2Q2UA 3HOXH 2KHIA 4XIGS 5IT9c 1OXVA 1N33L 1UEBA 3S15H 3S1MH 3K7UC 1W3SA 1CSQA 4DV7Q 1X56A 3RZOH 1Y14B 3PUWA 4BXXH 4A76A 3PCOB 3TREA 3TRZA 1VQHA 1HH2P 2WB1G 5IWAQ 5M3FG 4IO9A 1Q7YC 3RZDH 2GVAA 2GN5A 2VQEQ 5M5WH 4IPCA 2JA7H 1TWHH 2KBNA 2R7FA 1VQIA 1QUQA 3UDXA 4JYAQ 1C7YA 3PIOA 1J5EQ 4LF5L 1IXRA 2R93H 1X6OA 1HZCA 1K8GA 4DV6L 5GROA 3LGJA 4DV2Q 1IYJB 3T1YL 1VQ9A 2ES2A 1PH2A 1N36L 2N78A 3KJPA 2UUAQ 2OTJA 4X66L 1WI5A 1IBLQ 3ULPA 2OCEA 1C9OA 3CCUA 4JI0Q 1S3OA 3H3VH 4DR7Q 3G71A 5BR8L 2V1CC 4L5RC 2JA5G 5IYDG 2OWOA 4UP7A 2ID0A 3M4QA 4P71A 3TEHB 5JJKA 4OO1G 4R4CA 1E22A 1EYGA 2BA0A 1G6PA 4EX5A 2Y0SG 4DV7L 4TQUS 3CC7A 3E9HA 1SE8A 3KFUA 4HJAA 4KLKA 4A3IG 3PO2H 1KD1C 3HKZE 1Y1WH 4X6AH 3TS2A 1Y1WG 2XGTA 1SFOH 1XNQL 1E1TA 4DV5L 1VQ6A 4JI4Q 3AYHB 3PUZA 3GO5A 4X62L 1Q81C 1L2FA 1FGUA 1X65A 4GLVB 3CCRA 4NXML 1PHJA 2JA8G 4PZ6A 4APVA 2WAQG 1TWCH 1NE3A 2Q2HA 2CKZB 1MKHA 2QGQA 1VQNA 3OTOL 1LYLA 4GOPA 1U5KA 2RCNA 2JK8A 4A3MH 4A3MG 1X3GA 4GKKL 4UP9A 5LMUL 2F52A 2NN6G 3JC66 1Q1EA 4A4IA 3CPWA 3TS0A 4LUZA 5GAGC 1I50H 1SR3A 4LUVA 4DV4Q 1PH9A 4B3TL 4JI6Q 4A3LG 5EAYA 4DR6Q 4GNXB 2IY5B 4BBSG 3L7ZC 5C0XI 3CMEA 2B29A 4A3BG 1UWVA 5FLMG 4JBWA 1X9NA 3G48A 4YCWA 4GOPC 5ELNA 4LF4L 2LXJA 4KI0A 5M3MH 1YIJA 2HIVA 5M3MG 2GVBA 1YBYA 1G291 1KRTA 4DR2Q 1P8LA 1I94L 5GQOA 5IE8A 4LFCL 1FJGL 1NY4A 2NVYH 2QA4A 1N33Q 4K0KL 4HIMA 4B3SQ 3K0XA 1CKOA 3HOZG 4LUOA 1WCMG 2Z6KA 4DUZL 3UE0A 1A8VA 4BBRG 1EIFA 3K80C 4R1JA 3F8TA 4IJHA 2VQEL 3HOYG 3A74A 3HKSA 2VZAA 3CC4A 1VQ4A 1D8LA 3CMAA 3KF6A 3VDYA 1MJCA 2NZOA 4X65L 1EUJA 1G51A 2E5LL 2A8VA 5C4XG 1WFQA 2B63H 5C4XH 2CWAA 4A3EG 1N32L 2OQ0A 3G6EA 4A3EH 4YCUA 3CCEA 3OYYA 1VQJA 1OXUA 2PI2E 4OONA 2K52A 5AJ3L 3PIPA 1PH1A 1GM5A 4JI2Q 3F2BA 1QZGA 2JQOA 3PF4A 4MTNA 4LFAL 3A0JA 4DR5L 2Q2TA 3NEMA 1A0IA 2IX1A 1KXLA 4MNOA 1XNRQ 5GADC 1O7IA 1PYBA 3CPFA 4YHHL 4MZ9A 3RLOA 3JAMc 2MFIA 2K14A 3GDEA 4LFBQ 4ALPA 2F4VL 2R92G 2CWPA 1LM0A 1ASZA 2NVTH 3CCLA 3S2DH 3A5UA 4GN5A 3PUYA 4L5QA 1YJWA 3L2PA 2E2HH 1Y1VH 2ALYB 2E2JH 3HOUG 4KHPQ 3HKZG 2AKWB 2KCTA 1OXXK 2CQOA 2EXDA 3A5ZB 3HFZB 2MO1A 4C2MH 5IP9H 2VQFQ 2AHOB 4DUZQ 3IRBA 4EQ5A 4A3DH 2I5MX 4A3DG 1L0WA 4PMWA 1UE7A 1X54A 1HJPA 3FKIG 3ULJA 3I4MH 1HNWL 3RR5A 2RHQB 3I4MG 1VQEA 2PI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 Q;  4JOI C;  1P16 A;  3CQZ H;  4GN4 B;  1IBM L;  1TWG H;  2PNH A;  4IJL A;  1B8A A;  1VQC A;  1L1O C;  1C0A A;  1OXS C;  3RLF A;  1NMF A;  1VQA A;  4NPS A;  1YEZ A;  2K5H A;  5M5X H;  4QY7 A;  2I5H A;  4X64 L;  4DR4 Q;  1Q12 A;  2D62 A;  4YY3 L;  4DV1 L;  4B3T Q;  3NEN A;  4DV3 Q;  5DLQ E;  2N8N A;  2BA1 A;  4A3K G;  1VQ5 A;  4GKJ L;  3SGI A;  1M90 C;  4BBS H;  3E0E A;  4Y7N H;  4P74 A;  4LF6 L;  1JT8 A;  3KDF A;  2EQS A;  3S1Q H;  2UXB Q;  4WJ3 M;  4OWT B;  1FVI A;  3E9I A;  5HY6 A;  3M4O H;  1YZ6 A;  2YTX A;  1QVC A;  5C3E H;  1XTD A;  2EIF A;  3I2Z A;  4YWL A;  5JEA J;  1MJE A;  3TQY A;  3K81 C;  3J80 i;  3CCJ A;  4GOP B;  2NVX H;  4JC0 A;  1YIT A;  2Q2I A;  3KJO A;  5JJI A;  3GTG H;  4JI3 L;  1DGS A;  1SMX A;  3RLN A;  1Q46 A;  2B3G A;  4JI4 L;  2IX0 A;  1YI2 A;  4BY7 G;  4IFD J;  3KF6 B;  1XPR A;  3RNU A;  1CKM A;  4BY7 H;  4OX9 Q;  2CCZ A;  1QVF A;  2I5L X;  4A3G H;  4IOC A;  2DUD A;  1VQD A;  1VCI A;  2JE6 I;  3I56 A;  5LMN W;  1IBM Q;  1E7Z A;  1PVO A;  2NVQ H;  2RF4 A;  2YU9 H;  3S1R H;  4A3I H;  1S72 A;  2JEB I;  4R4I A;  3PO2 G;  1QZH A;  1HNZ L;  2K50 A;  1AE2 A;  2A19 A;  4GS3 A;  4DV2 L;  3T1Y Q;  4C3I H;  1KIX A;  3CAM A;  1EIY B;  3PF5 A;  4JI8 Q;  1AH9 A;  2KCM A;  4B3R L;  1XPO A;  2FXQ A;  2KEN A;  1WOC A;  3K7A H;  3J81 c;  4DR6 L;  4A3F G;  4BA1 I;  4X62 Q;  5C0X G;  2ZTC A;  3HOV H;  4JI0 L;  2HIX A;  3ER0 A;  1H95 A;  2K75 A;  3F2C A;  2I0Q A;  1BBW A;  2ASB A;  3PUX A;  3HOW G;  2JEA I;  1CKN A;  3G4S A;  4JCV E;  3GTK H;  1LTL A;  1CUK A;  1TXY A;  3AQQ A;  2ATW A;  1VQB A;  5JJL A;  3ERS X;  5FJ8 H;  4B3M Q;  1FJG Q;  4POF A;  3BZK A;  1KQS A;  3M4P A;  3BU2 A;  5IP7 H;  3I4N H;  4RG1 A;  1QUQ B;  4GLX A;  1L1O B;  2ZM6 Q;  3D31 A;  4LF7 Q;  2LXK A;  1MIU A;  4JI3 Q;  5IP9 G;  4JI7 Q;  3BJU A;  1VQP A;  3STB C;  4DR1 L;  3D0F A;  1XNQ Q;  2UUB Q;  3MEF A;  4A75 A;  2N49 A;  5HGQ A;  3KYH C;  1NBW A;  3T1H L;  1B7Y B;  1CSP A;  5LMN L;  1V43 A;  1PH4 A;  1N34 L;  3MXN B;  4K0K Q;  1XPU A;  2YTY A;  4O0A A;  1NTG A;  4DR3 Q;  4BXX G;  3K8A A;  2CFM A;  5M5Y H;  3KDF B;  2ZTD A;  5M3F H;  1UE1 A;  1PFS A;  2IT1 A;  4LFA Q;  2UXC Q;  4X64 Q;  2E8G A;  4NXN L;  3J7Z C;  1AE3 A;  4NXM Q;  1JJG A;  4QJF A;  2D0P A;  2VY3 A;  5IYB G;  2YYZ A;  2B63 G;  4JYA L;  5IYB H;  1YJN A;  3M3Y H;  5H1S E;  4UP8 A;  1SRO A;  4DUY Q;  2UXD L;  1CKN B;  2R93 G;  4IPD A;  1VS0 A;  3EIV A;  2F3I A;  2YTV A;  2Z6K C;  4ME3 A;  1HR0 L;  4A3C G;  4HJ9 A;  4AIM A;  1OTC A;  2NZH A;  4DV6 Q;  4DR2 L;  2KHJ A;  4P75 A;  4GKK Q;  2JJQ A;  1TWA H;  4BY1 H;  3UE1 A;  1VQ7 A;  2UUA L;  3PUV A;  1K73 C;  4KHP L;  3OW2 A;  2WAQ E;  1PV4 A;  3ZJY C;  4POG A;  3I4O A;  1N8R C;  3CCS A;  2JA5 H;  1HZA A;  3CF5 A;  3RN2 A;  2ZJP A;  1EQQ A;  4DNI A;  1PH5 A;  3U58 A;  1PH8 A;  4R4O A;  2VUM G;  1X3E A;  1J6Q A;  4LF8 Q;  2VUM H;  1S40 A;  4XTC S;  2UU9 Q;  3GTL H;  1HZB A;  1XMO Q;  3T1H Q;  4AQY Q;  1UE5 A;  5C4J H;  1I94 Q;  2E5L Q;  1X55 A;  1JB7 A;  2DGY A;  2MQH A;  3DLL A;  4JI1 Q;  4DAY B;  3KLW A;  5IWA L;  3J80 c;  2QEX A;  1NJI C;  3H3V I;  5AJ3 Q;  4JV5 L;  4PZ7 A;  1HR0 W;  4DK6 C;  2MNA A;  3FKI H;  4IFD G;  2UXC L;  1NMG A;  3GD7 A;  1HZ9 A;  1XNR L;  3PO3 G;  1SN8 A;  3WWV A;  4KHZ A;  3CP0 A;  5FLX c;  3OTO Q;  4PG3 A;  2UUC Q;  3HOV G;  2R6G A;  1I3Q H;  4X65 Q;  2HT1 A;  2ZJR A;  2VL6 A;  4L5T A;  3FP9 A;  4C3H H;  1GO3 E;  3M7N A;  1N36 Q;  4DR5 Q;  1J5E L;  4LF5 Q;  2AMC B;  1YHQ A;  4J15 A;  2VNU D;  1HNX Q;  4A3L H;  4QIW E;  2IHF A;  3EBE A;  3STB D;  5IYC G;  5C0X J;  4A3K H;  4JBK A;  4QGU A;  5C44 G;  3S24 A;  5C44 H;  1K83 H;  1WYD A;  5FLM H;  3J81 i;  4TVA B;  2R7D A;  3KF8 B;  4HIO A;  4A3B H;  1GD7 A;  3W1B A;  5K36 G;  4UY8 C;  4LNQ A;  4LFB L;  2K5N A;  2ZJQ A;  3M9B A;  3F1Z A;  1N9W A;  4LF4 Q;  5C3E G;  1HNW Q;  4B3S L;  1XMO L;  1Z9F A;  4OX9 L;  2NN6 I;  3H0G G;  4P73 A;  4X66 Q;  4FDB A;  1IBL L;  4H02 A;  3H0G H;  4DK3 C;  1I6H H;  2C35 B;  2VQF L;  1EWI A;  5E7N A;  3PV0 A;  4A93 H;  3HOZ H;  1I5F A;  1E24 A;  1WCM H;  4A93 G;  3PSI A;  1HNZ Q;  4JBJ A;  2K4K A;  2ZTE A;  1Q8K A;  1W2B A;  1PYS B;  1A63 A;  3EN2 A;  4BBR H;  2XTI A;  4NXN Q;  1VQK A;  2WFW A;  3CXC A;  3HOY H;  3PGZ A;  2PQA B;  3S16 H;  1TWF H;  3AFP A;  2JA7 G;  4Y52 H;  2UUC L;  3CW2 C;  4PZ8 A;  3U50 C;  4GNX A;  2HHH Q;  4JI5 Q;  3CCV A;  2LSS A;  3GTP H;  3J7A 5;  1V9P A;  1IBK L;  4DR4 L;  4A3C H;  1EOV A;  1GVP A;  5JEA G;  4YWK A;  4OO1 I;  4DAM A;  1IZ6 A;  4JI6 L;  1EQR A;  4WJ4 A;  1B70 B;  1SLJ A;  4JI2 L;  4BY1 G;  2N3S A;  4C3J H;  1VQF A;  4R4Q A;  5IY0 A;  4DR7 L;  4LF6 Q;  3U4V A;  1VQM A;  4IPG A;  3HOW H;  3UDG A;  4JI7 L;  4HID A;  4GN3 B;  1BBU A;  4AYB E;  2JA6 H;  1VQL A;  2JA6 G;  1RL2 A;  1K9M C;  1V1Q A;  2YV5 A;  1YVC A;  1Y1V G;  4YCV A;  3JAM i;  4AQY L;  1XMQ Q;  3GTO H;  3HOU H;  1KRS A;  2PQA A;  4JG2 A;  4DV4 L;  3CCM A;  4JI1 L;  3KOJ A;  2AWN A;  2Y0S E;  3U4Z A;  1PA6 A;  3L0O A;  2BH2 A;  1JMC A;  5J3B A;  5BR8 Q;  1FL0 A;  4HJ8 A;  1Q82 C;  2RHS B;  1A62 A;  2E2I H;  2Z0S A;  3AEV A;  4UPA A;  1IBK Q;  4IOA A;  4JI8 L;  1JE5 A;  4GNX C;  4DPG A;  4LFC Q;  4HJ7 A;  1VQG A;  2MO0 A;  1OXT A;  2JA8 H;  1IL2 A;  3H15 A;  2AWO A;  4LF9 L;  4GLA C;  4AYB G;  4DUY L;  1M1K C;  4P72 A;  3NBH B;  1RIP A;  1D7Q A;  3GTJ H;  2R7Z G;  2R7Z H;  4R4T A;  4B3R Q;  2WB1 E;  4DV5 Q;  4DV0 Q;  1E3P A;  1Q1B A;  1XJV A;  2OTL A;  3I7F A;  1BKB A;  1KC8 C;  4YY3 Q;  4DV1 Q;  1PH7 A;  1GKH A;  2UXD Q;  1KHI A;  2K5V A;  3S2H H;  1Z47 A;  1EFW A;  5LMU Q;  1K0R A;  2UXB L;  4YWM A;  2L15 A;  1Q86 C;  2H5X A;  1VQ8 A;  2ZM6 L;  1R9T H;  4B3M L;  1K3R A;  3DM3 A;  1T9H A;  4O2D A;  5ELO A;  1KL9 A;  2IHE A;  4L5S A;  1JJC B;  4DR3 L;  3UDI A;  2BH8 A;  4AH6 A;  1VQO A;  1ASY A;  3ICE A;  4IFD I;  1E1O A;  4JV5 Q;  5IYD H;  4HIK A;  4RMF A;  5GAE C;  1SRU A;  2HQL A;  5LMN Q;  3CD6 A;  4LF8 L;  4A3G G;  3W5O A;  2WP8 J;  1N32 Q;  3GTQ H;  4LF9 Q;  1PH6 A;  4IPH A;  4JI5 L;  2HHH L;  4QQB X;  2D0O A;  3S14 H;  3S1N H;  3ULL A;  3W1G A;  4DV0 L;  3AFQ A;  1YNX A;  4DV3 L;  4GKJ Q;  3PO3 H;  3FHW A;  3CC2 A;  4YHH Q;  4A3F H;  2VS1 A;  1UE6 A;  1WJJ A;  4A3J G;  1QVG A;  2VW9 A;  3I55 A;  1PH3 A;  4A3J H;  4OXP A;  4JBM A;  1L1O A;  3NEL A;  4NB3 A;  2JA9 A;  3UDF A;  1HR0 Q;  3M85 A;  1YJ9 A;  2R92 H;  3RN5 A;  4BA2 I;  5GAH C;  4QL5 A;  5IYC H;  1KAW A;  1XMQ L;  5FJ8 G;  4JOI A;  5IP7 G;  1K8A C;  1JJ2 A;  4OWX B;  1HNX L;  4HJ5 A;  3I4N G;  1U0L A;  2A1A A;  4DR1 Q;  1BVS A;  3F2D A;  2F4V Q;  3S17 H;  3BZC A;  4LW1 A;  2OQK A;  3Q8D A;  4LF7 L;  4LWC A;  2UU9 L;  4OWW B;  1X3F A;  3GTM H;  1YHA A;  4DKA C;  2PMZ E;  3B6Y A;  1YHB A;  2UUB L;  3HOX G;  3J81 j;  1LUZ A;  3CCQ A;  2Q2U A;  3HOX H;  2KHI A;  4XIG S;  5IT9 c;  1OXV A;  1N33 L;  1UEB A;  3S15 H;  3S1M H;  3K7U C;  1W3S A;  1CSQ A;  4DV7 Q;  1X56 A;  3RZO H;  1Y14 B;  3PUW A;  4BXX H;  4A76 A;  3PCO B;  3TRE A;  3TRZ A;  1VQH A;  1HH2 P;  2WB1 G;  5IWA Q;  5M3F G;  4IO9 A;  1Q7Y C;  3RZD H;  2GVA A;  2GN5 A;  2VQE Q;  5M5W H;  4IPC A;  2JA7 H;  1TWH H;  2KBN A;  2R7F A;  1VQI A;  1QUQ A;  3UDX A;  4JYA Q;  1C7Y A;  3PIO A;  1J5E Q;  4LF5 L;  1IXR A;  2R93 H;  1X6O A;  1HZC A;  1K8G A;  4DV6 L;  5GRO A;  3LGJ A;  4DV2 Q;  1IYJ B;  3T1Y L;  1VQ9 A;  2ES2 A;  1PH2 A;  1N36 L;  2N78 A;  3KJP A;  2UUA Q;  2OTJ A;  4X66 L;  1WI5 A;  1IBL Q;  3ULP A;  2OCE A;  1C9O A;  3CCU A;  4JI0 Q;  1S3O A;  3H3V H;  4DR7 Q;  3G71 A;  5BR8 L;  2V1C C;  4L5R C;  2JA5 G;  5IYD G;  2OWO A;  4UP7 A;  2ID0 A;  3M4Q A;  4P71 A;  3TEH B;  5JJK A;  4OO1 G;  4R4C A;  1E22 A;  1EYG A;  2BA0 A;  1G6P A;  4EX5 A;  2Y0S G;  4DV7 L;  4TQU S;  3CC7 A;  3E9H A;  1SE8 A;  3KFU A;  4HJA A;  4KLK A;  4A3I G;  3PO2 H;  1KD1 C;  3HKZ E;  1Y1W H;  4X6A H;  3TS2 A;  1Y1W G;  2XGT A;  1SFO H;  1XNQ L;  1E1T A;  4DV5 L;  1VQ6 A;  4JI4 Q;  3AYH B;  3PUZ A;  3GO5 A;  4X62 L;  1Q81 C;  1L2F A;  1FGU A;  1X65 A;  4GLV B;  3CCR A;  4NXM L;  1PHJ A;  2JA8 G;  4PZ6 A;  4APV A;  2WAQ G;  1TWC H;  1NE3 A;  2Q2H A;  2CKZ B;  1MKH A;  2QGQ A;  1VQN A;  3OTO L;  1LYL A;  4GOP A;  1U5K A;  2RCN A;  2JK8 A;  4A3M H;  4A3M G;  1X3G A;  4GKK L;  4UP9 A;  5LMU L;  2F52 A;  2NN6 G;  3JC6 6;  1Q1E A;  4A4I A;  3CPW A;  3TS0 A;  4LUZ A;  5GAG C;  1I50 H;  1SR3 A;  4LUV A;  4DV4 Q;  1PH9 A;  4B3T L;  4JI6 Q;  4A3L G;  5EAY A;  4DR6 Q;  4GNX B;  2IY5 B;  4BBS G;  3L7Z C;  5C0X I;  3CME A;  2B29 A;  4A3B G;  1UWV A;  5FLM G;  4JBW A;  1X9N A;  3G48 A;  4YCW A;  4GOP C;  5ELN A;  4LF4 L;  2LXJ A;  4KI0 A;  5M3M H;  1YIJ A;  2HIV A;  5M3M G;  2GVB A;  1YBY A;  1G29 1;  1KRT A;  4DR2 Q;  1P8L A;  1I94 L;  5GQO A;  5IE8 A;  4LFC L;  1FJG L;  1NY4 A;  2NVY H;  2QA4 A;  1N33 Q;  4K0K L;  4HIM A;  4B3S Q;  3K0X A;  1CKO A;  3HOZ G;  4LUO A;  1WCM G;  2Z6K A;  4DUZ L;  3UE0 A;  1A8V A;  4BBR G;  1EIF A;  3K80 C;  4R1J A;  3F8T A;  4IJH A;  2VQE L;  3HOY G;  3A74 A;  3HKS A;  2VZA A;  3CC4 A;  1VQ4 A;  1D8L A;  3CMA A;  3KF6 A;  3VDY A;  1MJC A;  2NZO A;  4X65 L;  1EUJ A;  1G51 A;  2E5L L;  2A8V A;  5C4X G;  1WFQ A;  2B63 H;  5C4X H;  2CWA A;  4A3E G;  1N32 L;  2OQ0 A;  3G6E A;  4A3E H;  4YCU A;  3CCE A;  3OYY A;  1VQJ A;  1OXU A;  2PI2 E;  4OON A;  2K52 A;  5AJ3 L;  3PIP A;  1PH1 A;  1GM5 A;  4JI2 Q;  3F2B A;  1QZG A;  2JQO A;  3PF4 A;  4MTN A;  4LFA L;  3A0J A;  4DR5 L;  2Q2T A;  3NEM A;  1A0I A;  2IX1 A;  1KXL A;  4MNO A;  1XNR Q;  5GAD C;  1O7I A;  1PYB A;  3CPF A;  4YHH L;  4MZ9 A;  3RLO A;  3JAM c;  2MFI A;  2K14 A;  3GDE A;  4LFB Q;  4ALP A;  2F4V L;  2R92 G;  2CWP A;  1LM0 A;  1ASZ A;  2NVT H;  3CCL A;  3S2D H;  3A5U A;  4GN5 A;  3PUY A;  4L5Q A;  1YJW A;  3L2P A;  2E2H H;  1Y1V H;  2ALY B;  2E2J H;  3HOU G;  4KHP Q;  3HKZ G;  2AKW B;  2KCT A;  1OXX K;  2CQO A;  2EXD A;  3A5Z B;  3HFZ B;  2MO1 A;  4C2M H;  5IP9 H;  2VQF Q;  2AHO B;  4DUZ Q;  3IRB A;  4EQ5 A;  4A3D H;  2I5M X;  4A3D G;  1L0W A;  4PMW A;  1UE7 A;  1X54 A;  1HJP A;  3FKI G;  3ULJ A;  3I4M H;  1HNW L;  3RR5 A;  2RHQ B;  3I4M G;  1VQE A;  2PI2 A; 
#chains in the Genus database with same CATH topology
 4GN4 B;  1CK1 A;  4ID6 A;  1JB3 A;  1VQC A;  3K57 A;  4DAV A;  1LTG D;  3RLF A;  1VQA A;  4A3B B;  2K5H A;  5M5X H;  1RF2 D;  1Q12 A;  2D62 A;  3PMF A;  4DV3 Q;  4GKJ L;  1A2T A;  2BA1 A;  3I4M B;  4DGZ A;  2F0P A;  4Y7N H;  4P74 A;  4LF6 L;  1JT8 A;  1O80 A;  2EYP A;  4OWT B;  3E9I A;  5HY6 A;  2JA7 B;  1RKN A;  1CHP D;  5LL6 X;  1QVC A;  2E2I B;  1XTD A;  2EIF A;  1CZG A;  1QG7 A;  3K81 C;  1G91 A;  1IHZ A;  3CCJ A;  4GOP B;  4JC0 A;  2NVX H;  2F0U A;  4CJ1 B;  1EY7 A;  3GTG H;  1SMX A;  1DD2 A;  3KLR A;  4JI4 L;  4RHS A;  4OIJ A;  2BDO A;  4DK1 A;  4K6D A;  4OX9 Q;  1NSN S;  1VQD A;  1VCI A;  1E7Z A;  2YU9 H;  3PO2 G;  1GXD C;  4LAA A;  2K50 A;  1D6E C;  4K5V A;  1AE2 A;  2DJG C;  1KIX A;  4DV2 L;  3CAM A;  3S1M B;  2KOL A;  2FXQ A;  4QB4 A;  1WTW A;  4A3F G;  3PO2 B;  2ZTC A;  4EQP A;  2I0Q A;  3A56 A;  2I46 A;  2EY6 A;  3GTK H;  1LTL A;  3S1R B;  1CUK A;  1TXY A;  1BCP D;  3A55 A;  3AQQ A;  3ERS X;  5FJ8 H;  4POF A;  3BU2 A;  4TKO B;  1DON A;  1QUQ B;  1QNU A;  1L1O B;  5G3L F;  2LXK A;  1B9M A;  4DR1 L;  1XNQ Q;  3NE5 B;  2UUB Q;  3MEF A;  4A75 A;  4G7O C;  1NBW A;  2F0I A;  2F0O A;  1PH4 A;  1CSP A;  1H9S A;  3MXN B;  3OPO A;  4DR3 Q;  4N8F A;  2CFM A;  3KDF B;  2EPB A;  5D3I B;  3Q22 A;  5M3F H;  2RQX A;  4X64 Q;  3S2H B;  2YYZ A;  1WTV A;  5H1S E;  1SRO A;  4DUY Q;  3EIV A;  2Z6K C;  3MXU A;  4HJ9 A;  1EQV A;  2JJQ A;  2WKC A;  1SSO A;  2UUA L;  4RGM A;  4KHP L;  3OW2 A;  4POG A;  3ZJY C;  1N8R C;  3CF5 A;  3RN2 A;  1PH5 A;  1HA6 A;  1F2Z A;  4R4O A;  1SBB B;  2BE5 C;  4AYB B;  1C8C A;  2UU9 Q;  1AW7 A;  1J8I A;  4K5X A;  4AQY Q;  1F77 A;  2E5L Q;  5C4J H;  1STE A;  1X55 A;  3K5L A;  1Z7T A;  4JV5 L;  3ERO A;  4PZ7 A;  3J7Y W;  2MNA A;  1NMG A;  3ND8 A;  5D3D A;  4C3I G;  2R92 B;  5CV4 A;  3RMH A;  1SN8 A;  1G6Z A;  3OTO Q;  2O4X A;  3HOV G;  4DAY A;  1I3Q H;  4X65 Q;  3LNN A;  5IGB A;  5EBC A;  2VL6 A;  4ILW A;  4CDE C;  4C3H H;  1GO3 E;  3K6O A;  2VB2 X;  1N36 Q;  4DR5 Q;  1J5E L;  1LTR D;  3TP7 A;  3E0J A;  4J15 A;  3T4A C;  2VNU D;  4QIW E;  2IHF A;  3EBE A;  2IPK D;  4BBR B;  5C0X J;  4JBK A;  2Q8I B;  1BOS A;  4QGU A;  1BNZ A;  4V0B A;  3R8B A;  5C44 H;  3J81 i;  1EZ6 A;  2RBM A;  4LFB L;  2ZJQ A;  3S16 B;  4NKL A;  2B2T A;  5KYL A;  3DWP A;  3TP8 A;  2GA4 B;  4X66 Q;  4NP5 A;  4DK3 C;  1E24 A;  1WCM H;  4J8Q A;  2K4K A;  3TZU A;  4KK7 A;  1PYS B;  1A63 A;  3NUC A;  5C5M A;  1U4L A;  1VQK A;  2CHB D;  4MTK A;  1WTX A;  3J7A 5;  3LX0 A;  1LT3 D;  2PQE A;  2KVM A;  3QG1 A;  3HOZ B;  1CQV A;  5JEA G;  4YWK A;  4R8N A;  4JI6 L;  4PQX A;  4JI2 L;  1MBY A;  2N3S A;  4A3I B;  3MFG A;  3D4R A;  5IY0 A;  4DR7 L;  3VA5 A;  3RD4 A;  1VQM A;  4IPG A;  3HOW H;  4HID A;  5IT9 L;  1VQL A;  5J22 A;  1RL2 A;  3C1F A;  2MHV A;  1V1Q A;  4KD4 A;  1U4R A;  3DMU A;  1WD0 A;  1KRS A;  4JG2 A;  3KBX A;  1JMC A;  2MJ8 A;  5BR8 Q;  2RHS B;  1A62 A;  5C3E B;  3HG9 A;  5CBA E;  3AEV A;  4IOA A;  2FFK B;  1JE5 A;  1MHW C;  4GNX C;  4DPG A;  4LFC Q;  2D5D A;  1OO9 B;  1VQG A;  2F0Q A;  3H15 A;  1B4O A;  1TS2 A;  2EYL A;  2SNM A;  4P72 A;  1JC7 A;  3NBH B;  5LL6 S;  5EPK A;  1KC8 C;  4YY3 Q;  4DV1 Q;  1PH7 A;  3VA7 A;  2F0J A;  3NTK A;  3BVG A;  2L9H A;  3DWQ A;  2N88 A;  2K5V A;  1Z47 A;  5IT9 E;  1EFW A;  1K0R A;  4YWM A;  4KY5 A;  1Q86 C;  1I4Q A;  4RCN A;  2RA4 A;  2IHE A;  4L5S A;  1JJC B;  2A73 B;  4PMB A;  4AH6 A;  4KN4 C;  4ZYS A;  4RMF A;  5IOD A;  4A3G G;  2LMC B;  1JOK A;  1PTO F;  3S14 H;  4KV6 A;  3MWY W;  1RCV D;  5EPL A;  3IAY A;  3AFQ A;  3SR1 A;  4A3F H;  2VS1 A;  1FGB D;  1RDP D;  2VW9 A;  4A3J H;  4OXP A;  1SNM A;  4JBM A;  3GTM B;  3FKI B;  1HR0 Q;  4C3H G;  1AZP A;  3K5O A;  5FOB B;  3GTQ B;  4QL5 A;  3VR6 A;  1JJ2 A;  1KAW A;  1XMQ L;  5IP7 G;  2IX3 A;  1U0L A;  2FMM A;  4DAP A;  4DR1 Q;  2F4V Q;  4LF7 L;  3C46 A;  4DKA C;  3B6Y A;  2QF7 A;  3J80 L;  2K5Q A;  3HOX H;  5IT9 c;  1TY0 A;  1UEB A;  4TSS A;  3K5M A;  4HCS A;  4DV7 Q;  3N6R A;  1Y14 B;  4BXX H;  3TRE A;  1VQH A;  5M3F G;  4CJ0 B;  1Q7Y C;  2B2W A;  2GVA A;  1VMC A;  4IUT A;  3S1Q B;  5M5W H;  1UNS A;  1K8O A;  2LY7 A;  1W6J A;  4HMI A;  1VQI A;  4OEM B;  1PFB A;  4JYA Q;  5FKA C;  5I4D A;  4IUV A;  1K8G A;  1O78 A;  5GRO A;  3LGJ A;  3T1Y L;  3E5S A;  1N36 L;  2N78 A;  2UUA Q;  2OTJ A;  2K5D A;  4LJZ C;  4OHJ A;  1KNE A;  3CCU A;  5CR3 A;  3DWA A;  1S3O A;  4XYQ A;  4L5R C;  4UP7 A;  2ID0 A;  1BR9 A;  3OWF A;  2EYJ A;  3IKJ A;  1D5Z C;  2Y0S G;  4DV7 L;  4I65 A;  3E9H A;  3KFU A;  4HJA A;  1EIG A;  2P5Z X;  4KKU A;  2F0H A;  4X6A H;  1BUV T;  1E1T A;  3PUZ A;  1BQQ T;  1UEA B;  2JA8 G;  4NXM L;  1PHJ A;  2WAQ G;  1NE3 A;  3D4D A;  2CKZ B;  1MKH A;  4WOR A;  2E76 C;  4BY1 B;  2RDH A;  2CVR A;  3H6M A;  3BZD B;  1VQN A;  3I4N B;  1U5K A;  3Q23 A;  4A3M G;  1JQY D;  4UP9 A;  5LMU L;  3JC6 6;  3CPW A;  4A4I A;  4KY6 A;  1ILP A;  4FXD A;  2PPB C;  4A3L G;  1I50 H;  4LUV A;  2LFN A;  4JI6 Q;  3GTP B;  3MHB A;  4GNX B;  3FEW X;  1EIH A;  3L7Z C;  2B29 A;  1X9N A;  5F2D A;  4LF4 L;  2LXJ A;  1YIJ A;  2X6G A;  5DM6 3;  3NSW A;  3BVZ A;  1KRT A;  1STG A;  1F2M A;  1YBY A;  5KNB A;  1I94 L;  5C4X B;  4K0K L;  1FJG L;  4LFC L;  1NY4 A;  1TII D;  5KYI A;  2QA4 A;  1CKO A;  3Q24 A;  2EJG C;  1I4G A;  3O13 A;  1T5E A;  3M3Y B;  1HTP A;  1EIF A;  3DUZ A;  3F8T A;  4IJH A;  2VQE L;  3HOY G;  3CC4 A;  1VQ4 A;  3V96 A;  3VYU A;  1VF5 C;  2A8V A;  5C4X G;  5I2X A;  2B63 H;  2EXZ A;  1IBK Q;  4A3E H;  4YCU A;  1JOQ A;  3PIP A;  3IFD A;  1GM5 A;  2JQO A;  4MTN A;  4LFA L;  3A0J A;  4L63 B;  4Q5V A;  2Q2T A;  1A0I A;  2B8G A;  1XNR Q;  1MGS A;  1PYB A;  3CPF A;  1XYI A;  4MZ9 A;  3RLO A;  3JAM c;  3GTJ B;  2WII B;  4LMQ D;  1D2B A;  4LFB Q;  4X3U A;  2CWP A;  3S2D H;  1DXM A;  2NVT H;  2IWH A;  3PUY A;  3ZYY X;  1PTO H;  1LAC A;  2E2H H;  1O7Y A;  3HGB A;  1F2Y A;  1CHQ D;  5C4Z A;  2PMZ B;  1OXX K;  2EXD A;  2MO1 A;  3IRB A;  4EQ5 A;  2I5M X;  2EY1 A;  1HJP A;  3I4M G;  1NAP A;  2KQ3 A;  5IGC A;  1P16 A;  4G7H C;  1IBM L;  1K8M A;  1ZEQ X;  1B8A A;  1L1O C;  4RGN A;  1OXS C;  1NMF A;  1Y1V B;  3X3N A;  1BBX C;  2PNR C;  3F2U A;  4X64 L;  4DR4 Q;  4YY3 L;  4ZLT F;  4DV1 L;  4B3T Q;  3NEN A;  2N8N A;  1EYD A;  1BXT A;  4BBS H;  3E0E A;  2ENB A;  2EQS A;  1QJO A;  2UXB Q;  4WJ3 M;  2L5T A;  3M4O H;  1YZ6 A;  2YTX A;  2SOB A;  3ITP A;  1I4R A;  3I2Z A;  3MFY A;  1GOZ A;  3MXG A;  3BYT B;  3KLS A;  4WJW A;  4EGV A;  5JJI A;  4JI3 L;  1DGS A;  3FPU B;  5FLX L;  1Q46 A;  1Y8N B;  3HP3 A;  2ZXP A;  4F7X A;  1ENF A;  4IFD J;  3KF6 B;  4BY7 H;  2I5L X;  3OWE B;  4IOC A;  1IBM Q;  2XSC A;  2WV6 D;  1PVO A;  4C3J B;  1G2S A;  2A19 A;  3T1Y Q;  1EIY B;  3AB9 A;  4JI8 Q;  4RHR A;  2KEN A;  3T13 A;  4DR6 L;  1RTO A;  5C0X G;  2CH4 A;  1H95 A;  4CKC A;  3N52 A;  3F2C A;  3PUX A;  4JCV E;  1G2T A;  1E2W A;  4B3M Q;  2KEE A;  4C3I B;  4QUC A;  4GLX A;  5M5Y B;  2ZM6 Q;  1PXU A;  1MIU A;  1TY2 A;  4JI3 Q;  3BJU A;  3NBI A;  1SEB D;  3STB C;  3D0F A;  1IYV A;  3MZ5 A;  1X3Q A;  3I73 A;  2MUY A;  3KYH C;  1HFN A;  1X3P A;  4FF4 A;  4RKB A;  1B7Y B;  1N34 L;  4XQN A;  1TT2 A;  5A35 A;  4K0K Q;  1XWE A;  4O0A A;  3D6W A;  5I2Y A;  1NTG A;  1NUC A;  5KRU A;  4I7Z C;  3K8A A;  4BXX G;  4XYO A;  2BDN A;  4FO2 A;  1PFS A;  2IT1 A;  4CBV A;  1PTO D;  1Y8O B;  1YJN A;  1ZYR D;  2DNC A;  2UXD L;  1H9R A;  3H94 A;  2R93 G;  4A3C G;  4ME3 A;  4H13 C;  5JEA H;  2OF1 A;  4PV1 C;  2HUG A;  2D2C C;  1TWA H;  1HA5 A;  3PUV A;  1PRT D;  3K5N A;  2A74 C;  3I4O A;  4ZUI A;  1HPC A;  1HZA A;  2ZJP A;  4DNI A;  4LK1 C;  2VUM G;  1ICW A;  1X3E A;  1S40 A;  3GTL H;  3BDL A;  1T5X D;  1ESR A;  1UE5 A;  1I94 Q;  4UAI A;  1EY4 A;  4DAY B;  1PDQ A;  4CHT B;  5IWA L;  3J80 c;  1DZ1 A;  4BWG B;  3WDN A;  5AJ3 Q;  3EVQ A;  4DK6 C;  2UXC L;  3FMC A;  4FYD A;  1XNR L;  3WWV A;  5JPM C;  2Z8L A;  5FLX c;  1DOL A;  2R6G A;  1BCP B;  1V8Q A;  2B2U A;  3FP9 A;  1G8Z D;  3M7N A;  2AMC B;  4IUR A;  3H0G B;  1JIC A;  1HNX Q;  4JW0 A;  5IGF A;  5IYC G;  3M4Y A;  1ML0 D;  4O42 A;  4H0L C;  1K83 H;  3J81 E;  1B44 D;  1TWF B;  3ND9 A;  3HOY B;  1GD7 A;  3W1B A;  5K36 G;  4LNQ A;  2K5N A;  3M9B A;  1TU2 B;  5C3E G;  4G7Z C;  1KLG D;  2JP1 A;  1KAB A;  1IBL L;  4H02 A;  1MSG A;  1I6H H;  1EWI A;  5E7N A;  4A93 H;  2K32 A;  4A93 G;  1HNZ Q;  1SYB A;  4JBJ A;  4BBR H;  2K28 A;  1CM9 A;  2JA7 G;  2UUC L;  4PZ8 A;  4ODG A;  4BS9 A;  3OMG A;  2KA7 A;  2KED A;  3EFX D;  5CV8 A;  4OO1 I;  1KLU D;  4WJ4 A;  4HTH A;  4BY1 G;  1DYQ A;  4LF6 Q;  5C6A A;  2JA8 B;  3UDG A;  2F0L A;  5DAU A;  4JI7 L;  1CFM A;  1K9M C;  3D4W A;  2RDG A;  2YV5 A;  3HOV B;  1YVC A;  1XMQ Q;  3GTO H;  3HOU H;  4HR7 B;  5DNF A;  4JI1 L;  2AWN A;  1BDO A;  1JE4 A;  4F87 A;  3U4Z A;  3QWN A;  3L0O A;  1FNW A;  2QKI C;  1A3V A;  4KKS A;  2E2I H;  1EU3 A;  2Z0S A;  5E1F A;  4K6L A;  4OGQ C;  4HJ7 A;  2MO0 A;  2QDB A;  4AYB G;  1L0Y B;  3RUZ A;  1GUG A;  3VR4 A;  3CRK C;  2R7Z G;  4B3R Q;  2WB1 E;  1LTS D;  1NR4 A;  2J4X A;  1E3P A;  3SK5 A;  5EGT A;  1JWU D;  1ESF A;  2NVY B;  1GKH A;  3L3O C;  1KHI A;  1WTO A;  2L15 A;  1HRJ A;  4HMJ A;  1R9T H;  4B3M L;  3DM3 A;  3PO3 B;  1KL9 A;  1IKL A;  5C3W A;  3UDI A;  2BH8 A;  4EQO A;  3D3R A;  4DR3 L;  1XX8 A;  3ICE A;  1E1O A;  4IFD I;  4OO1 H;  1D1I A;  1SRU A;  2HQL A;  2QEJ C;  3CD6 A;  3GP7 A;  1HTL D;  1N32 Q;  1BO0 A;  2PZW A;  1PH6 A;  4JI5 L;  4QQB X;  4X3K A;  1SJE D;  1EQT A;  5JJZ A;  4U67 3;  4NMZ A;  3ULL A;  1KTK A;  2O2L D;  4CKE A;  4DF7 A;  3I55 A;  2KHS A;  4KKT A;  3NEL A;  2KCC A;  2NTS A;  3VYR A;  3M85 A;  1YJ9 A;  2G9H D;  3RN5 A;  2PCF B;  3MTS A;  2PYK A;  3S15 B;  1IL8 A;  4JOI A;  1CTM A;  1K28 A;  3RZO B;  1HNX L;  1EFI D;  3FPP A;  2A1A A;  4A3G B;  1IKM A;  2CW0 D;  3F2D A;  2EYH A;  3EA6 A;  1SNQ A;  3Q8D A;  1BCP C;  1X3F A;  4A3K B;  2PMZ E;  1KNA A;  4A3J B;  1SNP A;  3J81 j;  1LUZ A;  2KHI A;  1N33 L;  1OXV A;  5M5X B;  1W3S A;  2JSO A;  4RGT A;  1TQO A;  3K7A B;  4QCL A;  1GHK A;  1Q3L A;  1V1P B;  4U68 A;  3PCO B;  4A76 A;  2M2L A;  3TRZ A;  3KBG A;  1HH2 P;  2WB1 G;  5IWA Q;  3R93 A;  2F0G A;  2JA7 H;  4J1M A;  2R7F A;  3QIA A;  2OEO A;  3GQB A;  1EEI D;  1C7Y A;  3PIO A;  5CV6 A;  1J5E Q;  1IXR A;  1WD1 A;  2R93 H;  4X3T A;  2B2V A;  3KJP A;  3FVQ A;  1WI5 A;  3H09 A;  4X66 L;  4JPB W;  3MVV A;  2RSN A;  3SK6 A;  1ET9 A;  4ZKB B;  5CC4 A;  1Z6H A;  3BG3 A;  4DR7 Q;  3G71 A;  5BR8 L;  5IYD G;  5M5W B;  4TRD A;  4XQJ A;  3M4Q A;  3TEH B;  1E22 A;  2H4O A;  4MN3 A;  3DEO A;  1EZ8 A;  1EYG A;  3CC7 A;  1DOM A;  1SJH D;  3NK9 A;  4DNR B;  1RJT A;  2HCC A;  3PO2 H;  1Y1W H;  4DV5 L;  4JI4 Q;  3HKZ B;  2NB0 A;  1Q8I A;  3GO5 A;  2Z4I A;  1Q81 C;  1FGU A;  4GLV B;  4O1N A;  2AUK A;  1TWC H;  2QGQ A;  5CGK A;  1H9K A;  4QIW B;  1LTB D;  3EJI A;  2NN6 G;  2NYZ D;  1PZI D;  3TS0 A;  2NN6 H;  4LUZ A;  4B3T L;  1F9P A;  4KD3 A;  4L8J A;  2IY5 B;  4BBS G;  2XWJ B;  4ZQ3 A;  2A6E C;  3CME A;  1M8A A;  3NTI A;  3MXP A;  4XT1 B;  5M3M H;  3A7L A;  4DR2 Q;  1P8L A;  3R2T A;  3NQI A;  4B3S Q;  4ABN A;  2H1E A;  4WRD A;  1SDF A;  1WCM G;  4M1U B;  1A8V A;  2QCP X;  2F0E A;  4R1J A;  3HKS A;  3CMA A;  3VDY A;  2K1B A;  1QNK A;  1U9R A;  4A3E G;  1N32 L;  3G6E A;  3CCE A;  3KF8 A;  3NQT A;  1VMP A;  2K52 A;  4JI2 Q;  4JVZ A;  1QZG A;  4DR5 L;  2IX1 A;  4MNO A;  2B2V C;  3BVM A;  3S1N B;  5E3F A;  1CI3 M;  2MFI A;  4ALP A;  2F4V L;  2R92 G;  1ASZ A;  3VR3 A;  3U9S A;  1SYC A;  4ZCK A;  3L9A X;  3L2P A;  2ALY B;  3HOU G;  1EYC A;  4KHP Q;  2L0C A;  2KCT A;  4KJO A;  2CQO A;  3A5Z B;  2DJF C;  5KGU A;  2AHO B;  4DUZ Q;  2B2T C;  1HHV A;  4A3D G;  1L0W A;  1SAP A;  2CQA A;  3TBI B;  4B9W A;  3ULJ A;  3I4M H;  1HNW L;  3RR5 A;  5BN5 A;  2LSS A;  1VQE A;  1N34 Q;  5BN4 A;  3CQZ H;  3S17 B;  1TWG H;  4RA8 A;  2NVT B;  4IJL A;  1AN8 A;  1YNN D;  3R3O A;  1TKW B;  2NVX B;  1F9R A;  1LT5 D;  1KDA A;  5COR A;  4DFA A;  5DLQ E;  2EYO A;  3GTG B;  1VQ5 A;  1LTA D;  4YIJ A;  1M90 C;  4X3S A;  3KDF A;  3D8G A;  5IGD A;  1TWH B;  1E0B A;  1D5X C;  1S5E D;  5DM7 3;  5JEA J;  4YWL A;  3TQY A;  3J80 E;  5LHY 1;  1YIT A;  2Q2I A;  4RAU C;  1DCZ A;  2B3G A;  3QO2 A;  2BCO A;  2IX0 A;  1YI2 A;  4NW2 A;  3MC0 B;  4BY7 G;  3RNU A;  1QVF A;  4KY7 A;  5LMN W;  3I56 A;  2JE6 I;  2E75 C;  2NVQ H;  2RF4 A;  4RWS C;  3S1R H;  4A3I H;  2JEB I;  5KEE A;  3PIO 3;  1SYD A;  2MGS A;  4GS3 A;  5EKI A;  1AH9 A;  3CU7 A;  2Z6B A;  1XPO A;  1I4H A;  1WOC A;  3J81 c;  5CBE E;  1LT4 D;  1RD9 D;  2CH4 W;  2HIX A;  3ER0 A;  3KUP A;  1SFO B;  1BBW A;  3HOW G;  1CKN A;  2F4I A;  5AFW A;  2PW5 A;  4BY7 B;  3Q6S A;  3SHL A;  3BZK A;  2Z1C A;  1KQS A;  1FNV A;  3I72 A;  2R61 A;  2FJ2 A;  3D31 A;  2K04 A;  2L1B A;  4CDF C;  4LF7 Q;  4IUU A;  5IP9 G;  2K33 A;  1VQP A;  1PFN A;  1CQF A;  2N49 A;  5HGQ A;  4OL7 A;  1WVL A;  3GTK B;  3IFT A;  5LMN L;  1V43 A;  4F88 A;  1XPU A;  4FP5 D;  5E4W C;  1S4Z A;  2ZTD A;  1UE1 A;  2L12 A;  4FF1 A;  4LFA Q;  1XTC D;  2UXC Q;  3J7Z C;  1AE3 A;  3DHQ A;  2VY3 A;  2VUM B;  2Y0S B;  5IYB G;  4JYA L;  1JOR A;  3HZX A;  1CKN B;  4IPD A;  2YTV A;  1CA6 A;  1HR0 L;  5C5L A;  4AIM A;  1OTC A;  2NZH A;  4DV6 Q;  2KHJ A;  4GKK Q;  1LV9 A;  4BY1 H;  3UE1 A;  1GUT A;  3AU7 A;  1K73 C;  1PV4 A;  3BDO A;  5A2Q L;  5FO7 B;  3CCS A;  3OIQ A;  1PRT C;  2JA5 H;  1EQQ A;  2EY5 A;  3U58 A;  1PH8 A;  1J6Q A;  4CDD C;  1S5F D;  5KIX A;  2SDF A;  5I9P A;  1HZB A;  1FYC A;  2C9O A;  3C3L A;  1JB7 A;  3KLW A;  1SMY C;  3NBH A;  1SXT A;  3FKI H;  4IFD G;  3GD7 A;  3D6C A;  3QJY A;  5I6W A;  3PO3 G;  4KHZ A;  3CP0 A;  2TSS A;  4R8I A;  4PG3 A;  2UUC Q;  5C0X H;  4B08 A;  4A3D B;  1JR0 D;  1QB5 D;  1QE6 A;  3I70 A;  2OXP A;  4K2L A;  5K5P A;  4LF5 Q;  1B53 A;  1SNO A;  1D1K A;  1ZXT A;  4A3L H;  3J7A V;  3STB D;  2EOT A;  1WCM B;  5C44 G;  4N8X 1;  1H9S B;  1WYD A;  2RCF A;  1S5C D;  3MXN A;  2VXW A;  1B2T A;  4HIO A;  4A3B H;  1R4P B;  1B50 A;  1HQR D;  3C2P A;  4UY8 C;  2G5D A;  3T51 B;  4DK0 A;  1N9W A;  4K14 A;  5EKL A;  1HNW Q;  4C3H B;  4B3S L;  4EQN A;  2Q8T A;  4DA2 A;  1XMO L;  3WOE A;  4OX9 L;  2NN6 I;  4Y7N B;  2D9U A;  4FDB A;  2C35 B;  4I7A A;  4N9P A;  2VQF L;  3HOZ H;  5BN3 A;  2EZV A;  1HUN A;  1H9M A;  1PTO B;  5T1G A;  4NXN Q;  2JA6 B;  2A69 D;  3TP6 A;  1K83 B;  2PQA B;  2DY7 A;  3S16 H;  1TWF H;  4Y52 H;  3CW2 C;  3U50 C;  4JI5 Q;  1I4P A;  1KDB A;  1GUO A;  3R2I A;  3BYY B;  1SE4 A;  4A3C H;  4DR4 L;  1GVP A;  3OMC A;  4DAM A;  1EQR A;  1B70 B;  1SLJ A;  2E74 C;  2F0V A;  2QDL A;  5J1Z A;  2A5H A;  2IW3 A;  3I4L A;  4RKL A;  1VQF A;  1IW7 D;  3HS0 C;  4QUF A;  1A15 A;  1B3Q A;  1II3 A;  1NCV A;  4MIU A;  5FO8 B;  1Y1V G;  3JAM E;  1EY9 A;  2B2Y A;  4DV4 L;  4C56 C;  4OEL B;  3CHB D;  5IIF A;  4QMG A;  3CKI B;  3KOJ A;  2Y0S E;  2KUM A;  5J3B A;  1FL0 A;  4HJ8 A;  1Q82 C;  5D65 A;  1AP0 A;  4UPA A;  5IGE A;  3HOW B;  1NR2 A;  4JI8 L;  5I9O A;  1SYF A;  3S9W A;  1OXT A;  2JA8 H;  1UUP A;  1IL2 A;  1E2Z A;  3A7A B;  3FDT A;  1QOH A;  4DUY L;  3T56 B;  1M1K C;  2R7Z H;  4R4T A;  1UAP A;  3VR5 A;  1C4Q A;  4DV0 Q;  3HEJ A;  1HFG A;  2AQ2 B;  1Q1B A;  2RVL A;  1STA A;  1XJV A;  3I7F A;  1BKB A;  1PZK D;  2C5C A;  2E2J B;  1SNC A;  2UXD Q;  4C2M B;  3I91 A;  3S2H H;  1SE2 A;  1SND A;  4S3S A;  1TS4 A;  2LKV A;  3P20 A;  2ZM6 L;  1VQ8 A;  1F9S A;  1T9H A;  4FVM A;  1U4P A;  5ELO A;  3QOL A;  4JV5 Q;  4RH6 A;  4HIK A;  5GAE C;  2G9D A;  5DEH A;  2V4D A;  2NWG A;  1PZJ D;  2WP8 J;  4KHV A;  2QW7 A;  4UDU C;  4LF9 Q;  2HHH L;  1Y69 U;  5ISR A;  5NUC A;  4FF3 A;  3I8Z A;  4DV0 L;  1YNX A;  4DN4 M;  3PO3 H;  3FHW A;  3CC2 A;  1WJJ A;  4A3J G;  1QVG A;  4UHV A;  2XRQ D;  1L1O A;  4NB3 A;  2JA9 A;  2IL8 A;  2R92 H;  4N9T A;  3S14 B;  4BA2 I;  3HOX B;  5GAH C;  2N55 A;  5IYC H;  5FJ8 G;  1K8A C;  1WTQ A;  1ONL A;  3I4N G;  1BVS A;  3BZC A;  4LW1 A;  2OQK A;  3GTM H;  4LWC A;  3SEB A;  2UU9 L;  3J7A F;  2ZXR A;  3G6J B;  1E2V A;  1YHB A;  2UUB L;  1SYE A;  5C44 B;  3CCQ A;  3S1M H;  3W3A A;  3K7U C;  1CSQ A;  3NP8 A;  4HN7 A;  1HCZ A;  1X56 A;  1A3T A;  5FLX E;  4IO9 A;  3RZD H;  2GN5 A;  2VQE Q;  4RFB A;  2K6A A;  1EOT A;  3K58 A;  1ROD A;  1QUQ A;  3UDX A;  4K2K A;  3A8J E;  1X6O A;  1HZC A;  4IN3 A;  4DV6 L;  4HSV A;  2NBF A;  1VQ9 A;  2WAQ B;  1IBL Q;  2BOS A;  2F0M A;  5C3X A;  5EPJ A;  4HAE A;  4JI0 Q;  3H3V H;  5ELC A;  3SE0 A;  1V1P A;  2V1C C;  2OWO A;  4P71 A;  2F0S A;  4R4C A;  1STH A;  5EBD A;  3ONA B;  5D14 A;  5M3F B;  2FHT A;  1TS3 A;  3SDZ A;  1G6P A;  4TQU S;  3Q0A A;  1SE8 A;  4KLK A;  1PFM A;  3OIP A;  3HKZ E;  4KJN A;  1KD1 C;  1RTN A;  2XGT A;  1XNQ L;  3LWU A;  4IUN A;  1PRT B;  3AYH B;  3V05 A;  2A69 C;  4X62 L;  3CCR A;  1B9N A;  3OTO L;  4GOP A;  2JXM B;  4A3M H;  1S5D D;  3NXW A;  4GKK L;  4XDX A;  2F52 A;  2LS0 1;  3OW7 A;  1Q1E A;  3OHX C;  1D5M C;  1EY5 A;  5GAG C;  3P1H A;  1SR3 A;  3CRL C;  4C1N K;  4DV4 Q;  4DR6 Q;  5L37 A;  3H3V C;  1W6K A;  1ZKO A;  4IAL A;  1UWV A;  2B39 A;  3G48 A;  4JK1 C;  5TSS A;  2HIV A;  5M3M G;  3TN2 A;  1G29 1;  1CT1 D;  5IE8 A;  2F0T A;  1EY0 A;  4HIM A;  3K0X A;  2XWB B;  2JYO A;  1LLR D;  4LUO A;  2ZT9 C;  2Z6K A;  4DUZ L;  1I3Q B;  3K80 C;  2A6H C;  5J39 A;  2VZA A;  1D8L A;  3KF6 A;  1MJC A;  2E5L L;  5C4X H;  2CWA A;  5M3M B;  2OQ0 A;  3OYY A;  1VQJ A;  1OXU A;  4OON A;  4QF4 A;  4CKB A;  4C1N I;  4IQZ A;  2E2H B;  4Z9C B;  2A6H D;  3PF4 A;  3F2B A;  2F0N A;  3NEM A;  1SE3 A;  1KXL A;  1F9Q A;  4H7B A;  2SEB D;  2K14 A;  3GDE A;  5M9O A;  1HUM A;  4KN7 C;  4K8J A;  1LM0 A;  4A3F B;  3CCL A;  1PRT F;  4GN5 A;  1J9O A;  1LAB A;  3TSS A;  1YJW A;  4E6I A;  2B8F A;  5E4X A;  2AKW B;  2L4N A;  1JCK B;  3HFZ B;  5IP9 H;  2M9V A;  1VF7 A;  1GUW A;  4PMC A;  4PMW A;  1UE7 A;  1X54 A;  2NZ1 D;  2RHQ B;  2X69 A;  2ZXO A;  2PI2 A;  5HGT A;  4JOI C;  2PNH A;  3KLS X;  3NWT A;  1H9J A;  1HXY D;  2DY8 A;  2O5J C;  1C0A A;  2B2W C;  2NUC A;  3E3X A;  1L0X B;  1QCB D;  4NPS A;  1YEZ A;  4QY7 A;  2I5H A;  1WTP A;  1Q90 A;  1R4Q B;  4A3K G;  4CJ2 C;  3SGI A;  4WFN 3;  3NTH A;  2L55 A;  4J6H A;  3S1Q H;  2YU9 B;  3E6Z X;  1FVI A;  4G4K A;  4MHE A;  2EJM A;  5C3E H;  1MJE A;  1TWG B;  1CA5 A;  1VDZ A;  1STY A;  3J80 i;  1O7L A;  1DM0 B;  1ENA A;  3KJO A;  2J0T D;  4ZKC B;  5C4H A;  3RLN A;  5ELE A;  1I4X A;  3TDQ A;  3BDC A;  1XPR A;  2M00 A;  1CKM A;  2CCZ A;  2AQ3 B;  4A3G H;  1B3A A;  2DUD A;  2R3Z A;  2EDG A;  3C1E A;  3EQL C;  1S72 A;  1QIL A;  4R4I A;  1QZH A;  1HNZ L;  4IFD H;  4ZAI A;  4C3I H;  4HSP A;  4FXK C;  3PF5 A;  2KCM A;  4B3R L;  3K7A H;  1WTH A;  4BA1 I;  4X62 Q;  3VYT A;  4FXG C;  4C3J G;  3HOV H;  4R9W A;  1LT6 D;  4JI0 L;  3GTO B;  3HOU B;  2K75 A;  2ASB A;  2HQE A;  2JEA I;  2OT2 A;  3G4S A;  2ATW A;  3T16 A;  1VQB A;  5JJL A;  1FJG Q;  3M4P A;  1LTI D;  5IP7 H;  3I4N H;  4RG1 A;  1S5B D;  3NHH A;  5EJW A;  5I6Y A;  5KND A;  1EY6 A;  2AUJ D;  4JI7 Q;  2O5I C;  4DXF A;  1I50 B;  1MI2 A;  3MEH A;  1ICF B;  3T1H L;  2NTT A;  2XIW A;  3QB3 A;  2KEC A;  4IUQ A;  2EVB A;  2YTY A;  2DNE A;  2J7Z A;  1EL0 A;  2EJF C;  5M5Y H;  2E8G A;  4NXN L;  4NXM Q;  1JJG A;  3HRZ C;  1A6X A;  4QJF A;  2D0P A;  1M4V A;  2B63 G;  5IYB H;  3M3Y H;  4EVO A;  1B1Z A;  4UP8 A;  1QWY A;  5C4J B;  1RHP A;  1R9T B;  1VS0 A;  2F3I A;  3GTL B;  2QIL A;  4H44 C;  4DR2 L;  4P75 A;  3GV3 A;  1VQ7 A;  3URY A;  1BF4 A;  2WAQ E;  4M8A A;  3WOF A;  3SVM A;  3TME A;  4DXG A;  3VR2 A;  1NNX A;  2VUM H;  4LF8 Q;  2MP1 A;  4XTC S;  1XMO Q;  3T1H Q;  1EEF D;  2WAC A;  1A3U A;  2DGY A;  2MQH A;  3DLL A;  4JI1 Q;  3P75 A;  2QEX A;  1ILQ A;  1NJI C;  3H3V I;  2Q8R E;  1HR0 W;  2IJ0 A;  2K05 A;  1HZ9 A;  5JVG 3;  4K8I A;  1I6V C;  1A2U A;  2WKD A;  5EKK A;  2JA5 B;  4CDC C;  2XN9 C;  1STB A;  1Y8P B;  2HT1 A;  2ZJR A;  5HUR A;  2AQ1 B;  2Z4H A;  4L5T A;  3IL8 A;  4RCO A;  1YHQ A;  4XXE A;  4A3K H;  5EQ0 A;  1PLF A;  3S24 A;  5FLM H;  4TVA B;  2R7D A;  3KF8 B;  4K5W A;  3A54 A;  1TR5 A;  3F1Z A;  1TS5 A;  4LF4 Q;  1Z9F A;  3H0G G;  1IW7 C;  4P73 A;  1PYW D;  3H0G H;  3PV0 A;  1I5F A;  3M4O B;  3PSI A;  2K5W A;  2ZTE A;  1Q8K A;  1W2B A;  3M7G A;  2FIN B;  3EN2 A;  3V2T A;  2XTI A;  2R93 B;  3HOY H;  2WFW A;  4DNT B;  4ZK9 B;  3CXC A;  3PGZ A;  3AFP A;  3MAQ A;  4GNX A;  2HHH Q;  3CCV A;  3GTP H;  5JAV A;  1V9P A;  5ELF A;  1PMR A;  4F8M A;  1IBK L;  1EOV A;  4B9X A;  1IZ6 A;  3I90 A;  2JN4 A;  4C3J H;  4R4Q A;  3U4V A;  4L6T B;  1V1O A;  2JA6 H;  4GN3 B;  1BBU A;  4AYB E;  1DOK A;  2JA6 G;  3W2D A;  1EWH A;  5G3L D;  2F0K A;  4YCV A;  3JAM i;  3NWS A;  1XXG A;  4AQY L;  2PQA A;  2TMP A;  1GUS A;  3CCM A;  5FO9 B;  1PA6 A;  2BH2 A;  5A2Q E;  1HQM C;  1GJX A;  1JOO A;  3DM1 A;  3I3C A;  2F0W A;  1MSH A;  2Z9H A;  2RSO A;  2AWO A;  4LF9 L;  4GLA C;  4ME5 A;  3J81 L;  1RIP A;  1D7Q A;  3GTJ H;  2XNA C;  4DV5 Q;  1O7Z A;  3KK7 A;  1SMY D;  3SK4 A;  2OTL A;  2CW0 C;  4PNY A;  1YNJ C;  5K36 H;  3QR8 A;  1LTT D;  3JAM L;  5LMU Q;  2UXB L;  3K0Y A;  1ET6 A;  2H5X A;  4RGO S;  1K3R A;  4O2D A;  4KMU C;  1F2L A;  1VQO A;  5IYD H;  1ASY A;  3TZD A;  1KAA A;  3T53 B;  5LMN Q;  1C48 A;  4LF8 L;  3W5O A;  2RDF A;  4ZRZ A;  3GTQ H;  4IPH A;  2X6L A;  2D0O A;  5JVH 3;  3PIP 3;  5JOB A;  3S1N H;  2F0F A;  2RKS A;  2ICI A;  4BBS B;  3W1G A;  3SXH A;  4FF2 A;  4DV3 L;  4GKJ Q;  2ICE C;  4YHH Q;  1UE6 A;  1PH3 A;  1FR3 A;  5ELD A;  3VYS A;  3UDF A;  2B2U C;  2K01 A;  1LO5 D;  4G57 A;  1FNU A;  2XVS A;  2L11 A;  4DU9 A;  4OWX B;  4HJ5 A;  5KNC A;  2PW7 A;  1AZQ A;  1K3B C;  1BCP F;  3CQZ B;  3S17 H;  3K59 A;  4OWW B;  1YHA A;  1SYG A;  2PZU A;  3HOX G;  2Q2U A;  3ERQ A;  4ZUJ A;  4XIG S;  4FNF A;  5CV5 A;  3LWE A;  5T1I A;  3S15 H;  3BS1 A;  3NPP A;  2HDM A;  2SNS A;  1JWM D;  3RZO H;  3PUW A;  4NDX A;  4IPC A;  4A93 B;  1TWH H;  2KBN A;  1WTR A;  4HCE A;  4LF5 L;  4P2C B;  4DV2 Q;  1IYJ B;  2ES2 A;  4XT3 B;  1PH2 A;  2A68 D;  1TVX A;  3ULP A;  2OCE A;  1C9O A;  2WB1 B;  3UI2 A;  5IGG A;  1Y1W B;  2F3W A;  3X3M A;  3RZD B;  2KJX A;  3FRP B;  2JA5 G;  2NVQ B;  2A68 C;  4XQQ A;  3DEP A;  5FK9 C;  3U9O A;  5JJK A;  4OO1 G;  3A8K E;  1EY8 A;  1K0S A;  2EY2 A;  2BA0 A;  4EX5 A;  1JWS D;  4A3I G;  1IYU A;  4KTA A;  3TS2 A;  1Y1W G;  1SFO H;  1VQ6 A;  2PZT A;  4HED A;  2HDL A;  1YNN C;  1L2F A;  1X65 A;  5JPN C;  3OSO A;  4PZ6 A;  2EYF A;  4APV A;  2F1M A;  4IUP A;  2Q2H A;  1TWA B;  2WIN B;  3GV6 A;  3SK8 A;  1LYL A;  3H91 A;  2EYM A;  2RCN A;  2JK8 A;  3AMU A;  1X3G A;  1X32 A;  1FD7 D;  2F03 A;  5CMD A;  3DXJ C;  4CGY B;  4IZ8 A;  3TP5 A;  4OIK A;  4V19 0;  1CZW A;  2KCN A;  1PH9 A;  5EAY A;  2HCI A;  1ENC A;  2F0D A;  5C0X I;  4A3B G;  5FLM G;  3A8I E;  4JBW A;  1TWC B;  4YCW A;  2BE5 D;  4GOP C;  5ELN A;  2B63 B;  3P7J A;  4KI0 A;  5IOC A;  4GZY C;  1EU4 A;  4A3E B;  1STN A;  2GVB A;  4ULL A;  1GUN A;  5GQO A;  2NVY H;  2PO4 A;  1N33 Q;  4A3M B;  3HOZ G;  2FMC A;  2DN8 A;  2K03 A;  2VB3 X;  3UE0 A;  4BBR G;  1EWC A;  2B2Y C;  3A74 A;  3OOC A;  3S2D B;  5CV9 A;  2HD3 A;  2NZO A;  4X65 L;  1EUJ A;  1G51 A;  1DJR D;  1WFQ A;  5CV7 A;  2F3V A;  2PI2 E;  1AFP A;  5ELB A;  5AJ3 L;  1PH1 A;  1EYA A;  4Q0F A;  5GAD C;  1O7I A;  4YHH L;  2R7Z B;  2K7V A;  1I6H B;  2XRS D;  1AEX A;  3QOJ A;  2E2D C;  2EE1 A;  3A5U A;  4L5Q A;  1KDC A;  2I07 B;  3MA2 B;  1Y1V H;  5COY A;  2E2J H;  2A6E D;  1YNJ D;  1GHJ A;  3HKZ G;  4C2M H;  2VQF Q;  5CYU A;  1ZYR C;  1U4M A;  4A3D H;  3PQI A;  3FKI G;  1PTO C;  2MPM A;  3G7L A;  1MD2 D; 
#chains in the Genus database with same CATH homology
 1N34 Q;  4JOI C;  1P16 A;  3CQZ H;  4GN4 B;  1IBM L;  1TWG H;  2PNH A;  4IJL A;  1B8A A;  1VQC A;  1L1O C;  1C0A A;  1OXS C;  3RLF A;  1NMF A;  1VQA A;  4NPS A;  1YEZ A;  2K5H A;  5M5X H;  4QY7 A;  2I5H A;  4X64 L;  4DR4 Q;  1Q12 A;  2D62 A;  4YY3 L;  4DV1 L;  4B3T Q;  3NEN A;  4DV3 Q;  5DLQ E;  2N8N A;  2BA1 A;  4A3K G;  1VQ5 A;  4GKJ L;  3SGI A;  1M90 C;  4BBS H;  3E0E A;  4Y7N H;  4P74 A;  4LF6 L;  1JT8 A;  3KDF A;  2EQS A;  3S1Q H;  2UXB Q;  4WJ3 M;  4OWT B;  1FVI A;  3E9I A;  5HY6 A;  3M4O H;  1YZ6 A;  2YTX A;  1QVC A;  5C3E H;  1XTD A;  2EIF A;  3I2Z A;  4YWL A;  5JEA J;  1MJE A;  3TQY A;  3K81 C;  3J80 i;  3CCJ A;  4GOP B;  2NVX H;  4JC0 A;  1YIT A;  2Q2I A;  3KJO A;  5JJI A;  3GTG H;  4JI3 L;  1DGS A;  1SMX A;  3RLN A;  1Q46 A;  2B3G A;  4JI4 L;  2IX0 A;  1YI2 A;  4BY7 G;  4IFD J;  3KF6 B;  1XPR A;  3RNU A;  1CKM A;  4BY7 H;  4OX9 Q;  2CCZ A;  1QVF A;  2I5L X;  4A3G H;  4IOC A;  2DUD A;  1VQD A;  1VCI A;  2JE6 I;  3I56 A;  5LMN W;  1IBM Q;  1E7Z A;  1PVO A;  2NVQ H;  2RF4 A;  2YU9 H;  3S1R H;  4A3I H;  1S72 A;  2JEB I;  4R4I A;  3PO2 G;  1QZH A;  1HNZ L;  2K50 A;  1AE2 A;  2A19 A;  4GS3 A;  4DV2 L;  3T1Y Q;  4C3I H;  1KIX A;  3CAM A;  1EIY B;  3PF5 A;  4JI8 Q;  1AH9 A;  2KCM A;  4B3R L;  1XPO A;  2FXQ A;  2KEN A;  1WOC A;  3K7A H;  3J81 c;  4DR6 L;  4A3F G;  4BA1 I;  4X62 Q;  5C0X G;  2ZTC A;  3HOV H;  4JI0 L;  2HIX A;  3ER0 A;  1H95 A;  2K75 A;  3F2C A;  2I0Q A;  1BBW A;  2ASB A;  3PUX A;  3HOW G;  2JEA I;  1CKN A;  3G4S A;  4JCV E;  3GTK H;  1LTL A;  1CUK A;  1TXY A;  3AQQ A;  2ATW A;  1VQB A;  5JJL A;  3ERS X;  5FJ8 H;  4B3M Q;  1FJG Q;  4POF A;  3BZK A;  1KQS A;  3M4P A;  3BU2 A;  5IP7 H;  3I4N H;  4RG1 A;  1QUQ B;  4GLX A;  1L1O B;  2ZM6 Q;  3D31 A;  4LF7 Q;  2LXK A;  1MIU A;  4JI3 Q;  5IP9 G;  4JI7 Q;  3BJU A;  1VQP A;  3STB C;  4DR1 L;  3D0F A;  1XNQ Q;  2UUB Q;  3MEF A;  4A75 A;  2N49 A;  5HGQ A;  3KYH C;  1NBW A;  3T1H L;  1B7Y B;  1CSP A;  5LMN L;  1V43 A;  1PH4 A;  1N34 L;  3MXN B;  4K0K Q;  1XPU A;  2YTY A;  4O0A A;  1NTG A;  4DR3 Q;  4BXX G;  3K8A A;  2CFM A;  5M5Y H;  3KDF B;  2ZTD A;  5M3F H;  1UE1 A;  1PFS A;  2IT1 A;  4LFA Q;  2UXC Q;  4X64 Q;  2E8G A;  4NXN L;  3J7Z C;  1AE3 A;  4NXM Q;  1JJG A;  4QJF A;  2D0P A;  2VY3 A;  5IYB G;  2YYZ A;  2B63 G;  4JYA L;  5IYB H;  1YJN A;  3M3Y H;  5H1S E;  4UP8 A;  1SRO A;  4DUY Q;  2UXD L;  1CKN B;  2R93 G;  4IPD A;  1VS0 A;  3EIV A;  2F3I A;  2YTV A;  2Z6K C;  4ME3 A;  1HR0 L;  4A3C G;  4HJ9 A;  4AIM A;  1OTC A;  2NZH A;  4DV6 Q;  4DR2 L;  2KHJ A;  4P75 A;  4GKK Q;  2JJQ A;  1TWA H;  4BY1 H;  3UE1 A;  1VQ7 A;  2UUA L;  3PUV A;  1K73 C;  4KHP L;  3OW2 A;  2WAQ E;  1PV4 A;  3ZJY C;  4POG A;  3I4O A;  1N8R C;  3CCS A;  2JA5 H;  1HZA A;  3CF5 A;  3RN2 A;  2ZJP A;  1EQQ A;  4DNI A;  1PH5 A;  3U58 A;  1PH8 A;  4R4O A;  2VUM G;  1X3E A;  1J6Q A;  4LF8 Q;  2VUM H;  1S40 A;  4XTC S;  2UU9 Q;  3GTL H;  1HZB A;  1XMO Q;  3T1H Q;  4AQY Q;  1UE5 A;  5C4J H;  1I94 Q;  2E5L Q;  1X55 A;  1JB7 A;  2DGY A;  2MQH A;  3DLL A;  4JI1 Q;  4DAY B;  3KLW A;  5IWA L;  3J80 c;  2QEX A;  1NJI C;  3H3V I;  5AJ3 Q;  4JV5 L;  4PZ7 A;  1HR0 W;  4DK6 C;  2MNA A;  3FKI H;  4IFD G;  2UXC L;  1NMG A;  3GD7 A;  1HZ9 A;  1XNR L;  3PO3 G;  1SN8 A;  3WWV A;  4KHZ A;  3CP0 A;  5FLX c;  3OTO Q;  4PG3 A;  2UUC Q;  3HOV G;  2R6G A;  1I3Q H;  4X65 Q;  2HT1 A;  2ZJR A;  2VL6 A;  4L5T A;  3FP9 A;  4C3H H;  1GO3 E;  3M7N A;  1N36 Q;  4DR5 Q;  1J5E L;  4LF5 Q;  2AMC B;  1YHQ A;  4J15 A;  2VNU D;  1HNX Q;  4A3L H;  4QIW E;  2IHF A;  3EBE A;  3STB D;  5IYC G;  5C0X J;  4A3K H;  4JBK A;  4QGU A;  5C44 G;  3S24 A;  5C44 H;  1K83 H;  1WYD A;  5FLM H;  3J81 i;  4TVA B;  2R7D A;  3KF8 B;  4HIO A;  4A3B H;  1GD7 A;  3W1B A;  5K36 G;  4UY8 C;  4LNQ A;  4LFB L;  2K5N A;  2ZJQ A;  3M9B A;  3F1Z A;  1N9W A;  4LF4 Q;  5C3E G;  1HNW Q;  4B3S L;  1XMO L;  1Z9F A;  4OX9 L;  2NN6 I;  3H0G G;  4P73 A;  4X66 Q;  4FDB A;  1IBL L;  4H02 A;  3H0G H;  4DK3 C;  1I6H H;  2C35 B;  2VQF L;  1EWI A;  5E7N A;  3PV0 A;  4A93 H;  3HOZ H;  1I5F A;  1E24 A;  1WCM H;  4A93 G;  3PSI A;  1HNZ Q;  4JBJ A;  2K4K A;  2ZTE A;  1Q8K A;  1W2B A;  1PYS B;  1A63 A;  3EN2 A;  4BBR H;  2XTI A;  4NXN Q;  1VQK A;  2WFW A;  3CXC A;  3HOY H;  3PGZ A;  2PQA B;  3S16 H;  1TWF H;  3AFP A;  2JA7 G;  4Y52 H;  2UUC L;  3CW2 C;  4PZ8 A;  3U50 C;  4GNX A;  2HHH Q;  4JI5 Q;  3CCV A;  2LSS A;  3GTP H;  3J7A 5;  1V9P A;  1IBK L;  4DR4 L;  4A3C H;  1EOV A;  1GVP A;  5JEA G;  4YWK A;  4OO1 I;  4DAM A;  1IZ6 A;  4JI6 L;  1EQR A;  4WJ4 A;  1B70 B;  1SLJ A;  4JI2 L;  4BY1 G;  2N3S A;  4C3J H;  1VQF A;  4R4Q A;  5IY0 A;  4DR7 L;  4LF6 Q;  3U4V A;  1VQM A;  4IPG A;  3HOW H;  3UDG A;  4JI7 L;  4HID A;  4GN3 B;  1BBU A;  4AYB E;  2JA6 H;  1VQL A;  2JA6 G;  1RL2 A;  1K9M C;  1V1Q A;  2YV5 A;  1YVC A;  1Y1V G;  4YCV A;  3JAM i;  4AQY L;  1XMQ Q;  3GTO H;  3HOU H;  1KRS A;  2PQA A;  4JG2 A;  4DV4 L;  3CCM A;  4JI1 L;  3KOJ A;  2AWN A;  2Y0S E;  3U4Z A;  1PA6 A;  3L0O A;  2BH2 A;  1JMC A;  5J3B A;  5BR8 Q;  1FL0 A;  4HJ8 A;  1Q82 C;  2RHS B;  1A62 A;  2E2I H;  2Z0S A;  3AEV A;  4UPA A;  1IBK Q;  4IOA A;  4JI8 L;  1JE5 A;  4GNX C;  4DPG A;  4LFC Q;  4HJ7 A;  1VQG A;  2MO0 A;  1OXT A;  2JA8 H;  1IL2 A;  3H15 A;  2AWO A;  4LF9 L;  4GLA C;  4AYB G;  4DUY L;  1M1K C;  4P72 A;  3NBH B;  1RIP A;  1D7Q A;  3GTJ H;  2R7Z G;  2R7Z H;  4R4T A;  4B3R Q;  2WB1 E;  4DV5 Q;  4DV0 Q;  1E3P A;  1Q1B A;  1XJV A;  2OTL A;  3I7F A;  1BKB A;  1KC8 C;  4YY3 Q;  4DV1 Q;  1PH7 A;  1GKH A;  2UXD Q;  1KHI A;  2K5V A;  3S2H H;  1Z47 A;  1EFW A;  5LMU Q;  1K0R A;  2UXB L;  4YWM A;  2L15 A;  1Q86 C;  2H5X A;  1VQ8 A;  2ZM6 L;  1R9T H;  4B3M L;  1K3R A;  3DM3 A;  1T9H A;  4O2D A;  5ELO A;  1KL9 A;  2IHE A;  4L5S A;  1JJC B;  4DR3 L;  3UDI A;  2BH8 A;  4AH6 A;  1VQO A;  1ASY A;  3ICE A;  4IFD I;  1E1O A;  4JV5 Q;  5IYD H;  4HIK A;  4RMF A;  5GAE C;  1SRU A;  2HQL A;  5LMN Q;  3CD6 A;  4LF8 L;  4A3G G;  3W5O A;  2WP8 J;  1N32 Q;  3GTQ H;  4LF9 Q;  1PH6 A;  4IPH A;  4JI5 L;  2HHH L;  4QQB X;  2D0O A;  3S14 H;  3S1N H;  3ULL A;  3W1G A;  4DV0 L;  3AFQ A;  1YNX A;  4DV3 L;  4GKJ Q;  3PO3 H;  3FHW A;  3CC2 A;  4YHH Q;  4A3F H;  2VS1 A;  1UE6 A;  1WJJ A;  4A3J G;  1QVG A;  2VW9 A;  3I55 A;  1PH3 A;  4A3J H;  4OXP A;  4JBM A;  1L1O A;  3NEL A;  4NB3 A;  2JA9 A;  3UDF A;  1HR0 Q;  3M85 A;  1YJ9 A;  2R92 H;  3RN5 A;  4BA2 I;  5GAH C;  4QL5 A;  5IYC H;  1KAW A;  1XMQ L;  5FJ8 G;  4JOI A;  5IP7 G;  1K8A C;  1JJ2 A;  4OWX B;  1HNX L;  4HJ5 A;  3I4N G;  1U0L A;  2A1A A;  4DR1 Q;  1BVS A;  3F2D A;  2F4V Q;  3S17 H;  3BZC A;  4LW1 A;  2OQK A;  3Q8D A;  4LF7 L;  4LWC A;  2UU9 L;  4OWW B;  1X3F A;  3GTM H;  1YHA A;  4DKA C;  2PMZ E;  3B6Y A;  1YHB A;  2UUB L;  3HOX G;  3J81 j;  1LUZ A;  3CCQ A;  2Q2U A;  3HOX H;  2KHI A;  4XIG S;  5IT9 c;  1OXV A;  1N33 L;  1UEB A;  3S15 H;  3S1M H;  3K7U C;  1W3S A;  1CSQ A;  4DV7 Q;  1X56 A;  3RZO H;  1Y14 B;  3PUW A;  4BXX H;  4A76 A;  3PCO B;  3TRE A;  3TRZ A;  1VQH A;  1HH2 P;  2WB1 G;  5IWA Q;  5M3F G;  4IO9 A;  1Q7Y C;  3RZD H;  2GVA A;  2GN5 A;  2VQE Q;  5M5W H;  4IPC A;  2JA7 H;  1TWH H;  2KBN A;  2R7F A;  1VQI A;  1QUQ A;  3UDX A;  4JYA Q;  1C7Y A;  3PIO A;  1J5E Q;  4LF5 L;  1IXR A;  2R93 H;  1X6O A;  1HZC A;  1K8G A;  4DV6 L;  5GRO A;  3LGJ A;  4DV2 Q;  1IYJ B;  3T1Y L;  1VQ9 A;  2ES2 A;  1PH2 A;  1N36 L;  2N78 A;  3KJP A;  2UUA Q;  2OTJ A;  4X66 L;  1WI5 A;  1IBL Q;  3ULP A;  2OCE A;  1C9O A;  3CCU A;  4JI0 Q;  1S3O A;  3H3V H;  4DR7 Q;  3G71 A;  5BR8 L;  2V1C C;  4L5R C;  2JA5 G;  5IYD G;  2OWO A;  4UP7 A;  2ID0 A;  3M4Q A;  4P71 A;  3TEH B;  5JJK A;  4OO1 G;  4R4C A;  1E22 A;  1EYG A;  2BA0 A;  1G6P A;  4EX5 A;  2Y0S G;  4DV7 L;  4TQU S;  3CC7 A;  3E9H A;  1SE8 A;  3KFU A;  4HJA A;  4KLK A;  4A3I G;  3PO2 H;  1KD1 C;  3HKZ E;  1Y1W H;  4X6A H;  3TS2 A;  1Y1W G;  2XGT A;  1SFO H;  1XNQ L;  1E1T A;  4DV5 L;  1VQ6 A;  4JI4 Q;  3AYH B;  3PUZ A;  3GO5 A;  4X62 L;  1Q81 C;  1L2F A;  1FGU A;  1X65 A;  4GLV B;  3CCR A;  4NXM L;  1PHJ A;  2JA8 G;  4PZ6 A;  4APV A;  2WAQ G;  1TWC H;  1NE3 A;  2Q2H A;  2CKZ B;  1MKH A;  2QGQ A;  1VQN A;  3OTO L;  1LYL A;  4GOP A;  1U5K A;  2RCN A;  2JK8 A;  4A3M H;  4A3M G;  1X3G A;  4GKK L;  4UP9 A;  5LMU L;  2F52 A;  2NN6 G;  3JC6 6;  1Q1E A;  4A4I A;  3CPW A;  3TS0 A;  4LUZ A;  5GAG C;  1I50 H;  1SR3 A;  4LUV A;  4DV4 Q;  1PH9 A;  4B3T L;  4JI6 Q;  4A3L G;  5EAY A;  4DR6 Q;  4GNX B;  2IY5 B;  4BBS G;  3L7Z C;  5C0X I;  3CME A;  2B29 A;  4A3B G;  1UWV A;  5FLM G;  4JBW A;  1X9N A;  3G48 A;  4YCW A;  4GOP C;  5ELN A;  4LF4 L;  2LXJ A;  4KI0 A;  5M3M H;  1YIJ A;  2HIV A;  5M3M G;  2GVB A;  1YBY A;  1G29 1;  1KRT A;  4DR2 Q;  1P8L A;  1I94 L;  5GQO A;  5IE8 A;  4LFC L;  1FJG L;  1NY4 A;  2NVY H;  2QA4 A;  1N33 Q;  4K0K L;  4HIM A;  4B3S Q;  3K0X A;  1CKO A;  3HOZ G;  4LUO A;  1WCM G;  2Z6K A;  4DUZ L;  3UE0 A;  1A8V A;  4BBR G;  1EIF A;  3K80 C;  4R1J A;  3F8T A;  4IJH A;  2VQE L;  3HOY G;  3A74 A;  3HKS A;  2VZA A;  3CC4 A;  1VQ4 A;  1D8L A;  3CMA A;  3KF6 A;  3VDY A;  1MJC A;  2NZO A;  4X65 L;  1EUJ A;  1G51 A;  2E5L L;  2A8V A;  5C4X G;  1WFQ A;  2B63 H;  5C4X H;  2CWA A;  4A3E G;  1N32 L;  2OQ0 A;  3G6E A;  4A3E H;  4YCU A;  3CCE A;  3OYY A;  1VQJ A;  1OXU A;  2PI2 E;  4OON A;  2K52 A;  5AJ3 L;  3PIP A;  1PH1 A;  1GM5 A;  4JI2 Q;  3F2B A;  1QZG A;  2JQO A;  3PF4 A;  4MTN A;  4LFA L;  3A0J A;  4DR5 L;  2Q2T A;  3NEM A;  1A0I A;  2IX1 A;  1KXL A;  4MNO A;  1XNR Q;  5GAD C;  1O7I A;  1PYB A;  3CPF A;  4YHH L;  4MZ9 A;  3RLO A;  3JAM c;  2MFI A;  2K14 A;  3GDE A;  4LFB Q;  4ALP A;  2F4V L;  2R92 G;  2CWP A;  1LM0 A;  1ASZ A;  2NVT H;  3CCL A;  3S2D H;  3A5U A;  4GN5 A;  3PUY A;  4L5Q A;  1YJW A;  3L2P A;  2E2H H;  1Y1V H;  2ALY B;  2E2J H;  3HOU G;  4KHP Q;  3HKZ G;  2AKW B;  2KCT A;  1OXX K;  2CQO A;  2EXD A;  3A5Z B;  3HFZ B;  2MO1 A;  4C2M H;  5IP9 H;  2VQF Q;  2AHO B;  4DUZ Q;  3IRB A;  4EQ5 A;  4A3D H;  2I5M X;  4A3D G;  1L0W A;  4PMW A;  1UE7 A;  1X54 A;  1HJP A;  3FKI G;  3ULJ A;  3I4M H;  1HNW L;  3RR5 A;  2RHQ B;  3I4M G;  1VQE A;  2PI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...