4GLAC

Obody nl8 bound to hen egg-white lysozyme
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
89
Chain Sequence
b'LHGTEVVVAGWVASLGDYGRVKIVKVSDRGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
total genus 14
structure length 89
sequence length 90
chains with identical sequence D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glaC00
3CC2A 1PH5A 1N9WA 1SR3A 2MFIA 1KD1C 1GVPA 3CCVA 4HJ5A 4LF5Q 4DV5Q 1KRSA 2JEBI 1YHAA 5C3EH 4GS3A 2B3GA 4AQYQ 1G51A 3ULPA 3JC66 4A3JG 1L1OC 4BBRG 1VQKA 3HOVG 2KCMA 1IL2A 4L5QA 4A3GG 1RL2A 3L0OA 1AH9A 2PQAB 4LF4Q 1TXYA 4PZ7A 1PH7A 3BZCA 2VW9A 3KJOA 1N8RC 3CCSA 1EQQA 1JMCA 1EUJA 4QL5A 4B3MQ 1PYSB 4JBWA 1V43A 1WI5A 5IYCH 3H0GG 3TEHB 1K3RA 1E22A 1N34Q 1OXXK 2NVYH 4DR6Q 4LFCL 1VS0A 2F3IA 2YTYA 4FDBA 3CPFA 4UPAA 2UU9L 4KHPQ 3F2CA 4A3MH 1L1OB 2E2HH 5GROA 2AWNA 5IYDH 3ULJA 2WAQG 1BVSA 4QJFA 4R4IA 2K4KA 3HOYH 2UXCQ 4DR1L 1VQEA 3PUYA 3CCQA 3KF6B 2N49A 1X3EA 3OYYA 4A3KH 1CUKA 2IT1A 1QVGA 5JJKA 2CWPA 3CPWA 1A63A 1V9PA 1JJCB 2Q2HA 4YHHL 1UEBA 1C7YA 3TS2A 2R93G 1UE6A 3MXNB 4BBSH 1E3PA 3HOZG 1EIFA 1LM0A 4C2MH 4DPGA 2NN6G 2R7DA 1Q46A 1FGUA 3UDGA 1L1OA 4AYBE 1HNXQ 1D8LA 2HHHQ 3I4MH 1S3OA 2WB1E 5M3FG 2VUMH 1MJCA 3GO5A 3W1BA 2VQEL 1HNWL 4A3EH 5FJ8H 2I0QA 2E8GA 3H3VI 1VQOA 1VQHA 3PUVA 3I55A 4JBMA 3LGJA 5IYBG 4L5SA 2MQHA 2MO0A 2R92G 1LYLA 3UDFA 3H15A 4Y7NH 4JI6L 3RZOH 1OTCA 4IOAA 2CFMA 4A3LH 3TREA 1K0RA 3G6EA 2UU9Q 1PH8A 1VQJA 2E5LL 1W3SA 5JEAG 4JI7L 3U50C 2VL6A 3K7AH 3ZJYC 5M3MH 4IFDI 1VQMA 1CKNB 2CQOA 5C44H 1I94L 3OTOL 2OQKA 3PV0A 4MNOA 4B3SL 3CCUA 4DR1Q 2B63H 4WJ4A 2CCZA 1A62A 2I5MX 3GTMH 5K36G 1TWHH 3STBD 3HOUG 1WCMG 4LF9Q 5JJIA 1E7ZA 3NEMA 2KENA 4IPDA 2VZAA 3NELA 2WFWA 4YHHQ 3GTGH 5HGQA 1SMXA 3RNUA 3GTPH 3E0EA 2UXBL 4APVA 3STBC 2EXDA 4QQBX 4KHZA 1Y1VH 4X62L 2MNAA 3F8TA 4A3CH 4GOPC 1HJPA 3J80i 3S1RH 1PH6A 2OTLA 1PVOA 4PZ6A 4HJ8A 1YEZA 4YCUA 3CC4A 1X3GA 3KFUA 2GN5A 1I5FA 4BY1G 4DUYL 1HNWQ 2VQEQ 3PIPA 4BA1I 1L0WA 5IP9G 1E1TA 3CCJA 1NJIC 3CXCA 2GVAA 5IWAL 3PUXA 2F4VL 2ALYB 2L15A 3KDFA 4P72A 4DR3L 4JI6Q 1HZBA 3D31A 3S1QH 2Q2UA 1NMFA 1Q81C 3E9IA 1PFSA 3HKSA 1YIJA 2E5LQ 1K8AC 2AMCB 4C3HH 4JI2L 1XNQL 3A74A 1OXTA 3F1ZA 3FKIH 4ME3A 1I94Q 3OTOQ 5LMNL 3J80c 1M1KC 4DNIA 4A76A 3J7A5 2K52A 3KF8B 5M5YH 1YJNA 2OTJA 2N8NA 3BZKA 3L7ZC 1MIUA 3KYHC 1YBYA 1RIPA 2K5NA 3HOXH 1TWAH 1WFQA 5C4XH 4X65Q 2UXBQ 3EN2A 3TS0A 3F2DA 1Y1WG 1XNRL 2MO1A 3J7ZC 4X62Q 3CMEA 2NVQH 3FHWA 2VS1A 4X6AH 5LMUL 2PI2A 3KOJA 5AJ3L 4A3FG 3I4NH 2K50A 2FXQA 2ZTCA 4DUYQ 1SROA 2NVXH 3PF5A 4DUZL 1NTGA 2UUAL 2HT1A 3PO2H 4GOPA 4WJ3M 4YY3Q 4DV0L 4A3JH 3HOVH 1JJGA 1PYBA 2R7ZH 3HFZB 4IJHA 5IWAQ 2JK8A 2OQ0A 3M85A 1KC8C 1MJEA 2JA5G 2F4VQ 2JA8G 4DR3Q 3OW2A 1VQLA 4QGUA 4BBSG 4HIDA 2A1AA 1IXRA 4DR2L 3M3YH 2KCTA 3RN2A 1N32L 1VQAA 4JI2Q 2E2JH 4LF8L 2JA6H 3BJUA 3K81C 3G48A 5LMNQ 1EIYB 4B3TL 1V1QA 2RHSB 1OXVA 1XMOQ 2VQFL 1J5EL 1QZGA 2RHQB 3I2ZA 1PH3A 2VY3A 4JI5Q 3U4VA 4L5RC 4EX5A 2BA1A 4JI0L 3K80C 1XNRQ 2XGTA 4LFBQ 1YVCA 1M90C 4LUVA 5LMUQ 4J15A 4HIKA 1EFWA 2JA7G 2HQLA 1PV4A 4A3IH 1NBWA 4GNXC 5AJ3Q 5C0XJ 2KBNA 1X3FA 1KHIA 2Q2TA 4DUZQ 1LTLA 2EQSA 1SLJA 3RN5A 2CWAA 4POFA 1QUQA 5ELOA 3G4SA 1QZHA 2D0PA 2XTIA 5C3EG 1VQNA 3U4ZA 4DKAC 2JA9A 1VQ6A 3ERSX 2QEXA 4DR2Q 3PO3H 2BH2A 1D7QA 4X66L 1AE3A 1N32Q 3M7NA 3S2HH 4DAYB 5H1SE 1EWIA 4LF8Q 2HIVA 2JE6I 4DV7L 4AYBG 1IBKL 2OWOA 3Q8DA 4B3TQ 2WB1G 3T1HL 3K8AA 2VQFQ 1J5EQ 1B70B 2EIFA 5FLMG 4XIGS 1PH9A 4IJLA 1NMGA 1O7IA 5IE8A 5IYBH 4OWXB 2R92H 3GTQH 3I7FA 3PF4A 1TWFH 2IX1A 1Z47A 2A19A 1IYJB 4LUOA 1CSPA 2UUCL 4JI0Q 1UE7A 5FLXc 2RF4A 1LUZA 2ZTDA 1IBLL 4IFDG 4DR7L 1XPOA 3CCRA 1QVFA 5LMNW 2YU9H 2ATWA 3ICEA 4LFCQ 3U58A 1X55A 3IRBA 5IP7H 4DV3L 3HOYG 1QVCA 1K83H 1KAWA 1WYDA 3A0JA 3S1NH 2IHFA 4POGA 2YTXA 3B6YA 4GNXA 3S16H 1Y14B 1VQDA 1I6HH 4A3DH 1YJ9A 4JC0A 3M4OH 3ER0A 4A4IA 1VQ8A 1KXLA 5IT9c 2Z6KC 3KDFB 5M5WH 1X54A 4X66Q 4BY7G 4C3JH 1C9OA 1GO3E 4A75A 4DV7Q 3M4PA 1VQIA 2BH8A 4GLAC 1J6QA 3EBEA 3HKZG 3T1HQ 1NE3A 1UWVA 1IBKQ 1CSQA 2VUMG 2PI2E 4UP8A 2Z0SA 4A93G 4A3EG 4R4OA 3GD7A 1UE1A 4K0KL 5JEAJ 4HJ9A 1DGSA 2B29A 2UUCQ 1K8GA 1VQ5A 3S14H 5DLQE 4JI1L 1HR0L 4DAMA 1IBLQ 1XTDA 4LUZA 4DR7Q 4A3LG 2JQOA 3F2BA 4HIOA 1XMQL 2ZJQA 1FJGL 3T1YL 1UE5A 5M3MG 1BBUA 4JI8L 3CCMA 1W2BA 3UE1A 4O2DA 5C44G 3RLNA 3M9BA 1YHQA 4LFAL 2B63G 1Q1EA 4JI7Q 2IX0A 1PH1A 1SFOH 3GDEA 1VQFA 3S1MH 4MTNA 3GTLH 3PUWA 4JI3L 1U0LA 4R4CA 3UDIA 4B3SQ 1N33L 3L2PA 2ID0A 1SRUA 3AFPA 4GOPB 2K5VA 3CAMA 4DV4L 1WJJA 1B8AA 4GLVB 3NBHB 1X9NA 3J81i 2LSSA 1Y1VG 4A3CG 4A3BH 4NXNL 3CW2C 2H5XA 4YCWA 2VNUD 3I56A 4DR5L 4IPHA 2Z6KA 2JEAI 3RR5A 1OXUA 4IOCA 1MKHA 2KHIA 1C0AA 4K0KQ 2PNHA 4GLXA 1YITA 4DR4L 4RMFA 4LF7L 3CF5A 1X56A 3A5UA 4JI1Q 1HR0Q 1CKOA 2HIXA 4BBRH 3RZDH 3BU2A 4IPCA 4RG1A 5GAGC 1XMQQ 1FJGQ 5M5XH 4OWTB 4A3GH 3T1YQ 3W1GA 1Q8KA 3J81c 2YV5A 4PMWA 4LFAQ 1I50H 3FKIG 1ASYA 4UP7A 1AE2A 4HIMA 1T9HA 3ULLA 4B3ML 4JI4L 2NZOA 1XNQQ 2AHOB 1BBWA 2YYZA 4YWMA 3EIVA 4OONA 2Y0SE 1BKBA 4DV2L 4DK6C 1X6OA 2D0OA 5GAEC 3HOXG 4IO9A 2GVBA 4HJ7A 1N33Q 5C4XG 4BA2I 3FP9A 4DV4Q 1JT8A 3H0GH 4O0AA 1QUQB 1G291 2BA0A 3CCEA 4AH6A 1KQSA 2ZJPA 4EQ5A 3AYHB 3KLWA 4BXXG 2UXCL 4NXNQ 4OO1G 3PUZA 1I3QH 4R4QA 1KRTA 3I4NG 4DR5Q 2R6GA 1A8VA 4JBJA 1VQPA 4JV5L 4YCVA 3RLOA 3PO2G 1E1OA 1N36L 2NZHA 5C0XG 3HOWG 2R7ZG 1PH4A 4IPGA 1P8LA 4DV6L 2UUAQ 4JOIA 4DR4Q 1H95A 4LF7Q 4DK3C 4DV0Q 4OO1I 1HZ9A 4P71A 3CCLA 2R93H 1YJWA 1HNZL 4XTCS 2OCEA 4R1JA 1HNXL 2HHHL 1XPUA 3GTKH 3H3VH 3GTJH 3HOZH 3M4QA 1EQRA 1JB7A 4GKKL 5GQOA 5C0XI 4QIWE 4GKJL 2JA6G 5FLMH 4YWLA 3I4MG 1PHJA 4JI4Q 3CMAA 4TVAB 2ES2A 3TQYA 5M3FH 1FVIA 2PMZE 5IY0A 4DV2Q 3AEVA 1L2FA 2YTVA 3AQQA 3CQZH 1IZ6A 3D0FA 1HZCA 3RLFA 2QGQA 1HR0W 2UUBL 1Q12A 3JAMi 4GNXB 1R9TH 5BR8L 2PQAA 2K5HA 2ZM6L 5IYCG 4JI3Q 1K73C 3K7UC 3CP0A 4OXPA 1IBML 4GN4B 3J81j 1GKHA 1HH2P 2AKWB 4A3IG 1JE5A 2KHJA 2WP8J 5C4JH 1S72A 2UXDL 1VQ9A 2WAQE 2ZTEA 4LF9L 4PG3A 5GAHC 4JV5Q 4A3MG 1HZAA 1NY4A 4R4TA 1YHBA 5IYDG 1N36Q 4UY8C 3HOUH 4JYAL 1WCMH 1WOCA 4DV6Q 1A0IA 1GD7A 1VCIA 4NB3A 4BY7H 4A3KG 1XJVA 4LF6L 1HNZQ 3JAMc 4P75A 2D62A 4MZ9A 3W5OA 3PO3G 4Y52H 1KL9A 1VQBA 4NXML 4GKKQ 4GKJQ 4A93H 4B3RL 1U5KA 2N3SA 1EYGA 1GM5A 1PA6A 5GADC 1KIXA 4IFDJ 3KF6A 4BY1H 4NPSA 3PIOA 3PCOB 5IP9H 1VQ7A 1B7YB 2R7FA 2N78A 2NN6I 5J3BA 1PH2A 3DM3A 1FL0A 4LNQA 2DGYA 2UUBQ 5FJ8G 5BR8Q 3S2DH 2ZM6Q 4P73A 4TQUS 2A8VA 1P16A 1IBMQ 4UP9A 4LW1A 4PZ8A 1CKMA 1S40A 3G71A 5IP7G 2E2IH 2UXDQ 1OXSC 5E7NA 1YI2A 4LWCA 3A5ZB 3AFQA 2LXJA 3NENA 3PSIA 2I5HA 4X65L 4DV3Q 4OWWB 4JYAQ 4OX9L 3CD6A 4A3DG 5EAYA 2I5LX 4QY7A 2K14A 3KJPA 1JJ2A 1YZ6A 2ZJRA 1VQCA 1Y1WH 3PGZA 4LF6Q 4H02A 2ASBA 1EOVA 1G6PA 2F52A 1CKNA 3HKZE 4NXMQ 4GN3B 1K9MC 4DV1L 3MEFA 2Q2IA 4B3RQ 3UDXA 4X64L 4YY3L 4A3FH 2K75A 4JG2A 4L5TA 1Q82C 4YWKA 1X65A 4JOIC 2RCNA 1VQGA 4P74A 4GN5A 4HJAA 1VQ4A 1Q86C 1Q7YC 3GTOH 2JA5H 4LF5L 4DV5L 5ELNA 2JA8H 3S15H 3K0XA 4AQYL 3WWVA 4ALPA 1SE8A 3VDYA 4JBKA 2NVTH 2CKZB 3DLLA 1XMOL 4LF4L 4KI0A 1Z9FA 2AWOA 4C3IH 4JI5L 4JI8Q 3CC7A 2V1CC 2Y0SG 2DUDA 1SN8A 1ASZA 4AIMA 3I4OA 4OX9Q 5HY6A 4LFBL 1TWCH 1TWGH 4JCVE 3SGIA 2JJQA 2IHEA 4BXXH 1YNXA 1XPRA 1N34L 3UE0A 2C35B 4DR6L 3E9HA 4KHPL 2LXKA 3S17H 4KLKA 4A3BG 2QA4A 2JA7H 2IY5B 4DV1Q 5JJLA 4X64Q 1E24A 3HOWH 3TRZA 1Q1BA 3S24A
chains in the Genus database with same CATH superfamily
1U4RA 3GTGB 1EIGA 1AN8A 1DXMA 1KRSA 2JEBI 4DXFA 2RKSA 4AQYQ 3ULPA 1G51A 3S1RB 2E74C 2F0NA 2ZXPA 1PH7A 5C3XA 1KLUD 2XNAC 4HTHA 4B3MQ 1PYSB 2L5TA 2QDBA 1V43A 1BO0A 5C5LA 4DU9A 2QKIC 3S15B 1K3RA 4I65A 1E22A 1QILA 2NVYH 2QCPX 3BG3A 2YTYA 3CPFA 4UPAA 3SR1A 1ESFA 2WAQG 5IGCA 4DR1L 3PUYA 1JICA 1QVGA 1S5DD 1A63A 1V9PA 2Q2HA 3TS2A 5EQ0A 2NVQB 1UE6A 3BDLA 1SE2A 1EIFA 2LS01 4C2MH 1STYA 2NVXB 1NR4A 2R7DA 4DPGA 1K0SA 4BBSH 3HOWB 2F0EA 2O5IC 2AQ3B 1MJCA 3GO5A 3W1BA 2R7ZB 3D8GA 3D3RA 2IWHA 4PMCA 3SE0A 2EDGA 3H3VI 4U673 1RTNA 4JK1C 3J7AV 3UDFA 1EYAA 3TREA 2UU9Q 4ZKCB 2MJ8A 1VQJA 1W3SA 3MZ5A 3K5MA 4JI7L 3U50C 3K7AH 3ZJYC 4LMQD 4FF1A 3PV0A 3TP6A 2CCZA 1A62A 3SXHA 1TWHH 5TSSA 3HOUG 4LF9Q 3NELA 4YHHQ 3WOEA 1SMXA 3GTPH 5CBEE 5COYA 5IT9L 1STHA 1Y1VH 4X62L 4A3CH 1GJXA 1YEZA 4YCUA 4C3JG 1I5FA 4DUYL 4J1MA 1K28A 1E1TA 3CCJA 1SJHD 1NJIC 2KHSA 1SNCA 3DMUA 4XXEA 2L15A 3KDFA 4P72A 4DR3L 1H9MA 2JP1A 2Q2UA 1NMFA 3E9IA 1PFSA 2EY1A 4FP5D 1YIJA 2E5LQ 1K8AC 1XNQL 2PQEA 3TN2A 3FKIH 4DK1A 3OTOQ 5LMNL 3KF8B 2XSCA 2EJGC 4WJWA 1YBYA 1H9SA 4X65Q 3DEOA 3K5LA 1XNRL 2K5WA 1I4PA 3CU7A 1LACA 2PI2A 3KOJA 4OO1H 3P20A 3I4NH 2K50A 1RCVD 2HT1A 1I6HB 4GOPA 1JJGA 4YY3Q 4A3JH 4J6HA 3HFZB 5IWAQ 3M85A 3C3LA 2AQ1B 3ITPA 3OW2A 5CV8A 4HIDA 4DNRB 3RN2A 1AP0A 4FF4A 3J81L 1H9RA 1EIYB 3SK4A 1F9PA 1V1QA 4X3KA 2VQFL 1J5EL 2AQ2B 2VY3A 1ZXTA 3EFXD 4JI5Q 3U4VA 3NPPA 4EX5A 4JI0L 2XGTA 2ICEC 5LMUQ 3BYTB 4TKOB 3FVQA 2BE5C 3IFDA 4Z9CB 5AJ3Q 3FKIB 4V0BA 5C0XJ 2KBNA 1X3FA 4XQQA 2F0TA 4DUZQ 1LTLA 5JPMC 1SLJA 4N9TA 2XTIA 4A3BB 1SE3A 4KN7C 2BH2A 4X66L 3M7NA 1EWIA 1ZYRD 2DNCA 1IBKL 3Q8DA 4B3TQ 3T1HL 1B70B 2EIFA 1JQYD 4G4KA 1NMGA 2R92H 4A3JB 3PF4A 2KEEA 1STEA 3NHHA 5FLXc 2E76C 1IBLL 5BN5A 1KLGD 4FF3A 3CCRA 5IGBA 4IURA 3Q22A 2PMZB 1VMPA 1JWUD 4ZUJA 1WYDA 3D4WA 2F0QA 4U68A 5EBDA 3H0GB 3A7LA 3ND8A 2EY5A 2KEDA 4A4IA 1G8ZD 2WKCA 3VR6A 2Z6KC 3KDFB 5M5WH 3A7AB 1C9OA 1G6ZA 4BBSG 2BH8A 2H1EA 3HKZG 5D14A 4UP8A 2GA4B 3G6JB 4OELB 2R93B 4RCOA 4HJ9A 5FOBB 5DM73 1I4QA 1EIHA 2UUCQ 3HOZB 5M9OA 4K6DA 1H9SB 4DR7Q 1UAPA 2JQOA 4HIOA 3T4AC 1XTCD 5IODA 5FK9C 4O2DA 3M9BA 2OXPA 1F2LA 3TZDA 2IX0A 1PH1A 1GUGA 1VQFA 3PUWA 3UDIA 1R9TB 2R92B 3A8KE 3AFPA 4GOPB 2SNSA 4GLVB 1STGA 2G9DA 1Y1VG 2DN8A 4A3CG 4NXNL 1E2WA 4DR5L 2NWGA 1Q8IA 3BZDB 2JEAI 5EBCA 1OXUA 2F0PA 2KHIA 1QNKA 4GLXA 4DR4L 4RMFA 1WTXA 1WTPA 4LF7L 4IUVA 1LT6D 4BBRH 3RZDH 2XVSA 4PQXA 4KV6A 1EY0A 4DGZA 4OWTB 5M5XH 1Q8KA 1Y69U 1LTTD 3NBIA 3NTHA 3FKIG 3BDCA 3R8BA 4B3ML 1JC7A 2BDOA 4YWMA 1QG7A 1D2BA 2K6AA 4DK6C 4HJ7A 3OOCA 3FP9A 1EWCA 3MFYA 4O0AA 1WTWA 4LJZC 4AH6A 3E0JA 3H94A 1UNSA 2BE5D 1O7LA 4OO1G 1LTBD 1S5FD 4LK1C 1KRTA 3HZXA 3I4NG 1ESRA 1A8VA 1EEID 1PMRA 2N55A 4JV5L 1ICFB 4FNFA 2O2LD 1N36L 1L0YB 1LABA 2NZHA 1PH4A 4K14A 1HQMC 3BVZA 1P8LA 4IPGA 1Y1WB 2UUAQ 1Y8PB 1MD2D 1HZ9A 5CBAE 3CCLA 4OO1I 2DJGC 3GTKH 4RHSA 1EQRA 4F8MA 4CJ2C 2ES2A 5M3FH 4R8NA 3T16A 4IFDH 5DEHA 2SOBA 3RLFA 1HZCA 1SMYC 2HUGA 5D65A 5IYCG 3RZDB 1U4LA 1SYBA 5CGKA 3CP0A 4OXPA 4C3IB 5M5XB 1IBML 4QIWB 2KHJA 1Y8OB 2B2TA 1DJRD 4LF9L 1KTKA 2Z9HA 3MTSA 5DAUA 1WCMH 4JYAL 1A0IA 1GD7A 2K04A 5JPNC 1JOKA 2JA7B 4LF6L 1HNZQ 2D62A 1SBBB 3Q23A 4NXML 4GKJQ 4A93H 1U5KA 1KIXA 5ISRA 4NPSA 2F0JA 3I90A 4NW2A 3PCOB 1VQ7A 1CI3M 3HRZC 2N78A 1B50A 4ABNA 5HGTA 4LNQA 3L9AX 1GHKA 4TQUS 2NYZD 4LW1A 3OPOA 2F0SA 1EY5A 2A6HC 1S40A 2UXDQ 4H44C 1OXSC 1YI2A 5M3FB 1KDBA 3AFQA 5IOCA 5G3LD 4X65L 4DV3Q 5JJZA 4OWWB 1MSHA 4QY7A 2K28A 4K8IA 3KJPA 1D5MC 3I4LA 3GV6A 1FD7D 1VQCA 3LWUA 4H02A 1DD2A 3HKZE 2IJ0A 3HOYB 1PFNA 4GN3B 4DV1L 4DK0A 4B3RQ 3JAME 4YY3L 1GXDC 4KD4A 1Q82C 4P74A 5A35A 4GN5A 1WCMB 2P5ZX 4QUFA 1Q7YC 3GTOH 4LF5L 4DV5L 4UHVA 1MI2A 3K0XA 3VDYA 5J39A 4OHJA 4LF4L 4A93B 3TP5A 4C3HG 1IKLA 4JI5L 2F3VA 1B53A 2DUDA 1SN8A 1AZQA 2EE1A 1ASZA 2EVBA 1TWGH 4JCVE 2BOSA 3H09A 2PW7A 4OEMB 1YNXA 4DR6L 3EVQA 4KY6A 1BCPD 1EY4A 5C44B 2IY5B 1EFID 2B63B 2RSOA 4X64Q 3TRZA 3MXUA 1B44D 1PDQA 3S24A 4UDUC 3OIPA 1SR3A 2MFIA 2DNEA 2PZWA 1GVPA 4HJ5A 5C3EH 3TP7A 2B3GA 5EKIA 3HOVG 3JC66 1AFPA 4BBRG 3G7LA 2KCMA 1C4QA 1RL2A 3L0OA 3CHBD 3U9OA 1MBYA 3S9WA 4ME5A 4RA8A 1TXYA 4QMGA 3Q24A 2ZXOA 1S5ED 3KJOA 1LLRD 1EQQA 4QL5A 4EVOA 1SMYD 4JBWA 3GTOB 1XX8A 4IUPA 2OT2A 4P2CB 4XQJA 1N34Q 1VS0A 2F3IA 4KHPQ 1EEFD 3T13A 5GROA 5IYDH 2M2LA 4R4IA 3WOFA 3HOXB 5C4XB 1SNOA 3QOLA 1CZWA 1SSOA 2N49A 4A3KH 2CWPA 2K05A 1TWGB 1JJCB 1C7YA 1IYUA 4XYOA 3MXNB 2JN4A 3SVMA 3QJYA 2MPMA 2NN6G 2EYPA 1Q46A 1HNXQ 4AYBE 3I4MH 1SYCA 1S3OA 2WB1E 5M3FG 1RHPA 1TKWB 1STNA 4A3EH 2TMPA 3SDZA 3M7GA 4HN7A 2I0QA 1HUNA 1VQHA 3I55A 4JBMA 2MO0A 2E2JB 5FLXL 3H15A 2NTTA 2PYKA 4ID6A 1K0RA 3G6EA 2JA6B 3BYYB 2Z4IA 2A6HD 1C48A 4B08A 2I46A 4IFDI 1VQMA 2CQOA 1I94L 1B3QA 1CTMA 3A54A 2I5MX 3GTMH 3STBD 1FNUA 1WCMG 5AFWA 5JJIA 3GTGH 2UXBL 5IIFA 4A3IB 2EY6A 1F2ZA 3S1RH 1HJPA 3J80i 3TMEA 1PVOA 3NTKA 3CC4A 1X3GA 2QF7A 3AMUA 3KFUA 2GN5A 1HNWQ 1EY6A 2VQEQ 5LL6S 1YNNC 1RF2D 4EGVA 4A3KB 3EQLC 2GVAA 1TY0A 2F4VL 3OMGA 2ALYB 2LFNA 4JI6Q 4ZAIA 1HZBA 3S1QH 1SEBD 1SDFA 4JI2L 2WINB 3A74A 4ME3A 3J80c 1TWFB 5M5YH 3HGBA 3L7ZC 1MIUA 2JSOA 2C5CA 3KYHC 2L12A 4ULLA 3TS0A 3F2DA 4BWGB 2MO1A 2NVQH 4KY7A 1K83B 2F4IA 4CKCA 1BNZA 4IZ8A 1O80A 3S16B 2G9HD 2CHBD 2NB0A 1RTOA 4FVMA 3SK6A 1NTGA 3J7YW 2NVXH 2UUAL 1A6XA 3P7JA 3M4OB 2E2DC 2R7ZH 1MJEA 3VR2A 1KC8C 5EKKA 4QGUA 2A1AA 3M3YH 3DWAA 2KCTA 1N32L 1PRTC 5E4WC 2FHTA 3K81C 3G48A 1ZKOA 5IGGA 1OXVA 2RHQB 3S14B 2XWBB 3NK9A 1SNPA 2K32A 2BA1A 5KYIA 3K80C 3S1QB 1F9RA 2F1MA 1M90C 4J15A 2QDLA 2RA4A 2HQLA 1H9KA 4GNXC 4QB4A 1HTPA 1TVXA 4OIJA 1K8OA 1HA5A 1KHIA 5M5YB 2EZVA 2B39A 2HD3A 4POFA 1QUQA 5ELOA 2Z4HA 3G4SA 1YNJC 2F3WA 5C3EG 1QOHA 3BS1A 4DKAC 2JA9A 3DWPA 4G7ZC 3ERSX 2QEXA 4DR2Q 1AE3A 3S2HH 4LF8Q 3K0YA 1KABA 3L3OC 4K5XA 4XIGS 1ZYRC 4IJLA 5IYBH 1O7IA 3I7FA 2A19A 1TS2A 4A3GB 2FJ2A 5EJWA 1UE7A 1LUZA 2ZTDA 2K33A 4OIKA 3I3CA 3M3YB 1QVFA 3ICEA 1DZ1A 3IRBA 5IP7H 4DV3L 3S17B 2FINB 2K1BA 2IHFA 2YTXA 3B6YA 3VA5A 1Y14B 1VQDA 1I6HH 1YJ9A 1EQTA 1PFBA 1VQ8A 3Q6SA 1KXLA 1F9QA 5LL6X 1I3QB 1X54A 4BY7G 3VYUA 4FYDA 1GO3E 4DV7Q 4GLAC 3I4MG 1J6QA 3OIQA 1NE3A 1CSQA 1YNND 5DM63 3OWEB 2V4DA 4A3EG 3X3MA 1Y8NB 1B2TA 3HP3A 2B29A 3EROA 5FO7B 1VQ5A 4JI1L 1HR0L 4KKSA 1XTDA 4LUZA 2E75C 1IKMA 3F2BA 1XMQL 2ZJQA 4M1UB 3MFGA 4C1NK 3S2HB 4RWSC 1Q1EA 3D4RA 1LV9A 4JI3L 2EXZA 3L2PA 4JW0A 4CDFC 3CAMA 4DV4L 3AU7A 1B8AA 5CC4A 1VMCA 3NBHB 2Q8TA 4G7HC 3LNNA 4A3BH 2DJFC 1JB3A 4KK7A 5FKAC 3KBGA 3CW2C 4DA2A 5IT9E 3FMCA 2Z6KA 4F7XA 3LX0A 3RR5A 2H4OA 4JVZA 4K0KQ 2B2WC 2PNHA 1PTOC 1SYGA 1EU4A 1WD1A 1SNDA 1CKOA 2PCFB 1PRTD 4IPCA 1FJGQ 1ZEQX 4NKLA 3W1GA 3T1YQ 2IW3A 5KIXA 4LFAQ 4DFAA 1AE2A 5KEEA 5CR3A 3ULLA 4HIMA 4JI4L 4RHRA 1S5CD 1B9MA 1BBWA 2WKDA 4MHEA 2G5DA 3V96A 2Y0SE 1BKBA 1HQRD 2SEBD 2D0OA 2TSSA 4DV2L 4ZYSA 1FR3A 4IO9A 1N33Q 1CZGA 1GUTA 3H0GH 1QUQB 1G291 5ELCA 1BXTA 3R3OA 1KQSA 2ZJPA 3AYHB 1PTOB 4DAVA 3N6RA 4BXXG 4R4QA 3ONAB 2LKVA 1E1OA 3HOWG 1YNJD 2R7ZG 4XYQA 4DV6L 1CA6A 4JOIA 1IHZA 4HCEA 4DV0Q 2R93H 4XTCS 4R1JA 1HNXL 4M8AA 3HOZH 2R3ZA 2KCNA 4GKKL 4EQOA 5FLMH 1PHJA 3MHBA 3CMAA 1C8CA 1PYWD 3J81E 5EPJA 5I6YA 1FVIA 2JA8B 2A68D 3NWSA 3D0FA 1D5XC 3CQZH 5ELBA 1LTSD 1STBA 4HMIA 1R9TH 2NVTB 2ZM6L 2MGSA 4CDDC 3K7UC 3WDNA 4CDCC 1GKHA 3NUCA 1HH2P 5ELDA 2HCIA 3FDTA 2RVLA 2WAQE 2ZTEA 2L9HA 1TWCB 1NY4A 4R4TA 4Q5VA 4X3SA 1HHVA 2EJFC 1VCIA 4MN3A 4B9XA 1XJVA 1B4OA 3F2UA 4P75A 1GUNA 2R61A 1LT4D 1VQBA 3SK5A 1ICWA 1EYGA 2N3SA 1SYFA 4RGMA 1QE6A 2B2YA 3VR5A 4IFDJ 4BY1H 1DOLA 1B7YB 1F2YA 1RDPD 5EPKA 4V190 2DGYA 2UUBQ 5IGFA 5BR8Q 2M9VA 2WB1B 4K5WA 5I6WA 5IP7G 3OW7A 4FF2A 5E7NA 2B8GA 2K7VA 3R93A 1A3VA 3QB3A 1DOKA 2LXJA 3PSIA 2I5HA 4G57A 4ZRZA 4ZUIA 1O7YA 3CQZB 2I5LX 1Y1WH 2ASBA 2XN9C 2E2HB 1EOVA 2ZT9C 1G6PA 1CKNA 4RGNA 1BDOA 1K9MC 4C1NI 3DM1A 3UDXA 4A3FH 2F0HA 4HSPA 4JOIC 4ZK9B 2RCNA 1PTOD 4HSVA 1Q86C 1VQ4A 2JA5H 5ELNA 1HFNA 4AQYL 1T5EA 3WWVA 1SE8A 2VUMB 2CKZB 3QR8A 3DLLA 4KI0A 4C3IH 3J80L 2QEJC 4BY1B 4JI8Q 1VF7A 2V1CC 2OF1A 1O78A 1T5XD 4AIMA 4OX9Q 5HY6A 2A5HA 3SGIA 1HFGA 3UE0A 4A3BG 1AZPA 1KNAA 2QA4A 2JA7H 1RJTA 1DOMA 2X6LA 1BCPC 1JORA 1Q1BA 5C4HA 3CC2A 3W3AA 1PH5A 1Q90A 1KD1C 5CORA 1EWHA 3CCVA 3NQIA 4GS3A 1TS5A 4A3JG 3VYSA 1VQKA 1L1OC 4KJOA 1IL2A 4L5QA 1AH9A 1JR0D 5ELFA 1I4GA 1NNXA 2XRQD 5C3WA 2B2UA 1K8MA 2B2YC 2VW9A 5C5MA 4A3FB 1CHPD 1RD9D 1N8RC 1STAA 3CCSA 5ELEA 1JMCA 2F0UA 2EJMA 3RD4A 1WI5A 1BCPB 2JA5B 1NR2A 3H0GG 4CDEC 2F0VA 1LT5D 1OXXK 2PO4A 1II3A 2HCCA 2UU9L 2N88A 1TY2A 1SNQA 3F2CA 4A3MH 1L1OB 4IUTA 4QJFA 3HOYH 2K4KA 2NZ1D 1VQEA 4FO2A 1SNMA 3PMFA 3CCQA 1CUKA 2OEOA 2A74C 3CPWA 4MIUA 2RSNA 4YHHL 2R93G 1DYQA 3W2DA 1E3PA 3HOZG 3TSSA 1JWSD 3R2TA 1QJOA 1FGUA 3UDGA 3URYA 2BDNA 1PLFA 5FJ8H 2E8GA 1VQOA 3PUVA 3LGJA 4L5SA 2R92G 1A2UA 1LYLA 3RZOH 1TR5A 1OTCA 2CFMA 3MXNA 4A3LH 4R9WA 1PH8A 1M8AA 2E5LL 5D3DA 3T56B 2EYHA 1CKNB 4ZLTF 5C44H 4CJ1B 5CMDA 3OTOL 4MNOA 2B63H 4EQNA 4DR1Q 1E7ZA 1CT1D 4J8QA 2WFWA 5HGQA 4HCSA 3RNUA 3E0EA 4QCLA 3STBC 1BQQT 4QQBX 2MNAA 3F8TA 4HEDA 1ILQA 1QWYA 2OTLA 1QCBD 3P75A 4HJ8A 4A3MB 3NXWA 4BY1G 2A6EC 3PIPA 2O5JC 4BA1I 1A2TA 1H9JA 3CXCA 5IWAL 3PUXA 3PO3B 1I4HA 4OL7A 1Q81C 1TS4A 1ENCA 2B2UC 4KN4C 1OXTA 2K01A 1M1KC 3J7A5 1A3TA 2K52A 1YJNA 4WRDA 3MAQA 2D9UA 2EYOA 2X6GA 2NUCA 4RKLA 3HOXH 1RKNA 1WFQA 5C4XH 2IPKD 5FO9B 5I2YA 5KRUA 1Y1WG 2YU9B 3RZOB 1IW7D 3J7ZC 4X62Q 2VS1A 5LMUL 4RFBA 5AJ3L 4A3FG 2FXQA 2ZTCA 3BVGA 4DUYQ 3AB9A 3PF5A 4DUZL 3SHLA 4DV0L 1BOSA 2JA5G 2JK8A 2JXMB 4DR3Q 4HAEA 1IXRA 3EJIA 3LWEA 2ICIA 2E2JH 1EY9A 2JA6H 3T51B 3BJUA 4C3IG 3DXJC 5LMNQ 4B3TL 2RHSB 4HMJA 1EOTA 5CV6A 1XMOQ 3TBIB 1QZGA 1TS3A 2LMCB 4PNYA 4PV1C 3I2ZA 2D2CC 3MVVA 1GUWA 3VYRA 3IFTA 1XNRQ 4LFBQ 3FPUB 2FMCA 4B9WA 2JA7G 1EFWA 4A3IH 1NBWA 3S1MB 3K58A 3NTIA 3GTLB 2HDLA 2Q2TA 5EKLA 2KA7A 1EQVA 2ZXRA 4KY5A 2D0PA 2EYFA 3DUZA 3U4ZA 3NE5B 4NDXA 1VQ6A 1B1ZA 4L6TB 1KAAA 2RDGA 1LT3D 3C1FA 3OSOA 4DAYB 2HIVA 1MGSA 2OWOA 1BUVT 5JAVA 1KDAA 3K8AA 2F0MA 2VQFQ 1J5EQ 1PH9A 3PIO3 3GTQH 3A56A 5IE8A 4I7AA 4NP5A 1TWFH 1FNVA 2IX1A 1G91A 3I70A 3N52A 5FO8B 2UUCL 2K03A 4JI0Q 4IFDG 4DR7L 1I50B 3A8IE 3IKJA 5LMNW 3IL8A 4LFCQ 1X55A 1X3QA 3HOYG 1QVCA 1K83H 1KAWA 3H3VC 2LY7A 3S16H 4GNXA 1SYDA 5E3FA 1LTGD 1J8IA 4JC0A 3M4OH 2RQXA 4K2LA 2RDHA 1E0BA 4TRDA 4X66Q 2WAQB 4C3JH 3M4PA 1VQIA 1IBKQ 3T1HQ 2A6ED 5C4ZA 2PI2E 1D1IA 4A93G 4RGTA 5JEAJ 1IL8A 4DAPA 1DGSA 3D6CA 4XT1B 1K8GA 3S14H 3GTJB 5DLQE 1IBLQ 2KVMA 4DAMA 2B8FA 1NUCA 4ZQ3A 4A3LG 5G3LF 3QG1A 5FLXE 1DONA 3ZYYX 4JI8L 3CRLC 5C44G 1YHQA 3RLNA 3J7AF 2B63G 4CBVA 1SFOH 3GDEA 4MTNA 1EYDA 1U0LA 4R4CA 4B3SQ 3GTQB 2ID0A 1SRUA 2K5VA 1WJJA 2XRSD 4RCNA 4WORA 4IUQA 5CV7A 2H5XA 1Z6HA 2F0IA 1CFMA 3I56A 4IPHA 3OWFA 4O42A 3HOUB 5A2QL 4KHVA 1MKHA 3U9SA 2ENBA 3K5NA 1YITA 3CF5A 2WV6D 3NBHA 4A3GH 4OGQC 5GAGC 1O7ZA 2YV5A 4PMWA 4C3JB 3K5OA 4CKEA 3RUZA 1WTRA 2YYZA 3K6OA 1BCPF 2K5QA 3S17H 5GAEC 2KECA 3HOXG 3S2DB 2GVBA 3I73A 4K6LA 5C4XG 4BA2I 1JT8A 5T1GA 2BA0A 2F0GA 4EQPA 4EQ5A 3KLWA 1ET9A 5CV4A 4NXNQ 3PUZA 1I3QH 4DR5Q 4L63B 2WIIB 5A2QE 5E1FA 1TT2A 1SFOB 4N8X1 4CJ0B 1PRTB 4DR4Q 4LF7Q 4DK3C 4P71A 1NCVA 1U9RA 1VF5C 1YJWA 1HNZL 1X3PA 4I7ZC 2B2WA 3M4QA 2EYMA 1JB7A 3TZUA 5GQOA 4GKJL 4QIWE 2JA6G 1SXTA 3Q0AA 5T1IA 4ZKBB 4RGOS 4TVAB 5CV5A 2L4NA 4HR7B 5I9PA 5IY0A 3AEVA 1L2FA 1UUPA 3AQQA 3JAMi 4GNXB 2PQAA 2K5HA 2A69D 4IQZA 2FMMA 3DEPA 2A68C 1K73C 5JEAH 2AKWB 1GHJA 4A3IG 1TQOA 5C4JH 2WP8J 2UXDL 1LO5D 5GAHC 4JV5Q 1ILPA 1WTHA 4KKUA 5K36H 5IYDG 1N36Q 1OO9B 2VXWA 1HCZA 1U4MA 1WOCA 2IX3A 3KLSA 4A3KG 4CHTB 3JAMc 4Y52H 3W5OA 3VR3A 1CQFA 5KNBA 1KL9A 1CM9A 4B3RL 1GM5A 4K8JA 5GADC 3KF6A 2B2VA 1TIID 1DM0B 4UAIA 4KJNA 5IP9H 1TU2B 5J3BA 1PH2A 2EYLA 1FL0A 2RBMA 1W6JA 3KUPA 1BF4A 3CRKC 3SK8A 1P16A 1AW7A 1IBMQ 1CKMA 1EL0A 3G71A 2E2IH 1PTOH 3O13A 3A5ZB 1BBXC 4JYAQ 3CD6A 1FGBD 2NVYB 2L0CA 4S3SA 4JPBW 1JJ2A 2ZJRA 1BR9A 3R2IA 4LF6Q 1ET6A 4X3TA 2F52A 5CV9A 4NXMQ 1WD0A 1CK1A 2IL8A 2Q2IA 5C4JB 4X64L 1DCZA 4KMUC 2EY2A 4ILWA 4L5TA 1X65A 1PZJD 1HTLD 3VA7A 1VQGA 3K57A 5EGTA 2JA8H 4IUUA 4C2MB 2HDMA 4ALPA 4BBSB 3HKZB 4JBKA 4XQNA 2NVTH 1XMOL 1VDZA 1Z9FA 2AWOA 3E3XA 3C46A 2F0KA 1R4PB 4LFBL 1TWCH 5L37A 2M00A 3HG9A 5IGEA 1WTOA 1N34L 3CKIB 3K7AB 2C35B 2RCFA 4XDXA 2KCCA 3E9HA 4KHPL 4DV1Q 3NWTA 1V1OA 1EZ8A 1TWHB 1E24A 2E2IB 5J22A 2AUJD 3M4YA 1N9WA 3GTPB 4N9PA 4LF5Q 2QW7A 4DV5Q 1AEXA 1YHAA 1Y1VB 2SDFA 4A3GG 3QOJA 5LHY1 2PQAB 1D1KA 4LF4Q 2L55A 2B2VC 4PZ7A 3BZCA 3HS0C 1EUJA 1B3AA 5IYCH 5E4XA 1I4RA 3TEHB 4GZYC 4DR6Q 3MC0B 2AUKA 3ND9A 4LFCL 4FDBA 2E2HH 2AWNA 3OMCA 3ULJA 1BVSA 2UXCQ 2A73B 4O1NA 1LTID 4G7OC 3KF6B 1I6VC 1X3EA 3OYYA 5JJKA 2IT1A 2KOLA 4F88A 1UEBA 2CH4A 4XT3B 1CA5A 3I4NB 1LM0A 2D5DA 3MWYW 4PMBA 2Z8LA 5I2XA 1L1OA 2HHHQ 1D8LA 2VUMH 4ODGA 1Q3LA 1HNWL 1GUSA 2VQEL 1QB5D 2K5DA 1FYCA 5BN3A 2F0DA 1W6KA 4E6IA 1F9SA 5IYBG 2MQHA 4QF4A 5KYLA 4JI6L 4Y7NH 4IOAA 5JEAG 2VL6A 5M3MH 4AYBB 2OQKA 4B3SL 3CCUA 3X3NA 4WJ4A 5K36G 3MXPA 2L11A 4IPDA 3NEMA 2KENA 1EZ6A 5HURA 3GV3A 2VZAA 4RH6A 2O4XA 4APVA 1GUOA 4IALA 2EXDA 4KHZA 1EU3A 1SYEA 4GOPC 1PH6A 4PZ6A 3RMHA 4FXKC 1R4QB 2J7ZA 4Q0FA 5IP9G 1L0WA 3TDQA 1LTRD 1X32A 3I72A 3D31A 1GOZA 3HKSA 2AMCB 1NSNS 4C3HH 3P1HA 3F1ZA 1I94Q 1HUMA 2Q8RE 4DNIA 4A76A 4FXDA 2OTJA 2N8NA 3BZKA 1K3BC 5D3IB 1RIPA 2K5NA 1TWAH 1EY7A 2F0FA 3TP8A 2UXBQ 3EN2A 3V05A 4Y7NB 3HEJA 3CMEA 4X6AH 3FHWA 2MUYA 5NUCA 3NP8A 5M3MB 5K5PA 1U4PA 3KLSX 1IW7C 5I4DA 1NAPA 1SROA 1Z7TA 1HRJA 3PO2H 4WJ3M 1PRTF 2KUMA 3MEHA 5C0XH 3HOVH 1PYBA 4IJHA 2OQ0A 2F4VQ 1V8QA 2JA8G 5M5WB 5F2DA 2KJXA 3A8JE 1VQLA 2F0WA 4DR2L 2CVRA 1QNUA 1RODA 1VQAA 3OHXC 4JI2Q 4LF8L 1HPCA 1V1PA 3J80E 1PH3A 2JYOA 5I9OA 1G2SA 2J0TD 4L5RC 4IUNA 4WFN3 1YVCA 4LUVA 3SEBA 4HIKA 2PPBC 4C3HB 3T53B 3E5SA 1PV4A 3NSWA 2EQSA 3C1EA 3RN5A 2CWAA 3QWNA 1QZHA 1L0XB 1TWAB 1D6EC 2CW0C 2J4XA 3MXGA 1VQNA 4DN4M 1XXGA 4H0LC 2NN6H 3PO3H 1D7QA 1N32Q 1UEAB 1S5BD 5H1SE 2JE6I 4DV7L 4AYBG 2WB1G 1XYIA 2VB2X 4CGYB 3D6WA 5FLMG 3PO2B 4OWXB 3HOVB 4BBRB 1Z47A 1IYJB 4LUOA 1CSPA 2CH4W 2KQ3A 2DY7A 2I07B 2RF4A 1XPOA 3BVMA 1ML0D 2YU9H 2ATWA 4DAYA 3U58A 1M4VA 3FPPA 3VR4A 4KD3A 3GP7A 3A0JA 3S1NH 5JVG3 4POGA 4A3DH 2BCOA 3ER0A 5IT9c 3JAML 4R8IA 1B9NA 4A75A 5EPLA 3PIP3 3EBEA 2F0OA 1UWVA 2VUMG 1JOOA 2Z0SA 4R4OA 3GD7A 1UE1A 4KKTA 4K0KL 4F87A 1A3UA 3GQBA 3GTKB 5KNDA 1F77A 2NTSA 1FJGL 1LTAD 3KK7A 3T1YL 1UE5A 1CQVA 5M3MG 1BBUA 4LFAL 3CCMA 1W2BA 3UE1A 1CHQD 4IN3A 4CKBA 2HQEA 4JI7Q 3S1MH 2F0LA 1PZKD 3GTLH 1N33L 2Z6BA 2C9OA 1D5ZC 1X9NA 3J81i 2LSSA 3FRPB 3H91A 3I91A 1PTOF 3PQIA 4YCWA 2VNUD 4FXGC 2MHVA 1PZID 5JVH3 5JOBA 4IOCA 5CYUA 4QUCA 3S1NB 1C0AA 1SE4A 4RAUC 1MSGA 1V1PB 3BDOA 3MA2B 4A3DB 2XWJB 1X56A 3A5UA 4JI1Q 1HR0Q 2HIXA 1SJED 4DXGA 3BU2A 4RG1A 1XMQQ 1ENAA 1HA6A 3J81c 1I50H 1ASYA 4UP7A 1T9HA 2NZOA 1XNQQ 2AHOB 4C56C 3QIAA 3EIVA 4OONA 1MHWC 4JI3Q 1EY8A 1X6OA 1JCKB 4DV4Q 3K59A 3CCEA 2B2TC 2UXCL 3KLRA 4DF7A 5J1ZA 2R6GA 2CQAA 4JBJA 1VQPA 3VYTA 2QILA 4YCVA 3RLOA 5KNCA 3PO2G 5C0XG 2Y0SB 2CW0D 2PW5A 2NBFA 1H95A 1F2MA 2OCEA 5BN4A 2HHHL 1XPUA 3H3VH 3GTJH 1ENFA 5C0XI 4YWLA 4JI4Q 1E2VA 3TQYA 4MTKA 4X3UA 2PMZE 4DV2Q 2Z1CA 4KTAA 2YTVA 3V2TA 3NQTA 1ONLA 3E6ZX 1IZ6A 3A55A 1HR0W 2QGQA 1WVLA 2UUBL 1Q12A 2XIWA 5BR8L 1J9OA 4GN4B 3J81j 2EPBA 2EOTA 1JE5A 1S72A 2A69C 2WACA 1VQ9A 4PG3A 1JWMD 2EYJA 4K5VA 4A3MG 1HZAA 1KNEA 1YHBA 4DNTB 4UY8C 3HOUH 4DV6Q 4N8FA 4L8JA 4NB3A 4BY7H 3KBXA 3C2PA 4RKBA 4MZ9A 3PO3G 2Q8IB 4GKKQ 2DY8A 1PA6A 1PXUA 1SAPA 3PIOA 5C3EB 2X69A 1WTVA 2R7FA 2NN6I 1E2ZA 1KDCA 3DM3A 1FNWA 4LAAA 5FJ8G 3S2DH 2ZM6Q 4P73A 2A8VA 2PZUA 4PZ8A 4UP9A 3D4DA 2RDFA 1G2TA 2MP1A 3ERQA 2L1BA 1WTQA 3DWQA 4LWCA 1IYVA 3NENA 3QO2A 1JE4A 4OX9L 4A3DG 5EAYA 2K14A 1YZ6A 5DNFA 3PGZA 4BS9A 3H6MA 5C6AA 1S4ZA 3MEFA 1PFMA 1I4XA 2K75A 4JG2A 4YWKA 4HJAA 3S15H 4BY7B 2PNRC 1A15A 4NMZA 3I4MB 5IGDA 4ZCKA 2VB3X 1XWEA 3EA6A 3DHQA 3I8ZA 1JOQA 3UI2A 4A3EB 3FEWX 5KGUA 2F03A 1EYCA 3CC7A 2SNMA 2Y0SG 4H13C 4H7BA 3I4OA 4K2KA 1HXYD 2FFKB 2JJQA 2IHEA 2PZTA 4BXXH 4YIJA 1XPRA 3IAYA 2LXKA 4KLKA 3KF8A 5JJLA 3GTMB 3HOWH 4TSSA
chains in the Genus database with same CATH topology
3CC2A 1PH5A 1N9WA 1SR3A 2MFIA 1KD1C 1GVPA 3CCVA 4HJ5A 4LF5Q 4DV5Q 1KRSA 2JEBI 1YHAA 5C3EH 4GS3A 2B3GA 4AQYQ 1G51A 3ULPA 3JC66 4A3JG 1L1OC 4BBRG 1VQKA 3HOVG 2KCMA 1IL2A 4L5QA 4A3GG 1RL2A 3L0OA 1AH9A 2PQAB 4LF4Q 1TXYA 4PZ7A 1PH7A 3BZCA 2VW9A 3KJOA 1N8RC 3CCSA 1EQQA 1JMCA 1EUJA 4QL5A 4B3MQ 1PYSB 4JBWA 1V43A 1WI5A 5IYCH 3H0GG 3TEHB 1K3RA 1E22A 1N34Q 1OXXK 2NVYH 4DR6Q 4LFCL 1VS0A 2F3IA 2YTYA 4FDBA 3CPFA 4UPAA 2UU9L 4KHPQ 3F2CA 4A3MH 1L1OB 2E2HH 5GROA 2AWNA 5IYDH 3ULJA 2WAQG 1BVSA 4QJFA 4R4IA 2K4KA 3HOYH 2UXCQ 4DR1L 1VQEA 3PUYA 3CCQA 3KF6B 2N49A 1X3EA 3OYYA 4A3KH 1CUKA 2IT1A 1QVGA 5JJKA 2CWPA 3CPWA 1A63A 1V9PA 1JJCB 2Q2HA 4YHHL 1UEBA 1C7YA 3TS2A 2R93G 1UE6A 3MXNB 4BBSH 1E3PA 3HOZG 1EIFA 1LM0A 4C2MH 4DPGA 2NN6G 2R7DA 1Q46A 1FGUA 3UDGA 1L1OA 4AYBE 1HNXQ 1D8LA 2HHHQ 3I4MH 1S3OA 2WB1E 5M3FG 2VUMH 1MJCA 3GO5A 3W1BA 2VQEL 1HNWL 4A3EH 5FJ8H 2I0QA 2E8GA 3H3VI 1VQOA 1VQHA 3PUVA 3I55A 4JBMA 3LGJA 5IYBG 4L5SA 2MQHA 2MO0A 2R92G 1LYLA 3UDFA 3H15A 4Y7NH 4JI6L 3RZOH 1OTCA 4IOAA 2CFMA 4A3LH 3TREA 1K0RA 3G6EA 2UU9Q 1PH8A 1VQJA 2E5LL 1W3SA 5JEAG 4JI7L 3U50C 2VL6A 3K7AH 3ZJYC 5M3MH 4IFDI 1VQMA 1CKNB 2CQOA 5C44H 1I94L 3OTOL 2OQKA 3PV0A 4MNOA 4B3SL 3CCUA 4DR1Q 2B63H 4WJ4A 2CCZA 1A62A 2I5MX 3GTMH 5K36G 1TWHH 3STBD 3HOUG 1WCMG 4LF9Q 5JJIA 1E7ZA 3NEMA 2KENA 4IPDA 2VZAA 3NELA 2WFWA 4YHHQ 3GTGH 5HGQA 1SMXA 3RNUA 3GTPH 3E0EA 2UXBL 4APVA 3STBC 2EXDA 4QQBX 4KHZA 1Y1VH 4X62L 2MNAA 3F8TA 4A3CH 4GOPC 1HJPA 3J80i 3S1RH 1PH6A 2OTLA 1PVOA 4PZ6A 4HJ8A 1YEZA 4YCUA 3CC4A 1X3GA 3KFUA 2GN5A 1I5FA 4BY1G 4DUYL 1HNWQ 2VQEQ 3PIPA 4BA1I 1L0WA 5IP9G 1E1TA 3CCJA 1NJIC 3CXCA 2GVAA 5IWAL 3PUXA 2F4VL 2ALYB 2L15A 3KDFA 4P72A 4DR3L 4JI6Q 1HZBA 3D31A 3S1QH 2Q2UA 1NMFA 1Q81C 3E9IA 1PFSA 3HKSA 1YIJA 2E5LQ 1K8AC 2AMCB 4C3HH 4JI2L 1XNQL 3A74A 1OXTA 3F1ZA 3FKIH 4ME3A 1I94Q 3OTOQ 5LMNL 3J80c 1M1KC 4DNIA 4A76A 3J7A5 2K52A 3KF8B 5M5YH 1YJNA 2OTJA 2N8NA 3BZKA 3L7ZC 1MIUA 3KYHC 1YBYA 1RIPA 2K5NA 3HOXH 1TWAH 1WFQA 5C4XH 4X65Q 2UXBQ 3EN2A 3TS0A 3F2DA 1Y1WG 1XNRL 2MO1A 3J7ZC 4X62Q 3CMEA 2NVQH 3FHWA 2VS1A 4X6AH 5LMUL 2PI2A 3KOJA 5AJ3L 4A3FG 3I4NH 2K50A 2FXQA 2ZTCA 4DUYQ 1SROA 2NVXH 3PF5A 4DUZL 1NTGA 2UUAL 2HT1A 3PO2H 4GOPA 4WJ3M 4YY3Q 4DV0L 4A3JH 3HOVH 1JJGA 1PYBA 2R7ZH 3HFZB 4IJHA 5IWAQ 2JK8A 2OQ0A 3M85A 1KC8C 1MJEA 2JA5G 2F4VQ 2JA8G 4DR3Q 3OW2A 1VQLA 4QGUA 4BBSG 4HIDA 2A1AA 1IXRA 4DR2L 3M3YH 2KCTA 3RN2A 1N32L 1VQAA 4JI2Q 2E2JH 4LF8L 2JA6H 3BJUA 3K81C 3G48A 5LMNQ 1EIYB 4B3TL 1V1QA 2RHSB 1OXVA 1XMOQ 2VQFL 1J5EL 1QZGA 2RHQB 3I2ZA 1PH3A 2VY3A 4JI5Q 3U4VA 4L5RC 4EX5A 2BA1A 4JI0L 3K80C 1XNRQ 2XGTA 4LFBQ 1YVCA 1M90C 4LUVA 5LMUQ 4J15A 4HIKA 1EFWA 2JA7G 2HQLA 1PV4A 4A3IH 1NBWA 4GNXC 5AJ3Q 5C0XJ 2KBNA 1X3FA 1KHIA 2Q2TA 4DUZQ 1LTLA 2EQSA 1SLJA 3RN5A 2CWAA 4POFA 1QUQA 5ELOA 3G4SA 1QZHA 2D0PA 2XTIA 5C3EG 1VQNA 3U4ZA 4DKAC 2JA9A 1VQ6A 3ERSX 2QEXA 4DR2Q 3PO3H 2BH2A 1D7QA 4X66L 1AE3A 1N32Q 3M7NA 3S2HH 4DAYB 5H1SE 1EWIA 4LF8Q 2HIVA 2JE6I 4DV7L 4AYBG 1IBKL 2OWOA 3Q8DA 4B3TQ 2WB1G 3T1HL 3K8AA 2VQFQ 1J5EQ 1B70B 2EIFA 5FLMG 4XIGS 1PH9A 4IJLA 1NMGA 1O7IA 5IE8A 5IYBH 4OWXB 2R92H 3GTQH 3I7FA 3PF4A 1TWFH 2IX1A 1Z47A 2A19A 1IYJB 4LUOA 1CSPA 2UUCL 4JI0Q 1UE7A 5FLXc 2RF4A 1LUZA 2ZTDA 1IBLL 4IFDG 4DR7L 1XPOA 3CCRA 1QVFA 5LMNW 2YU9H 2ATWA 3ICEA 4LFCQ 3U58A 1X55A 3IRBA 5IP7H 4DV3L 3HOYG 1QVCA 1K83H 1KAWA 1WYDA 3A0JA 3S1NH 2IHFA 4POGA 2YTXA 3B6YA 4GNXA 3S16H 1Y14B 1VQDA 1I6HH 4A3DH 1YJ9A 4JC0A 3M4OH 3ER0A 4A4IA 1VQ8A 1KXLA 5IT9c 2Z6KC 3KDFB 5M5WH 1X54A 4X66Q 4BY7G 4C3JH 1C9OA 1GO3E 4A75A 4DV7Q 3M4PA 1VQIA 2BH8A 4GLAC 1J6QA 3EBEA 3HKZG 3T1HQ 1NE3A 1UWVA 1IBKQ 1CSQA 2VUMG 2PI2E 4UP8A 2Z0SA 4A93G 4A3EG 4R4OA 3GD7A 1UE1A 4K0KL 5JEAJ 4HJ9A 1DGSA 2B29A 2UUCQ 1K8GA 1VQ5A 3S14H 5DLQE 4JI1L 1HR0L 4DAMA 1IBLQ 1XTDA 4LUZA 4DR7Q 4A3LG 2JQOA 3F2BA 4HIOA 1XMQL 2ZJQA 1FJGL 3T1YL 1UE5A 5M3MG 1BBUA 4JI8L 3CCMA 1W2BA 3UE1A 4O2DA 5C44G 3RLNA 3M9BA 1YHQA 4LFAL 2B63G 1Q1EA 4JI7Q 2IX0A 1PH1A 1SFOH 3GDEA 1VQFA 3S1MH 4MTNA 3GTLH 3PUWA 4JI3L 1U0LA 4R4CA 3UDIA 4B3SQ 1N33L 3L2PA 2ID0A 1SRUA 3AFPA 4GOPB 2K5VA 3CAMA 4DV4L 1WJJA 1B8AA 4GLVB 3NBHB 1X9NA 3J81i 2LSSA 1Y1VG 4A3CG 4A3BH 4NXNL 3CW2C 2H5XA 4YCWA 2VNUD 3I56A 4DR5L 4IPHA 2Z6KA 2JEAI 3RR5A 1OXUA 4IOCA 1MKHA 2KHIA 1C0AA 4K0KQ 2PNHA 4GLXA 1YITA 4DR4L 4RMFA 4LF7L 3CF5A 1X56A 3A5UA 4JI1Q 1HR0Q 1CKOA 2HIXA 4BBRH 3RZDH 3BU2A 4IPCA 4RG1A 5GAGC 1XMQQ 1FJGQ 5M5XH 4OWTB 4A3GH 3T1YQ 3W1GA 1Q8KA 3J81c 2YV5A 4PMWA 4LFAQ 1I50H 3FKIG 1ASYA 4UP7A 1AE2A 4HIMA 1T9HA 3ULLA 4B3ML 4JI4L 2NZOA 1XNQQ 2AHOB 1BBWA 2YYZA 4YWMA 3EIVA 4OONA 2Y0SE 1BKBA 4DV2L 4DK6C 1X6OA 2D0OA 5GAEC 3HOXG 4IO9A 2GVBA 4HJ7A 1N33Q 5C4XG 4BA2I 3FP9A 4DV4Q 1JT8A 3H0GH 4O0AA 1QUQB 1G291 2BA0A 3CCEA 4AH6A 1KQSA 2ZJPA 4EQ5A 3AYHB 3KLWA 4BXXG 2UXCL 4NXNQ 4OO1G 3PUZA 1I3QH 4R4QA 1KRTA 3I4NG 4DR5Q 2R6GA 1A8VA 4JBJA 1VQPA 4JV5L 4YCVA 3RLOA 3PO2G 1E1OA 1N36L 2NZHA 5C0XG 3HOWG 2R7ZG 1PH4A 4IPGA 1P8LA 4DV6L 2UUAQ 4JOIA 4DR4Q 1H95A 4LF7Q 4DK3C 4DV0Q 4OO1I 1HZ9A 4P71A 3CCLA 2R93H 1YJWA 1HNZL 4XTCS 2OCEA 4R1JA 1HNXL 2HHHL 1XPUA 3GTKH 3H3VH 3GTJH 3HOZH 3M4QA 1EQRA 1JB7A 4GKKL 5GQOA 5C0XI 4QIWE 4GKJL 2JA6G 5FLMH 4YWLA 3I4MG 1PHJA 4JI4Q 3CMAA 4TVAB 2ES2A 3TQYA 5M3FH 1FVIA 2PMZE 5IY0A 4DV2Q 3AEVA 1L2FA 2YTVA 3AQQA 3CQZH 1IZ6A 3D0FA 1HZCA 3RLFA 2QGQA 1HR0W 2UUBL 1Q12A 3JAMi 4GNXB 1R9TH 5BR8L 2PQAA 2K5HA 2ZM6L 5IYCG 4JI3Q 1K73C 3K7UC 3CP0A 4OXPA 1IBML 4GN4B 3J81j 1GKHA 1HH2P 2AKWB 4A3IG 1JE5A 2KHJA 2WP8J 5C4JH 1S72A 2UXDL 1VQ9A 2WAQE 2ZTEA 4LF9L 4PG3A 5GAHC 4JV5Q 4A3MG 1HZAA 1NY4A 4R4TA 1YHBA 5IYDG 1N36Q 4UY8C 3HOUH 4JYAL 1WCMH 1WOCA 4DV6Q 1A0IA 1GD7A 1VCIA 4NB3A 4BY7H 4A3KG 1XJVA 4LF6L 1HNZQ 3JAMc 4P75A 2D62A 4MZ9A 3W5OA 3PO3G 4Y52H 1KL9A 1VQBA 4NXML 4GKKQ 4GKJQ 4A93H 4B3RL 1U5KA 2N3SA 1EYGA 1GM5A 1PA6A 5GADC 1KIXA 4IFDJ 3KF6A 4BY1H 4NPSA 3PIOA 3PCOB 5IP9H 1VQ7A 1B7YB 2R7FA 2N78A 2NN6I 5J3BA 1PH2A 3DM3A 1FL0A 4LNQA 2DGYA 2UUBQ 5FJ8G 5BR8Q 3S2DH 2ZM6Q 4P73A 4TQUS 2A8VA 1P16A 1IBMQ 4UP9A 4LW1A 4PZ8A 1CKMA 1S40A 3G71A 5IP7G 2E2IH 2UXDQ 1OXSC 5E7NA 1YI2A 4LWCA 3A5ZB 3AFQA 2LXJA 3NENA 3PSIA 2I5HA 4X65L 4DV3Q 4OWWB 4JYAQ 4OX9L 3CD6A 4A3DG 5EAYA 2I5LX 4QY7A 2K14A 3KJPA 1JJ2A 1YZ6A 2ZJRA 1VQCA 1Y1WH 3PGZA 4LF6Q 4H02A 2ASBA 1EOVA 1G6PA 2F52A 1CKNA 3HKZE 4NXMQ 4GN3B 1K9MC 4DV1L 3MEFA 2Q2IA 4B3RQ 3UDXA 4X64L 4YY3L 4A3FH 2K75A 4JG2A 4L5TA 1Q82C 4YWKA 1X65A 4JOIC 2RCNA 1VQGA 4P74A 4GN5A 4HJAA 1VQ4A 1Q86C 1Q7YC 3GTOH 2JA5H 4LF5L 4DV5L 5ELNA 2JA8H 3S15H 3K0XA 4AQYL 3WWVA 4ALPA 1SE8A 3VDYA 4JBKA 2NVTH 2CKZB 3DLLA 1XMOL 4LF4L 4KI0A 1Z9FA 2AWOA 4C3IH 4JI5L 4JI8Q 3CC7A 2V1CC 2Y0SG 2DUDA 1SN8A 1ASZA 4AIMA 3I4OA 4OX9Q 5HY6A 4LFBL 1TWCH 1TWGH 4JCVE 3SGIA 2JJQA 2IHEA 4BXXH 1YNXA 1XPRA 1N34L 3UE0A 2C35B 4DR6L 3E9HA 4KHPL 2LXKA 3S17H 4KLKA 4A3BG 2QA4A 2JA7H 2IY5B 4DV1Q 5JJLA 4X64Q 1E24A 3HOWH 3TRZA 1Q1BA 3S24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 A;  1PH5 A;  1N9W A;  1SR3 A;  2MFI A;  1KD1 C;  1GVP A;  3CCV A;  4HJ5 A;  4LF5 Q;  4DV5 Q;  1KRS A;  2JEB I;  1YHA A;  5C3E H;  4GS3 A;  2B3G A;  4AQY Q;  1G51 A;  3ULP A;  3JC6 6;  4A3J G;  1L1O C;  4BBR G;  1VQK A;  3HOV G;  2KCM A;  1IL2 A;  4L5Q A;  4A3G G;  1RL2 A;  3L0O A;  1AH9 A;  2PQA B;  4LF4 Q;  1TXY A;  4PZ7 A;  1PH7 A;  3BZC A;  2VW9 A;  3KJO A;  1N8R C;  3CCS A;  1EQQ A;  1JMC A;  1EUJ A;  4QL5 A;  4B3M Q;  1PYS B;  4JBW A;  1V43 A;  1WI5 A;  5IYC H;  3H0G G;  3TEH B;  1K3R A;  1E22 A;  1N34 Q;  1OXX K;  2NVY H;  4DR6 Q;  4LFC L;  1VS0 A;  2F3I A;  2YTY A;  4FDB A;  3CPF A;  4UPA A;  2UU9 L;  4KHP Q;  3F2C A;  4A3M H;  1L1O B;  2E2H H;  5GRO A;  2AWN A;  5IYD H;  3ULJ A;  2WAQ G;  1BVS A;  4QJF A;  4R4I A;  2K4K A;  3HOY H;  2UXC Q;  4DR1 L;  1VQE A;  3PUY A;  3CCQ A;  3KF6 B;  2N49 A;  1X3E A;  3OYY A;  4A3K H;  1CUK A;  2IT1 A;  1QVG A;  5JJK A;  2CWP A;  3CPW A;  1A63 A;  1V9P A;  1JJC B;  2Q2H A;  4YHH L;  1UEB A;  1C7Y A;  3TS2 A;  2R93 G;  1UE6 A;  3MXN B;  4BBS H;  1E3P A;  3HOZ G;  1EIF A;  1LM0 A;  4C2M H;  4DPG A;  2NN6 G;  2R7D A;  1Q46 A;  1FGU A;  3UDG A;  1L1O A;  4AYB E;  1HNX Q;  1D8L A;  2HHH Q;  3I4M H;  1S3O A;  2WB1 E;  5M3F G;  2VUM H;  1MJC A;  3GO5 A;  3W1B A;  2VQE L;  1HNW L;  4A3E H;  5FJ8 H;  2I0Q A;  2E8G A;  3H3V I;  1VQO A;  1VQH A;  3PUV A;  3I55 A;  4JBM A;  3LGJ A;  5IYB G;  4L5S A;  2MQH A;  2MO0 A;  2R92 G;  1LYL A;  3UDF A;  3H15 A;  4Y7N H;  4JI6 L;  3RZO H;  1OTC A;  4IOA A;  2CFM A;  4A3L H;  3TRE A;  1K0R A;  3G6E A;  2UU9 Q;  1PH8 A;  1VQJ A;  2E5L L;  1W3S A;  5JEA G;  4JI7 L;  3U50 C;  2VL6 A;  3K7A H;  3ZJY C;  5M3M H;  4IFD I;  1VQM A;  1CKN B;  2CQO A;  5C44 H;  1I94 L;  3OTO L;  2OQK A;  3PV0 A;  4MNO A;  4B3S L;  3CCU A;  4DR1 Q;  2B63 H;  4WJ4 A;  2CCZ A;  1A62 A;  2I5M X;  3GTM H;  5K36 G;  1TWH H;  3STB D;  3HOU G;  1WCM G;  4LF9 Q;  5JJI A;  1E7Z A;  3NEM A;  2KEN A;  4IPD A;  2VZA A;  3NEL A;  2WFW A;  4YHH Q;  3GTG H;  5HGQ A;  1SMX A;  3RNU A;  3GTP H;  3E0E A;  2UXB L;  4APV A;  3STB C;  2EXD A;  4QQB X;  4KHZ A;  1Y1V H;  4X62 L;  2MNA A;  3F8T A;  4A3C H;  4GOP C;  1HJP A;  3J80 i;  3S1R H;  1PH6 A;  2OTL A;  1PVO A;  4PZ6 A;  4HJ8 A;  1YEZ A;  4YCU A;  3CC4 A;  1X3G A;  3KFU A;  2GN5 A;  1I5F A;  4BY1 G;  4DUY L;  1HNW Q;  2VQE Q;  3PIP A;  4BA1 I;  1L0W A;  5IP9 G;  1E1T A;  3CCJ A;  1NJI C;  3CXC A;  2GVA A;  5IWA L;  3PUX A;  2F4V L;  2ALY B;  2L15 A;  3KDF A;  4P72 A;  4DR3 L;  4JI6 Q;  1HZB A;  3D31 A;  3S1Q H;  2Q2U A;  1NMF A;  1Q81 C;  3E9I A;  1PFS A;  3HKS A;  1YIJ A;  2E5L Q;  1K8A C;  2AMC B;  4C3H H;  4JI2 L;  1XNQ L;  3A74 A;  1OXT A;  3F1Z A;  3FKI H;  4ME3 A;  1I94 Q;  3OTO Q;  5LMN L;  3J80 c;  1M1K C;  4DNI A;  4A76 A;  3J7A 5;  2K52 A;  3KF8 B;  5M5Y H;  1YJN A;  2OTJ A;  2N8N A;  3BZK A;  3L7Z C;  1MIU A;  3KYH C;  1YBY A;  1RIP A;  2K5N A;  3HOX H;  1TWA H;  1WFQ A;  5C4X H;  4X65 Q;  2UXB Q;  3EN2 A;  3TS0 A;  3F2D A;  1Y1W G;  1XNR L;  2MO1 A;  3J7Z C;  4X62 Q;  3CME A;  2NVQ H;  3FHW A;  2VS1 A;  4X6A H;  5LMU L;  2PI2 A;  3KOJ A;  5AJ3 L;  4A3F G;  3I4N H;  2K50 A;  2FXQ A;  2ZTC A;  4DUY Q;  1SRO A;  2NVX H;  3PF5 A;  4DUZ L;  1NTG A;  2UUA L;  2HT1 A;  3PO2 H;  4GOP A;  4WJ3 M;  4YY3 Q;  4DV0 L;  4A3J H;  3HOV H;  1JJG A;  1PYB A;  2R7Z H;  3HFZ B;  4IJH A;  5IWA Q;  2JK8 A;  2OQ0 A;  3M85 A;  1KC8 C;  1MJE A;  2JA5 G;  2F4V Q;  2JA8 G;  4DR3 Q;  3OW2 A;  1VQL A;  4QGU A;  4BBS G;  4HID A;  2A1A A;  1IXR A;  4DR2 L;  3M3Y H;  2KCT A;  3RN2 A;  1N32 L;  1VQA A;  4JI2 Q;  2E2J H;  4LF8 L;  2JA6 H;  3BJU A;  3K81 C;  3G48 A;  5LMN Q;  1EIY B;  4B3T L;  1V1Q A;  2RHS B;  1OXV A;  1XMO Q;  2VQF L;  1J5E L;  1QZG A;  2RHQ B;  3I2Z A;  1PH3 A;  2VY3 A;  4JI5 Q;  3U4V A;  4L5R C;  4EX5 A;  2BA1 A;  4JI0 L;  3K80 C;  1XNR Q;  2XGT A;  4LFB Q;  1YVC A;  1M90 C;  4LUV A;  5LMU Q;  4J15 A;  4HIK A;  1EFW A;  2JA7 G;  2HQL A;  1PV4 A;  4A3I H;  1NBW A;  4GNX C;  5AJ3 Q;  5C0X J;  2KBN A;  1X3F A;  1KHI A;  2Q2T A;  4DUZ Q;  1LTL A;  2EQS A;  1SLJ A;  3RN5 A;  2CWA A;  4POF A;  1QUQ A;  5ELO A;  3G4S A;  1QZH A;  2D0P A;  2XTI A;  5C3E G;  1VQN A;  3U4Z A;  4DKA C;  2JA9 A;  1VQ6 A;  3ERS X;  2QEX A;  4DR2 Q;  3PO3 H;  2BH2 A;  1D7Q A;  4X66 L;  1AE3 A;  1N32 Q;  3M7N A;  3S2H H;  4DAY B;  5H1S E;  1EWI A;  4LF8 Q;  2HIV A;  2JE6 I;  4DV7 L;  4AYB G;  1IBK L;  2OWO A;  3Q8D A;  4B3T Q;  2WB1 G;  3T1H L;  3K8A A;  2VQF Q;  1J5E Q;  1B70 B;  2EIF A;  5FLM G;  4XIG S;  1PH9 A;  4IJL A;  1NMG A;  1O7I A;  5IE8 A;  5IYB H;  4OWX B;  2R92 H;  3GTQ H;  3I7F A;  3PF4 A;  1TWF H;  2IX1 A;  1Z47 A;  2A19 A;  1IYJ B;  4LUO A;  1CSP A;  2UUC L;  4JI0 Q;  1UE7 A;  5FLX c;  2RF4 A;  1LUZ A;  2ZTD A;  1IBL L;  4IFD G;  4DR7 L;  1XPO A;  3CCR A;  1QVF A;  5LMN W;  2YU9 H;  2ATW A;  3ICE A;  4LFC Q;  3U58 A;  1X55 A;  3IRB A;  5IP7 H;  4DV3 L;  3HOY G;  1QVC A;  1K83 H;  1KAW A;  1WYD A;  3A0J A;  3S1N H;  2IHF A;  4POG A;  2YTX A;  3B6Y A;  4GNX A;  3S16 H;  1Y14 B;  1VQD A;  1I6H H;  4A3D H;  1YJ9 A;  4JC0 A;  3M4O H;  3ER0 A;  4A4I A;  1VQ8 A;  1KXL A;  5IT9 c;  2Z6K C;  3KDF B;  5M5W H;  1X54 A;  4X66 Q;  4BY7 G;  4C3J H;  1C9O A;  1GO3 E;  4A75 A;  4DV7 Q;  3M4P A;  1VQI A;  2BH8 A;  4GLA C;  1J6Q A;  3EBE A;  3HKZ G;  3T1H Q;  1NE3 A;  1UWV A;  1IBK Q;  1CSQ A;  2VUM G;  2PI2 E;  4UP8 A;  2Z0S A;  4A93 G;  4A3E G;  4R4O A;  3GD7 A;  1UE1 A;  4K0K L;  5JEA J;  4HJ9 A;  1DGS A;  2B29 A;  2UUC Q;  1K8G A;  1VQ5 A;  3S14 H;  5DLQ E;  4JI1 L;  1HR0 L;  4DAM A;  1IBL Q;  1XTD A;  4LUZ A;  4DR7 Q;  4A3L G;  2JQO A;  3F2B A;  4HIO A;  1XMQ L;  2ZJQ A;  1FJG L;  3T1Y L;  1UE5 A;  5M3M G;  1BBU A;  4JI8 L;  3CCM A;  1W2B A;  3UE1 A;  4O2D A;  5C44 G;  3RLN A;  3M9B A;  1YHQ A;  4LFA L;  2B63 G;  1Q1E A;  4JI7 Q;  2IX0 A;  1PH1 A;  1SFO H;  3GDE A;  1VQF A;  3S1M H;  4MTN A;  3GTL H;  3PUW A;  4JI3 L;  1U0L A;  4R4C A;  3UDI A;  4B3S Q;  1N33 L;  3L2P A;  2ID0 A;  1SRU A;  3AFP A;  4GOP B;  2K5V A;  3CAM A;  4DV4 L;  1WJJ A;  1B8A A;  4GLV B;  3NBH B;  1X9N A;  3J81 i;  2LSS A;  1Y1V G;  4A3C G;  4A3B H;  4NXN L;  3CW2 C;  2H5X A;  4YCW A;  2VNU D;  3I56 A;  4DR5 L;  4IPH A;  2Z6K A;  2JEA I;  3RR5 A;  1OXU A;  4IOC A;  1MKH A;  2KHI A;  1C0A A;  4K0K Q;  2PNH A;  4GLX A;  1YIT A;  4DR4 L;  4RMF A;  4LF7 L;  3CF5 A;  1X56 A;  3A5U A;  4JI1 Q;  1HR0 Q;  1CKO A;  2HIX A;  4BBR H;  3RZD H;  3BU2 A;  4IPC A;  4RG1 A;  5GAG C;  1XMQ Q;  1FJG Q;  5M5X H;  4OWT B;  4A3G H;  3T1Y Q;  3W1G A;  1Q8K A;  3J81 c;  2YV5 A;  4PMW A;  4LFA Q;  1I50 H;  3FKI G;  1ASY A;  4UP7 A;  1AE2 A;  4HIM A;  1T9H A;  3ULL A;  4B3M L;  4JI4 L;  2NZO A;  1XNQ Q;  2AHO B;  1BBW A;  2YYZ A;  4YWM A;  3EIV A;  4OON A;  2Y0S E;  1BKB A;  4DV2 L;  4DK6 C;  1X6O A;  2D0O A;  5GAE C;  3HOX G;  4IO9 A;  2GVB A;  4HJ7 A;  1N33 Q;  5C4X G;  4BA2 I;  3FP9 A;  4DV4 Q;  1JT8 A;  3H0G H;  4O0A A;  1QUQ B;  1G29 1;  2BA0 A;  3CCE A;  4AH6 A;  1KQS A;  2ZJP A;  4EQ5 A;  3AYH B;  3KLW A;  4BXX G;  2UXC L;  4NXN Q;  4OO1 G;  3PUZ A;  1I3Q H;  4R4Q A;  1KRT A;  3I4N G;  4DR5 Q;  2R6G A;  1A8V A;  4JBJ A;  1VQP A;  4JV5 L;  4YCV A;  3RLO A;  3PO2 G;  1E1O A;  1N36 L;  2NZH A;  5C0X G;  3HOW G;  2R7Z G;  1PH4 A;  4IPG A;  1P8L A;  4DV6 L;  2UUA Q;  4JOI A;  4DR4 Q;  1H95 A;  4LF7 Q;  4DK3 C;  4DV0 Q;  4OO1 I;  1HZ9 A;  4P71 A;  3CCL A;  2R93 H;  1YJW A;  1HNZ L;  4XTC S;  2OCE A;  4R1J A;  1HNX L;  2HHH L;  1XPU A;  3GTK H;  3H3V H;  3GTJ H;  3HOZ H;  3M4Q A;  1EQR A;  1JB7 A;  4GKK L;  5GQO A;  5C0X I;  4QIW E;  4GKJ L;  2JA6 G;  5FLM H;  4YWL A;  3I4M G;  1PHJ A;  4JI4 Q;  3CMA A;  4TVA B;  2ES2 A;  3TQY A;  5M3F H;  1FVI A;  2PMZ E;  5IY0 A;  4DV2 Q;  3AEV A;  1L2F A;  2YTV A;  3AQQ A;  3CQZ H;  1IZ6 A;  3D0F A;  1HZC A;  3RLF A;  2QGQ A;  1HR0 W;  2UUB L;  1Q12 A;  3JAM i;  4GNX B;  1R9T H;  5BR8 L;  2PQA A;  2K5H A;  2ZM6 L;  5IYC G;  4JI3 Q;  1K73 C;  3K7U C;  3CP0 A;  4OXP A;  1IBM L;  4GN4 B;  3J81 j;  1GKH A;  1HH2 P;  2AKW B;  4A3I G;  1JE5 A;  2KHJ A;  2WP8 J;  5C4J H;  1S72 A;  2UXD L;  1VQ9 A;  2WAQ E;  2ZTE A;  4LF9 L;  4PG3 A;  5GAH C;  4JV5 Q;  4A3M G;  1HZA A;  1NY4 A;  4R4T A;  1YHB A;  5IYD G;  1N36 Q;  4UY8 C;  3HOU H;  4JYA L;  1WCM H;  1WOC A;  4DV6 Q;  1A0I A;  1GD7 A;  1VCI A;  4NB3 A;  4BY7 H;  4A3K G;  1XJV A;  4LF6 L;  1HNZ Q;  3JAM c;  4P75 A;  2D62 A;  4MZ9 A;  3W5O A;  3PO3 G;  4Y52 H;  1KL9 A;  1VQB A;  4NXM L;  4GKK Q;  4GKJ Q;  4A93 H;  4B3R L;  1U5K A;  2N3S A;  1EYG A;  1GM5 A;  1PA6 A;  5GAD C;  1KIX A;  4IFD J;  3KF6 A;  4BY1 H;  4NPS A;  3PIO A;  3PCO B;  5IP9 H;  1VQ7 A;  1B7Y B;  2R7F A;  2N78 A;  2NN6 I;  5J3B A;  1PH2 A;  3DM3 A;  1FL0 A;  4LNQ A;  2DGY A;  2UUB Q;  5FJ8 G;  5BR8 Q;  3S2D H;  2ZM6 Q;  4P73 A;  4TQU S;  2A8V A;  1P16 A;  1IBM Q;  4UP9 A;  4LW1 A;  4PZ8 A;  1CKM A;  1S40 A;  3G71 A;  5IP7 G;  2E2I H;  2UXD Q;  1OXS C;  5E7N A;  1YI2 A;  4LWC A;  3A5Z B;  3AFQ A;  2LXJ A;  3NEN A;  3PSI A;  2I5H A;  4X65 L;  4DV3 Q;  4OWW B;  4JYA Q;  4OX9 L;  3CD6 A;  4A3D G;  5EAY A;  2I5L X;  4QY7 A;  2K14 A;  3KJP A;  1JJ2 A;  1YZ6 A;  2ZJR A;  1VQC A;  1Y1W H;  3PGZ A;  4LF6 Q;  4H02 A;  2ASB A;  1EOV A;  1G6P A;  2F52 A;  1CKN A;  3HKZ E;  4NXM Q;  4GN3 B;  1K9M C;  4DV1 L;  3MEF A;  2Q2I A;  4B3R Q;  3UDX A;  4X64 L;  4YY3 L;  4A3F H;  2K75 A;  4JG2 A;  4L5T A;  1Q82 C;  4YWK A;  1X65 A;  4JOI C;  2RCN A;  1VQG A;  4P74 A;  4GN5 A;  4HJA A;  1VQ4 A;  1Q86 C;  1Q7Y C;  3GTO H;  2JA5 H;  4LF5 L;  4DV5 L;  5ELN A;  2JA8 H;  3S15 H;  3K0X A;  4AQY L;  3WWV A;  4ALP A;  1SE8 A;  3VDY A;  4JBK A;  2NVT H;  2CKZ B;  3DLL A;  1XMO L;  4LF4 L;  4KI0 A;  1Z9F A;  2AWO A;  4C3I H;  4JI5 L;  4JI8 Q;  3CC7 A;  2V1C C;  2Y0S G;  2DUD A;  1SN8 A;  1ASZ A;  4AIM A;  3I4O A;  4OX9 Q;  5HY6 A;  4LFB L;  1TWC H;  1TWG H;  4JCV E;  3SGI A;  2JJQ A;  2IHE A;  4BXX H;  1YNX A;  1XPR A;  1N34 L;  3UE0 A;  2C35 B;  4DR6 L;  3E9H A;  4KHP L;  2LXK A;  3S17 H;  4KLK A;  4A3B G;  2QA4 A;  2JA7 H;  2IY5 B;  4DV1 Q;  5JJL A;  4X64 Q;  1E24 A;  3HOW H;  3TRZ A;  1Q1B A;  3S24 A; 
#chains in the Genus database with same CATH topology
 1U4R A;  3GTG B;  1EIG A;  1AN8 A;  1DXM A;  1KRS A;  2JEB I;  4DXF A;  2RKS A;  4AQY Q;  3ULP A;  1G51 A;  3S1R B;  2E74 C;  2F0N A;  2ZXP A;  1PH7 A;  5C3X A;  1KLU D;  2XNA C;  4HTH A;  4B3M Q;  1PYS B;  2L5T A;  2QDB A;  1V43 A;  1BO0 A;  5C5L A;  4DU9 A;  2QKI C;  3S15 B;  1K3R A;  4I65 A;  1E22 A;  1QIL A;  2NVY H;  2QCP X;  3BG3 A;  2YTY A;  3CPF A;  4UPA A;  3SR1 A;  1ESF A;  2WAQ G;  5IGC A;  4DR1 L;  3PUY A;  1JIC A;  1QVG A;  1S5D D;  1A63 A;  1V9P A;  2Q2H A;  3TS2 A;  5EQ0 A;  2NVQ B;  1UE6 A;  3BDL A;  1SE2 A;  1EIF A;  2LS0 1;  4C2M H;  1STY A;  2NVX B;  1NR4 A;  2R7D A;  4DPG A;  1K0S A;  4BBS H;  3HOW B;  2F0E A;  2O5I C;  2AQ3 B;  1MJC A;  3GO5 A;  3W1B A;  2R7Z B;  3D8G A;  3D3R A;  2IWH A;  4PMC A;  3SE0 A;  2EDG A;  3H3V I;  4U67 3;  1RTN A;  4JK1 C;  3J7A V;  3UDF A;  1EYA A;  3TRE A;  2UU9 Q;  4ZKC B;  2MJ8 A;  1VQJ A;  1W3S A;  3MZ5 A;  3K5M A;  4JI7 L;  3U50 C;  3K7A H;  3ZJY C;  4LMQ D;  4FF1 A;  3PV0 A;  3TP6 A;  2CCZ A;  1A62 A;  3SXH A;  1TWH H;  5TSS A;  3HOU G;  4LF9 Q;  3NEL A;  4YHH Q;  3WOE A;  1SMX A;  3GTP H;  5CBE E;  5COY A;  5IT9 L;  1STH A;  1Y1V H;  4X62 L;  4A3C H;  1GJX A;  1YEZ A;  4YCU A;  4C3J G;  1I5F A;  4DUY L;  4J1M A;  1K28 A;  1E1T A;  3CCJ A;  1SJH D;  1NJI C;  2KHS A;  1SNC A;  3DMU A;  4XXE A;  2L15 A;  3KDF A;  4P72 A;  4DR3 L;  1H9M A;  2JP1 A;  2Q2U A;  1NMF A;  3E9I A;  1PFS A;  2EY1 A;  4FP5 D;  1YIJ A;  2E5L Q;  1K8A C;  1XNQ L;  2PQE A;  3TN2 A;  3FKI H;  4DK1 A;  3OTO Q;  5LMN L;  3KF8 B;  2XSC A;  2EJG C;  4WJW A;  1YBY A;  1H9S A;  4X65 Q;  3DEO A;  3K5L A;  1XNR L;  2K5W A;  1I4P A;  3CU7 A;  1LAC A;  2PI2 A;  3KOJ A;  4OO1 H;  3P20 A;  3I4N H;  2K50 A;  1RCV D;  2HT1 A;  1I6H B;  4GOP A;  1JJG A;  4YY3 Q;  4A3J H;  4J6H A;  3HFZ B;  5IWA Q;  3M85 A;  3C3L A;  2AQ1 B;  3ITP A;  3OW2 A;  5CV8 A;  4HID A;  4DNR B;  3RN2 A;  1AP0 A;  4FF4 A;  3J81 L;  1H9R A;  1EIY B;  3SK4 A;  1F9P A;  1V1Q A;  4X3K A;  2VQF L;  1J5E L;  2AQ2 B;  2VY3 A;  1ZXT A;  3EFX D;  4JI5 Q;  3U4V A;  3NPP A;  4EX5 A;  4JI0 L;  2XGT A;  2ICE C;  5LMU Q;  3BYT B;  4TKO B;  3FVQ A;  2BE5 C;  3IFD A;  4Z9C B;  5AJ3 Q;  3FKI B;  4V0B A;  5C0X J;  2KBN A;  1X3F A;  4XQQ A;  2F0T A;  4DUZ Q;  1LTL A;  5JPM C;  1SLJ A;  4N9T A;  2XTI A;  4A3B B;  1SE3 A;  4KN7 C;  2BH2 A;  4X66 L;  3M7N A;  1EWI A;  1ZYR D;  2DNC A;  1IBK L;  3Q8D A;  4B3T Q;  3T1H L;  1B70 B;  2EIF A;  1JQY D;  4G4K A;  1NMG A;  2R92 H;  4A3J B;  3PF4 A;  2KEE A;  1STE A;  3NHH A;  5FLX c;  2E76 C;  1IBL L;  5BN5 A;  1KLG D;  4FF3 A;  3CCR A;  5IGB A;  4IUR A;  3Q22 A;  2PMZ B;  1VMP A;  1JWU D;  4ZUJ A;  1WYD A;  3D4W A;  2F0Q A;  4U68 A;  5EBD A;  3H0G B;  3A7L A;  3ND8 A;  2EY5 A;  2KED A;  4A4I A;  1G8Z D;  2WKC A;  3VR6 A;  2Z6K C;  3KDF B;  5M5W H;  3A7A B;  1C9O A;  1G6Z A;  4BBS G;  2BH8 A;  2H1E A;  3HKZ G;  5D14 A;  4UP8 A;  2GA4 B;  3G6J B;  4OEL B;  2R93 B;  4RCO A;  4HJ9 A;  5FOB B;  5DM7 3;  1I4Q A;  1EIH A;  2UUC Q;  3HOZ B;  5M9O A;  4K6D A;  1H9S B;  4DR7 Q;  1UAP A;  2JQO A;  4HIO A;  3T4A C;  1XTC D;  5IOD A;  5FK9 C;  4O2D A;  3M9B A;  2OXP A;  1F2L A;  3TZD A;  2IX0 A;  1PH1 A;  1GUG A;  1VQF A;  3PUW A;  3UDI A;  1R9T B;  2R92 B;  3A8K E;  3AFP A;  4GOP B;  2SNS A;  4GLV B;  1STG A;  2G9D A;  1Y1V G;  2DN8 A;  4A3C G;  4NXN L;  1E2W A;  4DR5 L;  2NWG A;  1Q8I A;  3BZD B;  2JEA I;  5EBC A;  1OXU A;  2F0P A;  2KHI A;  1QNK A;  4GLX A;  4DR4 L;  4RMF A;  1WTX A;  1WTP A;  4LF7 L;  4IUV A;  1LT6 D;  4BBR H;  3RZD H;  2XVS A;  4PQX A;  4KV6 A;  1EY0 A;  4DGZ A;  4OWT B;  5M5X H;  1Q8K A;  1Y69 U;  1LTT D;  3NBI A;  3NTH A;  3FKI G;  3BDC A;  3R8B A;  4B3M L;  1JC7 A;  2BDO A;  4YWM A;  1QG7 A;  1D2B A;  2K6A A;  4DK6 C;  4HJ7 A;  3OOC A;  3FP9 A;  1EWC A;  3MFY A;  4O0A A;  1WTW A;  4LJZ C;  4AH6 A;  3E0J A;  3H94 A;  1UNS A;  2BE5 D;  1O7L A;  4OO1 G;  1LTB D;  1S5F D;  4LK1 C;  1KRT A;  3HZX A;  3I4N G;  1ESR A;  1A8V A;  1EEI D;  1PMR A;  2N55 A;  4JV5 L;  1ICF B;  4FNF A;  2O2L D;  1N36 L;  1L0Y B;  1LAB A;  2NZH A;  1PH4 A;  4K14 A;  1HQM C;  3BVZ A;  1P8L A;  4IPG A;  1Y1W B;  2UUA Q;  1Y8P B;  1MD2 D;  1HZ9 A;  5CBA E;  3CCL A;  4OO1 I;  2DJG C;  3GTK H;  4RHS A;  1EQR A;  4F8M A;  4CJ2 C;  2ES2 A;  5M3F H;  4R8N A;  3T16 A;  4IFD H;  5DEH A;  2SOB A;  3RLF A;  1HZC A;  1SMY C;  2HUG A;  5D65 A;  5IYC G;  3RZD B;  1U4L A;  1SYB A;  5CGK A;  3CP0 A;  4OXP A;  4C3I B;  5M5X B;  1IBM L;  4QIW B;  2KHJ A;  1Y8O B;  2B2T A;  1DJR D;  4LF9 L;  1KTK A;  2Z9H A;  3MTS A;  5DAU A;  1WCM H;  4JYA L;  1A0I A;  1GD7 A;  2K04 A;  5JPN C;  1JOK A;  2JA7 B;  4LF6 L;  1HNZ Q;  2D62 A;  1SBB B;  3Q23 A;  4NXM L;  4GKJ Q;  4A93 H;  1U5K A;  1KIX A;  5ISR A;  4NPS A;  2F0J A;  3I90 A;  4NW2 A;  3PCO B;  1VQ7 A;  1CI3 M;  3HRZ C;  2N78 A;  1B50 A;  4ABN A;  5HGT A;  4LNQ A;  3L9A X;  1GHK A;  4TQU S;  2NYZ D;  4LW1 A;  3OPO A;  2F0S A;  1EY5 A;  2A6H C;  1S40 A;  2UXD Q;  4H44 C;  1OXS C;  1YI2 A;  5M3F B;  1KDB A;  3AFQ A;  5IOC A;  5G3L D;  4X65 L;  4DV3 Q;  5JJZ A;  4OWW B;  1MSH A;  4QY7 A;  2K28 A;  4K8I A;  3KJP A;  1D5M C;  3I4L A;  3GV6 A;  1FD7 D;  1VQC A;  3LWU A;  4H02 A;  1DD2 A;  3HKZ E;  2IJ0 A;  3HOY B;  1PFN A;  4GN3 B;  4DV1 L;  4DK0 A;  4B3R Q;  3JAM E;  4YY3 L;  1GXD C;  4KD4 A;  1Q82 C;  4P74 A;  5A35 A;  4GN5 A;  1WCM B;  2P5Z X;  4QUF A;  1Q7Y C;  3GTO H;  4LF5 L;  4DV5 L;  4UHV A;  1MI2 A;  3K0X A;  3VDY A;  5J39 A;  4OHJ A;  4LF4 L;  4A93 B;  3TP5 A;  4C3H G;  1IKL A;  4JI5 L;  2F3V A;  1B53 A;  2DUD A;  1SN8 A;  1AZQ A;  2EE1 A;  1ASZ A;  2EVB A;  1TWG H;  4JCV E;  2BOS A;  3H09 A;  2PW7 A;  4OEM B;  1YNX A;  4DR6 L;  3EVQ A;  4KY6 A;  1BCP D;  1EY4 A;  5C44 B;  2IY5 B;  1EFI D;  2B63 B;  2RSO A;  4X64 Q;  3TRZ A;  3MXU A;  1B44 D;  1PDQ A;  3S24 A;  4UDU C;  3OIP A;  1SR3 A;  2MFI A;  2DNE A;  2PZW A;  1GVP A;  4HJ5 A;  5C3E H;  3TP7 A;  2B3G A;  5EKI A;  3HOV G;  3JC6 6;  1AFP A;  4BBR G;  3G7L A;  2KCM A;  1C4Q A;  1RL2 A;  3L0O A;  3CHB D;  3U9O A;  1MBY A;  3S9W A;  4ME5 A;  4RA8 A;  1TXY A;  4QMG A;  3Q24 A;  2ZXO A;  1S5E D;  3KJO A;  1LLR D;  1EQQ A;  4QL5 A;  4EVO A;  1SMY D;  4JBW A;  3GTO B;  1XX8 A;  4IUP A;  2OT2 A;  4P2C B;  4XQJ A;  1N34 Q;  1VS0 A;  2F3I A;  4KHP Q;  1EEF D;  3T13 A;  5GRO A;  5IYD H;  2M2L A;  4R4I A;  3WOF A;  3HOX B;  5C4X B;  1SNO A;  3QOL A;  1CZW A;  1SSO A;  2N49 A;  4A3K H;  2CWP A;  2K05 A;  1TWG B;  1JJC B;  1C7Y A;  1IYU A;  4XYO A;  3MXN B;  2JN4 A;  3SVM A;  3QJY A;  2MPM A;  2NN6 G;  2EYP A;  1Q46 A;  1HNX Q;  4AYB E;  3I4M H;  1SYC A;  1S3O A;  2WB1 E;  5M3F G;  1RHP A;  1TKW B;  1STN A;  4A3E H;  2TMP A;  3SDZ A;  3M7G A;  4HN7 A;  2I0Q A;  1HUN A;  1VQH A;  3I55 A;  4JBM A;  2MO0 A;  2E2J B;  5FLX L;  3H15 A;  2NTT A;  2PYK A;  4ID6 A;  1K0R A;  3G6E A;  2JA6 B;  3BYY B;  2Z4I A;  2A6H D;  1C48 A;  4B08 A;  2I46 A;  4IFD I;  1VQM A;  2CQO A;  1I94 L;  1B3Q A;  1CTM A;  3A54 A;  2I5M X;  3GTM H;  3STB D;  1FNU A;  1WCM G;  5AFW A;  5JJI A;  3GTG H;  2UXB L;  5IIF A;  4A3I B;  2EY6 A;  1F2Z A;  3S1R H;  1HJP A;  3J80 i;  3TME A;  1PVO A;  3NTK A;  3CC4 A;  1X3G A;  2QF7 A;  3AMU A;  3KFU A;  2GN5 A;  1HNW Q;  1EY6 A;  2VQE Q;  5LL6 S;  1YNN C;  1RF2 D;  4EGV A;  4A3K B;  3EQL C;  2GVA A;  1TY0 A;  2F4V L;  3OMG A;  2ALY B;  2LFN A;  4JI6 Q;  4ZAI A;  1HZB A;  3S1Q H;  1SEB D;  1SDF A;  4JI2 L;  2WIN B;  3A74 A;  4ME3 A;  3J80 c;  1TWF B;  5M5Y H;  3HGB A;  3L7Z C;  1MIU A;  2JSO A;  2C5C A;  3KYH C;  2L12 A;  4ULL A;  3TS0 A;  3F2D A;  4BWG B;  2MO1 A;  2NVQ H;  4KY7 A;  1K83 B;  2F4I A;  4CKC A;  1BNZ A;  4IZ8 A;  1O80 A;  3S16 B;  2G9H D;  2CHB D;  2NB0 A;  1RTO A;  4FVM A;  3SK6 A;  1NTG A;  3J7Y W;  2NVX H;  2UUA L;  1A6X A;  3P7J A;  3M4O B;  2E2D C;  2R7Z H;  1MJE A;  3VR2 A;  1KC8 C;  5EKK A;  4QGU A;  2A1A A;  3M3Y H;  3DWA A;  2KCT A;  1N32 L;  1PRT C;  5E4W C;  2FHT A;  3K81 C;  3G48 A;  1ZKO A;  5IGG A;  1OXV A;  2RHQ B;  3S14 B;  2XWB B;  3NK9 A;  1SNP A;  2K32 A;  2BA1 A;  5KYI A;  3K80 C;  3S1Q B;  1F9R A;  2F1M A;  1M90 C;  4J15 A;  2QDL A;  2RA4 A;  2HQL A;  1H9K A;  4GNX C;  4QB4 A;  1HTP A;  1TVX A;  4OIJ A;  1K8O A;  1HA5 A;  1KHI A;  5M5Y B;  2EZV A;  2B39 A;  2HD3 A;  4POF A;  1QUQ A;  5ELO A;  2Z4H A;  3G4S A;  1YNJ C;  2F3W A;  5C3E G;  1QOH A;  3BS1 A;  4DKA C;  2JA9 A;  3DWP A;  4G7Z C;  3ERS X;  2QEX A;  4DR2 Q;  1AE3 A;  3S2H H;  4LF8 Q;  3K0Y A;  1KAB A;  3L3O C;  4K5X A;  4XIG S;  1ZYR C;  4IJL A;  5IYB H;  1O7I A;  3I7F A;  2A19 A;  1TS2 A;  4A3G B;  2FJ2 A;  5EJW A;  1UE7 A;  1LUZ A;  2ZTD A;  2K33 A;  4OIK A;  3I3C A;  3M3Y B;  1QVF A;  3ICE A;  1DZ1 A;  3IRB A;  5IP7 H;  4DV3 L;  3S17 B;  2FIN B;  2K1B A;  2IHF A;  2YTX A;  3B6Y A;  3VA5 A;  1Y14 B;  1VQD A;  1I6H H;  1YJ9 A;  1EQT A;  1PFB A;  1VQ8 A;  3Q6S A;  1KXL A;  1F9Q A;  5LL6 X;  1I3Q B;  1X54 A;  4BY7 G;  3VYU A;  4FYD A;  1GO3 E;  4DV7 Q;  4GLA C;  3I4M G;  1J6Q A;  3OIQ A;  1NE3 A;  1CSQ A;  1YNN D;  5DM6 3;  3OWE B;  2V4D A;  4A3E G;  3X3M A;  1Y8N B;  1B2T A;  3HP3 A;  2B29 A;  3ERO A;  5FO7 B;  1VQ5 A;  4JI1 L;  1HR0 L;  4KKS A;  1XTD A;  4LUZ A;  2E75 C;  1IKM A;  3F2B A;  1XMQ L;  2ZJQ A;  4M1U B;  3MFG A;  4C1N K;  3S2H B;  4RWS C;  1Q1E A;  3D4R A;  1LV9 A;  4JI3 L;  2EXZ A;  3L2P A;  4JW0 A;  4CDF C;  3CAM A;  4DV4 L;  3AU7 A;  1B8A A;  5CC4 A;  1VMC A;  3NBH B;  2Q8T A;  4G7H C;  3LNN A;  4A3B H;  2DJF C;  1JB3 A;  4KK7 A;  5FKA C;  3KBG A;  3CW2 C;  4DA2 A;  5IT9 E;  3FMC A;  2Z6K A;  4F7X A;  3LX0 A;  3RR5 A;  2H4O A;  4JVZ A;  4K0K Q;  2B2W C;  2PNH A;  1PTO C;  1SYG A;  1EU4 A;  1WD1 A;  1SND A;  1CKO A;  2PCF B;  1PRT D;  4IPC A;  1FJG Q;  1ZEQ X;  4NKL A;  3W1G A;  3T1Y Q;  2IW3 A;  5KIX A;  4LFA Q;  4DFA A;  1AE2 A;  5KEE A;  5CR3 A;  3ULL A;  4HIM A;  4JI4 L;  4RHR A;  1S5C D;  1B9M A;  1BBW A;  2WKD A;  4MHE A;  2G5D A;  3V96 A;  2Y0S E;  1BKB A;  1HQR D;  2SEB D;  2D0O A;  2TSS A;  4DV2 L;  4ZYS A;  1FR3 A;  4IO9 A;  1N33 Q;  1CZG A;  1GUT A;  3H0G H;  1QUQ B;  1G29 1;  5ELC A;  1BXT A;  3R3O A;  1KQS A;  2ZJP A;  3AYH B;  1PTO B;  4DAV A;  3N6R A;  4BXX G;  4R4Q A;  3ONA B;  2LKV A;  1E1O A;  3HOW G;  1YNJ D;  2R7Z G;  4XYQ A;  4DV6 L;  1CA6 A;  4JOI A;  1IHZ A;  4HCE A;  4DV0 Q;  2R93 H;  4XTC S;  4R1J A;  1HNX L;  4M8A A;  3HOZ H;  2R3Z A;  2KCN A;  4GKK L;  4EQO A;  5FLM H;  1PHJ A;  3MHB A;  3CMA A;  1C8C A;  1PYW D;  3J81 E;  5EPJ A;  5I6Y A;  1FVI A;  2JA8 B;  2A68 D;  3NWS A;  3D0F A;  1D5X C;  3CQZ H;  5ELB A;  1LTS D;  1STB A;  4HMI A;  1R9T H;  2NVT B;  2ZM6 L;  2MGS A;  4CDD C;  3K7U C;  3WDN A;  4CDC C;  1GKH A;  3NUC A;  1HH2 P;  5ELD A;  2HCI A;  3FDT A;  2RVL A;  2WAQ E;  2ZTE A;  2L9H A;  1TWC B;  1NY4 A;  4R4T A;  4Q5V A;  4X3S A;  1HHV A;  2EJF C;  1VCI A;  4MN3 A;  4B9X A;  1XJV A;  1B4O A;  3F2U A;  4P75 A;  1GUN A;  2R61 A;  1LT4 D;  1VQB A;  3SK5 A;  1ICW A;  1EYG A;  2N3S A;  1SYF A;  4RGM A;  1QE6 A;  2B2Y A;  3VR5 A;  4IFD J;  4BY1 H;  1DOL A;  1B7Y B;  1F2Y A;  1RDP D;  5EPK A;  4V19 0;  2DGY A;  2UUB Q;  5IGF A;  5BR8 Q;  2M9V A;  2WB1 B;  4K5W A;  5I6W A;  5IP7 G;  3OW7 A;  4FF2 A;  5E7N A;  2B8G A;  2K7V A;  3R93 A;  1A3V A;  3QB3 A;  1DOK A;  2LXJ A;  3PSI A;  2I5H A;  4G57 A;  4ZRZ A;  4ZUI A;  1O7Y A;  3CQZ B;  2I5L X;  1Y1W H;  2ASB A;  2XN9 C;  2E2H B;  1EOV A;  2ZT9 C;  1G6P A;  1CKN A;  4RGN A;  1BDO A;  1K9M C;  4C1N I;  3DM1 A;  3UDX A;  4A3F H;  2F0H A;  4HSP A;  4JOI C;  4ZK9 B;  2RCN A;  1PTO D;  4HSV A;  1Q86 C;  1VQ4 A;  2JA5 H;  5ELN A;  1HFN A;  4AQY L;  1T5E A;  3WWV A;  1SE8 A;  2VUM B;  2CKZ B;  3QR8 A;  3DLL A;  4KI0 A;  4C3I H;  3J80 L;  2QEJ C;  4BY1 B;  4JI8 Q;  1VF7 A;  2V1C C;  2OF1 A;  1O78 A;  1T5X D;  4AIM A;  4OX9 Q;  5HY6 A;  2A5H A;  3SGI A;  1HFG A;  3UE0 A;  4A3B G;  1AZP A;  1KNA A;  2QA4 A;  2JA7 H;  1RJT A;  1DOM A;  2X6L A;  1BCP C;  1JOR A;  1Q1B A;  5C4H A;  3CC2 A;  3W3A A;  1PH5 A;  1Q90 A;  1KD1 C;  5COR A;  1EWH A;  3CCV A;  3NQI A;  4GS3 A;  1TS5 A;  4A3J G;  3VYS A;  1VQK A;  1L1O C;  4KJO A;  1IL2 A;  4L5Q A;  1AH9 A;  1JR0 D;  5ELF A;  1I4G A;  1NNX A;  2XRQ D;  5C3W A;  2B2U A;  1K8M A;  2B2Y C;  2VW9 A;  5C5M A;  4A3F B;  1CHP D;  1RD9 D;  1N8R C;  1STA A;  3CCS A;  5ELE A;  1JMC A;  2F0U A;  2EJM A;  3RD4 A;  1WI5 A;  1BCP B;  2JA5 B;  1NR2 A;  3H0G G;  4CDE C;  2F0V A;  1LT5 D;  1OXX K;  2PO4 A;  1II3 A;  2HCC A;  2UU9 L;  2N88 A;  1TY2 A;  1SNQ A;  3F2C A;  4A3M H;  1L1O B;  4IUT A;  4QJF A;  3HOY H;  2K4K A;  2NZ1 D;  1VQE A;  4FO2 A;  1SNM A;  3PMF A;  3CCQ A;  1CUK A;  2OEO A;  2A74 C;  3CPW A;  4MIU A;  2RSN A;  4YHH L;  2R93 G;  1DYQ A;  3W2D A;  1E3P A;  3HOZ G;  3TSS A;  1JWS D;  3R2T A;  1QJO A;  1FGU A;  3UDG A;  3URY A;  2BDN A;  1PLF A;  5FJ8 H;  2E8G A;  1VQO A;  3PUV A;  3LGJ A;  4L5S A;  2R92 G;  1A2U A;  1LYL A;  3RZO H;  1TR5 A;  1OTC A;  2CFM A;  3MXN A;  4A3L H;  4R9W A;  1PH8 A;  1M8A A;  2E5L L;  5D3D A;  3T56 B;  2EYH A;  1CKN B;  4ZLT F;  5C44 H;  4CJ1 B;  5CMD A;  3OTO L;  4MNO A;  2B63 H;  4EQN A;  4DR1 Q;  1E7Z A;  1CT1 D;  4J8Q A;  2WFW A;  5HGQ A;  4HCS A;  3RNU A;  3E0E A;  4QCL A;  3STB C;  1BQQ T;  4QQB X;  2MNA A;  3F8T A;  4HED A;  1ILQ A;  1QWY A;  2OTL A;  1QCB D;  3P75 A;  4HJ8 A;  4A3M B;  3NXW A;  4BY1 G;  2A6E C;  3PIP A;  2O5J C;  4BA1 I;  1A2T A;  1H9J A;  3CXC A;  5IWA L;  3PUX A;  3PO3 B;  1I4H A;  4OL7 A;  1Q81 C;  1TS4 A;  1ENC A;  2B2U C;  4KN4 C;  1OXT A;  2K01 A;  1M1K C;  3J7A 5;  1A3T A;  2K52 A;  1YJN A;  4WRD A;  3MAQ A;  2D9U A;  2EYO A;  2X6G A;  2NUC A;  4RKL A;  3HOX H;  1RKN A;  1WFQ A;  5C4X H;  2IPK D;  5FO9 B;  5I2Y A;  5KRU A;  1Y1W G;  2YU9 B;  3RZO B;  1IW7 D;  3J7Z C;  4X62 Q;  2VS1 A;  5LMU L;  4RFB A;  5AJ3 L;  4A3F G;  2FXQ A;  2ZTC A;  3BVG A;  4DUY Q;  3AB9 A;  3PF5 A;  4DUZ L;  3SHL A;  4DV0 L;  1BOS A;  2JA5 G;  2JK8 A;  2JXM B;  4DR3 Q;  4HAE A;  1IXR A;  3EJI A;  3LWE A;  2ICI A;  2E2J H;  1EY9 A;  2JA6 H;  3T51 B;  3BJU A;  4C3I G;  3DXJ C;  5LMN Q;  4B3T L;  2RHS B;  4HMJ A;  1EOT A;  5CV6 A;  1XMO Q;  3TBI B;  1QZG A;  1TS3 A;  2LMC B;  4PNY A;  4PV1 C;  3I2Z A;  2D2C C;  3MVV A;  1GUW A;  3VYR A;  3IFT A;  1XNR Q;  4LFB Q;  3FPU B;  2FMC A;  4B9W A;  2JA7 G;  1EFW A;  4A3I H;  1NBW A;  3S1M B;  3K58 A;  3NTI A;  3GTL B;  2HDL A;  2Q2T A;  5EKL A;  2KA7 A;  1EQV A;  2ZXR A;  4KY5 A;  2D0P A;  2EYF A;  3DUZ A;  3U4Z A;  3NE5 B;  4NDX A;  1VQ6 A;  1B1Z A;  4L6T B;  1KAA A;  2RDG A;  1LT3 D;  3C1F A;  3OSO A;  4DAY B;  2HIV A;  1MGS A;  2OWO A;  1BUV T;  5JAV A;  1KDA A;  3K8A A;  2F0M A;  2VQF Q;  1J5E Q;  1PH9 A;  3PIO 3;  3GTQ H;  3A56 A;  5IE8 A;  4I7A A;  4NP5 A;  1TWF H;  1FNV A;  2IX1 A;  1G91 A;  3I70 A;  3N52 A;  5FO8 B;  2UUC L;  2K03 A;  4JI0 Q;  4IFD G;  4DR7 L;  1I50 B;  3A8I E;  3IKJ A;  5LMN W;  3IL8 A;  4LFC Q;  1X55 A;  1X3Q A;  3HOY G;  1QVC A;  1K83 H;  1KAW A;  3H3V C;  2LY7 A;  3S16 H;  4GNX A;  1SYD A;  5E3F A;  1LTG D;  1J8I A;  4JC0 A;  3M4O H;  2RQX A;  4K2L A;  2RDH A;  1E0B A;  4TRD A;  4X66 Q;  2WAQ B;  4C3J H;  3M4P A;  1VQI A;  1IBK Q;  3T1H Q;  2A6E D;  5C4Z A;  2PI2 E;  1D1I A;  4A93 G;  4RGT A;  5JEA J;  1IL8 A;  4DAP A;  1DGS A;  3D6C A;  4XT1 B;  1K8G A;  3S14 H;  3GTJ B;  5DLQ E;  1IBL Q;  2KVM A;  4DAM A;  2B8F A;  1NUC A;  4ZQ3 A;  4A3L G;  5G3L F;  3QG1 A;  5FLX E;  1DON A;  3ZYY X;  4JI8 L;  3CRL C;  5C44 G;  1YHQ A;  3RLN A;  3J7A F;  2B63 G;  4CBV A;  1SFO H;  3GDE A;  4MTN A;  1EYD A;  1U0L A;  4R4C A;  4B3S Q;  3GTQ B;  2ID0 A;  1SRU A;  2K5V A;  1WJJ A;  2XRS D;  4RCN A;  4WOR A;  4IUQ A;  5CV7 A;  2H5X A;  1Z6H A;  2F0I A;  1CFM A;  3I56 A;  4IPH A;  3OWF A;  4O42 A;  3HOU B;  5A2Q L;  4KHV A;  1MKH A;  3U9S A;  2ENB A;  3K5N A;  1YIT A;  3CF5 A;  2WV6 D;  3NBH A;  4A3G H;  4OGQ C;  5GAG C;  1O7Z A;  2YV5 A;  4PMW A;  4C3J B;  3K5O A;  4CKE A;  3RUZ A;  1WTR A;  2YYZ A;  3K6O A;  1BCP F;  2K5Q A;  3S17 H;  5GAE C;  2KEC A;  3HOX G;  3S2D B;  2GVB A;  3I73 A;  4K6L A;  5C4X G;  4BA2 I;  1JT8 A;  5T1G A;  2BA0 A;  2F0G A;  4EQP A;  4EQ5 A;  3KLW A;  1ET9 A;  5CV4 A;  4NXN Q;  3PUZ A;  1I3Q H;  4DR5 Q;  4L63 B;  2WII B;  5A2Q E;  5E1F A;  1TT2 A;  1SFO B;  4N8X 1;  4CJ0 B;  1PRT B;  4DR4 Q;  4LF7 Q;  4DK3 C;  4P71 A;  1NCV A;  1U9R A;  1VF5 C;  1YJW A;  1HNZ L;  1X3P A;  4I7Z C;  2B2W A;  3M4Q A;  2EYM A;  1JB7 A;  3TZU A;  5GQO A;  4GKJ L;  4QIW E;  2JA6 G;  1SXT A;  3Q0A A;  5T1I A;  4ZKB B;  4RGO S;  4TVA B;  5CV5 A;  2L4N A;  4HR7 B;  5I9P A;  5IY0 A;  3AEV A;  1L2F A;  1UUP A;  3AQQ A;  3JAM i;  4GNX B;  2PQA A;  2K5H A;  2A69 D;  4IQZ A;  2FMM A;  3DEP A;  2A68 C;  1K73 C;  5JEA H;  2AKW B;  1GHJ A;  4A3I G;  1TQO A;  5C4J H;  2WP8 J;  2UXD L;  1LO5 D;  5GAH C;  4JV5 Q;  1ILP A;  1WTH A;  4KKU A;  5K36 H;  5IYD G;  1N36 Q;  1OO9 B;  2VXW A;  1HCZ A;  1U4M A;  1WOC A;  2IX3 A;  3KLS A;  4A3K G;  4CHT B;  3JAM c;  4Y52 H;  3W5O A;  3VR3 A;  1CQF A;  5KNB A;  1KL9 A;  1CM9 A;  4B3R L;  1GM5 A;  4K8J A;  5GAD C;  3KF6 A;  2B2V A;  1TII D;  1DM0 B;  4UAI A;  4KJN A;  5IP9 H;  1TU2 B;  5J3B A;  1PH2 A;  2EYL A;  1FL0 A;  2RBM A;  1W6J A;  3KUP A;  1BF4 A;  3CRK C;  3SK8 A;  1P16 A;  1AW7 A;  1IBM Q;  1CKM A;  1EL0 A;  3G71 A;  2E2I H;  1PTO H;  3O13 A;  3A5Z B;  1BBX C;  4JYA Q;  3CD6 A;  1FGB D;  2NVY B;  2L0C A;  4S3S A;  4JPB W;  1JJ2 A;  2ZJR A;  1BR9 A;  3R2I A;  4LF6 Q;  1ET6 A;  4X3T A;  2F52 A;  5CV9 A;  4NXM Q;  1WD0 A;  1CK1 A;  2IL8 A;  2Q2I A;  5C4J B;  4X64 L;  1DCZ A;  4KMU C;  2EY2 A;  4ILW A;  4L5T A;  1X65 A;  1PZJ D;  1HTL D;  3VA7 A;  1VQG A;  3K57 A;  5EGT A;  2JA8 H;  4IUU A;  4C2M B;  2HDM A;  4ALP A;  4BBS B;  3HKZ B;  4JBK A;  4XQN A;  2NVT H;  1XMO L;  1VDZ A;  1Z9F A;  2AWO A;  3E3X A;  3C46 A;  2F0K A;  1R4P B;  4LFB L;  1TWC H;  5L37 A;  2M00 A;  3HG9 A;  5IGE A;  1WTO A;  1N34 L;  3CKI B;  3K7A B;  2C35 B;  2RCF A;  4XDX A;  2KCC A;  3E9H A;  4KHP L;  4DV1 Q;  3NWT A;  1V1O A;  1EZ8 A;  1TWH B;  1E24 A;  2E2I B;  5J22 A;  2AUJ D;  3M4Y A;  1N9W A;  3GTP B;  4N9P A;  4LF5 Q;  2QW7 A;  4DV5 Q;  1AEX A;  1YHA A;  1Y1V B;  2SDF A;  4A3G G;  3QOJ A;  5LHY 1;  2PQA B;  1D1K A;  4LF4 Q;  2L55 A;  2B2V C;  4PZ7 A;  3BZC A;  3HS0 C;  1EUJ A;  1B3A A;  5IYC H;  5E4X A;  1I4R A;  3TEH B;  4GZY C;  4DR6 Q;  3MC0 B;  2AUK A;  3ND9 A;  4LFC L;  4FDB A;  2E2H H;  2AWN A;  3OMC A;  3ULJ A;  1BVS A;  2UXC Q;  2A73 B;  4O1N A;  1LTI D;  4G7O C;  3KF6 B;  1I6V C;  1X3E A;  3OYY A;  5JJK A;  2IT1 A;  2KOL A;  4F88 A;  1UEB A;  2CH4 A;  4XT3 B;  1CA5 A;  3I4N B;  1LM0 A;  2D5D A;  3MWY W;  4PMB A;  2Z8L A;  5I2X A;  1L1O A;  2HHH Q;  1D8L A;  2VUM H;  4ODG A;  1Q3L A;  1HNW L;  1GUS A;  2VQE L;  1QB5 D;  2K5D A;  1FYC A;  5BN3 A;  2F0D A;  1W6K A;  4E6I A;  1F9S A;  5IYB G;  2MQH A;  4QF4 A;  5KYL A;  4JI6 L;  4Y7N H;  4IOA A;  5JEA G;  2VL6 A;  5M3M H;  4AYB B;  2OQK A;  4B3S L;  3CCU A;  3X3N A;  4WJ4 A;  5K36 G;  3MXP A;  2L11 A;  4IPD A;  3NEM A;  2KEN A;  1EZ6 A;  5HUR A;  3GV3 A;  2VZA A;  4RH6 A;  2O4X A;  4APV A;  1GUO A;  4IAL A;  2EXD A;  4KHZ A;  1EU3 A;  1SYE A;  4GOP C;  1PH6 A;  4PZ6 A;  3RMH A;  4FXK C;  1R4Q B;  2J7Z A;  4Q0F A;  5IP9 G;  1L0W A;  3TDQ A;  1LTR D;  1X32 A;  3I72 A;  3D31 A;  1GOZ A;  3HKS A;  2AMC B;  1NSN S;  4C3H H;  3P1H A;  3F1Z A;  1I94 Q;  1HUM A;  2Q8R E;  4DNI A;  4A76 A;  4FXD A;  2OTJ A;  2N8N A;  3BZK A;  1K3B C;  5D3I B;  1RIP A;  2K5N A;  1TWA H;  1EY7 A;  2F0F A;  3TP8 A;  2UXB Q;  3EN2 A;  3V05 A;  4Y7N B;  3HEJ A;  3CME A;  4X6A H;  3FHW A;  2MUY A;  5NUC A;  3NP8 A;  5M3M B;  5K5P A;  1U4P A;  3KLS X;  1IW7 C;  5I4D A;  1NAP A;  1SRO A;  1Z7T A;  1HRJ A;  3PO2 H;  4WJ3 M;  1PRT F;  2KUM A;  3MEH A;  5C0X H;  3HOV H;  1PYB A;  4IJH A;  2OQ0 A;  2F4V Q;  1V8Q A;  2JA8 G;  5M5W B;  5F2D A;  2KJX A;  3A8J E;  1VQL A;  2F0W A;  4DR2 L;  2CVR A;  1QNU A;  1ROD A;  1VQA A;  3OHX C;  4JI2 Q;  4LF8 L;  1HPC A;  1V1P A;  3J80 E;  1PH3 A;  2JYO A;  5I9O A;  1G2S A;  2J0T D;  4L5R C;  4IUN A;  4WFN 3;  1YVC A;  4LUV A;  3SEB A;  4HIK A;  2PPB C;  4C3H B;  3T53 B;  3E5S A;  1PV4 A;  3NSW A;  2EQS A;  3C1E A;  3RN5 A;  2CWA A;  3QWN A;  1QZH A;  1L0X B;  1TWA B;  1D6E C;  2CW0 C;  2J4X A;  3MXG A;  1VQN A;  4DN4 M;  1XXG A;  4H0L C;  2NN6 H;  3PO3 H;  1D7Q A;  1N32 Q;  1UEA B;  1S5B D;  5H1S E;  2JE6 I;  4DV7 L;  4AYB G;  2WB1 G;  1XYI A;  2VB2 X;  4CGY B;  3D6W A;  5FLM G;  3PO2 B;  4OWX B;  3HOV B;  4BBR B;  1Z47 A;  1IYJ B;  4LUO A;  1CSP A;  2CH4 W;  2KQ3 A;  2DY7 A;  2I07 B;  2RF4 A;  1XPO A;  3BVM A;  1ML0 D;  2YU9 H;  2ATW A;  4DAY A;  3U58 A;  1M4V A;  3FPP A;  3VR4 A;  4KD3 A;  3GP7 A;  3A0J A;  3S1N H;  5JVG 3;  4POG A;  4A3D H;  2BCO A;  3ER0 A;  5IT9 c;  3JAM L;  4R8I A;  1B9N A;  4A75 A;  5EPL A;  3PIP 3;  3EBE A;  2F0O A;  1UWV A;  2VUM G;  1JOO A;  2Z0S A;  4R4O A;  3GD7 A;  1UE1 A;  4KKT A;  4K0K L;  4F87 A;  1A3U A;  3GQB A;  3GTK B;  5KND A;  1F77 A;  2NTS A;  1FJG L;  1LTA D;  3KK7 A;  3T1Y L;  1UE5 A;  1CQV A;  5M3M G;  1BBU A;  4LFA L;  3CCM A;  1W2B A;  3UE1 A;  1CHQ D;  4IN3 A;  4CKB A;  2HQE A;  4JI7 Q;  3S1M H;  2F0L A;  1PZK D;  3GTL H;  1N33 L;  2Z6B A;  2C9O A;  1D5Z C;  1X9N A;  3J81 i;  2LSS A;  3FRP B;  3H91 A;  3I91 A;  1PTO F;  3PQI A;  4YCW A;  2VNU D;  4FXG C;  2MHV A;  1PZI D;  5JVH 3;  5JOB A;  4IOC A;  5CYU A;  4QUC A;  3S1N B;  1C0A A;  1SE4 A;  4RAU C;  1MSG A;  1V1P B;  3BDO A;  3MA2 B;  4A3D B;  2XWJ B;  1X56 A;  3A5U A;  4JI1 Q;  1HR0 Q;  2HIX A;  1SJE D;  4DXG A;  3BU2 A;  4RG1 A;  1XMQ Q;  1ENA A;  1HA6 A;  3J81 c;  1I50 H;  1ASY A;  4UP7 A;  1T9H A;  2NZO A;  1XNQ Q;  2AHO B;  4C56 C;  3QIA A;  3EIV A;  4OON A;  1MHW C;  4JI3 Q;  1EY8 A;  1X6O A;  1JCK B;  4DV4 Q;  3K59 A;  3CCE A;  2B2T C;  2UXC L;  3KLR A;  4DF7 A;  5J1Z A;  2R6G A;  2CQA A;  4JBJ A;  1VQP A;  3VYT A;  2QIL A;  4YCV A;  3RLO A;  5KNC A;  3PO2 G;  5C0X G;  2Y0S B;  2CW0 D;  2PW5 A;  2NBF A;  1H95 A;  1F2M A;  2OCE A;  5BN4 A;  2HHH L;  1XPU A;  3H3V H;  3GTJ H;  1ENF A;  5C0X I;  4YWL A;  4JI4 Q;  1E2V A;  3TQY A;  4MTK A;  4X3U A;  2PMZ E;  4DV2 Q;  2Z1C A;  4KTA A;  2YTV A;  3V2T A;  3NQT A;  1ONL A;  3E6Z X;  1IZ6 A;  3A55 A;  1HR0 W;  2QGQ A;  1WVL A;  2UUB L;  1Q12 A;  2XIW A;  5BR8 L;  1J9O A;  4GN4 B;  3J81 j;  2EPB A;  2EOT A;  1JE5 A;  1S72 A;  2A69 C;  2WAC A;  1VQ9 A;  4PG3 A;  1JWM D;  2EYJ A;  4K5V A;  4A3M G;  1HZA A;  1KNE A;  1YHB A;  4DNT B;  4UY8 C;  3HOU H;  4DV6 Q;  4N8F A;  4L8J A;  4NB3 A;  4BY7 H;  3KBX A;  3C2P A;  4RKB A;  4MZ9 A;  3PO3 G;  2Q8I B;  4GKK Q;  2DY8 A;  1PA6 A;  1PXU A;  1SAP A;  3PIO A;  5C3E B;  2X69 A;  1WTV A;  2R7F A;  2NN6 I;  1E2Z A;  1KDC A;  3DM3 A;  1FNW A;  4LAA A;  5FJ8 G;  3S2D H;  2ZM6 Q;  4P73 A;  2A8V A;  2PZU A;  4PZ8 A;  4UP9 A;  3D4D A;  2RDF A;  1G2T A;  2MP1 A;  3ERQ A;  2L1B A;  1WTQ A;  3DWQ A;  4LWC A;  1IYV A;  3NEN A;  3QO2 A;  1JE4 A;  4OX9 L;  4A3D G;  5EAY A;  2K14 A;  1YZ6 A;  5DNF A;  3PGZ A;  4BS9 A;  3H6M A;  5C6A A;  1S4Z A;  3MEF A;  1PFM A;  1I4X A;  2K75 A;  4JG2 A;  4YWK A;  4HJA A;  3S15 H;  4BY7 B;  2PNR C;  1A15 A;  4NMZ A;  3I4M B;  5IGD A;  4ZCK A;  2VB3 X;  1XWE A;  3EA6 A;  3DHQ A;  3I8Z A;  1JOQ A;  3UI2 A;  4A3E B;  3FEW X;  5KGU A;  2F03 A;  1EYC A;  3CC7 A;  2SNM A;  2Y0S G;  4H13 C;  4H7B A;  3I4O A;  4K2K A;  1HXY D;  2FFK B;  2JJQ A;  2IHE A;  2PZT A;  4BXX H;  4YIJ A;  1XPR A;  3IAY A;  2LXK A;  4KLK A;  3KF8 A;  5JJL A;  3GTM B;  3HOW H;  4TSS A; 
#chains in the Genus database with same CATH homology
 3CC2 A;  1PH5 A;  1N9W A;  1SR3 A;  2MFI A;  1KD1 C;  1GVP A;  3CCV A;  4HJ5 A;  4LF5 Q;  4DV5 Q;  1KRS A;  2JEB I;  1YHA A;  5C3E H;  4GS3 A;  2B3G A;  4AQY Q;  1G51 A;  3ULP A;  3JC6 6;  4A3J G;  1L1O C;  4BBR G;  1VQK A;  3HOV G;  2KCM A;  1IL2 A;  4L5Q A;  4A3G G;  1RL2 A;  3L0O A;  1AH9 A;  2PQA B;  4LF4 Q;  1TXY A;  4PZ7 A;  1PH7 A;  3BZC A;  2VW9 A;  3KJO A;  1N8R C;  3CCS A;  1EQQ A;  1JMC A;  1EUJ A;  4QL5 A;  4B3M Q;  1PYS B;  4JBW A;  1V43 A;  1WI5 A;  5IYC H;  3H0G G;  3TEH B;  1K3R A;  1E22 A;  1N34 Q;  1OXX K;  2NVY H;  4DR6 Q;  4LFC L;  1VS0 A;  2F3I A;  2YTY A;  4FDB A;  3CPF A;  4UPA A;  2UU9 L;  4KHP Q;  3F2C A;  4A3M H;  1L1O B;  2E2H H;  5GRO A;  2AWN A;  5IYD H;  3ULJ A;  2WAQ G;  1BVS A;  4QJF A;  4R4I A;  2K4K A;  3HOY H;  2UXC Q;  4DR1 L;  1VQE A;  3PUY A;  3CCQ A;  3KF6 B;  2N49 A;  1X3E A;  3OYY A;  4A3K H;  1CUK A;  2IT1 A;  1QVG A;  5JJK A;  2CWP A;  3CPW A;  1A63 A;  1V9P A;  1JJC B;  2Q2H A;  4YHH L;  1UEB A;  1C7Y A;  3TS2 A;  2R93 G;  1UE6 A;  3MXN B;  4BBS H;  1E3P A;  3HOZ G;  1EIF A;  1LM0 A;  4C2M H;  4DPG A;  2NN6 G;  2R7D A;  1Q46 A;  1FGU A;  3UDG A;  1L1O A;  4AYB E;  1HNX Q;  1D8L A;  2HHH Q;  3I4M H;  1S3O A;  2WB1 E;  5M3F G;  2VUM H;  1MJC A;  3GO5 A;  3W1B A;  2VQE L;  1HNW L;  4A3E H;  5FJ8 H;  2I0Q A;  2E8G A;  3H3V I;  1VQO A;  1VQH A;  3PUV A;  3I55 A;  4JBM A;  3LGJ A;  5IYB G;  4L5S A;  2MQH A;  2MO0 A;  2R92 G;  1LYL A;  3UDF A;  3H15 A;  4Y7N H;  4JI6 L;  3RZO H;  1OTC A;  4IOA A;  2CFM A;  4A3L H;  3TRE A;  1K0R A;  3G6E A;  2UU9 Q;  1PH8 A;  1VQJ A;  2E5L L;  1W3S A;  5JEA G;  4JI7 L;  3U50 C;  2VL6 A;  3K7A H;  3ZJY C;  5M3M H;  4IFD I;  1VQM A;  1CKN B;  2CQO A;  5C44 H;  1I94 L;  3OTO L;  2OQK A;  3PV0 A;  4MNO A;  4B3S L;  3CCU A;  4DR1 Q;  2B63 H;  4WJ4 A;  2CCZ A;  1A62 A;  2I5M X;  3GTM H;  5K36 G;  1TWH H;  3STB D;  3HOU G;  1WCM G;  4LF9 Q;  5JJI A;  1E7Z A;  3NEM A;  2KEN A;  4IPD A;  2VZA A;  3NEL A;  2WFW A;  4YHH Q;  3GTG H;  5HGQ A;  1SMX A;  3RNU A;  3GTP H;  3E0E A;  2UXB L;  4APV A;  3STB C;  2EXD A;  4QQB X;  4KHZ A;  1Y1V H;  4X62 L;  2MNA A;  3F8T A;  4A3C H;  4GOP C;  1HJP A;  3J80 i;  3S1R H;  1PH6 A;  2OTL A;  1PVO A;  4PZ6 A;  4HJ8 A;  1YEZ A;  4YCU A;  3CC4 A;  1X3G A;  3KFU A;  2GN5 A;  1I5F A;  4BY1 G;  4DUY L;  1HNW Q;  2VQE Q;  3PIP A;  4BA1 I;  1L0W A;  5IP9 G;  1E1T A;  3CCJ A;  1NJI C;  3CXC A;  2GVA A;  5IWA L;  3PUX A;  2F4V L;  2ALY B;  2L15 A;  3KDF A;  4P72 A;  4DR3 L;  4JI6 Q;  1HZB A;  3D31 A;  3S1Q H;  2Q2U A;  1NMF A;  1Q81 C;  3E9I A;  1PFS A;  3HKS A;  1YIJ A;  2E5L Q;  1K8A C;  2AMC B;  4C3H H;  4JI2 L;  1XNQ L;  3A74 A;  1OXT A;  3F1Z A;  3FKI H;  4ME3 A;  1I94 Q;  3OTO Q;  5LMN L;  3J80 c;  1M1K C;  4DNI A;  4A76 A;  3J7A 5;  2K52 A;  3KF8 B;  5M5Y H;  1YJN A;  2OTJ A;  2N8N A;  3BZK A;  3L7Z C;  1MIU A;  3KYH C;  1YBY A;  1RIP A;  2K5N A;  3HOX H;  1TWA H;  1WFQ A;  5C4X H;  4X65 Q;  2UXB Q;  3EN2 A;  3TS0 A;  3F2D A;  1Y1W G;  1XNR L;  2MO1 A;  3J7Z C;  4X62 Q;  3CME A;  2NVQ H;  3FHW A;  2VS1 A;  4X6A H;  5LMU L;  2PI2 A;  3KOJ A;  5AJ3 L;  4A3F G;  3I4N H;  2K50 A;  2FXQ A;  2ZTC A;  4DUY Q;  1SRO A;  2NVX H;  3PF5 A;  4DUZ L;  1NTG A;  2UUA L;  2HT1 A;  3PO2 H;  4GOP A;  4WJ3 M;  4YY3 Q;  4DV0 L;  4A3J H;  3HOV H;  1JJG A;  1PYB A;  2R7Z H;  3HFZ B;  4IJH A;  5IWA Q;  2JK8 A;  2OQ0 A;  3M85 A;  1KC8 C;  1MJE A;  2JA5 G;  2F4V Q;  2JA8 G;  4DR3 Q;  3OW2 A;  1VQL A;  4QGU A;  4BBS G;  4HID A;  2A1A A;  1IXR A;  4DR2 L;  3M3Y H;  2KCT A;  3RN2 A;  1N32 L;  1VQA A;  4JI2 Q;  2E2J H;  4LF8 L;  2JA6 H;  3BJU A;  3K81 C;  3G48 A;  5LMN Q;  1EIY B;  4B3T L;  1V1Q A;  2RHS B;  1OXV A;  1XMO Q;  2VQF L;  1J5E L;  1QZG A;  2RHQ B;  3I2Z A;  1PH3 A;  2VY3 A;  4JI5 Q;  3U4V A;  4L5R C;  4EX5 A;  2BA1 A;  4JI0 L;  3K80 C;  1XNR Q;  2XGT A;  4LFB Q;  1YVC A;  1M90 C;  4LUV A;  5LMU Q;  4J15 A;  4HIK A;  1EFW A;  2JA7 G;  2HQL A;  1PV4 A;  4A3I H;  1NBW A;  4GNX C;  5AJ3 Q;  5C0X J;  2KBN A;  1X3F A;  1KHI A;  2Q2T A;  4DUZ Q;  1LTL A;  2EQS A;  1SLJ A;  3RN5 A;  2CWA A;  4POF A;  1QUQ A;  5ELO A;  3G4S A;  1QZH A;  2D0P A;  2XTI A;  5C3E G;  1VQN A;  3U4Z A;  4DKA C;  2JA9 A;  1VQ6 A;  3ERS X;  2QEX A;  4DR2 Q;  3PO3 H;  2BH2 A;  1D7Q A;  4X66 L;  1AE3 A;  1N32 Q;  3M7N A;  3S2H H;  4DAY B;  5H1S E;  1EWI A;  4LF8 Q;  2HIV A;  2JE6 I;  4DV7 L;  4AYB G;  1IBK L;  2OWO A;  3Q8D A;  4B3T Q;  2WB1 G;  3T1H L;  3K8A A;  2VQF Q;  1J5E Q;  1B70 B;  2EIF A;  5FLM G;  4XIG S;  1PH9 A;  4IJL A;  1NMG A;  1O7I A;  5IE8 A;  5IYB H;  4OWX B;  2R92 H;  3GTQ H;  3I7F A;  3PF4 A;  1TWF H;  2IX1 A;  1Z47 A;  2A19 A;  1IYJ B;  4LUO A;  1CSP A;  2UUC L;  4JI0 Q;  1UE7 A;  5FLX c;  2RF4 A;  1LUZ A;  2ZTD A;  1IBL L;  4IFD G;  4DR7 L;  1XPO A;  3CCR A;  1QVF A;  5LMN W;  2YU9 H;  2ATW A;  3ICE A;  4LFC Q;  3U58 A;  1X55 A;  3IRB A;  5IP7 H;  4DV3 L;  3HOY G;  1QVC A;  1K83 H;  1KAW A;  1WYD A;  3A0J A;  3S1N H;  2IHF A;  4POG A;  2YTX A;  3B6Y A;  4GNX A;  3S16 H;  1Y14 B;  1VQD A;  1I6H H;  4A3D H;  1YJ9 A;  4JC0 A;  3M4O H;  3ER0 A;  4A4I A;  1VQ8 A;  1KXL A;  5IT9 c;  2Z6K C;  3KDF B;  5M5W H;  1X54 A;  4X66 Q;  4BY7 G;  4C3J H;  1C9O A;  1GO3 E;  4A75 A;  4DV7 Q;  3M4P A;  1VQI A;  2BH8 A;  4GLA C;  1J6Q A;  3EBE A;  3HKZ G;  3T1H Q;  1NE3 A;  1UWV A;  1IBK Q;  1CSQ A;  2VUM G;  2PI2 E;  4UP8 A;  2Z0S A;  4A93 G;  4A3E G;  4R4O A;  3GD7 A;  1UE1 A;  4K0K L;  5JEA J;  4HJ9 A;  1DGS A;  2B29 A;  2UUC Q;  1K8G A;  1VQ5 A;  3S14 H;  5DLQ E;  4JI1 L;  1HR0 L;  4DAM A;  1IBL Q;  1XTD A;  4LUZ A;  4DR7 Q;  4A3L G;  2JQO A;  3F2B A;  4HIO A;  1XMQ L;  2ZJQ A;  1FJG L;  3T1Y L;  1UE5 A;  5M3M G;  1BBU A;  4JI8 L;  3CCM A;  1W2B A;  3UE1 A;  4O2D A;  5C44 G;  3RLN A;  3M9B A;  1YHQ A;  4LFA L;  2B63 G;  1Q1E A;  4JI7 Q;  2IX0 A;  1PH1 A;  1SFO H;  3GDE A;  1VQF A;  3S1M H;  4MTN A;  3GTL H;  3PUW A;  4JI3 L;  1U0L A;  4R4C A;  3UDI A;  4B3S Q;  1N33 L;  3L2P A;  2ID0 A;  1SRU A;  3AFP A;  4GOP B;  2K5V A;  3CAM A;  4DV4 L;  1WJJ A;  1B8A A;  4GLV B;  3NBH B;  1X9N A;  3J81 i;  2LSS A;  1Y1V G;  4A3C G;  4A3B H;  4NXN L;  3CW2 C;  2H5X A;  4YCW A;  2VNU D;  3I56 A;  4DR5 L;  4IPH A;  2Z6K A;  2JEA I;  3RR5 A;  1OXU A;  4IOC A;  1MKH A;  2KHI A;  1C0A A;  4K0K Q;  2PNH A;  4GLX A;  1YIT A;  4DR4 L;  4RMF A;  4LF7 L;  3CF5 A;  1X56 A;  3A5U A;  4JI1 Q;  1HR0 Q;  1CKO A;  2HIX A;  4BBR H;  3RZD H;  3BU2 A;  4IPC A;  4RG1 A;  5GAG C;  1XMQ Q;  1FJG Q;  5M5X H;  4OWT B;  4A3G H;  3T1Y Q;  3W1G A;  1Q8K A;  3J81 c;  2YV5 A;  4PMW A;  4LFA Q;  1I50 H;  3FKI G;  1ASY A;  4UP7 A;  1AE2 A;  4HIM A;  1T9H A;  3ULL A;  4B3M L;  4JI4 L;  2NZO A;  1XNQ Q;  2AHO B;  1BBW A;  2YYZ A;  4YWM A;  3EIV A;  4OON A;  2Y0S E;  1BKB A;  4DV2 L;  4DK6 C;  1X6O A;  2D0O A;  5GAE C;  3HOX G;  4IO9 A;  2GVB A;  4HJ7 A;  1N33 Q;  5C4X G;  4BA2 I;  3FP9 A;  4DV4 Q;  1JT8 A;  3H0G H;  4O0A A;  1QUQ B;  1G29 1;  2BA0 A;  3CCE A;  4AH6 A;  1KQS A;  2ZJP A;  4EQ5 A;  3AYH B;  3KLW A;  4BXX G;  2UXC L;  4NXN Q;  4OO1 G;  3PUZ A;  1I3Q H;  4R4Q A;  1KRT A;  3I4N G;  4DR5 Q;  2R6G A;  1A8V A;  4JBJ A;  1VQP A;  4JV5 L;  4YCV A;  3RLO A;  3PO2 G;  1E1O A;  1N36 L;  2NZH A;  5C0X G;  3HOW G;  2R7Z G;  1PH4 A;  4IPG A;  1P8L A;  4DV6 L;  2UUA Q;  4JOI A;  4DR4 Q;  1H95 A;  4LF7 Q;  4DK3 C;  4DV0 Q;  4OO1 I;  1HZ9 A;  4P71 A;  3CCL A;  2R93 H;  1YJW A;  1HNZ L;  4XTC S;  2OCE A;  4R1J A;  1HNX L;  2HHH L;  1XPU A;  3GTK H;  3H3V H;  3GTJ H;  3HOZ H;  3M4Q A;  1EQR A;  1JB7 A;  4GKK L;  5GQO A;  5C0X I;  4QIW E;  4GKJ L;  2JA6 G;  5FLM H;  4YWL A;  3I4M G;  1PHJ A;  4JI4 Q;  3CMA A;  4TVA B;  2ES2 A;  3TQY A;  5M3F H;  1FVI A;  2PMZ E;  5IY0 A;  4DV2 Q;  3AEV A;  1L2F A;  2YTV A;  3AQQ A;  3CQZ H;  1IZ6 A;  3D0F A;  1HZC A;  3RLF A;  2QGQ A;  1HR0 W;  2UUB L;  1Q12 A;  3JAM i;  4GNX B;  1R9T H;  5BR8 L;  2PQA A;  2K5H A;  2ZM6 L;  5IYC G;  4JI3 Q;  1K73 C;  3K7U C;  3CP0 A;  4OXP A;  1IBM L;  4GN4 B;  3J81 j;  1GKH A;  1HH2 P;  2AKW B;  4A3I G;  1JE5 A;  2KHJ A;  2WP8 J;  5C4J H;  1S72 A;  2UXD L;  1VQ9 A;  2WAQ E;  2ZTE A;  4LF9 L;  4PG3 A;  5GAH C;  4JV5 Q;  4A3M G;  1HZA A;  1NY4 A;  4R4T A;  1YHB A;  5IYD G;  1N36 Q;  4UY8 C;  3HOU H;  4JYA L;  1WCM H;  1WOC A;  4DV6 Q;  1A0I A;  1GD7 A;  1VCI A;  4NB3 A;  4BY7 H;  4A3K G;  1XJV A;  4LF6 L;  1HNZ Q;  3JAM c;  4P75 A;  2D62 A;  4MZ9 A;  3W5O A;  3PO3 G;  4Y52 H;  1KL9 A;  1VQB A;  4NXM L;  4GKK Q;  4GKJ Q;  4A93 H;  4B3R L;  1U5K A;  2N3S A;  1EYG A;  1GM5 A;  1PA6 A;  5GAD C;  1KIX A;  4IFD J;  3KF6 A;  4BY1 H;  4NPS A;  3PIO A;  3PCO B;  5IP9 H;  1VQ7 A;  1B7Y B;  2R7F A;  2N78 A;  2NN6 I;  5J3B A;  1PH2 A;  3DM3 A;  1FL0 A;  4LNQ A;  2DGY A;  2UUB Q;  5FJ8 G;  5BR8 Q;  3S2D H;  2ZM6 Q;  4P73 A;  4TQU S;  2A8V A;  1P16 A;  1IBM Q;  4UP9 A;  4LW1 A;  4PZ8 A;  1CKM A;  1S40 A;  3G71 A;  5IP7 G;  2E2I H;  2UXD Q;  1OXS C;  5E7N A;  1YI2 A;  4LWC A;  3A5Z B;  3AFQ A;  2LXJ A;  3NEN A;  3PSI A;  2I5H A;  4X65 L;  4DV3 Q;  4OWW B;  4JYA Q;  4OX9 L;  3CD6 A;  4A3D G;  5EAY A;  2I5L X;  4QY7 A;  2K14 A;  3KJP A;  1JJ2 A;  1YZ6 A;  2ZJR A;  1VQC A;  1Y1W H;  3PGZ A;  4LF6 Q;  4H02 A;  2ASB A;  1EOV A;  1G6P A;  2F52 A;  1CKN A;  3HKZ E;  4NXM Q;  4GN3 B;  1K9M C;  4DV1 L;  3MEF A;  2Q2I A;  4B3R Q;  3UDX A;  4X64 L;  4YY3 L;  4A3F H;  2K75 A;  4JG2 A;  4L5T A;  1Q82 C;  4YWK A;  1X65 A;  4JOI C;  2RCN A;  1VQG A;  4P74 A;  4GN5 A;  4HJA A;  1VQ4 A;  1Q86 C;  1Q7Y C;  3GTO H;  2JA5 H;  4LF5 L;  4DV5 L;  5ELN A;  2JA8 H;  3S15 H;  3K0X A;  4AQY L;  3WWV A;  4ALP A;  1SE8 A;  3VDY A;  4JBK A;  2NVT H;  2CKZ B;  3DLL A;  1XMO L;  4LF4 L;  4KI0 A;  1Z9F A;  2AWO A;  4C3I H;  4JI5 L;  4JI8 Q;  3CC7 A;  2V1C C;  2Y0S G;  2DUD A;  1SN8 A;  1ASZ A;  4AIM A;  3I4O A;  4OX9 Q;  5HY6 A;  4LFB L;  1TWC H;  1TWG H;  4JCV E;  3SGI A;  2JJQ A;  2IHE A;  4BXX H;  1YNX A;  1XPR A;  1N34 L;  3UE0 A;  2C35 B;  4DR6 L;  3E9H A;  4KHP L;  2LXK A;  3S17 H;  4KLK A;  4A3B G;  2QA4 A;  2JA7 H;  2IY5 B;  4DV1 Q;  5JJL A;  4X64 Q;  1E24 A;  3HOW H;  3TRZ A;  1Q1B A;  3S24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...