4GLAC

Obody nl8 bound to hen egg-white lysozyme
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
90
structure length
89
Chain Sequence
b'LHGTEVVVAGWVASLGDYGRVKIVKVSDRGGAAVPVYLEAGKTPDHLFKVFAELSREDVVVIKGIVEASKGVGRGVEIFPSEIWILNKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
total genus 14
structure length 89
sequence length 90
chains with identical sequence D
ec nomenclature ec 6.1.1.12: Aspartate--tRNA ligase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4glaC00
4JI4L 3HOYG 4DV3Q 1YEZA 1XNQQ 4C3JH 3HKZE 1E22A 2CWPA 2N8NA 4K0KL 2E8GA 4R1JA 3FHWA 2I5LX 2QGQA 2ZM6L 1YBYA 1JJGA 2KENA 4A75A 4KI0A 4L5RC 2B3GA 1RIPA 2C35B 3TS0A 2JA6H 1Q12A 2E5LL 2I0QA 4LF6L 3HOUG 1PA6A 1N34L 3CCRA 4GLXA 1IL2A 1EYGA 1VQDA 4H02A 1QZGA 2WAQG 4BY7H 2PI2E 2NN6G 4P72A 1X54A 3CC7A 2N49A 1E7ZA 2F3IA 1XNRQ 4OX9L 1TWFH 3M4QA 3CD6A 4L5QA 1VCIA 4LF7L 1A0IA 2YTYA 4POFA 4DV4Q 1EUJA 1XMOL 2UUBL 4WJ3M 2JEBI 4DV6L 1EQQA 4C3IH 1A62A 1U0LA 1Q1BA 3CCSA 4B3TL 3S1MH 3ULLA 1EIFA 2PQAB 3CAMA 2ZJRA 1PH8A 4RMFA 4B3SQ 1B8AA 2H5XA 1N33L 4FDBA 3T1HL 3M4PA 2V1CC 3UDFA 2AWNA 1X3GA 2GVBA 4LUOA 4GNXA 4BA2I 3W5OA 2NVQH 4YWMA 4YHHQ 2FXQA 1V1QA 4HJ7A 1IBLQ 5GADC 4DR5L 1L1OB 1WFQA 3PCOB 2VQFL 4DR6L 3CCMA 1NE3A 2R6GA 1I94L 2CCZA 1UE5A 1SMXA 4QY7A 3F8TA 1PH3A 2D0PA 5IYDH 3RLOA 1GD7A 3PV0A 4DV7Q 4DNIA 4DR4Q 4X62L 4BXXH 1JE5A 5HGQA 1PH9A 5M3MG 4HJAA 2BH2A 2DGYA 3UDXA 3ULJA 4X65Q 3UDGA 4DV3L 3T1YQ 3J80c 1XNQL 1OXXK 1VQ6A 4A3KH 2K75A 4OXPA 1Q46A 1HR0W 3GTPH 3S2DH 4JC0A 3HKSA 4OONA 2VL6A 2Y0SG 1HR0Q 3L0OA 3PO3H 5IY0A 1BBUA 3S2HH 5IP9G 3UE1A 1XTDA 2A1AA 4NB3A 5IP7G 1GO3E 2UU9Q 1FJGQ 1N32Q 4OO1G 2R93G 3G4SA 1YJNA 4JBJA 3GTQH 3M3YH 1XNRL 1TWAH 1GKHA 1YHBA 1VQBA 4X66Q 2HHHQ 4DV4L 2CFMA 3F2CA 4QL5A 1OXTA 1KL9A 1SN8A 4GN4B 1KRTA 5C0XI 3J7A5 3LGJA 4B3SL 3KF6B 5GAHC 1QVFA 2YTVA 4MNOA 4C2MH 2MNAA 5FJ8H 1VQ9A 1YI2A 1EIYB 1GM5A 1BKBA 1FGUA 2PNHA 4YHHL 2WAQE 1DGSA 2R7FA 1IBLL 4A3DG 3GTGH 4A3EG 5FLMH 1MJEA 1Q7YC 4J15A 2ALYB 3HOXH 2VNUD 4DV2Q 2K50A 4R4IA 1QZHA 4HIOA 2OTLA 1MIUA 3I4NH 4JG2A 3STBD 1VQPA 4DK3C 4A3BG 3I4MH 2AWOA 1CKNB 2VQEQ 4JI5Q 2R92G 4DR4L 1H95A 2Q2UA 3RLFA 3T1YL 4JOIC 4X65L 5M5XH 3PUZA 4DV1L 2ZJPA 4LF9Q 1I3QH 1XPUA 3PO2H 4A4IA 4IPHA 1X6OA 4JI2Q 3NENA 5LMUQ 2UUCQ 1JB7A 3A0JA 1HR0L 1EOVA 4Y7NH 2IY5B 2KHJA 1XMQQ 1LYLA 2WP8J 4DKAC 2B63H 1Q8KA 4QJFA 4GN3B 3AFQA 1KC8C 3CCJA 2UU9L 1CUKA 2I5MX 3I4OA 4NXMQ 1FJGL 4POGA 4A3LG 1N32L 4JI0L 2BA1A 4A3IG 3K80C 5ELOA 3ULPA 3HOVH 2NVXH 1IBMQ 1CSQA 3H3VI 2JA5G 1HNWQ 4JI7Q 1PH4A 3TEHB 3KOJA 2ZTCA 1K8GA 4AQYL 2AHOB 2Z6KC 2RCNA 3CP0A 2IHFA 2B29A 4X66L 3F2BA 2E2JH 2HHHL 3S16H 3J81c 5IT9c 5IWAL 3NBHB 1Y14B 3HOYH 4LUVA 2Y0SE 1QUQB 4LWCA 4R4CA 1SLJA 2JA7H 4EQ5A 1TWHH 4PG3A 3GO5A 4BBRG 3G71A 4NXNQ 3H15A 3E9IA 4IO9A 2OTJA 4LUZA 1LM0A 4XTCS 5AJ3Q 3NELA 2QEXA 1M90C 3J81i 5JEAG 2HT1A 3GTOH 4WJ4A 3BZCA 1VQEA 2LXKA 3HOUH 4HIMA 4DV2L 5M5WH 3RZOH 3HOZG 2JJQA 5BR8Q 3PUWA 5JEAJ 1P16A 3CC2A 3CCEA 3KDFA 4OWXB 4YWLA 4R4QA 3TQYA 4JI6Q 3CPFA 2JEAI 2VUMG 3KFUA 3S17H 4JI5L 2VQEL 1IZ6A 4A3GG 2K4KA 4LF9L 1X55A 2I5HA 3MXNB 1PYSB 3MEFA 3CMAA 2UXBQ 5LMUL 1PFSA 2UUCL 4JI2L 2MFIA 4GLVB 1L1OA 1BVSA 2CQOA 3I7FA 4EX5A 5M3FH 1T9HA 4B3RQ 1VQNA 3BZKA 1NY4A 2A8VA 1MJCA 2YV5A 4QQBX 4BBSH 3EIVA 1XPRA 3UE0A 2CKZB 3K7AH 1ASYA 4NXML 1JMCA 5J3BA 4GOPC 3U50C 1IBML 4KHPL 3AEVA 3E0EA 5IYCH 4DV5Q 4JI7L 1HNWL 3UDIA 5LMNW 4DUYL 1PH2A 4UP7A 1J5EQ 3GD7A 5JJIA 2NN6I 4P75A 1N36Q 3ICEA 4A3DH 2NVYH 3WWVA 1VQJA 5E7NA 1YJWA 5GQOA 2UXDL 3PF4A 2JA8G 5C3EG 4MZ9A 4YY3L 3S15H 4NXNL 1VQIA 4UP8A 3GTJH 5AJ3L 4YCWA 2KHIA 5IP9H 4LNQA 3L2PA 2EIFA 1VQ5A 1G291 1UE6A 4YWKA 5C44G 1KRSA 5IP7H 2OQKA 5FLXc 3PGZA 4YCVA 2R93H 5BR8L 3D31A 1B7YB 2YTXA 4GOPB 4APVA 1W3SA 2JK8A 3K8AA 3M85A 4JI6L 3CMEA 2MQHA 3HFZB 2NZHA 1Y1VH 2ID0A 2RHSB 3GDEA 1D8LA 2K5NA 4IOAA 2R7DA 4UP9A 2AMCB 4C3HH 2UXBL 4A3CH 1SRUA 5M5YH 1J6QA 3Q8DA 4X64Q 3H0GH 4KHZA 4DR3Q 2IX0A 5IYDG 1IBKQ 3HOWH 4B3RL 1JT8A 4DV0Q 4HIDA 5DLQE 1VQHA 4BXXG 4DR7Q 4GKJQ 1S72A 3PUXA 4JBWA 4A3JH 1M1KC 3GTKH 4JYAQ 3DM3A 1G51A 2EQSA 2VS1A 1WCMG 3W1BA 2R7ZH 1NTGA 4HJ9A 2IT1A 2UUAQ 3H3VH 3KF8B 1BBWA 1FL0A 4OO1I 2ATWA 1J5EL 1WOCA 3KYHC 1JJCB 1VQFA 4IPCA 1CKOA 5HY6A 1TWCH 1N36L 2OWOA 1SR3A 4JV5Q 1I6HH 4AH6A 5C4XG 4GLAC 4DAYB 3PF5A 3EN2A 4LFAQ 4DV7L 1KAWA 3ERSX 2YU9H 1Z9FA 2N3SA 4Y52H 1U5KA 1V9PA 2K52A 4JI3Q 3K7UC 4P74A 3CCVA 2K14A 2KCMA 4OWWB 3GTMH 1X65A 5H1SE 4PMWA 4LF4Q 4P71A 3VDYA 1AH9A 4L5SA 1QUQA 4JOIA 2JA5H 4JBMA 5IYBG 5K36G 1NBWA 4K0KQ 3CXCA 2ASBA 2E2HH 1O7IA 3AFPA 1KD1C 3CW2C 1ASZA 3S24A 1CSPA 2BH8A 4A93H 1E3PA 1QVCA 1PV4A 4R4OA 3HOXG 1VS0A 2PMZE 4PZ7A 2Q2TA 4X64L 3I55A 3SGIA 2RHQB 4A3MG 4DR3L 1Y1WH 1IBKL 3G6EA 1HNXQ 1KHIA 2LXJA 1OXVA 2VY3A 1L0WA 4BBRH 4JI1Q 4DV0L 4A3FH 1VQLA 4BY1H 3I4MG 4DR7L 2D62A 4IPGA 4ME3A 4GKJL 5GROA 2JQOA 4LFBQ 4X6AH 1XMOQ 3AYHB 5GAEC 2ZJQA 4JYAL 4HJ8A 3S14H 1C7YA 3JC66 1KXLA 1I50H 1X56A 4DR2Q 1VQKA 1KIXA 1V43A 2D0OA 1YHQA 2UUAL 1KQSA 1OXSC 2B63G 4LFCQ 1VQAA 1X9NA 1HNZQ 4A76A 4A3GH 1AE2A 3PIOA 2EXDA 3M7NA 2XGTA 4AIMA 3PIPA 4PZ8A 3TRZA 3RLNA 4DR5Q 4LF8Q 2PQAA 2RF4A 2F4VQ 1NMGA 2KCTA 4LFAL 3K81C 3CPWA 1OTCA 5ELNA 4JI3L 5JJKA 1NJIC 3A74A 1XPOA 2HQLA 2IHEA 3FKIG 1K73C 4IPDA 1Q81C 2UXCQ 4LF4L 1XMQL 4LF5Q 1HZBA 2ZTDA 2JA7G 1HJPA 4IJLA 4B3MQ 3KJOA 1C0AA 1Q82C 1PYBA 4A93G 1TWGH 1HZCA 4DUZQ 1C9OA 3PSIA 2L15A 3CCQA 1PVOA 1W2BA 1L1OC 1NMFA 1YNXA 3A5UA 1YITA 3PUVA 5JJLA 1X3EA 1UWVA 3PUYA 2JA6G 2JA8H 5C3EH 1HNXL 1UEBA 2WFWA 3W1GA 5IE8A 5LMNQ 2MO0A 4TVAB 5M3MH 3CF5A 4JI1L 4GOPA 2WB1G 4DK6C 3S1RH 4JI8Q 1VQ7A 4BY7G 2HIVA 4LFBL 1AE3A 4GS3A 5C44H 4GNXC 1K9MC 2DUDA 4OWTB 3A5ZB 1VQCA 2N78A 3KDFB 3U4VA 3JAMc 4IOCA 4DR2L 4IFDG 3BU2A 5M3FG 3RN2A 1MKHA 1R9TH 4L5TA 1K83H 4LFCL 3J7ZC 1HNZL 1YVCA 1G6PA 4BBSG 1SFOH 3ER0A 4IFDJ 1UE1A 2KBNA 3J81j 1CKMA 5GAGC 1PH7A 1Q1EA 1E1TA 1K0RA 3JAMi 3OW2A 1VQOA 4LF8L 2K5VA 3E9HA 3KF6A 2F4VL 3OTOQ 2HIXA 5IYCG 4P73A 3GTLH 3STBC 1FVIA 2BA0A 1VQMA 3TS2A 2NZOA 2QA4A 1L2FA 2PI2A 3I56A 4AYBG 4BA1I 3KLWA 2UXCL 1LUZA 4DV1Q 4LF5L 4IFDI 1PH5A 1WYDA 4KLKA 4UPAA 1N9WA 3BJUA 4GNXB 4B3ML 1WCMH 5C0XG 2ZTEA 1HZ9A 2GVAA 4DUZL 1CKNA 3U58A 3F1ZA 1HZAA 4A3EH 1EWIA 4A3KG 4ALPA 1WJJA 1EQRA 3L7ZC 5C0XJ 3J80i 4O0AA 3M9BA 4DV5L 4DR1Q 2LSSA 1VQ4A 1YHAA 4JI0Q 5C4XH 2IX1A 3HKZG 3PO3G 4HJ5A 1LTLA 1B70B 4A3BH 3M4OH 4GKKQ 2Q2HA 2R92H 2K5HA 5LMNL 2JA9A 1A63A 2NVTH 1E24A 4JI8L 3B6YA 1Y1VG 1PH6A 4AQYQ 1E1OA 2Q2IA 2CWAA 1OXUA 1GVPA 4IJHA 4JBKA 5IWAQ 4A3CG 3H0GG 1X3FA 3FP9A 3HOWG 4XIGS 1PHJA 5IYBH 1IYJB 4JI4Q 3K0XA 4A3LH 1RL2A 1K8AC 2OCEA 4PZ6A 4A3IH 3RZDH 4A3JG 1YJ9A 4UY8C 1WI5A 4TQUS 2Z0SA 5FJ8G 2ZM6Q 1N8RC 2R7ZG 3OTOL 1VQGA 1Q86C 2WB1E 1K3RA 2A19A 4A3MH 2E5LQ 4LF6Q 4HIKA 4QGUA 3S1QH 5FLMG 1P8LA 3G48A 4DAMA 3DLLA 1N34Q 1UE7A 3KJPA 1QVGA 1IXRA 1TXYA 3EBEA 2E2IH 3I4NG 1I5FA 3RR5A 5C4JH 3IRBA 1HH2P 1SE8A 1Z47A 4R4TA 3I2ZA 1S40A 4OX9Q 2ES2A 1VQ8A 3CCLA 2XTIA 1D7QA 4LF7Q 2JE6I 2VZAA 4O2DA 2UUBQ 3NEMA 4DV6Q 3PO2G 4DPGA 2VW9A 2AKWB 2Z6KA 4DR1L 3F2DA 4B3TQ 4LW1A 3HOZH 4GN5A 3ZJYC 1EFWA 3RN5A 3RNUA 3OYYA 1N33Q 2VUMH 1YIJA 2YYZA 4GKKL 3T1HQ 4KHPQ 4NPSA 5EAYA 3CCUA 3D0FA 1JJ2A 2GN5A 2OQ0A 4AYBE 3CC4A 4JV5L 1XJVA 1SROA 1A8VA 3U4ZA 2MO1A 4DUYQ 3HOVG 2VQFQ 4DR6Q 1YZ6A 3FKIH 1PH1A 1I94Q 4RG1A 3S1NH 4MTNA 1S3OA 4YCUA 4JCVE 2UXDQ 2F52A 3AQQA 3TREA 1Y1WG 4X62Q 4QIWE 3CQZH 4YY3Q 4A3FG 4BY1G
chains in the Genus database with same CATH superfamily
4JI4L 3R8BA 5JVH3 3MC0B 3FEWX 2CWPA 4B9WA 2E8GA 1JJGA 2KEDA 4A75A 1F9QA 4LF6L 1RDPD 2B2UC 3CCRA 1QZGA 3CC7A 2F3IA 4L5QA 3C2PA 3KLSX 1WD0A 1DM0B 1U0LA 1Q1BA 4ABNA 3CCSA 1G2TA 2C5CA 3QWNA 1PH8A 3M4YA 3M4PA 1EY6A 2PMZB 2GVBA 4GNXA 4IUUA 3W5OA 4YHHQ 1WD1A 5J39A 1G6ZA 2F0OA 4RFBA 4KKSA 1QJOA 3F8TA 1PH3A 1FNWA 1VMCA 5IYDH 1Y69U 4IURA 4BXXH 1JE5A 4A3DG 2BH2A 2DGYA 3T1YQ 1WTHA 1VQ6A 1OXXK 2K75A 4OXPA 3GTPH 1AP0A 1B9NA 5FOBB 2L11A 4J6HA 1I4GA 2A1AA 1F2LA 1HUNA 4QUCA 1IW7C 2B8FA 1N32Q 3VA7A 1LTGD 2CHBD 1E0BA 3GTQH 1XNRL 1GKHA 1Q3LA 1VQBA 2XIWA 2HHHQ 1OXTA 3LGJA 3NK9A 4B3SL 1STHA 4KHVA 4WRDA 2YTVA 4MNOA 1G2SA 5K36H 1PLFA 1VQ9A 1EIYB 2NVTB 1FGUA 2E75C 3AMUA 3NPPA 1IBLL 2K01A 4RGMA 3GTGH 4A3EG 1MJEA 2HD3A 4J15A 2ALYB 3EA6A 2K50A 2DY8A 3A8KE 1GUSA 1EIHA 1SXTA 3I3CA 3I4MH 3MA2B 2VQEQ 3SK4A 1H95A 2Q2UA 1XPUA 3PUZA 4DV1L 1S5BD 4IUNA 5LMUQ 1X6OA 4JI2Q 2CVRA 1JB7A 1EY5A 4Y7NH 1WTRA 2KHJA 2A69D 4DKAC 2QEJC 1KDCA 3IFDA 4QJFA 4GN3B 3I4OA 4NXMQ 4A3LG 1ZKOA 2E2IB 1I3QB 2JA5G 4QF4A 1LTRD 3KOJA 2Z6KC 3CP0A 1A15A 1TS5A 4HMIA 1O80A 2B63B 3J81c 5IWAL 3NBHB 4CKCA 2Y0SE 1I4RA 1TWHH 3J7YW 1PRTB 4PG3A 3HOVB 4BBRG 4NXNQ 1O7YA 1KLGD 2H4OA 4J8QA 3E9IA 4KKUA 4LUZA 3GTOH 4LJZC 3J81i 2LXKA 3H6MA 5JOBA 3HS0C 3S16B 2RDFA 3RZOH 3HOZG 2JJQA 3HOYB 3PMFA 1P16A 3IAYA 3CCEA 5LL6S 4OWXB 4YWLA 3TQYA 2JEAI 2Q8RE 4A3GG 2C9OA 2K4KA 3ITPA 4KN4C 1FNVA 4C3JB 1PFSA 2UUCL 2FHTA 4G7HC 5EKIA 4MHEA 1LTTD 4B3RQ 3N6RA 3BZKA 4HCSA 2WV6D 3EIVA 2WB1B 3K7AH 1SE3A 1JMCA 1SDFA 1CQFA 1GUTA 5JJZA 3AEVA 4KHPL 2VB3X 5IYCH 1HNWL 1PFMA 2CH4W 1PTOD 5D3DA 1PH2A 5JJIA 3TN2A 3V2TA 3HRZC 4EQNA 3Q22A 4C3IB 1VQJA 2DN8A 1YJWA 3S1MB 2UXDL 3V96A 5C0XH 5AJ3L 5IP9H 3L2PA 1CHQD 1SBBB 5IP7H 4Q0FA 2OQKA 3BDCA 2MJ8A 4C1NI 3D31A 4APVA 1IHZA 2B2TA 3M85A 3QJYA 3CMEA 3HFZB 4CHTB 5ISRA 3GDEA 1D8LA 4HN7A 1GUGA 4GZYC 4TRDA 2UXBL 4C3HH 2EYOA 1SRUA 4DFAA 2WACA 2BDOA 3H0GH 3M7GA 5CV9A 1SNDA 1GHKA 3KBXA 4HIDA 3A7LA 2A69C 1BOSA 3A54A 4N9PA 2VS1A 2R7ZH 5KNCA 3M3YB 1NTGA 1BO0A 2F0HA 3N52A 4HJ9A 5FLXE 4G7OC 2ATWA 1PMRA 1J5EL 1WOCA 4IPCA 5IOCA 2CW0D 1SR3A 4EQOA 3MVVA 2LMCB 3EN2A 4DV7L 3CU7A 2YU9H 1F77A 2SDFA 4P74A 2KCMA 4H13C 1S4ZA 4LF4Q 1IL8A 4P71A 3T13A 4K6DA 4R8IA 3HGBA 3T4AC 1KD1C 3S24A 1CSPA 1PFBA 1E3PA 1IKLA 1QVCA 3PO2B 4X64L 3I55A 5A2QL 2RHQB 1OXVA 4DV0L 5C4ZA 3U9OA 4DR7L 2D62A 4LFBQ 2JQOA 2ZJQA 3S14H 1X56A 3BVZA 1GXDC 1L0XB 1TVXA 1YHQA 4HMJA 2UUAL 4LFCQ 1VQAA 3T53B 1HNZQ 4A76A 1LACA 4RGTA 4BY1B 4FP5D 2F3WA 2PNRC 3MEHA 3P75A 3RLNA 2RF4A 2F4VQ 4LFAL 2KCTA 3AB9A 3K81C 3VYTA 5ELNA 2M00A 5JJKA 1TY2A 3U9SA 4IPDA 2UXCQ 1HZBA 3KJOA 3GV3A 4KJOA 1Q82C 3EJIA 3S17B 4KKTA 1L1OC 2ICEC 3Q6SA 2PW7A 1X3EA 1UWVA 3PUYA 5DM73 4R9WA 1HNXL 5IE8A 5LMNQ 4TVAB 4GOPA 4WORA 4DK6C 3S1RH 2NUCA 2JYOA 2WINB 1TWGB 2SNSA 4JPBW 5C44H 1K9MC 4DAVA 2XWJB 2N78A 3BVMA 3U4VA 1TIID 2RVLA 5IGDA 4K2LA 1AZPA 5ELFA 1EYDA 1G6PA 4BBSG 4KD3A 1LTSD 5KRUA 2NVYB 1UE1A 3A55A 2F0TA 2F03A 2K03A 3O13A 1BCPF 1VQOA 3TP6A 2K5VA 2CW0C 3KF6A 5I6WA 3OTOQ 3S15B 1STNA 3STBC 3HEJA 5FO8B 1VQMA 4OL7A 1F9RA 1ESFA 2PI2A 2NBFA 3GP7A 1HQRD 4DV1Q 4IFDI 1QNUA 4KLKA 3VYUA 1N9WA 3BJUA 1U9RA 3W3AA 2A6HD 3GTLB 1CKNA 4IQZA 4A3EH 1EWIA 3JAME 4DR1Q 2KHSA 5M5YB 2IX1A 1B70B 3K0YA 2JA9A 1A63A 2NVTH 1JICA 3B6YA 1Y1VG 4JK1C 1OXUA 1D5XC 2FINB 5IWAQ 1I4HA 2RQXA 4XXEA 3HOWG 2EYMA 5IYBH 4A3LH 1A2UA 1RL2A 2EOTA 1K8AC 4ZLTF 1I6HB 3X3NA 1WI5A 5IODA 4TQUS 2MP1A 4Z9CB 1VQGA 1Q86C 1EY4A 2A19A 2HUGA 3MXPA 1P8LA 3G48A 1UE7A 3TP5A 1EEFD 2E2IH 2VB2X 3DHQA 1I5FA 1HH2P 1Z47A 1NAPA 4RKLA 4IUTA 4DAPA 4CDEC 4K8JA 3A56A 2VZAA 4O2DA 2UUBQ 4DPGA 2AKWB 3TZDA 1QOHA 3OIPA 3HOZH 4DNRB 4GN5A 3ZJYC 3DMUA 1YIJA 4GKKL 4KHPQ 3CCUA 3D0FA 1TU2B 2OQ0A 2L9HA 3LWUA 1SROA 1A8VA 1U4PA 2VQFQ 2TSSA 3E5SA 3FPUB 1S5FD 1S3OA 4MTNA 4DNTB 2UXDQ 1BCPB 1I6VC 2MPMA 2R3ZA 3TREA 4X62Q 4A3FG 1CZWA 3K6OA 1EWCA 3S9WA 4C3JH 3HKZE 2N8NA 4ME5A 2FMCA 2I5LX 3FHWA 2ZM6L 1QNKA 1ESRA 2C35B 1Q12A 2E5LL 1BF4A 1PA6A 3VR4A 4GLXA 4FXKC 1PTOB 4LAAA 2PI2E 1X54A 1AEXA 2N49A 1E7ZA 2NB0A 4OX9L 3CD6A 1VCIA 3E0JA 2YTYA 4EGVA 4POFA 1EUJA 1VF7A 1HFGA 2IJ0A 4DV6L 2CQAA 4C3IH 2GA4B 1C4QA 4BWGB 1KDAA 2LFNA 4UHVA 3S1MH 3VR5A 1K8OA 3CAMA 1B8AA 2H5XA 1N33L 2JA8B 5C3EB 4FDBA 3UDFA 2B2YA 4LUOA 4BA2I 4DF7A 4DR5L 1L1OB 5JPMC 3D3RA 4RCNA 4RWSC 2CCZA 4O42A 4QY7A 1I4XA 3RLOA 3BYTB 1GD7A 4DV7Q 3H91A 1TS4A 3KF8A 1R9TB 2NTTA 5M3MG 4X65Q 4DV3L 3PIP3 3J80c 1XNQL 1E2ZA 2NVQB 3DWPA 4JC0A 3S2DH 4DAYA 1F9SA 3L0OA 1M4VA 2F0DA 2VXWA 4HEDA 3VA5A 5IY0A 5IP9G 3T56B 5CBAE 1CQVA 1JB3A 1SNCA 1SSOA 5IP7G 1GO3E 2PO4A 1JOOA 2HDMA 1FJGQ 5KNDA 5BN4A 1YJNA 1I4PA 4RHRA 1AW7A 1E2WA 3M3YH 1NNXA 2R61A 1WCMB 3R2TA 2A68D 4RGOS 4X66Q 4DV4L 1HHVA 2EYJA 5I9OA 3IL8A 1KL9A 1SN8A 3J7A5 3KF6B 2Q8TA 5T1GA 1A3VA 3AU7A 1QVFA 5FJ8H 5C5MA 1RTOA 1GM5A 2PNHA 3HG9A 1DGSA 1ET9A 5FLMH 1H9JA 2VNUD 4DV2Q 4R4IA 3I70A 2OTLA 2B8GA 4NMZA 3CRKC 2EJFC 3OMGA 2IL8A 2AWOA 1BR9A 1CKNB 4C2MB 4DR4L 5C3XA 5I6YA 4JOIC 1CZGA 3ERQA 2ZJPA 3PO2H 4HR7B 2OXPA 5EPJA 3NENA 5EKKA 1HR0L 3HOXB 4X3UA 1EOVA 2SOBA 2WP8J 1CA6A 4XT3B 1KC8C 1JWMD 2UU9L 2KJXA 2RCFA 5M5XB 5FO9B 1IBMQ 2HCIA 1KLUD 4JI7Q 1UAPA 1U4LA 1PH4A 3TEHB 2ZTCA 2RCNA 2QKIC 1B9MA 2EDGA 2B29A 2E2JH 1HXYD 1QUQB 4ZAIA 1UNSA 3GO5A 3G71A 3H15A 2OTJA 5DEHA 1M90C 2EY5A 4WJ4A 3KLSA 1VQEA 1EYCA 5DNFA 4CKEA 1Y8OB 4HIMA 1B3AA 5BR8Q 1SNMA 3PUWA 2JA7B 3KDFA 4OGQC 4I7ZC 4R4QA 2L55A 3CPFA 4LMQD 3C3LA 3S17H 4JI5L 4RGNA 4DN4M 5CBEE 4N8X1 4LF9L 2I5HA 4G57A 3MEFA 1B53A 1SMYD 1XYIA 2MFIA 1D6EC 4GLVB 3J81E 1BVSA 2CQOA 4EX5A 1DD2A 1T9HA 2QDLA 4J1MA 2JA6B 1CI3M 4BBSH 3ONAB 2XN9C 1XPRA 2CKZB 2HCCA 5J3BA 4BY7B 4PNYA 5EGTA 5E4WC 3U50C 2MHVA 1TWFB 1F9PA 1HTLD 4DUYL 5M3FB 2DJGC 4UP7A 1LTBD 3GD7A 3ICEA 1N36Q 5KYLA 2NVYH 2A68C 5L37A 5GQOA 2RA4A 4K2KA 3S15H 1DOKA 1VQIA 3TDQA 4YCWA 2KHIA 2EIFA 1VQ5A 5C44G 1I4QA 5C3WA 3PGZA 4AYBB 3BVGA 4MN3A 4A3DB 2EPBA 4HCEA 1KAAA 1B7YB 2PYKA 2YTXA 4N9TA 1W3SA 1II3A 3J7AF 4JI6L 3H94A 1WTXA 1EIGA 1Y1VH 2ID0A 2EYPA 4QIWB 2AUJD 4A3KB 2AMCB 2F0UA 3SK8A 4IOAA 5D3IB 5M5YH 1J6QA 3Q8DA 5ELDA 1TQOA 3HOWH 3G7LA 1QCBD 3S2HB 4ZKCB 1VQHA 3DUZA 4JBWA 1M1KC 1STGA 4JYAQ 1W6JA 3SVMA 3KF8B 4OO1I 1FL0A 4NP5A 3KYHC 5HY6A 4HSPA 5I2YA 1I6HH 1EU3A 4G4KA 4DAYB 5KNBA 4A3JB 4KK7A 1Z9FA 2A6EC 2N3SA 4Y52H 1V9PA 2K52A 5H1SE 4IN3A 4PMWA 3RUZA 2ZXRA 5IT9L 1ENAA 5IYBG 1MD2D 1NUCA 2ASBA 2E2HH 1O7IA 3AFPA 2NZ1D 3CW2C 1ASZA 2BH8A 2AUKA 2F0SA 2D2CC 1SE4A 5BN3A 3GTMB 4FF2A 4EQPA 2BE5D 4DR3L 1IBKL 1SMYC 2VY3A 1L0WA 4A3FH 1VQLA 4JI1Q 2K33A 4IPGA 4GKJL 5GROA 3EFXD 5GAEC 4CJ0B 2E74C 5JPNC 2O5JC 1C7YA 1I50H 1QG7A 4TSSA 1KIXA 1F2ZA 2D0OA 1KQSA 1OXSC 2L12A 1CA5A 2B63G 1Y1WB 1PZKD 2I46A 3D8GA 4BBRB 3PIOA 3K5LA 2XGTA 1SE2A 3TRZA 4DR5Q 4LF8Q 2PQAA 1LTID 4JI3L 4RA8A 1MSGA 1BCPD 4DK0A 1XPOA 3HOUB 2HQLA 1K73C 4S3SA 4EVOA 1S5DD 5M5WB 1LT6D 1NR4A 4IJLA 4B3MQ 4YIJA 1C0AA 1Q90A 1HZCA 1C9OA 3C1FA 1W2BA 5IGFA 4C3JG 3TBIB 3D4WA 2F0FA 3SK6A 4K6LA 3HZXA 4XQJA 3A5UA 3PUVA 5G3LF 4F8MA 2JA8H 5C3EH 1PXUA 1UEBA 2WFWA 2Z9HA 1DYQA 5ELBA 1ET6A 2EZVA 3NXWA 5M3MH 3CF5A 1SYCA 2WB1G 4DK1A 1B4OA 1VQ7A 1SYEA 1EU4A 1HA6A 3SEBA 4CJ1B 1VQCA 3KDFB 4HTHA 3I73A 4IOCA 5AFWA 4DR2L 3BU2A 2F0PA 3RN2A 1MKHA 1R9TH 4ZRZA 1Y8NB 4C3IG 3J7ZC 2JN4A 5IGCA 1SFOH 1PH7A 2I07B 1Q1EA 3URYA 3OW2A 1K0RA 3E9HA 2B2VC 2Y0SB 1FVIA 3TS2A 4X3KA 3I4LA 4FVMA 4BA1I 3KLWA 4LK1C 5BN5A 2G5DA 2R93B 4LF5L 4GNXB 3K5MA 1WCMH 1R4PB 2EY1A 1B50A 1HZ9A 1SJED 4DUZL 1KTKA 3U58A 1HZAA 4XQQA 1EQTA 3KUPA 1WJJA 3L7ZC 4WJWA 4O0AA 4DV5L 3LX0A 2LSSA 1YHAA 3NTIA 1HCZA 1LT4D 1SYBA 4RH6A 3FDTA 1PH6A 4JI8L 4H44C 4PV1C 1SJHD 1GVPA 2SNMA 3GTKB 1JCKB 4FO2A 3BS1A 4A3CG 4FNFA 3FP9A 2AQ1B 1PHJA 4A3BB 4JI4Q 2R92B 3MZ5A 5T1IA 1TWCB 4PZ6A 5KYIA 5FJ8G 1SYFA 1K3RA 4LF6Q 1GUOA 4QGUA 3GV6A 4E6IA 3S1QH 5FLMG 3DLLA 1X3PA 3VR6A 1TXYA 3QOLA 1BCPC 5KGUA 5C4JH 4A3IB 3IRBA 4ODGA 4R4TA 2ES2A 1VQ8A 1LABA 2XTIA 4K14A 3NEMA 3PO2G 3F2DA 2J7ZA 5I2XA 1PYWD 3OYYA 1JWUD 4NPSA 5EAYA 3W2DA 1Z6HA 2GN5A 1STAA 1PTOC 3CC4A 4JV5L 4DA2A 2MO1A 4DUYQ 1A6XA 1RTNA 3MFGA 1YZ6A 4RG1A 3NHHA 5C5LA 3T51B 2F52A 3AQQA 1EY7A 4FF4A 2VUMB 1RCVD 4BY1G 3D6CA 2MGSA 3NQTA 1TS2A 2NTSA 4QMGA 4ZQ3A 4R1JA 5ELEA 2QGQA 3E3XA 4KTAA 2B3GA 2JA6H 3TS0A 2EY2A 3DEOA 1N34L 1IL2A 1STEA 3OWEB 4H02A 2WAQG 4BY7H 5HURA 5CMDA 1T5XD 1K0SA 3SK5A 1XNRQ 1TWFH 5IIFA 1KNEA 3QR8A 4IFDH 4LF7L 1A0IA 2E2DC 1XMOL 4P2CB 2JEBI 4B3TL 4HAEA 1EIFA 2PQAB 2ZJRA 4B3SQ 4RMFA 3ND9A 3QO2A 3T1HL 2AWNA 4YWMA 4HJ7A 1IBLQ 4L63B 5GADC 3PCOB 2N55A 1JOKA 4DR6L 3CCMA 1NE3A 1I94L 4MIUA 2HQEA 3PV0A 1PZJD 2A74C 1ICWA 5HGQA 4HJAA 3UDGA 4IZ8A 4A3KH 3SR1A 1KNAA 5IGGA 2VL6A 5EPKA 1XX8A 3S2HH 2QW7A 4FF1A 3UE1A 1XTDA 4V190 4NB3A 4ID6A 2L5TA 2PW5A 4OO1G 3G4SA 2LY7A 4JBJA 3DEPA 3GTPB 2F0GA 5CYUA 2EYHA 1TKWB 3KK7A 3VYRA 2CFMA 4IUPA 3F2CA 1DOLA 4GN4B 4NKLA 2B2WA 5C4XB 2MNAA 1X32A 3J80E 3M4OB 3P7JA 1YI2A 4TKOB 4YHHL 3I8ZA 3QIAA 3BZDB 4C1NK 1Q7YC 1EEID 1E2VA 4CBVA 4PQXA 4ZUJA 1QZHA 4O1NA 2QF7A 1MIUA 4XYOA 4U68A 4QB4A 4DK3C 1VF5C 3RLFA 3T1YL 1ZYRD 1SNPA 1I3QH 3RZDB 4A4IA 2UUCQ 2F3VA 3E6ZX 3GTGB 3A0JA 1LYLA 2EJMA 4N8FA 2B63H 1Q8KA 4A3MB 3I4MB 1CUKA 1YNND 4POGA 1N32L 4JI0L 3K80C 3HOVH 2ICIA 2BCOA 3H3VI 1HNWQ 4KJNA 1Z7TA 4AQYL 2AHOB 1ILQA 2K28A 2HHHL 3F2BA 1O78A 3S16H 1NR2A 3R2IA 4UAIA 5IT9c 1JQYD 1Y14B 2PQEA 3HOYH 4LWCA 3G6JB 4EQ5A 2L0CA 1ENFA 4ILWA 4XTCS 5AJ3Q 1LT5D 2QEXA 2M9VA 4OEMB 5JEAG 4DGZA 3BZCA 4IUVA 3HOUH 5EPLA 1CT1D 3FKIB 2EYFA 5M5WH 5JEAJ 3CC2A 2ZXOA 2FMMA 2VQEL 3KFUA 1IZ6A 4H0LC 4A93B 4ZKBB 1DONA 3CMAA 2QDBA 3ZYYX 2UXBQ 5LMUL 1ZXTA 4JI2L 4XYQA 3RZOB 2EYLA 2A6HC 1NY4A 2YV5A 4QQBX 3K59A 1C48A 3UE0A 4NXML 1ASYA 3CKIB 1OO9B 3MHBA 4DV5Q 3UDIA 2P5ZX 1J5EQ 2A73B 2NN6I 2Z1CA 4P75A 3L3OC 5E1FA 1CK1A 3WWVA 2PPBC 5E7NA 4PMCA 3K7AB 3PF4A 2B2YC 4V0BA 2JA8G 5C3EG 4MZ9A 1RJTA 4YY3L 1KABA 1SAPA 4NXNL 5FK9C 1G291 3P1HA 2R93H 1QWYA 2B39A 4GOPB 1MI2A 2JK8A 1QB5D 2KUMA 3MWYW 5FO7B 1EQVA 2NZHA 3TP7A 1A3TA 2K5NA 3VR2A 2EXZA 4UP9A 4A3CH 1ZYRC 3F2UA 4X64Q 5F2DA 4FXDA 3PO3B 3HKZB 4B3RL 3H3VC 1JT8A 4DV0Q 5DLQE 1DCZA 4XQNA 1JORA 4DR7Q 1S72A 2X69A 2PZWA 2XRSD 3GTKH 2RDHA 3L9AX 3DM3A 1G51A 1WCMG 2DY7A 3W1BA 4CDDC 1TWAB 4C3HB 3T16A 2IT1A 2UUAQ 3H0GB 3VR3A 4DU9A 2XRQD 1S5ED 1CKOA 1TWCH 2OWOA 1EZ8A 4JV5Q 4GLAC 3VYSA 3PF5A 3NSWA 4LFAQ 1CTMA 1G91A 2R7ZB 1ENCA 1U5KA 2NWGA 3K7UC 4RCOA 5I9PA 1EY8A 4OWWB 2MUYA 3Q0AA 1X65A 2D5DA 3NBHA 3VDYA 1FYCA 3I4NB 4JOIA 4JBMA 1VDZA 1C8CA 1NBWA 2LS01 3BDOA 3A7AB 4Q5VA 1PV4A 4R4OA 3HOXG 1VS0A 2PMZE 2EE1A 3SGIA 2KOLA 3OIQA 1HNXQ 3BDLA 3G6EA 4BY1H 1GUNA 4CDCC 5CV4A 3K5OA 4M1UB 5G3LD 4ME3A 1TR5A 1XMOQ 2JXMB 3WDNA 2NVXB 1RKNA 4CDFC 1V43A 4IALA 4OHJA 3H09A 1X9NA 1WTQA 1J8IA 1AE2A 2EXDA 2L4NA 2KCCA 1U4RA 5JAVA 3S14B 1OTCA 1UUPA 1K28A 1NJIC 2IX3A 3A74A 1UEAB 1EOTA 5TSSA 3MAQA 3X3MA 4LF4L 1XMQL 2B2UA 2JA7G 1GHJA 4KMUC 4ULLA 2RSOA 2M2LA 4F87A 1PYBA 3J7AV 1TWGH 3R93A 2DNCA 1EY0A 5EKLA 3CCQA 1D2BA 1D1KA 2CH4A 1LLRD 1NMFA 2JA6G 5FLXL 1B2TA 3SHLA 3W1GA 4K5VA 1ICFB 4OELB 3NQIA 2HIVA 5NUCA 4BY7G 1AE3A 4GS3A 4GNXC 1L0YB 4LFBL 3OHXC 4OWTB 4CGYB 1NCVA 3A5ZB 4HSVA 4IFDG 1ML0D 2DNEA 1WTPA 5M3FG 2G9DA 4L5TA 4LFCL 1HNZL 2Z6BA 4OO1H 4IFDJ 3ER0A 3S1RB 2AQ3B 4KD4A 1JWSD 1CHPD 1CKMA 5GAGC 5CR3A 1E1TA 5C44B 1HPCA 3LNNA 2F4VL 3GTLH 1PRTF 2HIXA 2WIIB 2BA0A 4ZUIA 2NZOA 2QA4A 1BUVT 3GTJB 4AYBG 4FXGC 2UXCL 1LUZA 3CHBD 1MSHA 4H7BA 1WYDA 4UPAA 3WOFA 3NWSA 2BDNA 2GVAA 3GQBA 3F1ZA 1HFNA 1G8ZD 4OIKA 5D65A 3K57A 4A3KG 1DZ1A 1STBA 3M9BA 4JI0Q 5C4XH 4HJ5A 5E4XA 3M4OH 4GKKQ 1NSNS 2Q2HA 2K5HA 5LMNL 1E24A 4AQYQ 2Q2IA 2CWAA 2EVBA 4IJHA 4A3EB 2F0NA 3MTSA 1Q8IA 1X3FA 2FFKB 4JVZA 4XIGS 1WTWA 1AZQA 3RZDH 3FVQA 4A3JG 1EL0A 1YJ9A 2LKVA 2DJFC 2QILA 2ZM6Q 1N8RC 3OTOL 5C4HA 2WB1E 3NP8A 2XSCA 4A3MH 2E5LQ 4HIKA 2D9UA 1RF2D 4DAMA 3QOJA 3MFYA 1IXRA 1EWHA 4ZK9B 3EBEA 1IYVA 1SE8A 2F0MA 3I2ZA 1S40A 4OX9Q 3CCLA 2JA5B 1D7QA 5JEAH 2JE6I 3I72A 4DV6Q 1KDBA 4F7XA 4K8IA 2V4DA 2VW9A 2Z6KA 3MXNA 4DR1L 4LW1A 1EFWA 1DXMA 3RMHA 1MGSA 1N33Q 3FMCA 2F0VA 3EROA 3K58A 1X3QA 3HOVG 2K1BA 2ENBA 2JP1A 3FKIH 1PH1A 4JCVE 4UDUC 3HOZB 2X6GA 2Q8IB 1Y1WG 4YY3Q 1XXGA 1PTOH 4A93H 3HOYG 4DV3Q 4A3GB 1FR3A 1YEZA 1XNQQ 1QILA 1E22A 1V8QA 4K0KL 1YBYA 2KENA 4L5RC 4KI0A 1RIPA 2OT2A 3QG1A 4I7AA 2I0QA 3HOUG 3D6WA 3JAML 3QB3A 1EYGA 1VQDA 4KY7A 5EJWA 2NN6G 4P72A 3M4QA 1J9OA 1FD7D 4DV4Q 2UUBL 4WJ3M 1EQQA 1PFNA 1SNQA 4RHSA 1A62A 2PZUA 4X3SA 3ULLA 2G9HD 1ZEQX 5CORA 4U673 2V1CC 5CV7A 1X3GA 2KQ3A 3J80L 1LTAD 2NVQH 2FXQA 3SDZA 1V1QA 1WFQA 2VQFL 4WFN3 2R6GA 1UE5A 1SMXA 3TSSA 2D0PA 1A2TA 2F0WA 5CC4A 4DNIA 4DR4Q 4X62L 3IKJA 1PH9A 1K83B 3PQIA 1LV9A 3UDXA 1TY0A 2B2TC 3ULJA 3PIO3 4IUQA 5A35A 2B2VA 1HR0W 1Q46A 3HKSA 4OONA 4ZYSA 2Y0SG 1HR0Q 4FYDA 2WKDA 4K5XA 3PO3H 1BBUA 2Z4HA 1STYA 4X3TA 1IKMA 4FF3A 2UU9Q 4I65A 2EY6A 2R93G 4R8NA 3R3OA 1SYDA 1TWAH 3S2DB 2BE5C 1YHBA 1F2YA 2F0KA 2F1MA 4QCLA 4QL5A 1KRTA 5C0XI 1WTVA 5JVG3 4C56C 1VMPA 5GAHC 4C2MH 1B1ZA 1BKBA 4NW2A 2RDGA 2RSNA 2WAQE 2R7FA 2F0IA 3HOXH 4HIOA 4KV6A 3I4NH 4JG2A 3STBD 1VQPA 4A3BG 1WTOA 2OEOA 4JI5Q 2R92G 1H9SA 2Z4IA 3SE0A 4X65L 5M5XH 4LF9Q 4RAUC 3FPPA 4IPHA 1HA5A 4ZCKA 2IY5B 1XMQQ 1MBYA 3NWTA 2A5HA 1BBXC 1A3UA 3EQLC 4BS9A 3AFQA 3CCJA 1FJGL 2I5MX 2FJ2A 2J4XA 2BA1A 4G7ZC 4A3IG 5ELOA 3ULPA 2ZXPA 2NVXH 1RHPA 1CSQA 1S5CD 3MXUA 3NTKA 2K7VA 3A8JE 1CFMA 1K8GA 2IHFA 2KVMA 4X66L 4LUVA 4R4CA 1SLJA 2JA7H 3K5NA 2X6LA 1SEBD 1D5MC 5C6AA 5EBCA 4IO9A 1LM0A 3BYYB 3NELA 5IGBA 4F88A 2HT1A 3OPOA 1M8AA 2BOSA 2E2JB 1FGBD 1YNJD 4DV2L 1K8MA 3S1NB 3NBIA 1BNZA 1U4MA 2F0EA 2VUMG 4JI6Q 3NTHA 1JE4A 3CQZB 3UI2A 4B9XA 1X55A 3MXNB 1PYSB 1L1OA 3D4RA 3I7FA 5M3FH 5IT9E 2WAQB 5KIXA 2E76C 4RKBA 5J1ZA 1VQNA 2A8VA 1MJCA 1D5ZC 1TS3A 2K5WA 3NUCA 4GOPC 1LO5D 1IBML 3E0EA 2KEEA 4JI7L 5FKAC 5LMNW 3C46A 4A3DH 2OF1A 3I90A 4BBSB 2HDLA 3TMEA 2J0TD 3OMCA 4UP8A 3GTJH 4LNQA 2XWBB 2Z8LA 5CV6A 1UE6A 3KBGA 4YWKA 1KRSA 5FLXc 4YCVA 1V1PA 5BR8L 4L6TB 1BDOA 1PZID 1GJXA 5LHY1 3K8AA 2MQHA 2ZT9C 2RHSB 1EZ6A 1H9MA 1R4QB 2R7DA 3Q23A 3DXJC 5KEEA 4KHZA 4QUFA 4KY5A 4DR3Q 2IX0A 5IYDG 5CGKA 1IBKQ 2JSOA 3MXGA 4BXXG 1SNOA 4GKJQ 2IW3A 3PUXA 1Y1VB 4A3JH 1PTOF 2RBMA 2EQSA 3GTQB 5I4DA 3H3VH 1BBWA 2KA7A 3HOWB 1N36L 1JJCB 1VQFA 2B2WC 3Q24A 3RD4A 4AH6A 5C4XG 4DXFA 1KAWA 3ERSX 2K5QA 4JI3Q 2F0QA 5ELCA 3CCVA 2K14A 3GTMH 4OIJA 1JC7A 3J81L 1AH9A 4L5SA 1QUQA 1EYAA 1YNJC 2JA5H 5K36G 4K0KQ 3DM1A 3CXCA 2WKCA 2PCFB 2TMPA 4NDXA 2RKSA 2K05A 1O7LA 4PZ7A 2K04A 2Q2TA 3NE5B 4Y7NB 1HRJA 4A3MG 1Y1WH 2EJGC 2K32A 1KHIA 2LXJA 2IWHA 3I91A 4BBRH 3I4MG 1O7ZA 2F4IA 4KN7C 5D14A 3DWQA 2E2HB 4X6AH 1B44D 3AYHB 1PDQA 3IFTA 4JYAL 4HJ8A 3JC66 1KXLA 1VQKA 4DR2Q 1AFPA 1H9SB 5HGTA 4K5WA 2AQ2B 4A3FB 4A3GH 1H9RA 3D4DA 1JOQA 3M7NA 2NN6H 3ND8A 4AIMA 3PIPA 4PZ8A 1TWHB 2KCNA 1K3BC 1NMGA 4CJ2C 3CPWA 4M8AA 1I50B 1D1IA 3WOEA 3GTOB 5LL6X 2QCPX 2IHEA 1PRTD 3FKIG 1QE6A 1Q81C 4LF5Q 4PMBA 4XT1B 2ZTDA 1HJPA 1W6KA 3OW7A 4A93G 4DXGA 4DUZQ 3PSIA 2L15A 1PVOA 2F0LA 1F2MA 1V1OA 1YNXA 1MHWC 5COYA 1BXTA 1EFID 5A2QE 2O4XA 1YITA 5JJLA 2MO0A 1ONLA 4JI1L 4JI8Q 2KECA 3V05A 2F0JA 4KY6A 2O5IC 2DUDA 2XVSA 1ILPA 2L1BA 3JAMc 3P20A 1CM9A 2K6AA 1K83H 1YVCA 1IYUA 5M3MB 5E3FA 3TZUA 1HUMA 2KBNA 5CV5A 3J81j 3JAMi 4LF8L 5IYCG 4P73A 3CRLC 3DWAA 1H9KA 1HQMC 3OWFA 1GUWA 1DOMA 1L2FA 3I56A 3OOCA 5EBDA 5EQ0A 1SFOB 1PH5A 4B3ML 5C0XG 2ZTEA 1FNUA 4ALPA 1YNNC 1EQRA 5K5PA 2SEBD 3J80i 5C0XJ 1VQ4A 3SXHA 3PO3G 3HKZG 1LTLA 4A3BH 2R92H 3KLRA 1DJRD 1EY9A 5DAUA 1E1OA 3HP3A 1V1PB 4JBKA 4MTKA 3BG3A 1BQQT 4C3HG 1RODA 3H0GG 2PZTA 1IYJB 4XDXA 3OSOA 3K0XA 2IPKD 1HTPA 1WVLA 2OCEA 1LT3D 4A3IH 4JW0A 3FRPB 4UY8C 1SYGA 1TT2A 2Z0SA 3A8IE 2R7ZG 2YU9B 5CV8A 1IW7D 4B08A 1Y8PB 1N34Q 2NYZD 3KJPA 1QVGA 2XNAC 3I4NG 3RR5A 1PRTC 2N88A 1XWEA 4LF7Q 5IGEA 4B3TQ 5M9OA 5DM63 3S1QB 1AN8A 1GOZA 3RN5A 3RNUA 1JR0D 2VUMH 1B3QA 2YYZA 1RD9D 5C4JB 3T1HQ 3LWEA 1JJ2A 4CKBA 4AYBE 3TP8A 1XJVA 1XTCD 2K5DA 3U4ZA 5J22A 2H1EA 4DR6Q 1T5EA 4L8JA 1I94Q 3S1NH 3C1EA 4YCUA 2A6ED 2O2LD 3EVQA 4QIWE 3CQZH
chains in the Genus database with same CATH topology
4JI4L 3HOYG 4DV3Q 1YEZA 1XNQQ 4C3JH 3HKZE 1E22A 2CWPA 2N8NA 4K0KL 2E8GA 4R1JA 3FHWA 2I5LX 2QGQA 2ZM6L 1YBYA 1JJGA 2KENA 4A75A 4KI0A 4L5RC 2B3GA 1RIPA 2C35B 3TS0A 2JA6H 1Q12A 2E5LL 2I0QA 4LF6L 3HOUG 1PA6A 1N34L 3CCRA 4GLXA 1IL2A 1EYGA 1VQDA 4H02A 1QZGA 2WAQG 4BY7H 2PI2E 2NN6G 4P72A 1X54A 3CC7A 2N49A 1E7ZA 2F3IA 1XNRQ 4OX9L 1TWFH 3M4QA 3CD6A 4L5QA 1VCIA 4LF7L 1A0IA 2YTYA 4POFA 4DV4Q 1EUJA 1XMOL 2UUBL 4WJ3M 2JEBI 4DV6L 1EQQA 4C3IH 1A62A 1U0LA 1Q1BA 3CCSA 4B3TL 3S1MH 3ULLA 1EIFA 2PQAB 3CAMA 2ZJRA 1PH8A 4RMFA 4B3SQ 1B8AA 2H5XA 1N33L 4FDBA 3T1HL 3M4PA 2V1CC 3UDFA 2AWNA 1X3GA 2GVBA 4LUOA 4GNXA 4BA2I 3W5OA 2NVQH 4YWMA 4YHHQ 2FXQA 1V1QA 4HJ7A 1IBLQ 5GADC 4DR5L 1L1OB 1WFQA 3PCOB 2VQFL 4DR6L 3CCMA 1NE3A 2R6GA 1I94L 2CCZA 1UE5A 1SMXA 4QY7A 3F8TA 1PH3A 2D0PA 5IYDH 3RLOA 1GD7A 3PV0A 4DV7Q 4DNIA 4DR4Q 4X62L 4BXXH 1JE5A 5HGQA 1PH9A 5M3MG 4HJAA 2BH2A 2DGYA 3UDXA 3ULJA 4X65Q 3UDGA 4DV3L 3T1YQ 3J80c 1XNQL 1OXXK 1VQ6A 4A3KH 2K75A 4OXPA 1Q46A 1HR0W 3GTPH 3S2DH 4JC0A 3HKSA 4OONA 2VL6A 2Y0SG 1HR0Q 3L0OA 3PO3H 5IY0A 1BBUA 3S2HH 5IP9G 3UE1A 1XTDA 2A1AA 4NB3A 5IP7G 1GO3E 2UU9Q 1FJGQ 1N32Q 4OO1G 2R93G 3G4SA 1YJNA 4JBJA 3GTQH 3M3YH 1XNRL 1TWAH 1GKHA 1YHBA 1VQBA 4X66Q 2HHHQ 4DV4L 2CFMA 3F2CA 4QL5A 1OXTA 1KL9A 1SN8A 4GN4B 1KRTA 5C0XI 3J7A5 3LGJA 4B3SL 3KF6B 5GAHC 1QVFA 2YTVA 4MNOA 4C2MH 2MNAA 5FJ8H 1VQ9A 1YI2A 1EIYB 1GM5A 1BKBA 1FGUA 2PNHA 4YHHL 2WAQE 1DGSA 2R7FA 1IBLL 4A3DG 3GTGH 4A3EG 5FLMH 1MJEA 1Q7YC 4J15A 2ALYB 3HOXH 2VNUD 4DV2Q 2K50A 4R4IA 1QZHA 4HIOA 2OTLA 1MIUA 3I4NH 4JG2A 3STBD 1VQPA 4DK3C 4A3BG 3I4MH 2AWOA 1CKNB 2VQEQ 4JI5Q 2R92G 4DR4L 1H95A 2Q2UA 3RLFA 3T1YL 4JOIC 4X65L 5M5XH 3PUZA 4DV1L 2ZJPA 4LF9Q 1I3QH 1XPUA 3PO2H 4A4IA 4IPHA 1X6OA 4JI2Q 3NENA 5LMUQ 2UUCQ 1JB7A 3A0JA 1HR0L 1EOVA 4Y7NH 2IY5B 2KHJA 1XMQQ 1LYLA 2WP8J 4DKAC 2B63H 1Q8KA 4QJFA 4GN3B 3AFQA 1KC8C 3CCJA 2UU9L 1CUKA 2I5MX 3I4OA 4NXMQ 1FJGL 4POGA 4A3LG 1N32L 4JI0L 2BA1A 4A3IG 3K80C 5ELOA 3ULPA 3HOVH 2NVXH 1IBMQ 1CSQA 3H3VI 2JA5G 1HNWQ 4JI7Q 1PH4A 3TEHB 3KOJA 2ZTCA 1K8GA 4AQYL 2AHOB 2Z6KC 2RCNA 3CP0A 2IHFA 2B29A 4X66L 3F2BA 2E2JH 2HHHL 3S16H 3J81c 5IT9c 5IWAL 3NBHB 1Y14B 3HOYH 4LUVA 2Y0SE 1QUQB 4LWCA 4R4CA 1SLJA 2JA7H 4EQ5A 1TWHH 4PG3A 3GO5A 4BBRG 3G71A 4NXNQ 3H15A 3E9IA 4IO9A 2OTJA 4LUZA 1LM0A 4XTCS 5AJ3Q 3NELA 2QEXA 1M90C 3J81i 5JEAG 2HT1A 3GTOH 4WJ4A 3BZCA 1VQEA 2LXKA 3HOUH 4HIMA 4DV2L 5M5WH 3RZOH 3HOZG 2JJQA 5BR8Q 3PUWA 5JEAJ 1P16A 3CC2A 3CCEA 3KDFA 4OWXB 4YWLA 4R4QA 3TQYA 4JI6Q 3CPFA 2JEAI 2VUMG 3KFUA 3S17H 4JI5L 2VQEL 1IZ6A 4A3GG 2K4KA 4LF9L 1X55A 2I5HA 3MXNB 1PYSB 3MEFA 3CMAA 2UXBQ 5LMUL 1PFSA 2UUCL 4JI2L 2MFIA 4GLVB 1L1OA 1BVSA 2CQOA 3I7FA 4EX5A 5M3FH 1T9HA 4B3RQ 1VQNA 3BZKA 1NY4A 2A8VA 1MJCA 2YV5A 4QQBX 4BBSH 3EIVA 1XPRA 3UE0A 2CKZB 3K7AH 1ASYA 4NXML 1JMCA 5J3BA 4GOPC 3U50C 1IBML 4KHPL 3AEVA 3E0EA 5IYCH 4DV5Q 4JI7L 1HNWL 3UDIA 5LMNW 4DUYL 1PH2A 4UP7A 1J5EQ 3GD7A 5JJIA 2NN6I 4P75A 1N36Q 3ICEA 4A3DH 2NVYH 3WWVA 1VQJA 5E7NA 1YJWA 5GQOA 2UXDL 3PF4A 2JA8G 5C3EG 4MZ9A 4YY3L 3S15H 4NXNL 1VQIA 4UP8A 3GTJH 5AJ3L 4YCWA 2KHIA 5IP9H 4LNQA 3L2PA 2EIFA 1VQ5A 1G291 1UE6A 4YWKA 5C44G 1KRSA 5IP7H 2OQKA 5FLXc 3PGZA 4YCVA 2R93H 5BR8L 3D31A 1B7YB 2YTXA 4GOPB 4APVA 1W3SA 2JK8A 3K8AA 3M85A 4JI6L 3CMEA 2MQHA 3HFZB 2NZHA 1Y1VH 2ID0A 2RHSB 3GDEA 1D8LA 2K5NA 4IOAA 2R7DA 4UP9A 2AMCB 4C3HH 2UXBL 4A3CH 1SRUA 5M5YH 1J6QA 3Q8DA 4X64Q 3H0GH 4KHZA 4DR3Q 2IX0A 5IYDG 1IBKQ 3HOWH 4B3RL 1JT8A 4DV0Q 4HIDA 5DLQE 1VQHA 4BXXG 4DR7Q 4GKJQ 1S72A 3PUXA 4JBWA 4A3JH 1M1KC 3GTKH 4JYAQ 3DM3A 1G51A 2EQSA 2VS1A 1WCMG 3W1BA 2R7ZH 1NTGA 4HJ9A 2IT1A 2UUAQ 3H3VH 3KF8B 1BBWA 1FL0A 4OO1I 2ATWA 1J5EL 1WOCA 3KYHC 1JJCB 1VQFA 4IPCA 1CKOA 5HY6A 1TWCH 1N36L 2OWOA 1SR3A 4JV5Q 1I6HH 4AH6A 5C4XG 4GLAC 4DAYB 3PF5A 3EN2A 4LFAQ 4DV7L 1KAWA 3ERSX 2YU9H 1Z9FA 2N3SA 4Y52H 1U5KA 1V9PA 2K52A 4JI3Q 3K7UC 4P74A 3CCVA 2K14A 2KCMA 4OWWB 3GTMH 1X65A 5H1SE 4PMWA 4LF4Q 4P71A 3VDYA 1AH9A 4L5SA 1QUQA 4JOIA 2JA5H 4JBMA 5IYBG 5K36G 1NBWA 4K0KQ 3CXCA 2ASBA 2E2HH 1O7IA 3AFPA 1KD1C 3CW2C 1ASZA 3S24A 1CSPA 2BH8A 4A93H 1E3PA 1QVCA 1PV4A 4R4OA 3HOXG 1VS0A 2PMZE 4PZ7A 2Q2TA 4X64L 3I55A 3SGIA 2RHQB 4A3MG 4DR3L 1Y1WH 1IBKL 3G6EA 1HNXQ 1KHIA 2LXJA 1OXVA 2VY3A 1L0WA 4BBRH 4JI1Q 4DV0L 4A3FH 1VQLA 4BY1H 3I4MG 4DR7L 2D62A 4IPGA 4ME3A 4GKJL 5GROA 2JQOA 4LFBQ 4X6AH 1XMOQ 3AYHB 5GAEC 2ZJQA 4JYAL 4HJ8A 3S14H 1C7YA 3JC66 1KXLA 1I50H 1X56A 4DR2Q 1VQKA 1KIXA 1V43A 2D0OA 1YHQA 2UUAL 1KQSA 1OXSC 2B63G 4LFCQ 1VQAA 1X9NA 1HNZQ 4A76A 4A3GH 1AE2A 3PIOA 2EXDA 3M7NA 2XGTA 4AIMA 3PIPA 4PZ8A 3TRZA 3RLNA 4DR5Q 4LF8Q 2PQAA 2RF4A 2F4VQ 1NMGA 2KCTA 4LFAL 3K81C 3CPWA 1OTCA 5ELNA 4JI3L 5JJKA 1NJIC 3A74A 1XPOA 2HQLA 2IHEA 3FKIG 1K73C 4IPDA 1Q81C 2UXCQ 4LF4L 1XMQL 4LF5Q 1HZBA 2ZTDA 2JA7G 1HJPA 4IJLA 4B3MQ 3KJOA 1C0AA 1Q82C 1PYBA 4A93G 1TWGH 1HZCA 4DUZQ 1C9OA 3PSIA 2L15A 3CCQA 1PVOA 1W2BA 1L1OC 1NMFA 1YNXA 3A5UA 1YITA 3PUVA 5JJLA 1X3EA 1UWVA 3PUYA 2JA6G 2JA8H 5C3EH 1HNXL 1UEBA 2WFWA 3W1GA 5IE8A 5LMNQ 2MO0A 4TVAB 5M3MH 3CF5A 4JI1L 4GOPA 2WB1G 4DK6C 3S1RH 4JI8Q 1VQ7A 4BY7G 2HIVA 4LFBL 1AE3A 4GS3A 5C44H 4GNXC 1K9MC 2DUDA 4OWTB 3A5ZB 1VQCA 2N78A 3KDFB 3U4VA 3JAMc 4IOCA 4DR2L 4IFDG 3BU2A 5M3FG 3RN2A 1MKHA 1R9TH 4L5TA 1K83H 4LFCL 3J7ZC 1HNZL 1YVCA 1G6PA 4BBSG 1SFOH 3ER0A 4IFDJ 1UE1A 2KBNA 3J81j 1CKMA 5GAGC 1PH7A 1Q1EA 1E1TA 1K0RA 3JAMi 3OW2A 1VQOA 4LF8L 2K5VA 3E9HA 3KF6A 2F4VL 3OTOQ 2HIXA 5IYCG 4P73A 3GTLH 3STBC 1FVIA 2BA0A 1VQMA 3TS2A 2NZOA 2QA4A 1L2FA 2PI2A 3I56A 4AYBG 4BA1I 3KLWA 2UXCL 1LUZA 4DV1Q 4LF5L 4IFDI 1PH5A 1WYDA 4KLKA 4UPAA 1N9WA 3BJUA 4GNXB 4B3ML 1WCMH 5C0XG 2ZTEA 1HZ9A 2GVAA 4DUZL 1CKNA 3U58A 3F1ZA 1HZAA 4A3EH 1EWIA 4A3KG 4ALPA 1WJJA 1EQRA 3L7ZC 5C0XJ 3J80i 4O0AA 3M9BA 4DV5L 4DR1Q 2LSSA 1VQ4A 1YHAA 4JI0Q 5C4XH 2IX1A 3HKZG 3PO3G 4HJ5A 1LTLA 1B70B 4A3BH 3M4OH 4GKKQ 2Q2HA 2R92H 2K5HA 5LMNL 2JA9A 1A63A 2NVTH 1E24A 4JI8L 3B6YA 1Y1VG 1PH6A 4AQYQ 1E1OA 2Q2IA 2CWAA 1OXUA 1GVPA 4IJHA 4JBKA 5IWAQ 4A3CG 3H0GG 1X3FA 3FP9A 3HOWG 4XIGS 1PHJA 5IYBH 1IYJB 4JI4Q 3K0XA 4A3LH 1RL2A 1K8AC 2OCEA 4PZ6A 4A3IH 3RZDH 4A3JG 1YJ9A 4UY8C 1WI5A 4TQUS 2Z0SA 5FJ8G 2ZM6Q 1N8RC 2R7ZG 3OTOL 1VQGA 1Q86C 2WB1E 1K3RA 2A19A 4A3MH 2E5LQ 4LF6Q 4HIKA 4QGUA 3S1QH 5FLMG 1P8LA 3G48A 4DAMA 3DLLA 1N34Q 1UE7A 3KJPA 1QVGA 1IXRA 1TXYA 3EBEA 2E2IH 3I4NG 1I5FA 3RR5A 5C4JH 3IRBA 1HH2P 1SE8A 1Z47A 4R4TA 3I2ZA 1S40A 4OX9Q 2ES2A 1VQ8A 3CCLA 2XTIA 1D7QA 4LF7Q 2JE6I 2VZAA 4O2DA 2UUBQ 3NEMA 4DV6Q 3PO2G 4DPGA 2VW9A 2AKWB 2Z6KA 4DR1L 3F2DA 4B3TQ 4LW1A 3HOZH 4GN5A 3ZJYC 1EFWA 3RN5A 3RNUA 3OYYA 1N33Q 2VUMH 1YIJA 2YYZA 4GKKL 3T1HQ 4KHPQ 4NPSA 5EAYA 3CCUA 3D0FA 1JJ2A 2GN5A 2OQ0A 4AYBE 3CC4A 4JV5L 1XJVA 1SROA 1A8VA 3U4ZA 2MO1A 4DUYQ 3HOVG 2VQFQ 4DR6Q 1YZ6A 3FKIH 1PH1A 1I94Q 4RG1A 3S1NH 4MTNA 1S3OA 4YCUA 4JCVE 2UXDQ 2F52A 3AQQA 3TREA 1Y1WG 4X62Q 4QIWE 3CQZH 4YY3Q 4A3FG 4BY1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 L;  3HOY G;  4DV3 Q;  1YEZ A;  1XNQ Q;  4C3J H;  3HKZ E;  1E22 A;  2CWP A;  2N8N A;  4K0K L;  2E8G A;  4R1J A;  3FHW A;  2I5L X;  2QGQ A;  2ZM6 L;  1YBY A;  1JJG A;  2KEN A;  4A75 A;  4KI0 A;  4L5R C;  2B3G A;  1RIP A;  2C35 B;  3TS0 A;  2JA6 H;  1Q12 A;  2E5L L;  2I0Q A;  4LF6 L;  3HOU G;  1PA6 A;  1N34 L;  3CCR A;  4GLX A;  1IL2 A;  1EYG A;  1VQD A;  4H02 A;  1QZG A;  2WAQ G;  4BY7 H;  2PI2 E;  2NN6 G;  4P72 A;  1X54 A;  3CC7 A;  2N49 A;  1E7Z A;  2F3I A;  1XNR Q;  4OX9 L;  1TWF H;  3M4Q A;  3CD6 A;  4L5Q A;  1VCI A;  4LF7 L;  1A0I A;  2YTY A;  4POF A;  4DV4 Q;  1EUJ A;  1XMO L;  2UUB L;  4WJ3 M;  2JEB I;  4DV6 L;  1EQQ A;  4C3I H;  1A62 A;  1U0L A;  1Q1B A;  3CCS A;  4B3T L;  3S1M H;  3ULL A;  1EIF A;  2PQA B;  3CAM A;  2ZJR A;  1PH8 A;  4RMF A;  4B3S Q;  1B8A A;  2H5X A;  1N33 L;  4FDB A;  3T1H L;  3M4P A;  2V1C C;  3UDF A;  2AWN A;  1X3G A;  2GVB A;  4LUO A;  4GNX A;  4BA2 I;  3W5O A;  2NVQ H;  4YWM A;  4YHH Q;  2FXQ A;  1V1Q A;  4HJ7 A;  1IBL Q;  5GAD C;  4DR5 L;  1L1O B;  1WFQ A;  3PCO B;  2VQF L;  4DR6 L;  3CCM A;  1NE3 A;  2R6G A;  1I94 L;  2CCZ A;  1UE5 A;  1SMX A;  4QY7 A;  3F8T A;  1PH3 A;  2D0P A;  5IYD H;  3RLO A;  1GD7 A;  3PV0 A;  4DV7 Q;  4DNI A;  4DR4 Q;  4X62 L;  4BXX H;  1JE5 A;  5HGQ A;  1PH9 A;  5M3M G;  4HJA A;  2BH2 A;  2DGY A;  3UDX A;  3ULJ A;  4X65 Q;  3UDG A;  4DV3 L;  3T1Y Q;  3J80 c;  1XNQ L;  1OXX K;  1VQ6 A;  4A3K H;  2K75 A;  4OXP A;  1Q46 A;  1HR0 W;  3GTP H;  3S2D H;  4JC0 A;  3HKS A;  4OON A;  2VL6 A;  2Y0S G;  1HR0 Q;  3L0O A;  3PO3 H;  5IY0 A;  1BBU A;  3S2H H;  5IP9 G;  3UE1 A;  1XTD A;  2A1A A;  4NB3 A;  5IP7 G;  1GO3 E;  2UU9 Q;  1FJG Q;  1N32 Q;  4OO1 G;  2R93 G;  3G4S A;  1YJN A;  4JBJ A;  3GTQ H;  3M3Y H;  1XNR L;  1TWA H;  1GKH A;  1YHB A;  1VQB A;  4X66 Q;  2HHH Q;  4DV4 L;  2CFM A;  3F2C A;  4QL5 A;  1OXT A;  1KL9 A;  1SN8 A;  4GN4 B;  1KRT A;  5C0X I;  3J7A 5;  3LGJ A;  4B3S L;  3KF6 B;  5GAH C;  1QVF A;  2YTV A;  4MNO A;  4C2M H;  2MNA A;  5FJ8 H;  1VQ9 A;  1YI2 A;  1EIY B;  1GM5 A;  1BKB A;  1FGU A;  2PNH A;  4YHH L;  2WAQ E;  1DGS A;  2R7F A;  1IBL L;  4A3D G;  3GTG H;  4A3E G;  5FLM H;  1MJE A;  1Q7Y C;  4J15 A;  2ALY B;  3HOX H;  2VNU D;  4DV2 Q;  2K50 A;  4R4I A;  1QZH A;  4HIO A;  2OTL A;  1MIU A;  3I4N H;  4JG2 A;  3STB D;  1VQP A;  4DK3 C;  4A3B G;  3I4M H;  2AWO A;  1CKN B;  2VQE Q;  4JI5 Q;  2R92 G;  4DR4 L;  1H95 A;  2Q2U A;  3RLF A;  3T1Y L;  4JOI C;  4X65 L;  5M5X H;  3PUZ A;  4DV1 L;  2ZJP A;  4LF9 Q;  1I3Q H;  1XPU A;  3PO2 H;  4A4I A;  4IPH A;  1X6O A;  4JI2 Q;  3NEN A;  5LMU Q;  2UUC Q;  1JB7 A;  3A0J A;  1HR0 L;  1EOV A;  4Y7N H;  2IY5 B;  2KHJ A;  1XMQ Q;  1LYL A;  2WP8 J;  4DKA C;  2B63 H;  1Q8K A;  4QJF A;  4GN3 B;  3AFQ A;  1KC8 C;  3CCJ A;  2UU9 L;  1CUK A;  2I5M X;  3I4O A;  4NXM Q;  1FJG L;  4POG A;  4A3L G;  1N32 L;  4JI0 L;  2BA1 A;  4A3I G;  3K80 C;  5ELO A;  3ULP A;  3HOV H;  2NVX H;  1IBM Q;  1CSQ A;  3H3V I;  2JA5 G;  1HNW Q;  4JI7 Q;  1PH4 A;  3TEH B;  3KOJ A;  2ZTC A;  1K8G A;  4AQY L;  2AHO B;  2Z6K C;  2RCN A;  3CP0 A;  2IHF A;  2B29 A;  4X66 L;  3F2B A;  2E2J H;  2HHH L;  3S16 H;  3J81 c;  5IT9 c;  5IWA L;  3NBH B;  1Y14 B;  3HOY H;  4LUV A;  2Y0S E;  1QUQ B;  4LWC A;  4R4C A;  1SLJ A;  2JA7 H;  4EQ5 A;  1TWH H;  4PG3 A;  3GO5 A;  4BBR G;  3G71 A;  4NXN Q;  3H15 A;  3E9I A;  4IO9 A;  2OTJ A;  4LUZ A;  1LM0 A;  4XTC S;  5AJ3 Q;  3NEL A;  2QEX A;  1M90 C;  3J81 i;  5JEA G;  2HT1 A;  3GTO H;  4WJ4 A;  3BZC A;  1VQE A;  2LXK A;  3HOU H;  4HIM A;  4DV2 L;  5M5W H;  3RZO H;  3HOZ G;  2JJQ A;  5BR8 Q;  3PUW A;  5JEA J;  1P16 A;  3CC2 A;  3CCE A;  3KDF A;  4OWX B;  4YWL A;  4R4Q A;  3TQY A;  4JI6 Q;  3CPF A;  2JEA I;  2VUM G;  3KFU A;  3S17 H;  4JI5 L;  2VQE L;  1IZ6 A;  4A3G G;  2K4K A;  4LF9 L;  1X55 A;  2I5H A;  3MXN B;  1PYS B;  3MEF A;  3CMA A;  2UXB Q;  5LMU L;  1PFS A;  2UUC L;  4JI2 L;  2MFI A;  4GLV B;  1L1O A;  1BVS A;  2CQO A;  3I7F A;  4EX5 A;  5M3F H;  1T9H A;  4B3R Q;  1VQN A;  3BZK A;  1NY4 A;  2A8V A;  1MJC A;  2YV5 A;  4QQB X;  4BBS H;  3EIV A;  1XPR A;  3UE0 A;  2CKZ B;  3K7A H;  1ASY A;  4NXM L;  1JMC A;  5J3B A;  4GOP C;  3U50 C;  1IBM L;  4KHP L;  3AEV A;  3E0E A;  5IYC H;  4DV5 Q;  4JI7 L;  1HNW L;  3UDI A;  5LMN W;  4DUY L;  1PH2 A;  4UP7 A;  1J5E Q;  3GD7 A;  5JJI A;  2NN6 I;  4P75 A;  1N36 Q;  3ICE A;  4A3D H;  2NVY H;  3WWV A;  1VQJ A;  5E7N A;  1YJW A;  5GQO A;  2UXD L;  3PF4 A;  2JA8 G;  5C3E G;  4MZ9 A;  4YY3 L;  3S15 H;  4NXN L;  1VQI A;  4UP8 A;  3GTJ H;  5AJ3 L;  4YCW A;  2KHI A;  5IP9 H;  4LNQ A;  3L2P A;  2EIF A;  1VQ5 A;  1G29 1;  1UE6 A;  4YWK A;  5C44 G;  1KRS A;  5IP7 H;  2OQK A;  5FLX c;  3PGZ A;  4YCV A;  2R93 H;  5BR8 L;  3D31 A;  1B7Y B;  2YTX A;  4GOP B;  4APV A;  1W3S A;  2JK8 A;  3K8A A;  3M85 A;  4JI6 L;  3CME A;  2MQH A;  3HFZ B;  2NZH A;  1Y1V H;  2ID0 A;  2RHS B;  3GDE A;  1D8L A;  2K5N A;  4IOA A;  2R7D A;  4UP9 A;  2AMC B;  4C3H H;  2UXB L;  4A3C H;  1SRU A;  5M5Y H;  1J6Q A;  3Q8D A;  4X64 Q;  3H0G H;  4KHZ A;  4DR3 Q;  2IX0 A;  5IYD G;  1IBK Q;  3HOW H;  4B3R L;  1JT8 A;  4DV0 Q;  4HID A;  5DLQ E;  1VQH A;  4BXX G;  4DR7 Q;  4GKJ Q;  1S72 A;  3PUX A;  4JBW A;  4A3J H;  1M1K C;  3GTK H;  4JYA Q;  3DM3 A;  1G51 A;  2EQS A;  2VS1 A;  1WCM G;  3W1B A;  2R7Z H;  1NTG A;  4HJ9 A;  2IT1 A;  2UUA Q;  3H3V H;  3KF8 B;  1BBW A;  1FL0 A;  4OO1 I;  2ATW A;  1J5E L;  1WOC A;  3KYH C;  1JJC B;  1VQF A;  4IPC A;  1CKO A;  5HY6 A;  1TWC H;  1N36 L;  2OWO A;  1SR3 A;  4JV5 Q;  1I6H H;  4AH6 A;  5C4X G;  4GLA C;  4DAY B;  3PF5 A;  3EN2 A;  4LFA Q;  4DV7 L;  1KAW A;  3ERS X;  2YU9 H;  1Z9F A;  2N3S A;  4Y52 H;  1U5K A;  1V9P A;  2K52 A;  4JI3 Q;  3K7U C;  4P74 A;  3CCV A;  2K14 A;  2KCM A;  4OWW B;  3GTM H;  1X65 A;  5H1S E;  4PMW A;  4LF4 Q;  4P71 A;  3VDY A;  1AH9 A;  4L5S A;  1QUQ A;  4JOI A;  2JA5 H;  4JBM A;  5IYB G;  5K36 G;  1NBW A;  4K0K Q;  3CXC A;  2ASB A;  2E2H H;  1O7I A;  3AFP A;  1KD1 C;  3CW2 C;  1ASZ A;  3S24 A;  1CSP A;  2BH8 A;  4A93 H;  1E3P A;  1QVC A;  1PV4 A;  4R4O A;  3HOX G;  1VS0 A;  2PMZ E;  4PZ7 A;  2Q2T A;  4X64 L;  3I55 A;  3SGI A;  2RHQ B;  4A3M G;  4DR3 L;  1Y1W H;  1IBK L;  3G6E A;  1HNX Q;  1KHI A;  2LXJ A;  1OXV A;  2VY3 A;  1L0W A;  4BBR H;  4JI1 Q;  4DV0 L;  4A3F H;  1VQL A;  4BY1 H;  3I4M G;  4DR7 L;  2D62 A;  4IPG A;  4ME3 A;  4GKJ L;  5GRO A;  2JQO A;  4LFB Q;  4X6A H;  1XMO Q;  3AYH B;  5GAE C;  2ZJQ A;  4JYA L;  4HJ8 A;  3S14 H;  1C7Y A;  3JC6 6;  1KXL A;  1I50 H;  1X56 A;  4DR2 Q;  1VQK A;  1KIX A;  1V43 A;  2D0O A;  1YHQ A;  2UUA L;  1KQS A;  1OXS C;  2B63 G;  4LFC Q;  1VQA A;  1X9N A;  1HNZ Q;  4A76 A;  4A3G H;  1AE2 A;  3PIO A;  2EXD A;  3M7N A;  2XGT A;  4AIM A;  3PIP A;  4PZ8 A;  3TRZ A;  3RLN A;  4DR5 Q;  4LF8 Q;  2PQA A;  2RF4 A;  2F4V Q;  1NMG A;  2KCT A;  4LFA L;  3K81 C;  3CPW A;  1OTC A;  5ELN A;  4JI3 L;  5JJK A;  1NJI C;  3A74 A;  1XPO A;  2HQL A;  2IHE A;  3FKI G;  1K73 C;  4IPD A;  1Q81 C;  2UXC Q;  4LF4 L;  1XMQ L;  4LF5 Q;  1HZB A;  2ZTD A;  2JA7 G;  1HJP A;  4IJL A;  4B3M Q;  3KJO A;  1C0A A;  1Q82 C;  1PYB A;  4A93 G;  1TWG H;  1HZC A;  4DUZ Q;  1C9O A;  3PSI A;  2L15 A;  3CCQ A;  1PVO A;  1W2B A;  1L1O C;  1NMF A;  1YNX A;  3A5U A;  1YIT A;  3PUV A;  5JJL A;  1X3E A;  1UWV A;  3PUY A;  2JA6 G;  2JA8 H;  5C3E H;  1HNX L;  1UEB A;  2WFW A;  3W1G A;  5IE8 A;  5LMN Q;  2MO0 A;  4TVA B;  5M3M H;  3CF5 A;  4JI1 L;  4GOP A;  2WB1 G;  4DK6 C;  3S1R H;  4JI8 Q;  1VQ7 A;  4BY7 G;  2HIV A;  4LFB L;  1AE3 A;  4GS3 A;  5C44 H;  4GNX C;  1K9M C;  2DUD A;  4OWT B;  3A5Z B;  1VQC A;  2N78 A;  3KDF B;  3U4V A;  3JAM c;  4IOC A;  4DR2 L;  4IFD G;  3BU2 A;  5M3F G;  3RN2 A;  1MKH A;  1R9T H;  4L5T A;  1K83 H;  4LFC L;  3J7Z C;  1HNZ L;  1YVC A;  1G6P A;  4BBS G;  1SFO H;  3ER0 A;  4IFD J;  1UE1 A;  2KBN A;  3J81 j;  1CKM A;  5GAG C;  1PH7 A;  1Q1E A;  1E1T A;  1K0R A;  3JAM i;  3OW2 A;  1VQO A;  4LF8 L;  2K5V A;  3E9H A;  3KF6 A;  2F4V L;  3OTO Q;  2HIX A;  5IYC G;  4P73 A;  3GTL H;  3STB C;  1FVI A;  2BA0 A;  1VQM A;  3TS2 A;  2NZO A;  2QA4 A;  1L2F A;  2PI2 A;  3I56 A;  4AYB G;  4BA1 I;  3KLW A;  2UXC L;  1LUZ A;  4DV1 Q;  4LF5 L;  4IFD I;  1PH5 A;  1WYD A;  4KLK A;  4UPA A;  1N9W A;  3BJU A;  4GNX B;  4B3M L;  1WCM H;  5C0X G;  2ZTE A;  1HZ9 A;  2GVA A;  4DUZ L;  1CKN A;  3U58 A;  3F1Z A;  1HZA A;  4A3E H;  1EWI A;  4A3K G;  4ALP A;  1WJJ A;  1EQR A;  3L7Z C;  5C0X J;  3J80 i;  4O0A A;  3M9B A;  4DV5 L;  4DR1 Q;  2LSS A;  1VQ4 A;  1YHA A;  4JI0 Q;  5C4X H;  2IX1 A;  3HKZ G;  3PO3 G;  4HJ5 A;  1LTL A;  1B70 B;  4A3B H;  3M4O H;  4GKK Q;  2Q2H A;  2R92 H;  2K5H A;  5LMN L;  2JA9 A;  1A63 A;  2NVT H;  1E24 A;  4JI8 L;  3B6Y A;  1Y1V G;  1PH6 A;  4AQY Q;  1E1O A;  2Q2I A;  2CWA A;  1OXU A;  1GVP A;  4IJH A;  4JBK A;  5IWA Q;  4A3C G;  3H0G G;  1X3F A;  3FP9 A;  3HOW G;  4XIG S;  1PHJ A;  5IYB H;  1IYJ B;  4JI4 Q;  3K0X A;  4A3L H;  1RL2 A;  1K8A C;  2OCE A;  4PZ6 A;  4A3I H;  3RZD H;  4A3J G;  1YJ9 A;  4UY8 C;  1WI5 A;  4TQU S;  2Z0S A;  5FJ8 G;  2ZM6 Q;  1N8R C;  2R7Z G;  3OTO L;  1VQG A;  1Q86 C;  2WB1 E;  1K3R A;  2A19 A;  4A3M H;  2E5L Q;  4LF6 Q;  4HIK A;  4QGU A;  3S1Q H;  5FLM G;  1P8L A;  3G48 A;  4DAM A;  3DLL A;  1N34 Q;  1UE7 A;  3KJP A;  1QVG A;  1IXR A;  1TXY A;  3EBE A;  2E2I H;  3I4N G;  1I5F A;  3RR5 A;  5C4J H;  3IRB A;  1HH2 P;  1SE8 A;  1Z47 A;  4R4T A;  3I2Z A;  1S40 A;  4OX9 Q;  2ES2 A;  1VQ8 A;  3CCL A;  2XTI A;  1D7Q A;  4LF7 Q;  2JE6 I;  2VZA A;  4O2D A;  2UUB Q;  3NEM A;  4DV6 Q;  3PO2 G;  4DPG A;  2VW9 A;  2AKW B;  2Z6K A;  4DR1 L;  3F2D A;  4B3T Q;  4LW1 A;  3HOZ H;  4GN5 A;  3ZJY C;  1EFW A;  3RN5 A;  3RNU A;  3OYY A;  1N33 Q;  2VUM H;  1YIJ A;  2YYZ A;  4GKK L;  3T1H Q;  4KHP Q;  4NPS A;  5EAY A;  3CCU A;  3D0F A;  1JJ2 A;  2GN5 A;  2OQ0 A;  4AYB E;  3CC4 A;  4JV5 L;  1XJV A;  1SRO A;  1A8V A;  3U4Z A;  2MO1 A;  4DUY Q;  3HOV G;  2VQF Q;  4DR6 Q;  1YZ6 A;  3FKI H;  1PH1 A;  1I94 Q;  4RG1 A;  3S1N H;  4MTN A;  1S3O A;  4YCU A;  4JCV E;  2UXD Q;  2F52 A;  3AQQ A;  3TRE A;  1Y1W G;  4X62 Q;  4QIW E;  3CQZ H;  4YY3 Q;  4A3F G;  4BY1 G; 
#chains in the Genus database with same CATH topology
 4JI4 L;  3R8B A;  5JVH 3;  3MC0 B;  3FEW X;  2CWP A;  4B9W A;  2E8G A;  1JJG A;  2KED A;  4A75 A;  1F9Q A;  4LF6 L;  1RDP D;  2B2U C;  3CCR A;  1QZG A;  3CC7 A;  2F3I A;  4L5Q A;  3C2P A;  3KLS X;  1WD0 A;  1DM0 B;  1U0L A;  1Q1B A;  4ABN A;  3CCS A;  1G2T A;  2C5C A;  3QWN A;  1PH8 A;  3M4Y A;  3M4P A;  1EY6 A;  2PMZ B;  2GVB A;  4GNX A;  4IUU A;  3W5O A;  4YHH Q;  1WD1 A;  5J39 A;  1G6Z A;  2F0O A;  4RFB A;  4KKS A;  1QJO A;  3F8T A;  1PH3 A;  1FNW A;  1VMC A;  5IYD H;  1Y69 U;  4IUR A;  4BXX H;  1JE5 A;  4A3D G;  2BH2 A;  2DGY A;  3T1Y Q;  1WTH A;  1VQ6 A;  1OXX K;  2K75 A;  4OXP A;  3GTP H;  1AP0 A;  1B9N A;  5FOB B;  2L11 A;  4J6H A;  1I4G A;  2A1A A;  1F2L A;  1HUN A;  4QUC A;  1IW7 C;  2B8F A;  1N32 Q;  3VA7 A;  1LTG D;  2CHB D;  1E0B A;  3GTQ H;  1XNR L;  1GKH A;  1Q3L A;  1VQB A;  2XIW A;  2HHH Q;  1OXT A;  3LGJ A;  3NK9 A;  4B3S L;  1STH A;  4KHV A;  4WRD A;  2YTV A;  4MNO A;  1G2S A;  5K36 H;  1PLF A;  1VQ9 A;  1EIY B;  2NVT B;  1FGU A;  2E75 C;  3AMU A;  3NPP A;  1IBL L;  2K01 A;  4RGM A;  3GTG H;  4A3E G;  1MJE A;  2HD3 A;  4J15 A;  2ALY B;  3EA6 A;  2K50 A;  2DY8 A;  3A8K E;  1GUS A;  1EIH A;  1SXT A;  3I3C A;  3I4M H;  3MA2 B;  2VQE Q;  3SK4 A;  1H95 A;  2Q2U A;  1XPU A;  3PUZ A;  4DV1 L;  1S5B D;  4IUN A;  5LMU Q;  1X6O A;  4JI2 Q;  2CVR A;  1JB7 A;  1EY5 A;  4Y7N H;  1WTR A;  2KHJ A;  2A69 D;  4DKA C;  2QEJ C;  1KDC A;  3IFD A;  4QJF A;  4GN3 B;  3I4O A;  4NXM Q;  4A3L G;  1ZKO A;  2E2I B;  1I3Q B;  2JA5 G;  4QF4 A;  1LTR D;  3KOJ A;  2Z6K C;  3CP0 A;  1A15 A;  1TS5 A;  4HMI A;  1O80 A;  2B63 B;  3J81 c;  5IWA L;  3NBH B;  4CKC A;  2Y0S E;  1I4R A;  1TWH H;  3J7Y W;  1PRT B;  4PG3 A;  3HOV B;  4BBR G;  4NXN Q;  1O7Y A;  1KLG D;  2H4O A;  4J8Q A;  3E9I A;  4KKU A;  4LUZ A;  3GTO H;  4LJZ C;  3J81 i;  2LXK A;  3H6M A;  5JOB A;  3HS0 C;  3S16 B;  2RDF A;  3RZO H;  3HOZ G;  2JJQ A;  3HOY B;  3PMF A;  1P16 A;  3IAY A;  3CCE A;  5LL6 S;  4OWX B;  4YWL A;  3TQY A;  2JEA I;  2Q8R E;  4A3G G;  2C9O A;  2K4K A;  3ITP A;  4KN4 C;  1FNV A;  4C3J B;  1PFS A;  2UUC L;  2FHT A;  4G7H C;  5EKI A;  4MHE A;  1LTT D;  4B3R Q;  3N6R A;  3BZK A;  4HCS A;  2WV6 D;  3EIV A;  2WB1 B;  3K7A H;  1SE3 A;  1JMC A;  1SDF A;  1CQF A;  1GUT A;  5JJZ A;  3AEV A;  4KHP L;  2VB3 X;  5IYC H;  1HNW L;  1PFM A;  2CH4 W;  1PTO D;  5D3D A;  1PH2 A;  5JJI A;  3TN2 A;  3V2T A;  3HRZ C;  4EQN A;  3Q22 A;  4C3I B;  1VQJ A;  2DN8 A;  1YJW A;  3S1M B;  2UXD L;  3V96 A;  5C0X H;  5AJ3 L;  5IP9 H;  3L2P A;  1CHQ D;  1SBB B;  5IP7 H;  4Q0F A;  2OQK A;  3BDC A;  2MJ8 A;  4C1N I;  3D31 A;  4APV A;  1IHZ A;  2B2T A;  3M85 A;  3QJY A;  3CME A;  3HFZ B;  4CHT B;  5ISR A;  3GDE A;  1D8L A;  4HN7 A;  1GUG A;  4GZY C;  4TRD A;  2UXB L;  4C3H H;  2EYO A;  1SRU A;  4DFA A;  2WAC A;  2BDO A;  3H0G H;  3M7G A;  5CV9 A;  1SND A;  1GHK A;  3KBX A;  4HID A;  3A7L A;  2A69 C;  1BOS A;  3A54 A;  4N9P A;  2VS1 A;  2R7Z H;  5KNC A;  3M3Y B;  1NTG A;  1BO0 A;  2F0H A;  3N52 A;  4HJ9 A;  5FLX E;  4G7O C;  2ATW A;  1PMR A;  1J5E L;  1WOC A;  4IPC A;  5IOC A;  2CW0 D;  1SR3 A;  4EQO A;  3MVV A;  2LMC B;  3EN2 A;  4DV7 L;  3CU7 A;  2YU9 H;  1F77 A;  2SDF A;  4P74 A;  2KCM A;  4H13 C;  1S4Z A;  4LF4 Q;  1IL8 A;  4P71 A;  3T13 A;  4K6D A;  4R8I A;  3HGB A;  3T4A C;  1KD1 C;  3S24 A;  1CSP A;  1PFB A;  1E3P A;  1IKL A;  1QVC A;  3PO2 B;  4X64 L;  3I55 A;  5A2Q L;  2RHQ B;  1OXV A;  4DV0 L;  5C4Z A;  3U9O A;  4DR7 L;  2D62 A;  4LFB Q;  2JQO A;  2ZJQ A;  3S14 H;  1X56 A;  3BVZ A;  1GXD C;  1L0X B;  1TVX A;  1YHQ A;  4HMJ A;  2UUA L;  4LFC Q;  1VQA A;  3T53 B;  1HNZ Q;  4A76 A;  1LAC A;  4RGT A;  4BY1 B;  4FP5 D;  2F3W A;  2PNR C;  3MEH A;  3P75 A;  3RLN A;  2RF4 A;  2F4V Q;  4LFA L;  2KCT A;  3AB9 A;  3K81 C;  3VYT A;  5ELN A;  2M00 A;  5JJK A;  1TY2 A;  3U9S A;  4IPD A;  2UXC Q;  1HZB A;  3KJO A;  3GV3 A;  4KJO A;  1Q82 C;  3EJI A;  3S17 B;  4KKT A;  1L1O C;  2ICE C;  3Q6S A;  2PW7 A;  1X3E A;  1UWV A;  3PUY A;  5DM7 3;  4R9W A;  1HNX L;  5IE8 A;  5LMN Q;  4TVA B;  4GOP A;  4WOR A;  4DK6 C;  3S1R H;  2NUC A;  2JYO A;  2WIN B;  1TWG B;  2SNS A;  4JPB W;  5C44 H;  1K9M C;  4DAV A;  2XWJ B;  2N78 A;  3BVM A;  3U4V A;  1TII D;  2RVL A;  5IGD A;  4K2L A;  1AZP A;  5ELF A;  1EYD A;  1G6P A;  4BBS G;  4KD3 A;  1LTS D;  5KRU A;  2NVY B;  1UE1 A;  3A55 A;  2F0T A;  2F03 A;  2K03 A;  3O13 A;  1BCP F;  1VQO A;  3TP6 A;  2K5V A;  2CW0 C;  3KF6 A;  5I6W A;  3OTO Q;  3S15 B;  1STN A;  3STB C;  3HEJ A;  5FO8 B;  1VQM A;  4OL7 A;  1F9R A;  1ESF A;  2PI2 A;  2NBF A;  3GP7 A;  1HQR D;  4DV1 Q;  4IFD I;  1QNU A;  4KLK A;  3VYU A;  1N9W A;  3BJU A;  1U9R A;  3W3A A;  2A6H D;  3GTL B;  1CKN A;  4IQZ A;  4A3E H;  1EWI A;  3JAM E;  4DR1 Q;  2KHS A;  5M5Y B;  2IX1 A;  1B70 B;  3K0Y A;  2JA9 A;  1A63 A;  2NVT H;  1JIC A;  3B6Y A;  1Y1V G;  4JK1 C;  1OXU A;  1D5X C;  2FIN B;  5IWA Q;  1I4H A;  2RQX A;  4XXE A;  3HOW G;  2EYM A;  5IYB H;  4A3L H;  1A2U A;  1RL2 A;  2EOT A;  1K8A C;  4ZLT F;  1I6H B;  3X3N A;  1WI5 A;  5IOD A;  4TQU S;  2MP1 A;  4Z9C B;  1VQG A;  1Q86 C;  1EY4 A;  2A19 A;  2HUG A;  3MXP A;  1P8L A;  3G48 A;  1UE7 A;  3TP5 A;  1EEF D;  2E2I H;  2VB2 X;  3DHQ A;  1I5F A;  1HH2 P;  1Z47 A;  1NAP A;  4RKL A;  4IUT A;  4DAP A;  4CDE C;  4K8J A;  3A56 A;  2VZA A;  4O2D A;  2UUB Q;  4DPG A;  2AKW B;  3TZD A;  1QOH A;  3OIP A;  3HOZ H;  4DNR B;  4GN5 A;  3ZJY C;  3DMU A;  1YIJ A;  4GKK L;  4KHP Q;  3CCU A;  3D0F A;  1TU2 B;  2OQ0 A;  2L9H A;  3LWU A;  1SRO A;  1A8V A;  1U4P A;  2VQF Q;  2TSS A;  3E5S A;  3FPU B;  1S5F D;  1S3O A;  4MTN A;  4DNT B;  2UXD Q;  1BCP B;  1I6V C;  2MPM A;  2R3Z A;  3TRE A;  4X62 Q;  4A3F G;  1CZW A;  3K6O A;  1EWC A;  3S9W A;  4C3J H;  3HKZ E;  2N8N A;  4ME5 A;  2FMC A;  2I5L X;  3FHW A;  2ZM6 L;  1QNK A;  1ESR A;  2C35 B;  1Q12 A;  2E5L L;  1BF4 A;  1PA6 A;  3VR4 A;  4GLX A;  4FXK C;  1PTO B;  4LAA A;  2PI2 E;  1X54 A;  1AEX A;  2N49 A;  1E7Z A;  2NB0 A;  4OX9 L;  3CD6 A;  1VCI A;  3E0J A;  2YTY A;  4EGV A;  4POF A;  1EUJ A;  1VF7 A;  1HFG A;  2IJ0 A;  4DV6 L;  2CQA A;  4C3I H;  2GA4 B;  1C4Q A;  4BWG B;  1KDA A;  2LFN A;  4UHV A;  3S1M H;  3VR5 A;  1K8O A;  3CAM A;  1B8A A;  2H5X A;  1N33 L;  2JA8 B;  5C3E B;  4FDB A;  3UDF A;  2B2Y A;  4LUO A;  4BA2 I;  4DF7 A;  4DR5 L;  1L1O B;  5JPM C;  3D3R A;  4RCN A;  4RWS C;  2CCZ A;  4O42 A;  4QY7 A;  1I4X A;  3RLO A;  3BYT B;  1GD7 A;  4DV7 Q;  3H91 A;  1TS4 A;  3KF8 A;  1R9T B;  2NTT A;  5M3M G;  4X65 Q;  4DV3 L;  3PIP 3;  3J80 c;  1XNQ L;  1E2Z A;  2NVQ B;  3DWP A;  4JC0 A;  3S2D H;  4DAY A;  1F9S A;  3L0O A;  1M4V A;  2F0D A;  2VXW A;  4HED A;  3VA5 A;  5IY0 A;  5IP9 G;  3T56 B;  5CBA E;  1CQV A;  1JB3 A;  1SNC A;  1SSO A;  5IP7 G;  1GO3 E;  2PO4 A;  1JOO A;  2HDM A;  1FJG Q;  5KND A;  5BN4 A;  1YJN A;  1I4P A;  4RHR A;  1AW7 A;  1E2W A;  3M3Y H;  1NNX A;  2R61 A;  1WCM B;  3R2T A;  2A68 D;  4RGO S;  4X66 Q;  4DV4 L;  1HHV A;  2EYJ A;  5I9O A;  3IL8 A;  1KL9 A;  1SN8 A;  3J7A 5;  3KF6 B;  2Q8T A;  5T1G A;  1A3V A;  3AU7 A;  1QVF A;  5FJ8 H;  5C5M A;  1RTO A;  1GM5 A;  2PNH A;  3HG9 A;  1DGS A;  1ET9 A;  5FLM H;  1H9J A;  2VNU D;  4DV2 Q;  4R4I A;  3I70 A;  2OTL A;  2B8G A;  4NMZ A;  3CRK C;  2EJF C;  3OMG A;  2IL8 A;  2AWO A;  1BR9 A;  1CKN B;  4C2M B;  4DR4 L;  5C3X A;  5I6Y A;  4JOI C;  1CZG A;  3ERQ A;  2ZJP A;  3PO2 H;  4HR7 B;  2OXP A;  5EPJ A;  3NEN A;  5EKK A;  1HR0 L;  3HOX B;  4X3U A;  1EOV A;  2SOB A;  2WP8 J;  1CA6 A;  4XT3 B;  1KC8 C;  1JWM D;  2UU9 L;  2KJX A;  2RCF A;  5M5X B;  5FO9 B;  1IBM Q;  2HCI A;  1KLU D;  4JI7 Q;  1UAP A;  1U4L A;  1PH4 A;  3TEH B;  2ZTC A;  2RCN A;  2QKI C;  1B9M A;  2EDG A;  2B29 A;  2E2J H;  1HXY D;  1QUQ B;  4ZAI A;  1UNS A;  3GO5 A;  3G71 A;  3H15 A;  2OTJ A;  5DEH A;  1M90 C;  2EY5 A;  4WJ4 A;  3KLS A;  1VQE A;  1EYC A;  5DNF A;  4CKE A;  1Y8O B;  4HIM A;  1B3A A;  5BR8 Q;  1SNM A;  3PUW A;  2JA7 B;  3KDF A;  4OGQ C;  4I7Z C;  4R4Q A;  2L55 A;  3CPF A;  4LMQ D;  3C3L A;  3S17 H;  4JI5 L;  4RGN A;  4DN4 M;  5CBE E;  4N8X 1;  4LF9 L;  2I5H A;  4G57 A;  3MEF A;  1B53 A;  1SMY D;  1XYI A;  2MFI A;  1D6E C;  4GLV B;  3J81 E;  1BVS A;  2CQO A;  4EX5 A;  1DD2 A;  1T9H A;  2QDL A;  4J1M A;  2JA6 B;  1CI3 M;  4BBS H;  3ONA B;  2XN9 C;  1XPR A;  2CKZ B;  2HCC A;  5J3B A;  4BY7 B;  4PNY A;  5EGT A;  5E4W C;  3U50 C;  2MHV A;  1TWF B;  1F9P A;  1HTL D;  4DUY L;  5M3F B;  2DJG C;  4UP7 A;  1LTB D;  3GD7 A;  3ICE A;  1N36 Q;  5KYL A;  2NVY H;  2A68 C;  5L37 A;  5GQO A;  2RA4 A;  4K2K A;  3S15 H;  1DOK A;  1VQI A;  3TDQ A;  4YCW A;  2KHI A;  2EIF A;  1VQ5 A;  5C44 G;  1I4Q A;  5C3W A;  3PGZ A;  4AYB B;  3BVG A;  4MN3 A;  4A3D B;  2EPB A;  4HCE A;  1KAA A;  1B7Y B;  2PYK A;  2YTX A;  4N9T A;  1W3S A;  1II3 A;  3J7A F;  4JI6 L;  3H94 A;  1WTX A;  1EIG A;  1Y1V H;  2ID0 A;  2EYP A;  4QIW B;  2AUJ D;  4A3K B;  2AMC B;  2F0U A;  3SK8 A;  4IOA A;  5D3I B;  5M5Y H;  1J6Q A;  3Q8D A;  5ELD A;  1TQO A;  3HOW H;  3G7L A;  1QCB D;  3S2H B;  4ZKC B;  1VQH A;  3DUZ A;  4JBW A;  1M1K C;  1STG A;  4JYA Q;  1W6J A;  3SVM A;  3KF8 B;  4OO1 I;  1FL0 A;  4NP5 A;  3KYH C;  5HY6 A;  4HSP A;  5I2Y A;  1I6H H;  1EU3 A;  4G4K A;  4DAY B;  5KNB A;  4A3J B;  4KK7 A;  1Z9F A;  2A6E C;  2N3S A;  4Y52 H;  1V9P A;  2K52 A;  5H1S E;  4IN3 A;  4PMW A;  3RUZ A;  2ZXR A;  5IT9 L;  1ENA A;  5IYB G;  1MD2 D;  1NUC A;  2ASB A;  2E2H H;  1O7I A;  3AFP A;  2NZ1 D;  3CW2 C;  1ASZ A;  2BH8 A;  2AUK A;  2F0S A;  2D2C C;  1SE4 A;  5BN3 A;  3GTM B;  4FF2 A;  4EQP A;  2BE5 D;  4DR3 L;  1IBK L;  1SMY C;  2VY3 A;  1L0W A;  4A3F H;  1VQL A;  4JI1 Q;  2K33 A;  4IPG A;  4GKJ L;  5GRO A;  3EFX D;  5GAE C;  4CJ0 B;  2E74 C;  5JPN C;  2O5J C;  1C7Y A;  1I50 H;  1QG7 A;  4TSS A;  1KIX A;  1F2Z A;  2D0O A;  1KQS A;  1OXS C;  2L12 A;  1CA5 A;  2B63 G;  1Y1W B;  1PZK D;  2I46 A;  3D8G A;  4BBR B;  3PIO A;  3K5L A;  2XGT A;  1SE2 A;  3TRZ A;  4DR5 Q;  4LF8 Q;  2PQA A;  1LTI D;  4JI3 L;  4RA8 A;  1MSG A;  1BCP D;  4DK0 A;  1XPO A;  3HOU B;  2HQL A;  1K73 C;  4S3S A;  4EVO A;  1S5D D;  5M5W B;  1LT6 D;  1NR4 A;  4IJL A;  4B3M Q;  4YIJ A;  1C0A A;  1Q90 A;  1HZC A;  1C9O A;  3C1F A;  1W2B A;  5IGF A;  4C3J G;  3TBI B;  3D4W A;  2F0F A;  3SK6 A;  4K6L A;  3HZX A;  4XQJ A;  3A5U A;  3PUV A;  5G3L F;  4F8M A;  2JA8 H;  5C3E H;  1PXU A;  1UEB A;  2WFW A;  2Z9H A;  1DYQ A;  5ELB A;  1ET6 A;  2EZV A;  3NXW A;  5M3M H;  3CF5 A;  1SYC A;  2WB1 G;  4DK1 A;  1B4O A;  1VQ7 A;  1SYE A;  1EU4 A;  1HA6 A;  3SEB A;  4CJ1 B;  1VQC A;  3KDF B;  4HTH A;  3I73 A;  4IOC A;  5AFW A;  4DR2 L;  3BU2 A;  2F0P A;  3RN2 A;  1MKH A;  1R9T H;  4ZRZ A;  1Y8N B;  4C3I G;  3J7Z C;  2JN4 A;  5IGC A;  1SFO H;  1PH7 A;  2I07 B;  1Q1E A;  3URY A;  3OW2 A;  1K0R A;  3E9H A;  2B2V C;  2Y0S B;  1FVI A;  3TS2 A;  4X3K A;  3I4L A;  4FVM A;  4BA1 I;  3KLW A;  4LK1 C;  5BN5 A;  2G5D A;  2R93 B;  4LF5 L;  4GNX B;  3K5M A;  1WCM H;  1R4P B;  2EY1 A;  1B50 A;  1HZ9 A;  1SJE D;  4DUZ L;  1KTK A;  3U58 A;  1HZA A;  4XQQ A;  1EQT A;  3KUP A;  1WJJ A;  3L7Z C;  4WJW A;  4O0A A;  4DV5 L;  3LX0 A;  2LSS A;  1YHA A;  3NTI A;  1HCZ A;  1LT4 D;  1SYB A;  4RH6 A;  3FDT A;  1PH6 A;  4JI8 L;  4H44 C;  4PV1 C;  1SJH D;  1GVP A;  2SNM A;  3GTK B;  1JCK B;  4FO2 A;  3BS1 A;  4A3C G;  4FNF A;  3FP9 A;  2AQ1 B;  1PHJ A;  4A3B B;  4JI4 Q;  2R92 B;  3MZ5 A;  5T1I A;  1TWC B;  4PZ6 A;  5KYI A;  5FJ8 G;  1SYF A;  1K3R A;  4LF6 Q;  1GUO A;  4QGU A;  3GV6 A;  4E6I A;  3S1Q H;  5FLM G;  3DLL A;  1X3P A;  3VR6 A;  1TXY A;  3QOL A;  1BCP C;  5KGU A;  5C4J H;  4A3I B;  3IRB A;  4ODG A;  4R4T A;  2ES2 A;  1VQ8 A;  1LAB A;  2XTI A;  4K14 A;  3NEM A;  3PO2 G;  3F2D A;  2J7Z A;  5I2X A;  1PYW D;  3OYY A;  1JWU D;  4NPS A;  5EAY A;  3W2D A;  1Z6H A;  2GN5 A;  1STA A;  1PTO C;  3CC4 A;  4JV5 L;  4DA2 A;  2MO1 A;  4DUY Q;  1A6X A;  1RTN A;  3MFG A;  1YZ6 A;  4RG1 A;  3NHH A;  5C5L A;  3T51 B;  2F52 A;  3AQQ A;  1EY7 A;  4FF4 A;  2VUM B;  1RCV D;  4BY1 G;  3D6C A;  2MGS A;  3NQT A;  1TS2 A;  2NTS A;  4QMG A;  4ZQ3 A;  4R1J A;  5ELE A;  2QGQ A;  3E3X A;  4KTA A;  2B3G A;  2JA6 H;  3TS0 A;  2EY2 A;  3DEO A;  1N34 L;  1IL2 A;  1STE A;  3OWE B;  4H02 A;  2WAQ G;  4BY7 H;  5HUR A;  5CMD A;  1T5X D;  1K0S A;  3SK5 A;  1XNR Q;  1TWF H;  5IIF A;  1KNE A;  3QR8 A;  4IFD H;  4LF7 L;  1A0I A;  2E2D C;  1XMO L;  4P2C B;  2JEB I;  4B3T L;  4HAE A;  1EIF A;  2PQA B;  2ZJR A;  4B3S Q;  4RMF A;  3ND9 A;  3QO2 A;  3T1H L;  2AWN A;  4YWM A;  4HJ7 A;  1IBL Q;  4L63 B;  5GAD C;  3PCO B;  2N55 A;  1JOK A;  4DR6 L;  3CCM A;  1NE3 A;  1I94 L;  4MIU A;  2HQE A;  3PV0 A;  1PZJ D;  2A74 C;  1ICW A;  5HGQ A;  4HJA A;  3UDG A;  4IZ8 A;  4A3K H;  3SR1 A;  1KNA A;  5IGG A;  2VL6 A;  5EPK A;  1XX8 A;  3S2H H;  2QW7 A;  4FF1 A;  3UE1 A;  1XTD A;  4V19 0;  4NB3 A;  4ID6 A;  2L5T A;  2PW5 A;  4OO1 G;  3G4S A;  2LY7 A;  4JBJ A;  3DEP A;  3GTP B;  2F0G A;  5CYU A;  2EYH A;  1TKW B;  3KK7 A;  3VYR A;  2CFM A;  4IUP A;  3F2C A;  1DOL A;  4GN4 B;  4NKL A;  2B2W A;  5C4X B;  2MNA A;  1X32 A;  3J80 E;  3M4O B;  3P7J A;  1YI2 A;  4TKO B;  4YHH L;  3I8Z A;  3QIA A;  3BZD B;  4C1N K;  1Q7Y C;  1EEI D;  1E2V A;  4CBV A;  4PQX A;  4ZUJ A;  1QZH A;  4O1N A;  2QF7 A;  1MIU A;  4XYO A;  4U68 A;  4QB4 A;  4DK3 C;  1VF5 C;  3RLF A;  3T1Y L;  1ZYR D;  1SNP A;  1I3Q H;  3RZD B;  4A4I A;  2UUC Q;  2F3V A;  3E6Z X;  3GTG B;  3A0J A;  1LYL A;  2EJM A;  4N8F A;  2B63 H;  1Q8K A;  4A3M B;  3I4M B;  1CUK A;  1YNN D;  4POG A;  1N32 L;  4JI0 L;  3K80 C;  3HOV H;  2ICI A;  2BCO A;  3H3V I;  1HNW Q;  4KJN A;  1Z7T A;  4AQY L;  2AHO B;  1ILQ A;  2K28 A;  2HHH L;  3F2B A;  1O78 A;  3S16 H;  1NR2 A;  3R2I A;  4UAI A;  5IT9 c;  1JQY D;  1Y14 B;  2PQE A;  3HOY H;  4LWC A;  3G6J B;  4EQ5 A;  2L0C A;  1ENF A;  4ILW A;  4XTC S;  5AJ3 Q;  1LT5 D;  2QEX A;  2M9V A;  4OEM B;  5JEA G;  4DGZ A;  3BZC A;  4IUV A;  3HOU H;  5EPL A;  1CT1 D;  3FKI B;  2EYF A;  5M5W H;  5JEA J;  3CC2 A;  2ZXO A;  2FMM A;  2VQE L;  3KFU A;  1IZ6 A;  4H0L C;  4A93 B;  4ZKB B;  1DON A;  3CMA A;  2QDB A;  3ZYY X;  2UXB Q;  5LMU L;  1ZXT A;  4JI2 L;  4XYQ A;  3RZO B;  2EYL A;  2A6H C;  1NY4 A;  2YV5 A;  4QQB X;  3K59 A;  1C48 A;  3UE0 A;  4NXM L;  1ASY A;  3CKI B;  1OO9 B;  3MHB A;  4DV5 Q;  3UDI A;  2P5Z X;  1J5E Q;  2A73 B;  2NN6 I;  2Z1C A;  4P75 A;  3L3O C;  5E1F A;  1CK1 A;  3WWV A;  2PPB C;  5E7N A;  4PMC A;  3K7A B;  3PF4 A;  2B2Y C;  4V0B A;  2JA8 G;  5C3E G;  4MZ9 A;  1RJT A;  4YY3 L;  1KAB A;  1SAP A;  4NXN L;  5FK9 C;  1G29 1;  3P1H A;  2R93 H;  1QWY A;  2B39 A;  4GOP B;  1MI2 A;  2JK8 A;  1QB5 D;  2KUM A;  3MWY W;  5FO7 B;  1EQV A;  2NZH A;  3TP7 A;  1A3T A;  2K5N A;  3VR2 A;  2EXZ A;  4UP9 A;  4A3C H;  1ZYR C;  3F2U A;  4X64 Q;  5F2D A;  4FXD A;  3PO3 B;  3HKZ B;  4B3R L;  3H3V C;  1JT8 A;  4DV0 Q;  5DLQ E;  1DCZ A;  4XQN A;  1JOR A;  4DR7 Q;  1S72 A;  2X69 A;  2PZW A;  2XRS D;  3GTK H;  2RDH A;  3L9A X;  3DM3 A;  1G51 A;  1WCM G;  2DY7 A;  3W1B A;  4CDD C;  1TWA B;  4C3H B;  3T16 A;  2IT1 A;  2UUA Q;  3H0G B;  3VR3 A;  4DU9 A;  2XRQ D;  1S5E D;  1CKO A;  1TWC H;  2OWO A;  1EZ8 A;  4JV5 Q;  4GLA C;  3VYS A;  3PF5 A;  3NSW A;  4LFA Q;  1CTM A;  1G91 A;  2R7Z B;  1ENC A;  1U5K A;  2NWG A;  3K7U C;  4RCO A;  5I9P A;  1EY8 A;  4OWW B;  2MUY A;  3Q0A A;  1X65 A;  2D5D A;  3NBH A;  3VDY A;  1FYC A;  3I4N B;  4JOI A;  4JBM A;  1VDZ A;  1C8C A;  1NBW A;  2LS0 1;  3BDO A;  3A7A B;  4Q5V A;  1PV4 A;  4R4O A;  3HOX G;  1VS0 A;  2PMZ E;  2EE1 A;  3SGI A;  2KOL A;  3OIQ A;  1HNX Q;  3BDL A;  3G6E A;  4BY1 H;  1GUN A;  4CDC C;  5CV4 A;  3K5O A;  4M1U B;  5G3L D;  4ME3 A;  1TR5 A;  1XMO Q;  2JXM B;  3WDN A;  2NVX B;  1RKN A;  4CDF C;  1V43 A;  4IAL A;  4OHJ A;  3H09 A;  1X9N A;  1WTQ A;  1J8I A;  1AE2 A;  2EXD A;  2L4N A;  2KCC A;  1U4R A;  5JAV A;  3S14 B;  1OTC A;  1UUP A;  1K28 A;  1NJI C;  2IX3 A;  3A74 A;  1UEA B;  1EOT A;  5TSS A;  3MAQ A;  3X3M A;  4LF4 L;  1XMQ L;  2B2U A;  2JA7 G;  1GHJ A;  4KMU C;  4ULL A;  2RSO A;  2M2L A;  4F87 A;  1PYB A;  3J7A V;  1TWG H;  3R93 A;  2DNC A;  1EY0 A;  5EKL A;  3CCQ A;  1D2B A;  1D1K A;  2CH4 A;  1LLR D;  1NMF A;  2JA6 G;  5FLX L;  1B2T A;  3SHL A;  3W1G A;  4K5V A;  1ICF B;  4OEL B;  3NQI A;  2HIV A;  5NUC A;  4BY7 G;  1AE3 A;  4GS3 A;  4GNX C;  1L0Y B;  4LFB L;  3OHX C;  4OWT B;  4CGY B;  1NCV A;  3A5Z B;  4HSV A;  4IFD G;  1ML0 D;  2DNE A;  1WTP A;  5M3F G;  2G9D A;  4L5T A;  4LFC L;  1HNZ L;  2Z6B A;  4OO1 H;  4IFD J;  3ER0 A;  3S1R B;  2AQ3 B;  4KD4 A;  1JWS D;  1CHP D;  1CKM A;  5GAG C;  5CR3 A;  1E1T A;  5C44 B;  1HPC A;  3LNN A;  2F4V L;  3GTL H;  1PRT F;  2HIX A;  2WII B;  2BA0 A;  4ZUI A;  2NZO A;  2QA4 A;  1BUV T;  3GTJ B;  4AYB G;  4FXG C;  2UXC L;  1LUZ A;  3CHB D;  1MSH A;  4H7B A;  1WYD A;  4UPA A;  3WOF A;  3NWS A;  2BDN A;  2GVA A;  3GQB A;  3F1Z A;  1HFN A;  1G8Z D;  4OIK A;  5D65 A;  3K57 A;  4A3K G;  1DZ1 A;  1STB A;  3M9B A;  4JI0 Q;  5C4X H;  4HJ5 A;  5E4X A;  3M4O H;  4GKK Q;  1NSN S;  2Q2H A;  2K5H A;  5LMN L;  1E24 A;  4AQY Q;  2Q2I A;  2CWA A;  2EVB A;  4IJH A;  4A3E B;  2F0N A;  3MTS A;  1Q8I A;  1X3F A;  2FFK B;  4JVZ A;  4XIG S;  1WTW A;  1AZQ A;  3RZD H;  3FVQ A;  4A3J G;  1EL0 A;  1YJ9 A;  2LKV A;  2DJF C;  2QIL A;  2ZM6 Q;  1N8R C;  3OTO L;  5C4H A;  2WB1 E;  3NP8 A;  2XSC A;  4A3M H;  2E5L Q;  4HIK A;  2D9U A;  1RF2 D;  4DAM A;  3QOJ A;  3MFY A;  1IXR A;  1EWH A;  4ZK9 B;  3EBE A;  1IYV A;  1SE8 A;  2F0M A;  3I2Z A;  1S40 A;  4OX9 Q;  3CCL A;  2JA5 B;  1D7Q A;  5JEA H;  2JE6 I;  3I72 A;  4DV6 Q;  1KDB A;  4F7X A;  4K8I A;  2V4D A;  2VW9 A;  2Z6K A;  3MXN A;  4DR1 L;  4LW1 A;  1EFW A;  1DXM A;  3RMH A;  1MGS A;  1N33 Q;  3FMC A;  2F0V A;  3ERO A;  3K58 A;  1X3Q A;  3HOV G;  2K1B A;  2ENB A;  2JP1 A;  3FKI H;  1PH1 A;  4JCV E;  4UDU C;  3HOZ B;  2X6G A;  2Q8I B;  1Y1W G;  4YY3 Q;  1XXG A;  1PTO H;  4A93 H;  3HOY G;  4DV3 Q;  4A3G B;  1FR3 A;  1YEZ A;  1XNQ Q;  1QIL A;  1E22 A;  1V8Q A;  4K0K L;  1YBY A;  2KEN A;  4L5R C;  4KI0 A;  1RIP A;  2OT2 A;  3QG1 A;  4I7A A;  2I0Q A;  3HOU G;  3D6W A;  3JAM L;  3QB3 A;  1EYG A;  1VQD A;  4KY7 A;  5EJW A;  2NN6 G;  4P72 A;  3M4Q A;  1J9O A;  1FD7 D;  4DV4 Q;  2UUB L;  4WJ3 M;  1EQQ A;  1PFN A;  1SNQ A;  4RHS A;  1A62 A;  2PZU A;  4X3S A;  3ULL A;  2G9H D;  1ZEQ X;  5COR A;  4U67 3;  2V1C C;  5CV7 A;  1X3G A;  2KQ3 A;  3J80 L;  1LTA D;  2NVQ H;  2FXQ A;  3SDZ A;  1V1Q A;  1WFQ A;  2VQF L;  4WFN 3;  2R6G A;  1UE5 A;  1SMX A;  3TSS A;  2D0P A;  1A2T A;  2F0W A;  5CC4 A;  4DNI A;  4DR4 Q;  4X62 L;  3IKJ A;  1PH9 A;  1K83 B;  3PQI A;  1LV9 A;  3UDX A;  1TY0 A;  2B2T C;  3ULJ A;  3PIO 3;  4IUQ A;  5A35 A;  2B2V A;  1HR0 W;  1Q46 A;  3HKS A;  4OON A;  4ZYS A;  2Y0S G;  1HR0 Q;  4FYD A;  2WKD A;  4K5X A;  3PO3 H;  1BBU A;  2Z4H A;  1STY A;  4X3T A;  1IKM A;  4FF3 A;  2UU9 Q;  4I65 A;  2EY6 A;  2R93 G;  4R8N A;  3R3O A;  1SYD A;  1TWA H;  3S2D B;  2BE5 C;  1YHB A;  1F2Y A;  2F0K A;  2F1M A;  4QCL A;  4QL5 A;  1KRT A;  5C0X I;  1WTV A;  5JVG 3;  4C56 C;  1VMP A;  5GAH C;  4C2M H;  1B1Z A;  1BKB A;  4NW2 A;  2RDG A;  2RSN A;  2WAQ E;  2R7F A;  2F0I A;  3HOX H;  4HIO A;  4KV6 A;  3I4N H;  4JG2 A;  3STB D;  1VQP A;  4A3B G;  1WTO A;  2OEO A;  4JI5 Q;  2R92 G;  1H9S A;  2Z4I A;  3SE0 A;  4X65 L;  5M5X H;  4LF9 Q;  4RAU C;  3FPP A;  4IPH A;  1HA5 A;  4ZCK A;  2IY5 B;  1XMQ Q;  1MBY A;  3NWT A;  2A5H A;  1BBX C;  1A3U A;  3EQL C;  4BS9 A;  3AFQ A;  3CCJ A;  1FJG L;  2I5M X;  2FJ2 A;  2J4X A;  2BA1 A;  4G7Z C;  4A3I G;  5ELO A;  3ULP A;  2ZXP A;  2NVX H;  1RHP A;  1CSQ A;  1S5C D;  3MXU A;  3NTK A;  2K7V A;  3A8J E;  1CFM A;  1K8G A;  2IHF A;  2KVM A;  4X66 L;  4LUV A;  4R4C A;  1SLJ A;  2JA7 H;  3K5N A;  2X6L A;  1SEB D;  1D5M C;  5C6A A;  5EBC A;  4IO9 A;  1LM0 A;  3BYY B;  3NEL A;  5IGB A;  4F88 A;  2HT1 A;  3OPO A;  1M8A A;  2BOS A;  2E2J B;  1FGB D;  1YNJ D;  4DV2 L;  1K8M A;  3S1N B;  3NBI A;  1BNZ A;  1U4M A;  2F0E A;  2VUM G;  4JI6 Q;  3NTH A;  1JE4 A;  3CQZ B;  3UI2 A;  4B9X A;  1X55 A;  3MXN B;  1PYS B;  1L1O A;  3D4R A;  3I7F A;  5M3F H;  5IT9 E;  2WAQ B;  5KIX A;  2E76 C;  4RKB A;  5J1Z A;  1VQN A;  2A8V A;  1MJC A;  1D5Z C;  1TS3 A;  2K5W A;  3NUC A;  4GOP C;  1LO5 D;  1IBM L;  3E0E A;  2KEE A;  4JI7 L;  5FKA C;  5LMN W;  3C46 A;  4A3D H;  2OF1 A;  3I90 A;  4BBS B;  2HDL A;  3TME A;  2J0T D;  3OMC A;  4UP8 A;  3GTJ H;  4LNQ A;  2XWB B;  2Z8L A;  5CV6 A;  1UE6 A;  3KBG A;  4YWK A;  1KRS A;  5FLX c;  4YCV A;  1V1P A;  5BR8 L;  4L6T B;  1BDO A;  1PZI D;  1GJX A;  5LHY 1;  3K8A A;  2MQH A;  2ZT9 C;  2RHS B;  1EZ6 A;  1H9M A;  1R4Q B;  2R7D A;  3Q23 A;  3DXJ C;  5KEE A;  4KHZ A;  4QUF A;  4KY5 A;  4DR3 Q;  2IX0 A;  5IYD G;  5CGK A;  1IBK Q;  2JSO A;  3MXG A;  4BXX G;  1SNO A;  4GKJ Q;  2IW3 A;  3PUX A;  1Y1V B;  4A3J H;  1PTO F;  2RBM A;  2EQS A;  3GTQ B;  5I4D A;  3H3V H;  1BBW A;  2KA7 A;  3HOW B;  1N36 L;  1JJC B;  1VQF A;  2B2W C;  3Q24 A;  3RD4 A;  4AH6 A;  5C4X G;  4DXF A;  1KAW A;  3ERS X;  2K5Q A;  4JI3 Q;  2F0Q A;  5ELC A;  3CCV A;  2K14 A;  3GTM H;  4OIJ A;  1JC7 A;  3J81 L;  1AH9 A;  4L5S A;  1QUQ A;  1EYA A;  1YNJ C;  2JA5 H;  5K36 G;  4K0K Q;  3DM1 A;  3CXC A;  2WKC A;  2PCF B;  2TMP A;  4NDX A;  2RKS A;  2K05 A;  1O7L A;  4PZ7 A;  2K04 A;  2Q2T A;  3NE5 B;  4Y7N B;  1HRJ A;  4A3M G;  1Y1W H;  2EJG C;  2K32 A;  1KHI A;  2LXJ A;  2IWH A;  3I91 A;  4BBR H;  3I4M G;  1O7Z A;  2F4I A;  4KN7 C;  5D14 A;  3DWQ A;  2E2H B;  4X6A H;  1B44 D;  3AYH B;  1PDQ A;  3IFT A;  4JYA L;  4HJ8 A;  3JC6 6;  1KXL A;  1VQK A;  4DR2 Q;  1AFP A;  1H9S B;  5HGT A;  4K5W A;  2AQ2 B;  4A3F B;  4A3G H;  1H9R A;  3D4D A;  1JOQ A;  3M7N A;  2NN6 H;  3ND8 A;  4AIM A;  3PIP A;  4PZ8 A;  1TWH B;  2KCN A;  1K3B C;  1NMG A;  4CJ2 C;  3CPW A;  4M8A A;  1I50 B;  1D1I A;  3WOE A;  3GTO B;  5LL6 X;  2QCP X;  2IHE A;  1PRT D;  3FKI G;  1QE6 A;  1Q81 C;  4LF5 Q;  4PMB A;  4XT1 B;  2ZTD A;  1HJP A;  1W6K A;  3OW7 A;  4A93 G;  4DXG A;  4DUZ Q;  3PSI A;  2L15 A;  1PVO A;  2F0L A;  1F2M A;  1V1O A;  1YNX A;  1MHW C;  5COY A;  1BXT A;  1EFI D;  5A2Q E;  2O4X A;  1YIT A;  5JJL A;  2MO0 A;  1ONL A;  4JI1 L;  4JI8 Q;  2KEC A;  3V05 A;  2F0J A;  4KY6 A;  2O5I C;  2DUD A;  2XVS A;  1ILP A;  2L1B A;  3JAM c;  3P20 A;  1CM9 A;  2K6A A;  1K83 H;  1YVC A;  1IYU A;  5M3M B;  5E3F A;  3TZU A;  1HUM A;  2KBN A;  5CV5 A;  3J81 j;  3JAM i;  4LF8 L;  5IYC G;  4P73 A;  3CRL C;  3DWA A;  1H9K A;  1HQM C;  3OWF A;  1GUW A;  1DOM A;  1L2F A;  3I56 A;  3OOC A;  5EBD A;  5EQ0 A;  1SFO B;  1PH5 A;  4B3M L;  5C0X G;  2ZTE A;  1FNU A;  4ALP A;  1YNN C;  1EQR A;  5K5P A;  2SEB D;  3J80 i;  5C0X J;  1VQ4 A;  3SXH A;  3PO3 G;  3HKZ G;  1LTL A;  4A3B H;  2R92 H;  3KLR A;  1DJR D;  1EY9 A;  5DAU A;  1E1O A;  3HP3 A;  1V1P B;  4JBK A;  4MTK A;  3BG3 A;  1BQQ T;  4C3H G;  1ROD A;  3H0G G;  2PZT A;  1IYJ B;  4XDX A;  3OSO A;  3K0X A;  2IPK D;  1HTP A;  1WVL A;  2OCE A;  1LT3 D;  4A3I H;  4JW0 A;  3FRP B;  4UY8 C;  1SYG A;  1TT2 A;  2Z0S A;  3A8I E;  2R7Z G;  2YU9 B;  5CV8 A;  1IW7 D;  4B08 A;  1Y8P B;  1N34 Q;  2NYZ D;  3KJP A;  1QVG A;  2XNA C;  3I4N G;  3RR5 A;  1PRT C;  2N88 A;  1XWE A;  4LF7 Q;  5IGE A;  4B3T Q;  5M9O A;  5DM6 3;  3S1Q B;  1AN8 A;  1GOZ A;  3RN5 A;  3RNU A;  1JR0 D;  2VUM H;  1B3Q A;  2YYZ A;  1RD9 D;  5C4J B;  3T1H Q;  3LWE A;  1JJ2 A;  4CKB A;  4AYB E;  3TP8 A;  1XJV A;  1XTC D;  2K5D A;  3U4Z A;  5J22 A;  2H1E A;  4DR6 Q;  1T5E A;  4L8J A;  1I94 Q;  3S1N H;  3C1E A;  4YCU A;  2A6E D;  2O2L D;  3EVQ A;  4QIW E;  3CQZ H; 
#chains in the Genus database with same CATH homology
 4JI4 L;  3HOY G;  4DV3 Q;  1YEZ A;  1XNQ Q;  4C3J H;  3HKZ E;  1E22 A;  2CWP A;  2N8N A;  4K0K L;  2E8G A;  4R1J A;  3FHW A;  2I5L X;  2QGQ A;  2ZM6 L;  1YBY A;  1JJG A;  2KEN A;  4A75 A;  4KI0 A;  4L5R C;  2B3G A;  1RIP A;  2C35 B;  3TS0 A;  2JA6 H;  1Q12 A;  2E5L L;  2I0Q A;  4LF6 L;  3HOU G;  1PA6 A;  1N34 L;  3CCR A;  4GLX A;  1IL2 A;  1EYG A;  1VQD A;  4H02 A;  1QZG A;  2WAQ G;  4BY7 H;  2PI2 E;  2NN6 G;  4P72 A;  1X54 A;  3CC7 A;  2N49 A;  1E7Z A;  2F3I A;  1XNR Q;  4OX9 L;  1TWF H;  3M4Q A;  3CD6 A;  4L5Q A;  1VCI A;  4LF7 L;  1A0I A;  2YTY A;  4POF A;  4DV4 Q;  1EUJ A;  1XMO L;  2UUB L;  4WJ3 M;  2JEB I;  4DV6 L;  1EQQ A;  4C3I H;  1A62 A;  1U0L A;  1Q1B A;  3CCS A;  4B3T L;  3S1M H;  3ULL A;  1EIF A;  2PQA B;  3CAM A;  2ZJR A;  1PH8 A;  4RMF A;  4B3S Q;  1B8A A;  2H5X A;  1N33 L;  4FDB A;  3T1H L;  3M4P A;  2V1C C;  3UDF A;  2AWN A;  1X3G A;  2GVB A;  4LUO A;  4GNX A;  4BA2 I;  3W5O A;  2NVQ H;  4YWM A;  4YHH Q;  2FXQ A;  1V1Q A;  4HJ7 A;  1IBL Q;  5GAD C;  4DR5 L;  1L1O B;  1WFQ A;  3PCO B;  2VQF L;  4DR6 L;  3CCM A;  1NE3 A;  2R6G A;  1I94 L;  2CCZ A;  1UE5 A;  1SMX A;  4QY7 A;  3F8T A;  1PH3 A;  2D0P A;  5IYD H;  3RLO A;  1GD7 A;  3PV0 A;  4DV7 Q;  4DNI A;  4DR4 Q;  4X62 L;  4BXX H;  1JE5 A;  5HGQ A;  1PH9 A;  5M3M G;  4HJA A;  2BH2 A;  2DGY A;  3UDX A;  3ULJ A;  4X65 Q;  3UDG A;  4DV3 L;  3T1Y Q;  3J80 c;  1XNQ L;  1OXX K;  1VQ6 A;  4A3K H;  2K75 A;  4OXP A;  1Q46 A;  1HR0 W;  3GTP H;  3S2D H;  4JC0 A;  3HKS A;  4OON A;  2VL6 A;  2Y0S G;  1HR0 Q;  3L0O A;  3PO3 H;  5IY0 A;  1BBU A;  3S2H H;  5IP9 G;  3UE1 A;  1XTD A;  2A1A A;  4NB3 A;  5IP7 G;  1GO3 E;  2UU9 Q;  1FJG Q;  1N32 Q;  4OO1 G;  2R93 G;  3G4S A;  1YJN A;  4JBJ A;  3GTQ H;  3M3Y H;  1XNR L;  1TWA H;  1GKH A;  1YHB A;  1VQB A;  4X66 Q;  2HHH Q;  4DV4 L;  2CFM A;  3F2C A;  4QL5 A;  1OXT A;  1KL9 A;  1SN8 A;  4GN4 B;  1KRT A;  5C0X I;  3J7A 5;  3LGJ A;  4B3S L;  3KF6 B;  5GAH C;  1QVF A;  2YTV A;  4MNO A;  4C2M H;  2MNA A;  5FJ8 H;  1VQ9 A;  1YI2 A;  1EIY B;  1GM5 A;  1BKB A;  1FGU A;  2PNH A;  4YHH L;  2WAQ E;  1DGS A;  2R7F A;  1IBL L;  4A3D G;  3GTG H;  4A3E G;  5FLM H;  1MJE A;  1Q7Y C;  4J15 A;  2ALY B;  3HOX H;  2VNU D;  4DV2 Q;  2K50 A;  4R4I A;  1QZH A;  4HIO A;  2OTL A;  1MIU A;  3I4N H;  4JG2 A;  3STB D;  1VQP A;  4DK3 C;  4A3B G;  3I4M H;  2AWO A;  1CKN B;  2VQE Q;  4JI5 Q;  2R92 G;  4DR4 L;  1H95 A;  2Q2U A;  3RLF A;  3T1Y L;  4JOI C;  4X65 L;  5M5X H;  3PUZ A;  4DV1 L;  2ZJP A;  4LF9 Q;  1I3Q H;  1XPU A;  3PO2 H;  4A4I A;  4IPH A;  1X6O A;  4JI2 Q;  3NEN A;  5LMU Q;  2UUC Q;  1JB7 A;  3A0J A;  1HR0 L;  1EOV A;  4Y7N H;  2IY5 B;  2KHJ A;  1XMQ Q;  1LYL A;  2WP8 J;  4DKA C;  2B63 H;  1Q8K A;  4QJF A;  4GN3 B;  3AFQ A;  1KC8 C;  3CCJ A;  2UU9 L;  1CUK A;  2I5M X;  3I4O A;  4NXM Q;  1FJG L;  4POG A;  4A3L G;  1N32 L;  4JI0 L;  2BA1 A;  4A3I G;  3K80 C;  5ELO A;  3ULP A;  3HOV H;  2NVX H;  1IBM Q;  1CSQ A;  3H3V I;  2JA5 G;  1HNW Q;  4JI7 Q;  1PH4 A;  3TEH B;  3KOJ A;  2ZTC A;  1K8G A;  4AQY L;  2AHO B;  2Z6K C;  2RCN A;  3CP0 A;  2IHF A;  2B29 A;  4X66 L;  3F2B A;  2E2J H;  2HHH L;  3S16 H;  3J81 c;  5IT9 c;  5IWA L;  3NBH B;  1Y14 B;  3HOY H;  4LUV A;  2Y0S E;  1QUQ B;  4LWC A;  4R4C A;  1SLJ A;  2JA7 H;  4EQ5 A;  1TWH H;  4PG3 A;  3GO5 A;  4BBR G;  3G71 A;  4NXN Q;  3H15 A;  3E9I A;  4IO9 A;  2OTJ A;  4LUZ A;  1LM0 A;  4XTC S;  5AJ3 Q;  3NEL A;  2QEX A;  1M90 C;  3J81 i;  5JEA G;  2HT1 A;  3GTO H;  4WJ4 A;  3BZC A;  1VQE A;  2LXK A;  3HOU H;  4HIM A;  4DV2 L;  5M5W H;  3RZO H;  3HOZ G;  2JJQ A;  5BR8 Q;  3PUW A;  5JEA J;  1P16 A;  3CC2 A;  3CCE A;  3KDF A;  4OWX B;  4YWL A;  4R4Q A;  3TQY A;  4JI6 Q;  3CPF A;  2JEA I;  2VUM G;  3KFU A;  3S17 H;  4JI5 L;  2VQE L;  1IZ6 A;  4A3G G;  2K4K A;  4LF9 L;  1X55 A;  2I5H A;  3MXN B;  1PYS B;  3MEF A;  3CMA A;  2UXB Q;  5LMU L;  1PFS A;  2UUC L;  4JI2 L;  2MFI A;  4GLV B;  1L1O A;  1BVS A;  2CQO A;  3I7F A;  4EX5 A;  5M3F H;  1T9H A;  4B3R Q;  1VQN A;  3BZK A;  1NY4 A;  2A8V A;  1MJC A;  2YV5 A;  4QQB X;  4BBS H;  3EIV A;  1XPR A;  3UE0 A;  2CKZ B;  3K7A H;  1ASY A;  4NXM L;  1JMC A;  5J3B A;  4GOP C;  3U50 C;  1IBM L;  4KHP L;  3AEV A;  3E0E A;  5IYC H;  4DV5 Q;  4JI7 L;  1HNW L;  3UDI A;  5LMN W;  4DUY L;  1PH2 A;  4UP7 A;  1J5E Q;  3GD7 A;  5JJI A;  2NN6 I;  4P75 A;  1N36 Q;  3ICE A;  4A3D H;  2NVY H;  3WWV A;  1VQJ A;  5E7N A;  1YJW A;  5GQO A;  2UXD L;  3PF4 A;  2JA8 G;  5C3E G;  4MZ9 A;  4YY3 L;  3S15 H;  4NXN L;  1VQI A;  4UP8 A;  3GTJ H;  5AJ3 L;  4YCW A;  2KHI A;  5IP9 H;  4LNQ A;  3L2P A;  2EIF A;  1VQ5 A;  1G29 1;  1UE6 A;  4YWK A;  5C44 G;  1KRS A;  5IP7 H;  2OQK A;  5FLX c;  3PGZ A;  4YCV A;  2R93 H;  5BR8 L;  3D31 A;  1B7Y B;  2YTX A;  4GOP B;  4APV A;  1W3S A;  2JK8 A;  3K8A A;  3M85 A;  4JI6 L;  3CME A;  2MQH A;  3HFZ B;  2NZH A;  1Y1V H;  2ID0 A;  2RHS B;  3GDE A;  1D8L A;  2K5N A;  4IOA A;  2R7D A;  4UP9 A;  2AMC B;  4C3H H;  2UXB L;  4A3C H;  1SRU A;  5M5Y H;  1J6Q A;  3Q8D A;  4X64 Q;  3H0G H;  4KHZ A;  4DR3 Q;  2IX0 A;  5IYD G;  1IBK Q;  3HOW H;  4B3R L;  1JT8 A;  4DV0 Q;  4HID A;  5DLQ E;  1VQH A;  4BXX G;  4DR7 Q;  4GKJ Q;  1S72 A;  3PUX A;  4JBW A;  4A3J H;  1M1K C;  3GTK H;  4JYA Q;  3DM3 A;  1G51 A;  2EQS A;  2VS1 A;  1WCM G;  3W1B A;  2R7Z H;  1NTG A;  4HJ9 A;  2IT1 A;  2UUA Q;  3H3V H;  3KF8 B;  1BBW A;  1FL0 A;  4OO1 I;  2ATW A;  1J5E L;  1WOC A;  3KYH C;  1JJC B;  1VQF A;  4IPC A;  1CKO A;  5HY6 A;  1TWC H;  1N36 L;  2OWO A;  1SR3 A;  4JV5 Q;  1I6H H;  4AH6 A;  5C4X G;  4GLA C;  4DAY B;  3PF5 A;  3EN2 A;  4LFA Q;  4DV7 L;  1KAW A;  3ERS X;  2YU9 H;  1Z9F A;  2N3S A;  4Y52 H;  1U5K A;  1V9P A;  2K52 A;  4JI3 Q;  3K7U C;  4P74 A;  3CCV A;  2K14 A;  2KCM A;  4OWW B;  3GTM H;  1X65 A;  5H1S E;  4PMW A;  4LF4 Q;  4P71 A;  3VDY A;  1AH9 A;  4L5S A;  1QUQ A;  4JOI A;  2JA5 H;  4JBM A;  5IYB G;  5K36 G;  1NBW A;  4K0K Q;  3CXC A;  2ASB A;  2E2H H;  1O7I A;  3AFP A;  1KD1 C;  3CW2 C;  1ASZ A;  3S24 A;  1CSP A;  2BH8 A;  4A93 H;  1E3P A;  1QVC A;  1PV4 A;  4R4O A;  3HOX G;  1VS0 A;  2PMZ E;  4PZ7 A;  2Q2T A;  4X64 L;  3I55 A;  3SGI A;  2RHQ B;  4A3M G;  4DR3 L;  1Y1W H;  1IBK L;  3G6E A;  1HNX Q;  1KHI A;  2LXJ A;  1OXV A;  2VY3 A;  1L0W A;  4BBR H;  4JI1 Q;  4DV0 L;  4A3F H;  1VQL A;  4BY1 H;  3I4M G;  4DR7 L;  2D62 A;  4IPG A;  4ME3 A;  4GKJ L;  5GRO A;  2JQO A;  4LFB Q;  4X6A H;  1XMO Q;  3AYH B;  5GAE C;  2ZJQ A;  4JYA L;  4HJ8 A;  3S14 H;  1C7Y A;  3JC6 6;  1KXL A;  1I50 H;  1X56 A;  4DR2 Q;  1VQK A;  1KIX A;  1V43 A;  2D0O A;  1YHQ A;  2UUA L;  1KQS A;  1OXS C;  2B63 G;  4LFC Q;  1VQA A;  1X9N A;  1HNZ Q;  4A76 A;  4A3G H;  1AE2 A;  3PIO A;  2EXD A;  3M7N A;  2XGT A;  4AIM A;  3PIP A;  4PZ8 A;  3TRZ A;  3RLN A;  4DR5 Q;  4LF8 Q;  2PQA A;  2RF4 A;  2F4V Q;  1NMG A;  2KCT A;  4LFA L;  3K81 C;  3CPW A;  1OTC A;  5ELN A;  4JI3 L;  5JJK A;  1NJI C;  3A74 A;  1XPO A;  2HQL A;  2IHE A;  3FKI G;  1K73 C;  4IPD A;  1Q81 C;  2UXC Q;  4LF4 L;  1XMQ L;  4LF5 Q;  1HZB A;  2ZTD A;  2JA7 G;  1HJP A;  4IJL A;  4B3M Q;  3KJO A;  1C0A A;  1Q82 C;  1PYB A;  4A93 G;  1TWG H;  1HZC A;  4DUZ Q;  1C9O A;  3PSI A;  2L15 A;  3CCQ A;  1PVO A;  1W2B A;  1L1O C;  1NMF A;  1YNX A;  3A5U A;  1YIT A;  3PUV A;  5JJL A;  1X3E A;  1UWV A;  3PUY A;  2JA6 G;  2JA8 H;  5C3E H;  1HNX L;  1UEB A;  2WFW A;  3W1G A;  5IE8 A;  5LMN Q;  2MO0 A;  4TVA B;  5M3M H;  3CF5 A;  4JI1 L;  4GOP A;  2WB1 G;  4DK6 C;  3S1R H;  4JI8 Q;  1VQ7 A;  4BY7 G;  2HIV A;  4LFB L;  1AE3 A;  4GS3 A;  5C44 H;  4GNX C;  1K9M C;  2DUD A;  4OWT B;  3A5Z B;  1VQC A;  2N78 A;  3KDF B;  3U4V A;  3JAM c;  4IOC A;  4DR2 L;  4IFD G;  3BU2 A;  5M3F G;  3RN2 A;  1MKH A;  1R9T H;  4L5T A;  1K83 H;  4LFC L;  3J7Z C;  1HNZ L;  1YVC A;  1G6P A;  4BBS G;  1SFO H;  3ER0 A;  4IFD J;  1UE1 A;  2KBN A;  3J81 j;  1CKM A;  5GAG C;  1PH7 A;  1Q1E A;  1E1T A;  1K0R A;  3JAM i;  3OW2 A;  1VQO A;  4LF8 L;  2K5V A;  3E9H A;  3KF6 A;  2F4V L;  3OTO Q;  2HIX A;  5IYC G;  4P73 A;  3GTL H;  3STB C;  1FVI A;  2BA0 A;  1VQM A;  3TS2 A;  2NZO A;  2QA4 A;  1L2F A;  2PI2 A;  3I56 A;  4AYB G;  4BA1 I;  3KLW A;  2UXC L;  1LUZ A;  4DV1 Q;  4LF5 L;  4IFD I;  1PH5 A;  1WYD A;  4KLK A;  4UPA A;  1N9W A;  3BJU A;  4GNX B;  4B3M L;  1WCM H;  5C0X G;  2ZTE A;  1HZ9 A;  2GVA A;  4DUZ L;  1CKN A;  3U58 A;  3F1Z A;  1HZA A;  4A3E H;  1EWI A;  4A3K G;  4ALP A;  1WJJ A;  1EQR A;  3L7Z C;  5C0X J;  3J80 i;  4O0A A;  3M9B A;  4DV5 L;  4DR1 Q;  2LSS A;  1VQ4 A;  1YHA A;  4JI0 Q;  5C4X H;  2IX1 A;  3HKZ G;  3PO3 G;  4HJ5 A;  1LTL A;  1B70 B;  4A3B H;  3M4O H;  4GKK Q;  2Q2H A;  2R92 H;  2K5H A;  5LMN L;  2JA9 A;  1A63 A;  2NVT H;  1E24 A;  4JI8 L;  3B6Y A;  1Y1V G;  1PH6 A;  4AQY Q;  1E1O A;  2Q2I A;  2CWA A;  1OXU A;  1GVP A;  4IJH A;  4JBK A;  5IWA Q;  4A3C G;  3H0G G;  1X3F A;  3FP9 A;  3HOW G;  4XIG S;  1PHJ A;  5IYB H;  1IYJ B;  4JI4 Q;  3K0X A;  4A3L H;  1RL2 A;  1K8A C;  2OCE A;  4PZ6 A;  4A3I H;  3RZD H;  4A3J G;  1YJ9 A;  4UY8 C;  1WI5 A;  4TQU S;  2Z0S A;  5FJ8 G;  2ZM6 Q;  1N8R C;  2R7Z G;  3OTO L;  1VQG A;  1Q86 C;  2WB1 E;  1K3R A;  2A19 A;  4A3M H;  2E5L Q;  4LF6 Q;  4HIK A;  4QGU A;  3S1Q H;  5FLM G;  1P8L A;  3G48 A;  4DAM A;  3DLL A;  1N34 Q;  1UE7 A;  3KJP A;  1QVG A;  1IXR A;  1TXY A;  3EBE A;  2E2I H;  3I4N G;  1I5F A;  3RR5 A;  5C4J H;  3IRB A;  1HH2 P;  1SE8 A;  1Z47 A;  4R4T A;  3I2Z A;  1S40 A;  4OX9 Q;  2ES2 A;  1VQ8 A;  3CCL A;  2XTI A;  1D7Q A;  4LF7 Q;  2JE6 I;  2VZA A;  4O2D A;  2UUB Q;  3NEM A;  4DV6 Q;  3PO2 G;  4DPG A;  2VW9 A;  2AKW B;  2Z6K A;  4DR1 L;  3F2D A;  4B3T Q;  4LW1 A;  3HOZ H;  4GN5 A;  3ZJY C;  1EFW A;  3RN5 A;  3RNU A;  3OYY A;  1N33 Q;  2VUM H;  1YIJ A;  2YYZ A;  4GKK L;  3T1H Q;  4KHP Q;  4NPS A;  5EAY A;  3CCU A;  3D0F A;  1JJ2 A;  2GN5 A;  2OQ0 A;  4AYB E;  3CC4 A;  4JV5 L;  1XJV A;  1SRO A;  1A8V A;  3U4Z A;  2MO1 A;  4DUY Q;  3HOV G;  2VQF Q;  4DR6 Q;  1YZ6 A;  3FKI H;  1PH1 A;  1I94 Q;  4RG1 A;  3S1N H;  4MTN A;  1S3O A;  4YCU A;  4JCV E;  2UXD Q;  2F52 A;  3AQQ A;  3TRE A;  1Y1W G;  4X62 Q;  4QIW E;  3CQZ H;  4YY3 Q;  4A3F G;  4BY1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...