4GLKA

Structure and activity of abiq, a lactococcal anti-phage endoribonuclease belonging to the type-iii toxin-antitoxin system
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
165
Chain Sequence
GTLRFFTVTDEYIAYLRKFESKVHYQYENNASTYVGVVLKKNDFNYFIPLLSYNPEKDKAMKKRSRIVTRLFEIGNINNPLGYLLHHNMIPVPDSELIPLPLDLKKPKHKMMQKQLIYMKSISEKIENKSEVVYRKAAHEKDGYYLKFSCDFKLLEAKATLYSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activity of AbiQ, a lactococcal endoribonuclease belonging to the type III toxin-antitoxin system.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
molecule keywords AbiQ
total genus 55
structure length 165
sequence length 168
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4glkA00
4GLKA 2XD0A 2XDBA 2XDDA 4RMOA 4ATOA
chains in the Genus database with same CATH superfamily
1VIFA 4JPBW 3LX7A 5IHIA 1QW1A 4XTXA 4OMQA 2DAQA 4E7IA 1AHJB 1K0XA 1Y0MA 3P8DA 3CCJA 5FU6C 3J81E 3G6ET 3NHNA 3FDRA 3ZL7C 2ZPGB 1CKBA 4PJOF 1K76A 2X3WD 2P0QA 1VQKA 3M0SA 4ATOA 1T0HA 1V1CA 4FM4B 2CH4W 1I8FA 1ZA1B 4J9BA 5CR2A 3EG3A 3NTKA 1JEGA 3UA6A 3RMQA 4BDZA 2AZVA 2KEAA 1KQ2A 4M7AE 2QI2A 2EFIA 3GF5A 3CCJQ 2QDYB 1ZSGA 3CCLT 2M02A 3G7ZA 3QDRB 2DXBA 1PD1A 4OMMA 3QWYA 3SWNA 3CCSA 1UECA 8AT1B 4M78B 2ZZDA 2KXDA 4IKFA 2DILA 1T3LA 5FRMA 1QVGS 1UEBA 2E70A 2QTVA 5GANd 1GCPA 5C0MA 2ED0A 2D8JA 4IIOA 4M78C 2OI3A 1KJWA 1KFZA 2BTTA 4KGVB 2ROLA 3JCMV 2CGHA 2C0OA 2E65A 2RHUA 3RESA 2EQIA 5LJ5e 1VQ9T 3FLGA 5LJ5g 2LTOA 3MO8A 4VUBA 2OTJA 1U06A 2NWMA 4PJLA 1XQHA 3T9NA 2VUBA 1K73R 3SEMA 1VQOQ 1Q86C 4FL6A 2F2VA 2HKNA 5IXFA 1T3SA 3UDCA 3LWHA 4C92B 1SF9A 2D6FA 2NLUA 1RAEB 3AT1B 3EGXB 3NGPA 4M77F 3BDLA 2ZPIB 3CCQA 5GAOr 2OTLT 3I9QA 1K0SA 3QZ5B 1Q81U 1IZ6A 4BACA 2DD4A 2L3SA 4M7DE 1S1NA 1EX4A 2X4JA 3EHRA 4A4GA 4LDXA 3PIPA 4M75F 1YJ9A 3CCRT 2WSEE 1X6BA 1T0JA 2K6DA 2LMJA 3LH0A 3MEWA 3G4SA 4IUPA 2VXFA 5A2QE 3SD4A 2VGMA 1BYMA 4RTYA 3CCQQ 3JAME 3G71Q 2HZYA 2BUDA 3QSUA 1AWWA 1YJNT 4M7DG 1IHVA 1YJWQ 2RQRA 4A53A 5GANh 1WIEA 1QVFS 2VASA 4IIMA 1VQMQ 2QYZA 5AT1B 4JUVA 2Y90A 3PTAA 1UGQB 1SKUB 2L89A 1KK7A 1RACB 4F16A 1XOVA 2HQHA 3D7SB 1W6XA 4M7DA 5KYUB 3CPFA 5EG2A 1AZGB 4LD9K 2ZCFB 1OX8A 1W2BP 4ZGEB 3V8LA 1KHCA 2R58A 4CI0C 2PVOB 2JNGA 1VQLT 1QKXA 2KK4A 2L3QA 2IG0A 2JN0A 2LVMA 2RHZA 4KT0E 1M3BA 2EYXA 4DBHA 3CCEA 4N4HA 1Y07A 3BFMA 3OS5A 2K9GA 4EMKB 4JLIA 2DTHA 3M56A 1UGPB 1UGRB 5L8RE 3QHSA 2YXYA 4C92E 1UHCA 2NYSA 2FZCB 5GMKh 3M57A 3CCST 1QCOA 3VS4A 2F2XA 1AZEA 2KI7A 1KD1C 1QLYA 2OJ2A 4KGXB 2FL7A 1RLPC 4M77A 4FW2A 1WZOA 2HNIA 2CT4A 3UATA 1H3HA 3OYIA 2RI5A 1IHWA 1VQNA 3A98A 1R0BG 2PVDB 4IUUA 4CC7A 3PT9A 2V1QA 1R77A 3I55A 2YUPA 1YJ9T 1SHFA 2K3BA 5GMKi 1G3YA 4KULA 4MZMA 5FRNA 3FRNA 1WHLA 1VQPA 1VIEA 1I0CA 2KDSA 2F69A 1YIJQ 2V8KA 3INZA 3CMAA 1D0XA 1VQ5A 4RG2A 2DERA 3O8VA 4XAXB 2M1HA 2EJFA 1WJSA 2R57A 3S3MA 5GANj 3E1SA 4MDWA 2FPEA 3OMGA 3CC7Q 5GMKj 4ZTJA 1VQOA 3GIBA 1PHTA 3JCMf 4JRKA 2CT3A 2GQVA 2YWWA 3CMET 1OU8A 3QJYA 2OTJT 4C8QG 2EQKA 1VQNQ 4C8QB 1KIKA 5FU6B 2E41A 2EJ9A 3A8MB 3FB9A 2LQWA 3HFNA 3EG2A 3CD6T 3CC4A 1KQSS 1YWOA 3OYJA 4PKCC 5CAIA 1RABB 1M8VA 5CVIA 3CC4T 1AWJA 4E7KA 1TU0B 2EBPA 1BU1A 4CC2A 1IXDA 1M1FA 2DIQA 1VQ8T 4BUGA 3GOXA 2YRVA 2GCXA 3CMAQ 3PGGA 1WXTA 2RI2A 1FX7A 2YUNA 3META 4M7DC 1PSEA 2FB7A 3WVEB 2PNIA 4PL6A 2X35A 2JM9A 4KBMB 1AVZC 2PQWA 3VS3A 1ZUYA 1X01A 2DK3A 2JS0A 4M78A 3OYEA 2DJZA 2JTEA 4L6V5 2KMTA 1BI2A 1H641 3UT1A 2GFUA 2RM4A 2CREA 3FEOA 4ZGDB 2EJGA 4ZN3A 3BDUA 2D0NA 4M7DF 2BZYA 1YJWA 3HRSA 5KYYB 3ME9A 3OB9A 1NE8A 2GGRA 1NLOC 1P92A 2GTJA 3OYBA 1K73C 2A28A 2DO3A 2C0IA 2E64A 5KH6A 2QTXA 4J6WA 3PNWC 4J83A 1D1BA 3H41A 2NUPB 1M4ZA 3VUBA 4JLGA 1IB8A 1M27C 1RI0A 1JXOA 3OYNA 2OAWA 3OYKA 2YT6A 2DL8A 2DX1A 1ZLMA 3QIIA 1KG1A 3AHUA 4PNOA 5HKCA 1NBEB 4OMLA 4MZPA 2JVVA 2O4XA 4AFUC 4QQ6A 3CCUT 1GFDA 4M78E 1YI2T 1YIJT 4EPCA 4OB0B 1LCKA 4NOYA 1XNIA 1JBMA 2MF2A 4RTUA 2HBWA 2EQJA 2EQMA 2DPPB 3JV3A 3HFOA 3VS5A 2VWFA 3JB9I 2RO0A 3MP1A 3EG9A 1WA7A 2XI9A 2LNVA 4C0DB 2DA9A 1O9SA 2EPDA 5I22A 1Q86R 4M7AC 1WQWA 3JCMQ 1BIAA 1YITA 1GBQA 1M1KR 2GF7A 2K57A 4QVCA 1M3AA 2KBTA 4OGCA 4C92F 2CZ7B 2DBMA 2GBQA 4A4HA 2JW4A 3OY9A 3I56A 2H3EB 1SEMA 4E7HA 1VQ4A 5KYYA 1Q7YC 4HKEA 3DKMA 2R5AA 1WHHA 1I5LA 2EWNA 3RMSA 2EQUA 4OMOA 1F1BB 3VJPA 2D0QB 3PVQA 4RMOA 2LCCA 3H0IA 3JB9J 1YI2Q 2JMAA 2KAFA 4RTVA 1XTDA 1ZBJA 2KVQG 3CCUQ 1I4K1 1PCXA 4HT9A 4PLLA 3E2UA 1MMDA 3CC4Q 5IN1A 4N0AA 1I81A 3JB9F 5FU7C 2E10A 2ED1A 4OVAA 4C92D 4ESRA 1TS9A 1U1TA 3TVTA 4ZNXA 4BE2A 1KC8U 4YTLA 2KSSA 4ORZA 4FSSA 1YFNA 2CP6A 4WCIA 5GAN3 4WF2A 2DYBA 2RHYA 3DB3A 4B9WA 4L5GA 2FRYA 2SEMA 2C0TA 2HBPA 5J39A 2K5FA 4PJOE 5IT9E 2E6ZA 3L1AA 3S3OA 4J5YA 1Z9ZA 3OW2A 1M90R 1VQ9A 2QGGA 1WFWA 2JXBA 1TUDA 1K8AU 5CCAA 4BI8B 1R8OB 3QG1A 2BZXA 3OQ5A 2MAMA 5L23A 1K73U 2XU8A 2ZAEA 2P84A 4M7AF 3OMCA 2DRMA 3C4SA 2COWA 3LWIA 4Y28E 4O6JA 2KXCA 4OGEA 4BI3A 1G3TA 4RTWA 4PFOA 3PVLA 2LDMA 1X2QA 4Y91A 3L2QA 3BE3A 2CH4A 2PTKA 1OV3A 2L0AA 2NUZA 5ECAA 1YITT 2EGCA 1JU5C 1Y71A 2KYBA 5GAOp 1OEBA 4QKUA 1UDLA 3KBGA 1QVGP 4L59A 4XU3A 3JRZA 1M30A 2EYZA 1WPYA 4OF1A 3CCSQ 4KRTA 3RR6A 2EYQA 3PMTA 1UUEA 2XDDA 1X69A 4HCKA 1D1CA 2DMOA 3M0TA 4M7DD 2ATCB 2D9TA 4C92A 1QP3A 3EFOA 5EC7A 1VQLQ 4A54A 4RG8A 2WSFE 4HCBA 4M77B 3X20B 3P8HA 4M77E 4DBRA 3V7CA 3QKJA 4P5NA 2W10A 1K9MU 5KYWA 2KRNA 3RNJA 1W4SA 2YDLA 3MKDA 1QWEA 5IAYA 2MK5A 4J6YA 5GMKm 1IRXA 2P0KA 1KD1R 3MEAA 1TH7A 2E4HA 2FO0A 2K79A 3REAB 4FW1A 4M78F 1PNJA 2DM1A 1S72T 4J7IA 2YSQA 3TCJA 5FW9A 1NPPA 1LJOA 3I5SA 4E7LA 2DL5A 3M9QA 1YP5A 2K3XA 5GAMj 4HCCA 2RPNA 3M5AA 3EAEA 2HKQB 5FU7B 1V29B 4J9CA 1YJNQ 2YLCA 5GAN7 4LN2A 1RLQC 4XTWA 2QEXA 3OW2P 2JM8A 1WDXA 3CCQT 1K1ZA 3GP8A 4FT2A 1VQ6T 4CC3A 4JRPA 3I56Q 4PJOG 1NEBA 4PJNA 2P0PA 1VQ6A 2BKDN 3G4SQ 5KCOA 2XHCA 2JZ2A 1QVFP 1JQQA 1TWBA 2DXTA 3MJXA 3FC3A 1LVKA 5LJ3j 3RDVA 3E9FA 4HA8A 4J7FA 4X9CA 1LOJA 4QVZA 2CZ6B 2ABLA 5DM7R 2X4YA 4O5VA 1N8RR 3GNGA 3VUZA 2DEQA 7AT1B 4N4IA 2K4YA 2KT8A 1BCMA 4AG2C 3CBPA 1SSFA 3CXCA 4BD3A 3EFOB 5HCKA 5LJ3e 2EIFA 3C0CA 1K4US 3ER0A 4Z02A 3R6OA 6AT1B 3HKSA 1NPRA 5GAMh 2VVKA 1NZ9A 4ZGJB 3EGUA 3SFMA 4C0FA 2HSEB 2L2PA 4PJMA 2ZGWA 4LDVA 1CSKA 1MUZA 1X75C 4FU6A 1SPKA 3R6NA 4AFSC 1WXUA 2GTOA 1G3SA 3FJ5A 5GAN6 3THKA 2HSPA 2RB6A 1NYFA 4DOWA 4Z88A 4M78D 1N9SA 3CCRQ 1ARKA 2X4WA 4M7DB 1GXIE 1M1KU 2VXEA 4PFZA 4D6WA 3CCJT 1FMKA 2O9VA 1Z9QA 4IUTA 3OYGA 1TTHB 1M8MA 4M77C 2EW3A 5GANe 2V8IA 4HT8A 4FYWB 3L42A 4FSXA 1YCYA 2DYIA 3JCMP 5HY6A 2GFAA 2L3PA 3X25B 1WQ7A 2RD1A 2G6FX 2WACA 4GLKA 1SSHA 4Z8AA 2XKOC 2CUDA 2E6NA 2O2OA 1SG5A 1YCSB 1RAFB 2DRKA 2RF0A 2JTMA 3C94A 2ENMA 2LQNA 2QQRA 4MMLA 1K9MC 1WHJA 2E3HA 2CZ0B 2DZCA 2O01E 3VKIA 2KNBB 3HL8A 3OS0A 1O75A 4R0KA 5KYWB 1Q82C 3S3NA 1YHQA 5GAMf 1PKTA 5FWCA 1NJIC 3V7RA 3G71A 3G6EA 3RKXA 2QEXQ 1TOVA 1VQ7T 4M75D 4KUIA 2QA4T 3L2ZA 5GMKe 3HRUA 2X3XD 3TQ7P 4F7UA 2EKHA 1SRMA 2KE9A 3X26B 4M7AD 1N27A 3E19A 2KRSA 3VS1A 3OYDA 1YNZA 2MOXA 5D6XA 3GLXA 3A1PA 1OX9A 3KUFA 3SDZA 2QEXT 2DTOA 4JS5A 3UPUA 4E6RA 4X34A 3SHWA 2CDTA 2CYZB 3M4GA 4EIKA 4RTZA 3PMIA 5J3BA 2LX7A 4LXCA 1S72A 1VQMA 3VS6A 3H0HA 3REBB 1MMNA 2O31A 1VQ6Q 3EGDB 5I2MA 3EFSA 2VV5A 2CSQA 2K2MA 2H8HA 4J9IA 2P4RA 2AZSA 4FYYB 4TVRA 2HL5C 1YN8A 1VYUA 1YITQ 3UA7A 2VB6A 4FIBA 4GLMA 3JB9D 4QQDA 2XK0A 5GAMg 5GAN5 5IHKA 3MHXA 4UC4A 1Q7YR 3A8GB 1MHNA 1G2BA 1KSWA 2OAUA 1MMGA 2I2LA 1N8RU 2KR3A 2PZ1A 3UWNA 4LDUA 4PJOA 2PUOB 5LJ3g 2X9HA 2RQTA 1QCFA 3OYYA 5LJ5f 1RAAB 1ZSZC 3OBYA 2LT1A 2EGAA 4M75C 1UB4A 2VKNA 2YRCA 3QPHA 2QDLA 3WXMB 1VQLA 4PJOC 4M78G 2A08A 2PUKB 3I55Q 4GY5A 2HEQA 4PJOD 4J8OA 5CKFA 4M75B 1HJDA 1WXBA 2IIMA 1VQ7Q 3EHQA 4HVVA 4LUEA 2J06A 4PFPA 3M0UA 2RN8A 1GBRA 2DXCA 2FHDA 3VYGA 4C0DC 1ABOA 2QQ9A 4LDWA 1VQ5Q 1EZZB 1MV0B 1G5VA 3NMZC 2L3RA 4C0ZA 2CSIA 2EYWA 2D1XA 1GCQA 2COYA 1U3OA 1A0NB 3CCLA 2COZA 1C0MA 4RKUE 1UHFA 1X6OA 3M53A 1VQPT 2XG8D 3ZFJA 4EDUA 3ULRB 3F70A 2J6FA 1QCNA 1W70A 5LL6S 2E5KA 2K5IA 5KCHA 4C8QC 4OMNA 4X1VA 3X28B 2NUTA 1K8AR 4C5EA 4XU1A 1R0CB 4J6XA 2A3LA 2X51A 3VV0A 4LD6A 5AYFA 2FZGB 3QZ9B 3EG9B 1PRLC 1MGQA 2HL3A 4WTOB 1GFCA 2ROTA 4KH1B 3J80E 1J3TA 4A4KA 2G3RA 1OULA 3OYLA 4BY6B 2L8DA 3L2RA 5KYNA 1LNXA 4KUDK 3OBWA 1NYGA 3BW1A 2D8HA 4F17A 3MEVA 3CD6A 3IQLA 4R56A 1B34A 2RHXA 2JTFA 1BI1A 1S72Q 3GPLA 2O88A 2F2WA 2MWPA 4A4FA 3M55A 4J9HA 2M51A 2BZ8A 3EG0A 8ATCB 3H0FA 1XJWB 3OYMA 4FCYA 2AK5A 2HDAA 2K2VA 2KYMA 3EG1A 3H9NA 5D6YA 2LT4A 2DZ9A 3JCMJ 1GCQC 2LC4A 2VYTA 4BE0A 1D09B 4MMKA 4V2SA 3OS1A 5CKBA 1ABQA 4N4GA 1JJ2P 4B6MA 3G1JA 2H3JA 3OYFA 5LJ3d 2LRQA 2RQWA 1N8RC 2DVEA 2MYSA 3TEEA 4XTUA 2LCSA 2LJ3A 3G4ST 4DBQA 1JJ2S 4J9EA 3Q1JA 2HAXA 3SB2A 2EAYA 3J7AF 2HCKA 2FPDA 4DQ2A 3CCVQ 3CC2Q 2CP0A 1PWTA 2JS2A 3OYAA 2DNUA 2FVUA 5A0GA 2CP3A 3QXEB 4M7AG 1N6AA 2LJ1A 1NJIR 3CXCP 1M9SA 5GJWB 4RCBA 2B86A 1Q81R 1FXXA 2YHTA 1MV3A 4JZ3A 2F1LA 3FIFA 1YHQQ 2RA2A 2QQBA 3CQTA 3M0RA 1PSFA 3QUIA 2HQEA 3JCMX 3CCET 2QXFA 4D8DA 1W1FA 1PG5B 2JUFA 2A7YA 1QWFA 5KE3A 2LCLA 3A8LB 4Q5WA 5GANg 1VQ8Q 1AD5A 2A36A 1OZ3A 3JCMb 1H3ZA 1VQ7A 1E7OA 3M4YA 1E6HA 1B07A 2RNAA 3HP9A 1EIFA 3LW5E 2RK2A 2PVGB 1ZUKA 3VYHB 3N5BB 1KQSA 4M75G 5KYXA 5GAN8 1OQKA 3DLLA 1N5ZA 1RL2A 4JZ4A 1RUWA 1Y7XA 2RQVA 5D7UA 1Y57A 3QJ6A 5IH2A 1YI2A 1U5SA 1M2VA 4EMKC 5GAMd 3CCUA 4NL3A 2E12A 2M9UA 1HK9A 3OS2A 5CQXA 4KGZB 3S6WA 4LUDA 5GAMe 4JRIA 4OB1B 2DF6A 2F5TX 3MCAB 2CKKA 1M5Q1 4J9DA 1WGSA 2EYYA 4DOVA 3HHTB 4AFQC 3VS2A 1JB0E 2VC8A 1RAIB 1Q86U 1HXDA 2RJCA 4F04B 1NEGA 2QG9B 1BK2A 2J6KA 1WJRA 5D6WA 4PJOB 2BE9B 4RCCA 5CKHA 3A8HB 4A63B 4ELZC 3ASKA 3H6ZA 4GBQA 3U23A 1YHQT 1G83A 1OPLA 1Q7YU 4AG1C 4F7UE 2OTLA 1B3QA 1BBZA 2FPFA 4LNPA 3JCMW 3A5ZB 3TU4K 4M7AB 4RTXA 4EMHA 4XU2A 5DLOA 3CBMA 2JT4A 4OMFB 5KE2A 1QVGA 3CC2T 2KQWA 1RAHB 3C12A 3JCMh 4E7ZA 1M90C 1KHIA 2K7AA 4ME7A 2MMPA 4NL2A 1Q82U 2XIDA 3NTHA 3QYHB 4MDXA 1OYXA 2DVJA 2QGFB 3EGDA 5FWBA 3CC7T 1JJ2A 5CIUA 4HVWA 2QAZA 2DL3A 2FG0A 1B7TA 1WLPB 1KC8R 3X24B 1PRMC 2DL4A 2RI3A 4C5GA 1SRLA 2PU9B 2DEUA 2SRCA 1W2BA 4M77G 1FYNA 4M77D 2XDBA 4DBFA 3OSSC 3CMEA 1GL5A 3PE0A 1QVPA 3CC2A 3CCEQ 2E1HA 4OMPA 3RIRA 1K8AC 1TUGB 4CRIA 1BI3A 2JMCA 1QQJA 5GAN4 1U1SA 4C0GA 2DKGA 4AT1B 1UFFA 1FWZA 3SWNB 3LGFA 3JCMc 1UE9A 1TXQA 1VQ8A 2EGEA 1BIBA 5GJVB 1WHMA 3G71T 2LQ8A 4F7UG 4DEYA 4J9GA 5I21A 3M54A 2GQIA 4JS4A 1YIJA 4EMGA 4E2FB 2AIRB 3C95A 1UJYA 2ZPBB 1D3BA 1Q95G 2XD0A 2DLPA 2OX7A 3M58A 1X2KA 1TG0A 4OP0A 1KC8C 4N0AC 1V76A 2V26A 1NM7A 1NG2A 4C8QA 4XU0A 4JRQA 2NUPA 1JO8A 2JOYA 4DA4A 2CP2A 1IO6A 3CMAT 1DJ7B 2RQUA 3VS7A 2W0ZA 1UG1A 5GAOl 3EH2A 1ZQ1A 3CPWP 2J05A 1D1AA 1MNEA 1C1AA 1YJNA 3EGXA 2IPOB 1Q82R 3MEUA 5GAOm 2NUTB 1M1KC 2QASA 2KY9A 2VGNA 2P4TA 3CPWS 5FROA 4M75E 4M4ZA 2ECZA 1Y96B 1VQ9Q 1UGSB 1H92A 1G8XA 1BB9A 2K5LA 3OYCA 4E7SA 2MIOA 3OW2S 1WI7A 1VQNT 2OTJQ 2MPXC 2YLBA 1UJ0A 2CP7A 4BE1A 2E5QA 3ZEHA 2XICA 3RERA 3M0QA 4KH0B 4BDYA 2E3IA 4IURA 4RTTA 4PJJA 3V8JA 4JDSA 5CKDA 1ZUUA 2RH2A 4BI4A 2B8AA 1QMCA 4C8QE 3LH5A 4M7AA 1KQ1A 3HRTA 4QT7A 2J6OA 4OB2B 3CCVA 2Z0WA 1X6GA 2DD5A 3CCLQ 1EFNA 2AKLA 2DETA 3RKWA 4C5IA 5CQYA 1PKSA 3ZBDA 3JCMg 1M90U 1AOJA 2BE7D 3A8OB 2L5QA 4M75A 4DEXA 1YJ9Q 1OPKA 1YWPA 4HVUA 4IUQA 1BCOA 1I5OB 3O5ZA 1QP2A 3HPWA 3CCRA 2DL7A 3VS0A 4HXJA 4QVDA 2LP5A 3RBBB 2EVRA 2YUOA 1IGQA 1WX6A 4C5HA 1G3WA 1UGVA 4QW2A 1VQOT 1W2BS 5DLQE 4D8KA 2O9SA 4PK4A 4F7UF 2O4XB 1WJQA 2RJFA 3VRZA 3SWNC 3CD6Q 3CCVT 3KFVA 3MP8A 5HK0A 1VQ5T 5FLXE 5IHNA 2LNHB 3RKYA 4Y92A 5GAOn 3CMEQ 2Y4XA 4XQ3A 4FYVB 1AEYA 3DLMA 4C92G 4NS5A 5DY9A 1K9MR 2GNCA 3I55T 4AFZC 1HYOA 4BB7A 5CK9A 4RUGA 5LJ5h 2EKOA 3CCMQ 1UTIA 2BIVA 2CUBA 1AT1B 1VYTA 4C8QD 5I2SA 1PC0A 3QDFA 4ZTFA 5HK3A 3NFCA 1ZSZA 2A0FB 1M3CA 4J9FA 3EH1A 5M9OA 2V1RA 1N9RA 5J26A 1MMAA 2CP5A 2M0YA 4E47A 3P8BB 3VU3C 3LYIA 3LLRA 4F7UB 4R55A 1LPLA 1ZA2B 2HQXA 2I0NA 3PIOA 3L2VA 1B34B 3KXTA 1KQSP 1D0ZA 1MNDA 5GANf 2RHIA 2AHJB 1TUCA 2FEIA 3L2UA 2DJQA 2HMAA 4Z89A 3TREA 1U8RA 1OOTA 3CPWA 1QKWA 3CBOA 2FRWA 3QO3A 1FMVA 1IGUA 1VQ4T 1Y96A 5CKEA 5GMKl 4LE9A 1HD3A 2AT1B 3E9GA 2JJ9A 5LJ5d 3I5RA 1X43A 3DB4A 1NJIU 4XTZA 2QK0A 4JJCA 2MWOA 5LJ3f 5LJ5j 1IREB 4C92C 1K9AA 2DFUA 2RJEA 4JJDA 3HTRA 2J7IA 4ELYC 5I11A 4EMKA 3HSBA 3QBYA 3OSVA 1E6GA 2MCNA 2DTIA 3WVDB 2XDPA 1ZX6A 3UF4A 1OU9A 3L2WA 2RK1A 2KGTA 2QA4Q 1ZBXA 1BI0A 3QWXX 1VQKT 2DIGA 1WNLA 1VQMT 2RMOA 4A4EA 3CXCS 1GRIA 1JRIA 1YJWT 1I07A 1VA7A 1ZSZB 2LX9A 2Y4YA 2M16A 1Q81C 3JB9H 1VQKQ 1WHGA 3I35A 2ESWA 4MZTA 3VRYA 1PD0A 4JJBA 3EFRA 2K3YA 4AMCA 2CZ1B 1I1JA 3LGLA 1CKAA 1M2OA 3MPUB 1RI9A 2ZPFB 2YUQA 9ATCB 2AKKA 1ZHIA 1KD1U 4X9DA 1RADB 5KYUA 2XMFA 2YRDA 1YBYA 4HCZA 2R5MA 1M1GA 3URGA 4JJNK 4OB3B 4C8QF 4FYXB 2OTLQ 2V8JA 1VUBA 3BY7A 3V8KA 2QA4A 4ANJA 3GBQA 3RUXA 3TSZA 1ACMB 1VQ4Q 3CCMA 5KYXB 3JCMd 3GNFB 4CC4B 1SHGA 3JB9G 2KT1A 1VQPQ 1HSQA 5CO7A 5GAN2 3I56T 4F14A 5A0DA 2LQKA 2LZ6B 2WSCE 4PLIA 1X27A 2QQSA 2C06A 1TSFA 3H8ZA 1OI1A 2MI6A 3M59A 4LDYA 3TSWA 3MP6A 4E7JA 4FT4A 3NPFA 3V7SA 5C6SA 3NTIA 1AWXA 4II1A 2A37A 3QYGB 1C6VX 3FJPA 2DXUA 1WYXA 2FZKB 2ZPEB 2KRMA 4BY6C 3JCMe 2X4XA 2FYKA 1NLPC 5LJ3h 3CEYA 5IXBA 1VYVA 1D3BB 4XTYA 3CC7A 1JXMA 3OYHA 1AWOA 2RJDA 2KROA 3CCMT 1D0YA 1OZ2A 5A0LA 2IVWA 2M0OA 4ZN1A 1WHKA 3OA6A 1QVFA 2DBKA 4B9XA 1FMWA 4XK8E 1RAGB 4K11A 2ZPHB 4QQGA 2CS7A 4IUVA 2HD0A 1BKBA 5GAOq 1VOMA 1PM3A 3JSCA 2F5KA 3G6EQ 1M2VB 4XTVA 2LJ0A 2DE0X 1H8KA 3M0PA 2QQAA 3PFSA
chains in the Genus database with same CATH topology
1VIFA 4F7UG 3JCMQ 1BIAA 3LX7A 1YITA 5I2MA 1QW1A 5I21A 3EFSA 2VV5A 3M54A 4XTXA 2DAQA 4E7IA 2GF7A 1AHJB 2K57A 4QVCA 3P8DA 4TVRA 3CCJA 5FU6C 3J81E 3G6ET 4OGCA 4JS4A 1YIJA 3FDRA 4C92F 2CZ7B 4EMGA 2ZPGB 4A4HA 4FIBA 3C95A 3OY9A 3JB9D 2ZPBB 4QQDA 3I56A 2XK0A 4PJOF 1D3BA 5GAMg 5GAN5 2XD0A 3MHXA 4E7HA 1VQ4A 4UC4A 1Q7YC 3M58A 3A8GB 1MHNA 4HKEA 2P0QA 3DKMA 1VQKA 2R5AA 2OAUA 4ATOA 4OP0A 2I2LA 1KC8C 1I5LA 4FM4B 4N0AC 2EWNA 1I8FA 1N8RU 3RMSA 2EQUA 3UWNA 4LDUA 4PJOA 2PUOB 3VJPA 5CR2A 5LJ3g 2D0QB 3NTKA 4C8QA 4XU0A 4JRQA 3RMQA 2JOYA 3OYYA 5LJ5f 4RMOA 4BDZA 1KQ2A 2LCCA 2QI2A 2EFIA 4DA4A 3GF5A 3OBYA 4M7AE 2QDYB 2LT1A 3JB9J 3CCLT 2KAFA 1DJ7B 3G7ZA 1XTDA 2KVQG 4M75C 1UB4A 5GAOl 1ZQ1A 3QDRB 2DXBA 3QPHA 3SWNA 3WXMB 2QQAA 3CCSA 4M78G 1VQLA 4PJOC 1I4K1 1YJNA 2PUKB 4M78B 2ZZDA 4HT9A 4PLLA 4IKFA 3MEUA 5IN1A 5GAOm 5FRMA 4GY5A 1QVGS 4N0AA 4PJOD 1I81A 1UEBA 1M1KC 4J8OA 2E70A 2KY9A 2E10A 2VGNA 4M75B 5CKFA 5FU7C 4OVAA 2P4TA 5GANd 5C0MA 3CPWS 4C92D 5FROA 4M75E 1Y96B 1UGSB 4M78C 1U1TA 4BE2A 2K5LA 3OYCA 1KC8U 4YTLA 3OW2S 1VQNT 3JCMV 2DXCA 2FHDA 2KSSA 3VYGA 2CGHA 2YLBA 4C0DC 2E65A 5GAN3 2QQ9A 4LDWA 4BE1A 2RHUA 2E5QA 4WF2A 3RESA 3ZEHA 2XICA 5LJ5e 2RHYA 3RERA 1G5VA 3DB3A 3FLGA 1VQ9T 2L3RA 5LJ5g 4C0ZA 2LTOA 3MO8A 4VUBA 4BDYA 4B9WA 2OTJA 4L5GA 3T9NA 1XQHA 4IURA 2HBPA 5J39A 2K5FA 3V8JA 2VUBA 4JDSA 2E6ZA 5CKDA 5IT9E 4PJOE 2RH2A 3L1AA 2B8AA 4BI4A 3S3OA 4RKUE 3CCLA 4J5YA 1Q86C 4C8QE 3M53A 1X6OA 3OW2A 1VQ9A 1VQPT 4FL6A 2XG8D 4M7AA 1KQ1A 3HRTA 3ZFJA 4EDUA 4OB2B 3CCVA 2DD5A 3UDCA 1K8AU 5CCAA 3F70A 4BI8B 3RKWA 3LWHA 1R8OB 3QG1A 5CQYA 3OQ5A 4C5IA 4C92B 5LL6S 3ZBDA 2MAMA 1K73U 2XU8A 2D6FA 4M7AF 3OMCA 2K5IA 2NLUA 3JCMg 1M90U 5KCHA 3C4SA 4M77F 3BDLA 4C8QC 3A8OB 3X28B 2ZPIB 3LWIA 4Y28E 3CCQA 5GAOr 2L5QA 4C5EA 4O6JA 2OTLT 4OGEA 4BI3A 4M75A 4XU1A 1G3TA 4J6XA 2A3LA 3QZ5B 4IUQA 1Q81U 2LDMA 4Y91A 1IZ6A 3VV0A 4BACA 2DD4A 4LD6A 1QP2A 3HPWA 5AYFA 3L2QA 3QZ9B 4M7DE 3CCRA 1MGQA 4QVDA 2X4JA 4A4GA 4LDXA 3PIPA 4M75F 1YJ9A 1YITT 3CCRT 2WSEE 4C5HA 3J80E 1G3WA 4A4KA 1Y71A 2G3RA 3OYLA 4QW2A 1VQOT 1W2BS 5DLQE 4BY6B 5GAOp 2L8DA 3LH0A 3MEWA 3KBGA 4F7UF 4IUPA 2VXFA 4L59A 4XU3A 3JRZA 3SD4A 5A2QE 3L2RA 2VGMA 1LNXA 1BYMA 2O4XB 1WJQA 2RJFA 4KUDK 1WPYA 4OF1A 3SWNC 3OBWA 3CCVT 3JAME 2BUDA 3BW1A 2EYQA 3PMTA 3QSUA 2XDDA 3MP8A 5HK0A 1VQ5T 5FLXE 1YJNT 4M7DG 3MEVA 4M7DD 4A53A 5GANh 3CD6A 3RKYA 2D9TA 4R56A 1QVFS 5GAOn 1B34A 2RHXA 2JTFA 1BI1A 2Y4XA 3GPLA 4XQ3A 4C92A 4JUVA 1QP3A 2Y90A 3PTAA 1UGQB 2MWPA 2L89A 3DLMA 4C92G 4A4FA 3M55A 4NS5A 5DY9A 1XOVA 3I55T 3OYMA 4A54A 4RG8A 2WSFE 4BB7A 5CK9A 4M77B 4HCBA 3X20B 2K2VA 5LJ5h 2EKOA 3P8HA 5D6YA 2BIVA 4M77E 4M7DA 2LT4A 2DZ9A 3V7CA 3QKJA 3CPFA 5EG2A 4P5NA 3JCMJ 1K9MU 4C8QD 4LD9K 1W4SA 2ZCFB 2LC4A 4ZGEB 2VYTA 5I2SA 4BE0A 5IAYA 4MMKA 4V2SA 3V8LA 1KHCA 2R58A 4J6YA 4CI0C 2PVOB 3OS1A 5GMKm 2P0KA 4ZTFA 5CKBA 2JNGA 1VQLT 4N4GA 2KK4A 3MEAA 5HK3A 3NFCA 1TH7A 2H3JA 3G4SA 2IG0A 5LJ3d 3OYFA 2LRQA 2JN0A 5M9OA 2LVMA 2RHZA 4KT0E 4M78F 3CCEA 1N9RA 5J26A 1S72T 4J7IA 3TCJA 1NPPA 4N4HA 2DVEA 1LJOA 4E47A 1Y07A 4E7LA 1N8RC 3M9QA 3BFMA 3OS5A 3TEEA 4XTUA 2K3XA 4EMKB 3P8BB 5GAMj 3VU3C 4HCCA 1JJ2S 3G4ST 2DTHA 3M5AA 3EAEA 3M56A 4JLIA 1V29B 3LYIA 3LLRA 1UGPB 1UGRB 3Q1JA 2YLCA 5FU7B 5L8RE 4F7UB 3QHSA 5GAN7 4R55A 2HAXA 3SB2A 2HQXA 4C92E 2EAYA 3PIOA 4XTWA 3L2VA 4ELZC 1B34B 5GMKh 3KXTA 2QEXA 3J7AF 3M57A 4DQ2A 3CCST 3CCQT 5GANf 2RHIA 2AHJB 3GP8A 4FT2A 1KD1C 1VQ6T 3L2UA 4JRPA 4PJOG 3OYAA 2FVUA 2FL7A 5A0GA 3TREA 2P0PA 4M77A 1VQ6A 1U8RA 2BKDN 3QXEB 4M7AG 1N6AA 2HNIA 3CPWA 3CBOA 3OYIA 2RI5A 1VQNA 5KCOA 1M9SA 2PVDB 2XHCA 2JZ2A 4IUUA 2DXTA 3PT9A 3QO3A 4RCBA 3FC3A 5LJ3j 1FXXA 2YHTA 3I55A 1VQ4T 1Y96A 3E9FA 4HA8A 5CKEA 5GMKl 1YJ9T 5LJ5d 3E9GA 4J7FA 1LOJA 3FIFA 4QVZA 4X9CA 5GMKi 2CZ6B 2RA2A 1G3YA 1NJIU 3DB4A 4KULA 2QQBA 4MZMA 4XTZA 5FRNA 2MWOA 1PSFA 5DM7R 2X4YA 3FRNA 3QUIA 4O5VA 2HQEA 3JCMX 3CCET 2QXFA 3GNGA 5LJ3f 1VQPA 1VIEA 5LJ5j 2JUFA 3VUZA 2DEQA 2KDSA 2A7YA 4N4IA 1IREB 2F69A 4C92C 2RJEA 2K4YA 5KE3A 2V8KA 2LCLA 1SSFA 3A8LB 3CBPA 3INZA 4Q5WA 4BD3A 4ELYC 3CXCA 5GANg 3CMAA 3JCMb 1VQ5A 1OZ3A 4RG2A 4EMKA 1H3ZA 1VQ7A 3M4YA 3HSBA 3QBYA 3O8VA 4XAXB 3OSVA 2M1HA 2EJFA 1WJSA 2R57A 5LJ3e 2DTIA 2EIFA 3ER0A 3HP9A 4Z02A 1EIFA 3LW5E 2RK2A 2XDPA 3R6OA 3WVDB 2PVGB 3S3MA 5GANj 3HKSA 3L2WA 3VYHB 1NPRA 3E1SA 2RK1A 4MDWA 3N5BB 1KQSA 3OMGA 5GAMh 4M75G 1NZ9A 4ZGJB 5GMKj 1ZBXA 1BI0A 4ZTJA 1VQOA 3SFMA 1VQKT 2DIGA 5GAN8 3GIBA 3JCMf 1WNLA 4JRKA 3DLLA 2GQVA 1VQMT 4C0FA 1RL2A 3CMET 4A4EA 3CXCS 1Y7XA 3QJYA 3QJ6A 2OTJT 1YI2A 2ZGWA 1JRIA 4LDVA 2EQKA 4C8QG 1YJWT 1X75C 4EMKC 5GAMd 4C8QB 3CCUA 4FU6A 2LX9A 2Y4YA 4NL3A 5FU6B 2E12A 2M16A 2E41A 2M9UA 3A8MB 2EJ9A 1HK9A 3FB9A 1Q81C 3OS2A 5CQXA 3JB9H 3HFNA 3S6WA 1G3SA 4MZTA 3CC4A 3CD6T 1KQSS 5GAMe 4JRIA 3EFRA 2K3YA 4OB1B 2F5TX 3OYJA 5GAN6 4PKCC 2CZ1B 3LGLA 5CAIA 1M8VA 5CVIA 3CC4T 2RB6A 3MCAB 2CKKA 4E7KA 1M5Q1 4DOWA 4M78D 1WGSA 2ZPFB 1N9SA 2X4WA 4DOVA 1M1FA 3HHTB 2DIQA 1ZHIA 4BUGA 1VQ8T 3GOXA 4M7DB 1JB0E 2VC8A 2YRVA 1KD1U 4X9DA 2GCXA 1M1KU 1GXIE 2VXEA 1Q86U 1HXDA 4D6WA 1YBYA 3PGGA 2RJCA 3CCJT 4HCZA 2R5MA 2RI2A 1M1GA 3URGA 4IUTA 3OYGA 4JJNK 4OB3B 1FX7A 3META 4M77C 4C8QF 5GANe 1WJRA 5D6WA 2V8JA 4PJOB 2V8IA 4HT8A 5CKHA 4RCCA 3L42A 3A8HB 4M7DC 1VUBA 1PSEA 3ASKA 3BY7A 3H6ZA 4FSXA 3V8KA 2FB7A 3WVEB 1YCYA 2QA4A 3RUXA 3JCMP 1YHQT 5HY6A 4PL6A 2GFAA 2X35A 1Q7YU 4KBMB 3CCMA 3X25B 4F7UE 3JCMd 2C06A 1WQ7A 2RD1A 2PQWA 2OTLA 2WACA 4GLKA 1X01A 2DK3A 3JCMW 2XKOC 4M78A 3OYEA 3A5ZB 2DJZA 2E6NA 3GNFB 4L6V5 3TU4K 2KMTA 1BI2A 1H641 4M7AB 3UT1A 3JB9G 2GFUA 3JB9F 4EMHA 4XU2A 5CO7A 5DLOA 2RM4A 3FEOA 5GAN2 3CBMA 4ZGDB 2EJGA 2JTMA 3C94A 3I56T 4ZN3A 4OMFB 2QQRA 4MMLA 5KE2A 5A0DA 3BDUA 1K9MC 2LQKA 4M7DF 1QVGA 1YJWA 2WSCE 3HRSA 2CZ0B 4PLIA 2DZCA 3CC2T 2O01E 3VKIA 3CMAT 3ME9A 3OB9A 1NE8A 2QQSA 3HL8A 1O75A 3H8ZA 3OS0A 1OI1A 2KQWA 2MI6A 3C12A 1P92A 3M59A 4LDYA 3JCMh 1Q82C 3OYBA 1M90C 1KHIA 3MP6A 1K73C 4E7JA 2DO3A 5KH6A 2E64A 3S3NA 1YHQA 2QTXA 5GAMf 4FT4A 4J6WA 3PNWC 4J83A 3V7SA 4ME7A 2MMPA 3V7RA 4NL2A 1NJIC 5C6SA 3G71A 3NTIA 1Q82U 4II1A 3G6EA 2XIDA 3NTHA 3QYHB 4MDXA 1M4ZA 1OYXA 3RKXA 3QYGB 3VUBA 3FJPA 2DXUA 4JLGA 3CC7T 1VQ7T 1JJ2A 4M75D 4KUIA 1RI0A 2ZPEB 5CIUA 3OYNA 2QA4T 3OYKA 4BY6C 3L2ZA 3X24B 3JCMe 5GMKe 3QIIA 3HRUA 1KG1A 2X4XA 2FYKA 3AHUA 4PNOA 4F7UA 5HKCA 2RI3A 5LJ3h 4C5GA 4MZPA 2JVVA 3CEYA 2PU9B 2O4XA 1W2BA 1D3BB 4M77G 4QQ6A 3CCUT 4XTYA 3X26B 4M78E 3OYHA 3CC7A 2RJDA 1YI2T 4EPCA 4M77D 1YIJT 4OB0B 4NOYA 1XNIA 2XDBA 3CCMT 4M7AD 1JBMA 1N27A 3OSSC 3E19A 2MF2A 3CMEA 1QVPA 3OYDA 3CC2A 2E1HA 2EQJA 2DPPB 2EQMA 3RIRA 3HFOA 1K8AC 5D6XA 1OZ2A 4CRIA 1BI3A 2IVWA 5A0LA 3JB9I 2M0OA 2RO0A 3MP1A 5GAN4 1U1SA 3GLXA 3KUFA 3SDZA 4C0GA 4ZN1A 2DKGA 2QEXT 3OA6A 1QVFA 4B9XA 2DTOA 1FWZA 2XI9A 4XK8E 4JS5A 3UPUA 3SWNB 3LGFA 4X34A 2LNVA 4C0DB 2CYZB 2ZPHB 3M4GA 3JCMc 2CS7A 4IUVA 4QQGA 1VQ8A 2HD0A 1BKBA 5GAOq 1O9SA 3PMIA 3JSCA 2F5KA 5J3BA 4XTVA 1BIBA 1S72A 1VQMA 4M7AC 1WQWA 3G71T 3PFSA 2LQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLK A;  2XD0 A;  2XDB A;  2XDD A;  4RMO A;  4ATO A; 
#chains in the Genus database with same CATH topology
 1VIF A;  4JPB W;  3LX7 A;  5IHI A;  1QW1 A;  4XTX A;  4OMQ A;  2DAQ A;  4E7I A;  1AHJ B;  1K0X A;  1Y0M A;  3P8D A;  3CCJ A;  5FU6 C;  3J81 E;  3G6E T;  3NHN A;  3FDR A;  3ZL7 C;  2ZPG B;  1CKB A;  4PJO F;  1K76 A;  2X3W D;  2P0Q A;  1VQK A;  3M0S A;  4ATO A;  1T0H A;  1V1C A;  4FM4 B;  2CH4 W;  1I8F A;  1ZA1 B;  4J9B A;  5CR2 A;  3EG3 A;  3NTK A;  1JEG A;  3UA6 A;  3RMQ A;  4BDZ A;  2AZV A;  2KEA A;  1KQ2 A;  4M7A E;  2QI2 A;  2EFI A;  3GF5 A;  3CCJ Q;  2QDY B;  1ZSG A;  3CCL T;  2M02 A;  3G7Z A;  3QDR B;  2DXB A;  1PD1 A;  4OMM A;  3QWY A;  3SWN A;  3CCS A;  1UEC A;  8AT1 B;  4M78 B;  2ZZD A;  2KXD A;  4IKF A;  2DIL A;  1T3L A;  5FRM A;  1QVG S;  1UEB A;  2E70 A;  2QTV A;  5GAN d;  1GCP A;  5C0M A;  2ED0 A;  2D8J A;  4IIO A;  4M78 C;  2OI3 A;  1KJW A;  1KFZ A;  2BTT A;  4KGV B;  2ROL A;  3JCM V;  2CGH A;  2C0O A;  2E65 A;  2RHU A;  3RES A;  2EQI A;  5LJ5 e;  1VQ9 T;  3FLG A;  5LJ5 g;  2LTO A;  3MO8 A;  4VUB A;  2OTJ A;  1U06 A;  2NWM A;  4PJL A;  1XQH A;  3T9N A;  2VUB A;  1K73 R;  3SEM A;  1VQO Q;  1Q86 C;  4FL6 A;  2F2V A;  2HKN A;  5IXF A;  1T3S A;  3UDC A;  3LWH A;  4C92 B;  1SF9 A;  2D6F A;  2NLU A;  1RAE B;  3AT1 B;  3EGX B;  3NGP A;  4M77 F;  3BDL A;  2ZPI B;  3CCQ A;  5GAO r;  2OTL T;  3I9Q A;  1K0S A;  3QZ5 B;  1Q81 U;  1IZ6 A;  4BAC A;  2DD4 A;  2L3S A;  4M7D E;  1S1N A;  1EX4 A;  2X4J A;  3EHR A;  4A4G A;  4LDX A;  3PIP A;  4M75 F;  1YJ9 A;  3CCR T;  2WSE E;  1X6B A;  1T0J A;  2K6D A;  2LMJ A;  3LH0 A;  3MEW A;  3G4S A;  4IUP A;  2VXF A;  5A2Q E;  3SD4 A;  2VGM A;  1BYM A;  4RTY A;  3CCQ Q;  3JAM E;  3G71 Q;  2HZY A;  2BUD A;  3QSU A;  1AWW A;  1YJN T;  4M7D G;  1IHV A;  1YJW Q;  2RQR A;  4A53 A;  5GAN h;  1WIE A;  1QVF S;  2VAS A;  4IIM A;  1VQM Q;  2QYZ A;  5AT1 B;  4JUV A;  2Y90 A;  3PTA A;  1UGQ B;  1SKU B;  2L89 A;  1KK7 A;  1RAC B;  4F16 A;  1XOV A;  2HQH A;  3D7S B;  1W6X A;  4M7D A;  5KYU B;  3CPF A;  5EG2 A;  1AZG B;  4LD9 K;  2ZCF B;  1OX8 A;  1W2B P;  4ZGE B;  3V8L A;  1KHC A;  2R58 A;  4CI0 C;  2PVO B;  2JNG A;  1VQL T;  1QKX A;  2KK4 A;  2L3Q A;  2IG0 A;  2JN0 A;  2LVM A;  2RHZ A;  4KT0 E;  1M3B A;  2EYX A;  4DBH A;  3CCE A;  4N4H A;  1Y07 A;  3BFM A;  3OS5 A;  2K9G A;  4EMK B;  4JLI A;  2DTH A;  3M56 A;  1UGP B;  1UGR B;  5L8R E;  3QHS A;  2YXY A;  4C92 E;  1UHC A;  2NYS A;  2FZC B;  5GMK h;  3M57 A;  3CCS T;  1QCO A;  3VS4 A;  2F2X A;  1AZE A;  2KI7 A;  1KD1 C;  1QLY A;  2OJ2 A;  4KGX B;  2FL7 A;  1RLP C;  4M77 A;  4FW2 A;  1WZO A;  2HNI A;  2CT4 A;  3UAT A;  1H3H A;  3OYI A;  2RI5 A;  1IHW A;  1VQN A;  3A98 A;  1R0B G;  2PVD B;  4IUU A;  4CC7 A;  3PT9 A;  2V1Q A;  1R77 A;  3I55 A;  2YUP A;  1YJ9 T;  1SHF A;  2K3B A;  5GMK i;  1G3Y A;  4KUL A;  4MZM A;  5FRN A;  3FRN A;  1WHL A;  1VQP A;  1VIE A;  1I0C A;  2KDS A;  2F69 A;  1YIJ Q;  2V8K A;  3INZ A;  3CMA A;  1D0X A;  1VQ5 A;  4RG2 A;  2DER A;  3O8V A;  4XAX B;  2M1H A;  2EJF A;  1WJS A;  2R57 A;  3S3M A;  5GAN j;  3E1S A;  4MDW A;  2FPE A;  3OMG A;  3CC7 Q;  5GMK j;  4ZTJ A;  1VQO A;  3GIB A;  1PHT A;  3JCM f;  4JRK A;  2CT3 A;  2GQV A;  2YWW A;  3CME T;  1OU8 A;  3QJY A;  2OTJ T;  4C8Q G;  2EQK A;  1VQN Q;  4C8Q B;  1KIK A;  5FU6 B;  2E41 A;  2EJ9 A;  3A8M B;  3FB9 A;  2LQW A;  3HFN A;  3EG2 A;  3CD6 T;  3CC4 A;  1KQS S;  1YWO A;  3OYJ A;  4PKC C;  5CAI A;  1RAB B;  1M8V A;  5CVI A;  3CC4 T;  1AWJ A;  4E7K A;  1TU0 B;  2EBP A;  1BU1 A;  4CC2 A;  1IXD A;  1M1F A;  2DIQ A;  1VQ8 T;  4BUG A;  3GOX A;  2YRV A;  2GCX A;  3CMA Q;  3PGG A;  1WXT A;  2RI2 A;  1FX7 A;  2YUN A;  3MET A;  4M7D C;  1PSE A;  2FB7 A;  3WVE B;  2PNI A;  4PL6 A;  2X35 A;  2JM9 A;  4KBM B;  1AVZ C;  2PQW A;  3VS3 A;  1ZUY A;  1X01 A;  2DK3 A;  2JS0 A;  4M78 A;  3OYE A;  2DJZ A;  2JTE A;  4L6V 5;  2KMT A;  1BI2 A;  1H64 1;  3UT1 A;  2GFU A;  2RM4 A;  2CRE A;  3FEO A;  4ZGD B;  2EJG A;  4ZN3 A;  3BDU A;  2D0N A;  4M7D F;  2BZY A;  1YJW A;  3HRS A;  5KYY B;  3ME9 A;  3OB9 A;  1NE8 A;  2GGR A;  1NLO C;  1P92 A;  2GTJ A;  3OYB A;  1K73 C;  2A28 A;  2DO3 A;  2C0I A;  2E64 A;  5KH6 A;  2QTX A;  4J6W A;  3PNW C;  4J83 A;  1D1B A;  3H41 A;  2NUP B;  1M4Z A;  3VUB A;  4JLG A;  1IB8 A;  1M27 C;  1RI0 A;  1JXO A;  3OYN A;  2OAW A;  3OYK A;  2YT6 A;  2DL8 A;  2DX1 A;  1ZLM A;  3QII A;  1KG1 A;  3AHU A;  4PNO A;  5HKC A;  1NBE B;  4OML A;  4MZP A;  2JVV A;  2O4X A;  4AFU C;  4QQ6 A;  3CCU T;  1GFD A;  4M78 E;  1YI2 T;  1YIJ T;  4EPC A;  4OB0 B;  1LCK A;  4NOY A;  1XNI A;  1JBM A;  2MF2 A;  4RTU A;  2HBW A;  2EQJ A;  2EQM A;  2DPP B;  3JV3 A;  3HFO A;  3VS5 A;  2VWF A;  3JB9 I;  2RO0 A;  3MP1 A;  3EG9 A;  1WA7 A;  2XI9 A;  2LNV A;  4C0D B;  2DA9 A;  1O9S A;  2EPD A;  5I22 A;  1Q86 R;  4M7A C;  1WQW A;  3JCM Q;  1BIA A;  1YIT A;  1GBQ A;  1M1K R;  2GF7 A;  2K57 A;  4QVC A;  1M3A A;  2KBT A;  4OGC A;  4C92 F;  2CZ7 B;  2DBM A;  2GBQ A;  4A4H A;  2JW4 A;  3OY9 A;  3I56 A;  2H3E B;  1SEM A;  4E7H A;  1VQ4 A;  5KYY A;  1Q7Y C;  4HKE A;  3DKM A;  2R5A A;  1WHH A;  1I5L A;  2EWN A;  3RMS A;  2EQU A;  4OMO A;  1F1B B;  3VJP A;  2D0Q B;  3PVQ A;  4RMO A;  2LCC A;  3H0I A;  3JB9 J;  1YI2 Q;  2JMA A;  2KAF A;  4RTV A;  1XTD A;  1ZBJ A;  2KVQ G;  3CCU Q;  1I4K 1;  1PCX A;  4HT9 A;  4PLL A;  3E2U A;  1MMD A;  3CC4 Q;  5IN1 A;  4N0A A;  1I81 A;  3JB9 F;  5FU7 C;  2E10 A;  2ED1 A;  4OVA A;  4C92 D;  4ESR A;  1TS9 A;  1U1T A;  3TVT A;  4ZNX A;  4BE2 A;  1KC8 U;  4YTL A;  2KSS A;  4ORZ A;  4FSS A;  1YFN A;  2CP6 A;  4WCI A;  5GAN 3;  4WF2 A;  2DYB A;  2RHY A;  3DB3 A;  4B9W A;  4L5G A;  2FRY A;  2SEM A;  2C0T A;  2HBP A;  5J39 A;  2K5F A;  4PJO E;  5IT9 E;  2E6Z A;  3L1A A;  3S3O A;  4J5Y A;  1Z9Z A;  3OW2 A;  1M90 R;  1VQ9 A;  2QGG A;  1WFW A;  2JXB A;  1TUD A;  1K8A U;  5CCA A;  4BI8 B;  1R8O B;  3QG1 A;  2BZX A;  3OQ5 A;  2MAM A;  5L23 A;  1K73 U;  2XU8 A;  2ZAE A;  2P84 A;  4M7A F;  3OMC A;  2DRM A;  3C4S A;  2COW A;  3LWI A;  4Y28 E;  4O6J A;  2KXC A;  4OGE A;  4BI3 A;  1G3T A;  4RTW A;  4PFO A;  3PVL A;  2LDM A;  1X2Q A;  4Y91 A;  3L2Q A;  3BE3 A;  2CH4 A;  2PTK A;  1OV3 A;  2L0A A;  2NUZ A;  5ECA A;  1YIT T;  2EGC A;  1JU5 C;  1Y71 A;  2KYB A;  5GAO p;  1OEB A;  4QKU A;  1UDL A;  3KBG A;  1QVG P;  4L59 A;  4XU3 A;  3JRZ A;  1M30 A;  2EYZ A;  1WPY A;  4OF1 A;  3CCS Q;  4KRT A;  3RR6 A;  2EYQ A;  3PMT A;  1UUE A;  2XDD A;  1X69 A;  4HCK A;  1D1C A;  2DMO A;  3M0T A;  4M7D D;  2ATC B;  2D9T A;  4C92 A;  1QP3 A;  3EFO A;  5EC7 A;  1VQL Q;  4A54 A;  4RG8 A;  2WSF E;  4HCB A;  4M77 B;  3X20 B;  3P8H A;  4M77 E;  4DBR A;  3V7C A;  3QKJ A;  4P5N A;  2W10 A;  1K9M U;  5KYW A;  2KRN A;  3RNJ A;  1W4S A;  2YDL A;  3MKD A;  1QWE A;  5IAY A;  2MK5 A;  4J6Y A;  5GMK m;  1IRX A;  2P0K A;  1KD1 R;  3MEA A;  1TH7 A;  2E4H A;  2FO0 A;  2K79 A;  3REA B;  4FW1 A;  4M78 F;  1PNJ A;  2DM1 A;  1S72 T;  4J7I A;  2YSQ A;  3TCJ A;  5FW9 A;  1NPP A;  1LJO A;  3I5S A;  4E7L A;  2DL5 A;  3M9Q A;  1YP5 A;  2K3X A;  5GAM j;  4HCC A;  2RPN A;  3M5A A;  3EAE A;  2HKQ B;  5FU7 B;  1V29 B;  4J9C A;  1YJN Q;  2YLC A;  5GAN 7;  4LN2 A;  1RLQ C;  4XTW A;  2QEX A;  3OW2 P;  2JM8 A;  1WDX A;  3CCQ T;  1K1Z A;  3GP8 A;  4FT2 A;  1VQ6 T;  4CC3 A;  4JRP A;  3I56 Q;  4PJO G;  1NEB A;  4PJN A;  2P0P A;  1VQ6 A;  2BKD N;  3G4S Q;  5KCO A;  2XHC A;  2JZ2 A;  1QVF P;  1JQQ A;  1TWB A;  2DXT A;  3MJX A;  3FC3 A;  1LVK A;  5LJ3 j;  3RDV A;  3E9F A;  4HA8 A;  4J7F A;  4X9C A;  1LOJ A;  4QVZ A;  2CZ6 B;  2ABL A;  5DM7 R;  2X4Y A;  4O5V A;  1N8R R;  3GNG A;  3VUZ A;  2DEQ A;  7AT1 B;  4N4I A;  2K4Y A;  2KT8 A;  1BCM A;  4AG2 C;  3CBP A;  1SSF A;  3CXC A;  4BD3 A;  3EFO B;  5HCK A;  5LJ3 e;  2EIF A;  3C0C A;  1K4U S;  3ER0 A;  4Z02 A;  3R6O A;  6AT1 B;  3HKS A;  1NPR A;  5GAM h;  2VVK A;  1NZ9 A;  4ZGJ B;  3EGU A;  3SFM A;  4C0F A;  2HSE B;  2L2P A;  4PJM A;  2ZGW A;  4LDV A;  1CSK A;  1MUZ A;  1X75 C;  4FU6 A;  1SPK A;  3R6N A;  4AFS C;  1WXU A;  2GTO A;  1G3S A;  3FJ5 A;  5GAN 6;  3THK A;  2HSP A;  2RB6 A;  1NYF A;  4DOW A;  4Z88 A;  4M78 D;  1N9S A;  3CCR Q;  1ARK A;  2X4W A;  4M7D B;  1GXI E;  1M1K U;  2VXE A;  4PFZ A;  4D6W A;  3CCJ T;  1FMK A;  2O9V A;  1Z9Q A;  4IUT A;  3OYG A;  1TTH B;  1M8M A;  4M77 C;  2EW3 A;  5GAN e;  2V8I A;  4HT8 A;  4FYW B;  3L42 A;  4FSX A;  1YCY A;  2DYI A;  3JCM P;  5HY6 A;  2GFA A;  2L3P A;  3X25 B;  1WQ7 A;  2RD1 A;  2G6F X;  2WAC A;  4GLK A;  1SSH A;  4Z8A A;  2XKO C;  2CUD A;  2E6N A;  2O2O A;  1SG5 A;  1YCS B;  1RAF B;  2DRK A;  2RF0 A;  2JTM A;  3C94 A;  2ENM A;  2LQN A;  2QQR A;  4MML A;  1K9M C;  1WHJ A;  2E3H A;  2CZ0 B;  2DZC A;  2O01 E;  3VKI A;  2KNB B;  3HL8 A;  3OS0 A;  1O75 A;  4R0K A;  5KYW B;  1Q82 C;  3S3N A;  1YHQ A;  5GAM f;  1PKT A;  5FWC A;  1NJI C;  3V7R A;  3G71 A;  3G6E A;  3RKX A;  2QEX Q;  1TOV A;  1VQ7 T;  4M75 D;  4KUI A;  2QA4 T;  3L2Z A;  5GMK e;  3HRU A;  2X3X D;  3TQ7 P;  4F7U A;  2EKH A;  1SRM A;  2KE9 A;  3X26 B;  4M7A D;  1N27 A;  3E19 A;  2KRS A;  3VS1 A;  3OYD A;  1YNZ A;  2MOX A;  5D6X A;  3GLX A;  3A1P A;  1OX9 A;  3KUF A;  3SDZ A;  2QEX T;  2DTO A;  4JS5 A;  3UPU A;  4E6R A;  4X34 A;  3SHW A;  2CDT A;  2CYZ B;  3M4G A;  4EIK A;  4RTZ A;  3PMI A;  5J3B A;  2LX7 A;  4LXC A;  1S72 A;  1VQM A;  3VS6 A;  3H0H A;  3REB B;  1MMN A;  2O31 A;  1VQ6 Q;  3EGD B;  5I2M A;  3EFS A;  2VV5 A;  2CSQ A;  2K2M A;  2H8H A;  4J9I A;  2P4R A;  2AZS A;  4FYY B;  4TVR A;  2HL5 C;  1YN8 A;  1VYU A;  1YIT Q;  3UA7 A;  2VB6 A;  4FIB A;  4GLM A;  3JB9 D;  4QQD A;  2XK0 A;  5GAM g;  5GAN 5;  5IHK A;  3MHX A;  4UC4 A;  1Q7Y R;  3A8G B;  1MHN A;  1G2B A;  1KSW A;  2OAU A;  1MMG A;  2I2L A;  1N8R U;  2KR3 A;  2PZ1 A;  3UWN A;  4LDU A;  4PJO A;  2PUO B;  5LJ3 g;  2X9H A;  2RQT A;  1QCF A;  3OYY A;  5LJ5 f;  1RAA B;  1ZSZ C;  3OBY A;  2LT1 A;  2EGA A;  4M75 C;  1UB4 A;  2VKN A;  2YRC A;  3QPH A;  2QDL A;  3WXM B;  1VQL A;  4PJO C;  4M78 G;  2A08 A;  2PUK B;  3I55 Q;  4GY5 A;  2HEQ A;  4PJO D;  4J8O A;  5CKF A;  4M75 B;  1HJD A;  1WXB A;  2IIM A;  1VQ7 Q;  3EHQ A;  4HVV A;  4LUE A;  2J06 A;  4PFP A;  3M0U A;  2RN8 A;  1GBR A;  2DXC A;  2FHD A;  3VYG A;  4C0D C;  1ABO A;  2QQ9 A;  4LDW A;  1VQ5 Q;  1EZZ B;  1MV0 B;  1G5V A;  3NMZ C;  2L3R A;  4C0Z A;  2CSI A;  2EYW A;  2D1X A;  1GCQ A;  2COY A;  1U3O A;  1A0N B;  3CCL A;  2COZ A;  1C0M A;  4RKU E;  1UHF A;  1X6O A;  3M53 A;  1VQP T;  2XG8 D;  3ZFJ A;  4EDU A;  3ULR B;  3F70 A;  2J6F A;  1QCN A;  1W70 A;  5LL6 S;  2E5K A;  2K5I A;  5KCH A;  4C8Q C;  4OMN A;  4X1V A;  3X28 B;  2NUT A;  1K8A R;  4C5E A;  4XU1 A;  1R0C B;  4J6X A;  2A3L A;  2X51 A;  3VV0 A;  4LD6 A;  5AYF A;  2FZG B;  3QZ9 B;  3EG9 B;  1PRL C;  1MGQ A;  2HL3 A;  4WTO B;  1GFC A;  2ROT A;  4KH1 B;  3J80 E;  1J3T A;  4A4K A;  2G3R A;  1OUL A;  3OYL A;  4BY6 B;  2L8D A;  3L2R A;  5KYN A;  1LNX A;  4KUD K;  3OBW A;  1NYG A;  3BW1 A;  2D8H A;  4F17 A;  3MEV A;  3CD6 A;  3IQL A;  4R56 A;  1B34 A;  2RHX A;  2JTF A;  1BI1 A;  1S72 Q;  3GPL A;  2O88 A;  2F2W A;  2MWP A;  4A4F A;  3M55 A;  4J9H A;  2M51 A;  2BZ8 A;  3EG0 A;  8ATC B;  3H0F A;  1XJW B;  3OYM A;  4FCY A;  2AK5 A;  2HDA A;  2K2V A;  2KYM A;  3EG1 A;  3H9N A;  5D6Y A;  2LT4 A;  2DZ9 A;  3JCM J;  1GCQ C;  2LC4 A;  2VYT A;  4BE0 A;  1D09 B;  4MMK A;  4V2S A;  3OS1 A;  5CKB A;  1ABQ A;  4N4G A;  1JJ2 P;  4B6M A;  3G1J A;  2H3J A;  3OYF A;  5LJ3 d;  2LRQ A;  2RQW A;  1N8R C;  2DVE A;  2MYS A;  3TEE A;  4XTU A;  2LCS A;  2LJ3 A;  3G4S T;  4DBQ A;  1JJ2 S;  4J9E A;  3Q1J A;  2HAX A;  3SB2 A;  2EAY A;  3J7A F;  2HCK A;  2FPD A;  4DQ2 A;  3CCV Q;  3CC2 Q;  2CP0 A;  1PWT A;  2JS2 A;  3OYA A;  2DNU A;  2FVU A;  5A0G A;  2CP3 A;  3QXE B;  4M7A G;  1N6A A;  2LJ1 A;  1NJI R;  3CXC P;  1M9S A;  5GJW B;  4RCB A;  2B86 A;  1Q81 R;  1FXX A;  2YHT A;  1MV3 A;  4JZ3 A;  2F1L A;  3FIF A;  1YHQ Q;  2RA2 A;  2QQB A;  3CQT A;  3M0R A;  1PSF A;  3QUI A;  2HQE A;  3JCM X;  3CCE T;  2QXF A;  4D8D A;  1W1F A;  1PG5 B;  2JUF A;  2A7Y A;  1QWF A;  5KE3 A;  2LCL A;  3A8L B;  4Q5W A;  5GAN g;  1VQ8 Q;  1AD5 A;  2A36 A;  1OZ3 A;  3JCM b;  1H3Z A;  1VQ7 A;  1E7O A;  3M4Y A;  1E6H A;  1B07 A;  2RNA A;  3HP9 A;  1EIF A;  3LW5 E;  2RK2 A;  2PVG B;  1ZUK A;  3VYH B;  3N5B B;  1KQS A;  4M75 G;  5KYX A;  5GAN 8;  1OQK A;  3DLL A;  1N5Z A;  1RL2 A;  4JZ4 A;  1RUW A;  1Y7X A;  2RQV A;  5D7U A;  1Y57 A;  3QJ6 A;  5IH2 A;  1YI2 A;  1U5S A;  1M2V A;  4EMK C;  5GAM d;  3CCU A;  4NL3 A;  2E12 A;  2M9U A;  1HK9 A;  3OS2 A;  5CQX A;  4KGZ B;  3S6W A;  4LUD A;  5GAM e;  4JRI A;  4OB1 B;  2DF6 A;  2F5T X;  3MCA B;  2CKK A;  1M5Q 1;  4J9D A;  1WGS A;  2EYY A;  4DOV A;  3HHT B;  4AFQ C;  3VS2 A;  1JB0 E;  2VC8 A;  1RAI B;  1Q86 U;  1HXD A;  2RJC A;  4F04 B;  1NEG A;  2QG9 B;  1BK2 A;  2J6K A;  1WJR A;  5D6W A;  4PJO B;  2BE9 B;  4RCC A;  5CKH A;  3A8H B;  4A63 B;  4ELZ C;  3ASK A;  3H6Z A;  4GBQ A;  3U23 A;  1YHQ T;  1G83 A;  1OPL A;  1Q7Y U;  4AG1 C;  4F7U E;  2OTL A;  1B3Q A;  1BBZ A;  2FPF A;  4LNP A;  3JCM W;  3A5Z B;  3TU4 K;  4M7A B;  4RTX A;  4EMH A;  4XU2 A;  5DLO A;  3CBM A;  2JT4 A;  4OMF B;  5KE2 A;  1QVG A;  3CC2 T;  2KQW A;  1RAH B;  3C12 A;  3JCM h;  4E7Z A;  1M90 C;  1KHI A;  2K7A A;  4ME7 A;  2MMP A;  4NL2 A;  1Q82 U;  2XID A;  3NTH A;  3QYH B;  4MDX A;  1OYX A;  2DVJ A;  2QGF B;  3EGD A;  5FWB A;  3CC7 T;  1JJ2 A;  5CIU A;  4HVW A;  2QAZ A;  2DL3 A;  2FG0 A;  1B7T A;  1WLP B;  1KC8 R;  3X24 B;  1PRM C;  2DL4 A;  2RI3 A;  4C5G A;  1SRL A;  2PU9 B;  2DEU A;  2SRC A;  1W2B A;  4M77 G;  1FYN A;  4M77 D;  2XDB A;  4DBF A;  3OSS C;  3CME A;  1GL5 A;  3PE0 A;  1QVP A;  3CC2 A;  3CCE Q;  2E1H A;  4OMP A;  3RIR A;  1K8A C;  1TUG B;  4CRI A;  1BI3 A;  2JMC A;  1QQJ A;  5GAN 4;  1U1S A;  4C0G A;  2DKG A;  4AT1 B;  1UFF A;  1FWZ A;  3SWN B;  3LGF A;  3JCM c;  1UE9 A;  1TXQ A;  1VQ8 A;  2EGE A;  1BIB A;  5GJV B;  1WHM A;  3G71 T;  2LQ8 A;  4F7U G;  4DEY A;  4J9G A;  5I21 A;  3M54 A;  2GQI A;  4JS4 A;  1YIJ A;  4EMG A;  4E2F B;  2AIR B;  3C95 A;  1UJY A;  2ZPB B;  1D3B A;  1Q95 G;  2XD0 A;  2DLP A;  2OX7 A;  3M58 A;  1X2K A;  1TG0 A;  4OP0 A;  1KC8 C;  4N0A C;  1V76 A;  2V26 A;  1NM7 A;  1NG2 A;  4C8Q A;  4XU0 A;  4JRQ A;  2NUP A;  1JO8 A;  2JOY A;  4DA4 A;  2CP2 A;  1IO6 A;  3CMA T;  1DJ7 B;  2RQU A;  3VS7 A;  2W0Z A;  1UG1 A;  5GAO l;  3EH2 A;  1ZQ1 A;  3CPW P;  2J05 A;  1D1A A;  1MNE A;  1C1A A;  1YJN A;  3EGX A;  2IPO B;  1Q82 R;  3MEU A;  5GAO m;  2NUT B;  1M1K C;  2QAS A;  2KY9 A;  2VGN A;  2P4T A;  3CPW S;  5FRO A;  4M75 E;  4M4Z A;  2ECZ A;  1Y96 B;  1VQ9 Q;  1UGS B;  1H92 A;  1G8X A;  1BB9 A;  2K5L A;  3OYC A;  4E7S A;  2MIO A;  3OW2 S;  1WI7 A;  1VQN T;  2OTJ Q;  2MPX C;  2YLB A;  1UJ0 A;  2CP7 A;  4BE1 A;  2E5Q A;  3ZEH A;  2XIC A;  3RER A;  3M0Q A;  4KH0 B;  4BDY A;  2E3I A;  4IUR A;  4RTT A;  4PJJ A;  3V8J A;  4JDS A;  5CKD A;  1ZUU A;  2RH2 A;  4BI4 A;  2B8A A;  1QMC A;  4C8Q E;  3LH5 A;  4M7A A;  1KQ1 A;  3HRT A;  4QT7 A;  2J6O A;  4OB2 B;  3CCV A;  2Z0W A;  1X6G A;  2DD5 A;  3CCL Q;  1EFN A;  2AKL A;  2DET A;  3RKW A;  4C5I A;  5CQY A;  1PKS A;  3ZBD A;  3JCM g;  1M90 U;  1AOJ A;  2BE7 D;  3A8O B;  2L5Q A;  4M75 A;  4DEX A;  1YJ9 Q;  1OPK A;  1YWP A;  4HVU A;  4IUQ A;  1BCO A;  1I5O B;  3O5Z A;  1QP2 A;  3HPW A;  3CCR A;  2DL7 A;  3VS0 A;  4HXJ A;  4QVD A;  2LP5 A;  3RBB B;  2EVR A;  2YUO A;  1IGQ A;  1WX6 A;  4C5H A;  1G3W A;  1UGV A;  4QW2 A;  1VQO T;  1W2B S;  5DLQ E;  4D8K A;  2O9S A;  4PK4 A;  4F7U F;  2O4X B;  1WJQ A;  2RJF A;  3VRZ A;  3SWN C;  3CD6 Q;  3CCV T;  3KFV A;  3MP8 A;  5HK0 A;  1VQ5 T;  5FLX E;  5IHN A;  2LNH B;  3RKY A;  4Y92 A;  5GAO n;  3CME Q;  2Y4X A;  4XQ3 A;  4FYV B;  1AEY A;  3DLM A;  4C92 G;  4NS5 A;  5DY9 A;  1K9M R;  2GNC A;  3I55 T;  4AFZ C;  1HYO A;  4BB7 A;  5CK9 A;  4RUG A;  5LJ5 h;  2EKO A;  3CCM Q;  1UTI A;  2BIV A;  2CUB A;  1AT1 B;  1VYT A;  4C8Q D;  5I2S A;  1PC0 A;  3QDF A;  4ZTF A;  5HK3 A;  3NFC A;  1ZSZ A;  2A0F B;  1M3C A;  4J9F A;  3EH1 A;  5M9O A;  2V1R A;  1N9R A;  5J26 A;  1MMA A;  2CP5 A;  2M0Y A;  4E47 A;  3P8B B;  3VU3 C;  3LYI A;  3LLR A;  4F7U B;  4R55 A;  1LPL A;  1ZA2 B;  2HQX A;  2I0N A;  3PIO A;  3L2V A;  1B34 B;  3KXT A;  1KQS P;  1D0Z A;  1MND A;  5GAN f;  2RHI A;  2AHJ B;  1TUC A;  2FEI A;  3L2U A;  2DJQ A;  2HMA A;  4Z89 A;  3TRE A;  1U8R A;  1OOT A;  3CPW A;  1QKW A;  3CBO A;  2FRW A;  3QO3 A;  1FMV A;  1IGU A;  1VQ4 T;  1Y96 A;  5CKE A;  5GMK l;  4LE9 A;  1HD3 A;  2AT1 B;  3E9G A;  2JJ9 A;  5LJ5 d;  3I5R A;  1X43 A;  3DB4 A;  1NJI U;  4XTZ A;  2QK0 A;  4JJC A;  2MWO A;  5LJ3 f;  5LJ5 j;  1IRE B;  4C92 C;  1K9A A;  2DFU A;  2RJE A;  4JJD A;  3HTR A;  2J7I A;  4ELY C;  5I11 A;  4EMK A;  3HSB A;  3QBY A;  3OSV A;  1E6G A;  2MCN A;  2DTI A;  3WVD B;  2XDP A;  1ZX6 A;  3UF4 A;  1OU9 A;  3L2W A;  2RK1 A;  2KGT A;  2QA4 Q;  1ZBX A;  1BI0 A;  3QWX X;  1VQK T;  2DIG A;  1WNL A;  1VQM T;  2RMO A;  4A4E A;  3CXC S;  1GRI A;  1JRI A;  1YJW T;  1I07 A;  1VA7 A;  1ZSZ B;  2LX9 A;  2Y4Y A;  2M16 A;  1Q81 C;  3JB9 H;  1VQK Q;  1WHG A;  3I35 A;  2ESW A;  4MZT A;  3VRY A;  1PD0 A;  4JJB A;  3EFR A;  2K3Y A;  4AMC A;  2CZ1 B;  1I1J A;  3LGL A;  1CKA A;  1M2O A;  3MPU B;  1RI9 A;  2ZPF B;  2YUQ A;  9ATC B;  2AKK A;  1ZHI A;  1KD1 U;  4X9D A;  1RAD B;  5KYU A;  2XMF A;  2YRD A;  1YBY A;  4HCZ A;  2R5M A;  1M1G A;  3URG A;  4JJN K;  4OB3 B;  4C8Q F;  4FYX B;  2OTL Q;  2V8J A;  1VUB A;  3BY7 A;  3V8K A;  2QA4 A;  4ANJ A;  3GBQ A;  3RUX A;  3TSZ A;  1ACM B;  1VQ4 Q;  3CCM A;  5KYX B;  3JCM d;  3GNF B;  4CC4 B;  1SHG A;  3JB9 G;  2KT1 A;  1VQP Q;  1HSQ A;  5CO7 A;  5GAN 2;  3I56 T;  4F14 A;  5A0D A;  2LQK A;  2LZ6 B;  2WSC E;  4PLI A;  1X27 A;  2QQS A;  2C06 A;  1TSF A;  3H8Z A;  1OI1 A;  2MI6 A;  3M59 A;  4LDY A;  3TSW A;  3MP6 A;  4E7J A;  4FT4 A;  3NPF A;  3V7S A;  5C6S A;  3NTI A;  1AWX A;  4II1 A;  2A37 A;  3QYG B;  1C6V X;  3FJP A;  2DXU A;  1WYX A;  2FZK B;  2ZPE B;  2KRM A;  4BY6 C;  3JCM e;  2X4X A;  2FYK A;  1NLP C;  5LJ3 h;  3CEY A;  5IXB A;  1VYV A;  1D3B B;  4XTY A;  3CC7 A;  1JXM A;  3OYH A;  1AWO A;  2RJD A;  2KRO A;  3CCM T;  1D0Y A;  1OZ2 A;  5A0L A;  2IVW A;  2M0O A;  4ZN1 A;  1WHK A;  3OA6 A;  1QVF A;  2DBK A;  4B9X A;  1FMW A;  4XK8 E;  1RAG B;  4K11 A;  2ZPH B;  4QQG A;  2CS7 A;  4IUV A;  2HD0 A;  1BKB A;  5GAO q;  1VOM A;  1PM3 A;  3JSC A;  2F5K A;  3G6E Q;  1M2V B;  4XTV A;  2LJ0 A;  2DE0 X;  1H8K A;  3M0P A;  2QQA A;  3PFS A; 
#chains in the Genus database with same CATH homology
 1VIF A;  4F7U G;  3JCM Q;  1BIA A;  3LX7 A;  1YIT A;  5I2M A;  1QW1 A;  5I21 A;  3EFS A;  2VV5 A;  3M54 A;  4XTX A;  2DAQ A;  4E7I A;  2GF7 A;  1AHJ B;  2K57 A;  4QVC A;  3P8D A;  4TVR A;  3CCJ A;  5FU6 C;  3J81 E;  3G6E T;  4OGC A;  4JS4 A;  1YIJ A;  3FDR A;  4C92 F;  2CZ7 B;  4EMG A;  2ZPG B;  4A4H A;  4FIB A;  3C95 A;  3OY9 A;  3JB9 D;  2ZPB B;  4QQD A;  3I56 A;  2XK0 A;  4PJO F;  1D3B A;  5GAM g;  5GAN 5;  2XD0 A;  3MHX A;  4E7H A;  1VQ4 A;  4UC4 A;  1Q7Y C;  3M58 A;  3A8G B;  1MHN A;  4HKE A;  2P0Q A;  3DKM A;  1VQK A;  2R5A A;  2OAU A;  4ATO A;  4OP0 A;  2I2L A;  1KC8 C;  1I5L A;  4FM4 B;  4N0A C;  2EWN A;  1I8F A;  1N8R U;  3RMS A;  2EQU A;  3UWN A;  4LDU A;  4PJO A;  2PUO B;  3VJP A;  5CR2 A;  5LJ3 g;  2D0Q B;  3NTK A;  4C8Q A;  4XU0 A;  4JRQ A;  3RMQ A;  2JOY A;  3OYY A;  5LJ5 f;  4RMO A;  4BDZ A;  1KQ2 A;  2LCC A;  2QI2 A;  2EFI A;  4DA4 A;  3GF5 A;  3OBY A;  4M7A E;  2QDY B;  2LT1 A;  3JB9 J;  3CCL T;  2KAF A;  1DJ7 B;  3G7Z A;  1XTD A;  2KVQ G;  4M75 C;  1UB4 A;  5GAO l;  1ZQ1 A;  3QDR B;  2DXB A;  3QPH A;  3SWN A;  3WXM B;  2QQA A;  3CCS A;  4M78 G;  1VQL A;  4PJO C;  1I4K 1;  1YJN A;  2PUK B;  4M78 B;  2ZZD A;  4HT9 A;  4PLL A;  4IKF A;  3MEU A;  5IN1 A;  5GAO m;  5FRM A;  4GY5 A;  1QVG S;  4N0A A;  4PJO D;  1I81 A;  1UEB A;  1M1K C;  4J8O A;  2E70 A;  2KY9 A;  2E10 A;  2VGN A;  4M75 B;  5CKF A;  5FU7 C;  4OVA A;  2P4T A;  5GAN d;  5C0M A;  3CPW S;  4C92 D;  5FRO A;  4M75 E;  1Y96 B;  1UGS B;  4M78 C;  1U1T A;  4BE2 A;  2K5L A;  3OYC A;  1KC8 U;  4YTL A;  3OW2 S;  1VQN T;  3JCM V;  2DXC A;  2FHD A;  2KSS A;  3VYG A;  2CGH A;  2YLB A;  4C0D C;  2E65 A;  5GAN 3;  2QQ9 A;  4LDW A;  4BE1 A;  2RHU A;  2E5Q A;  4WF2 A;  3RES A;  3ZEH A;  2XIC A;  5LJ5 e;  2RHY A;  3RER A;  1G5V A;  3DB3 A;  3FLG A;  1VQ9 T;  2L3R A;  5LJ5 g;  4C0Z A;  2LTO A;  3MO8 A;  4VUB A;  4BDY A;  4B9W A;  2OTJ A;  4L5G A;  3T9N A;  1XQH A;  4IUR A;  2HBP A;  5J39 A;  2K5F A;  3V8J A;  2VUB A;  4JDS A;  2E6Z A;  5CKD A;  5IT9 E;  4PJO E;  2RH2 A;  3L1A A;  2B8A A;  4BI4 A;  3S3O A;  4RKU E;  3CCL A;  4J5Y A;  1Q86 C;  4C8Q E;  3M53 A;  1X6O A;  3OW2 A;  1VQ9 A;  1VQP T;  4FL6 A;  2XG8 D;  4M7A A;  1KQ1 A;  3HRT A;  3ZFJ A;  4EDU A;  4OB2 B;  3CCV A;  2DD5 A;  3UDC A;  1K8A U;  5CCA A;  3F70 A;  4BI8 B;  3RKW A;  3LWH A;  1R8O B;  3QG1 A;  5CQY A;  3OQ5 A;  4C5I A;  4C92 B;  5LL6 S;  3ZBD A;  2MAM A;  1K73 U;  2XU8 A;  2D6F A;  4M7A F;  3OMC A;  2K5I A;  2NLU A;  3JCM g;  1M90 U;  5KCH A;  3C4S A;  4M77 F;  3BDL A;  4C8Q C;  3A8O B;  3X28 B;  2ZPI B;  3LWI A;  4Y28 E;  3CCQ A;  5GAO r;  2L5Q A;  4C5E A;  4O6J A;  2OTL T;  4OGE A;  4BI3 A;  4M75 A;  4XU1 A;  1G3T A;  4J6X A;  2A3L A;  3QZ5 B;  4IUQ A;  1Q81 U;  2LDM A;  4Y91 A;  1IZ6 A;  3VV0 A;  4BAC A;  2DD4 A;  4LD6 A;  1QP2 A;  3HPW A;  5AYF A;  3L2Q A;  3QZ9 B;  4M7D E;  3CCR A;  1MGQ A;  4QVD A;  2X4J A;  4A4G A;  4LDX A;  3PIP A;  4M75 F;  1YJ9 A;  1YIT T;  3CCR T;  2WSE E;  4C5H A;  3J80 E;  1G3W A;  4A4K A;  1Y71 A;  2G3R A;  3OYL A;  4QW2 A;  1VQO T;  1W2B S;  5DLQ E;  4BY6 B;  5GAO p;  2L8D A;  3LH0 A;  3MEW A;  3KBG A;  4F7U F;  4IUP A;  2VXF A;  4L59 A;  4XU3 A;  3JRZ A;  3SD4 A;  5A2Q E;  3L2R A;  2VGM A;  1LNX A;  1BYM A;  2O4X B;  1WJQ A;  2RJF A;  4KUD K;  1WPY A;  4OF1 A;  3SWN C;  3OBW A;  3CCV T;  3JAM E;  2BUD A;  3BW1 A;  2EYQ A;  3PMT A;  3QSU A;  2XDD A;  3MP8 A;  5HK0 A;  1VQ5 T;  5FLX E;  1YJN T;  4M7D G;  3MEV A;  4M7D D;  4A53 A;  5GAN h;  3CD6 A;  3RKY A;  2D9T A;  4R56 A;  1QVF S;  5GAO n;  1B34 A;  2RHX A;  2JTF A;  1BI1 A;  2Y4X A;  3GPL A;  4XQ3 A;  4C92 A;  4JUV A;  1QP3 A;  2Y90 A;  3PTA A;  1UGQ B;  2MWP A;  2L89 A;  3DLM A;  4C92 G;  4A4F A;  3M55 A;  4NS5 A;  5DY9 A;  1XOV A;  3I55 T;  3OYM A;  4A54 A;  4RG8 A;  2WSF E;  4BB7 A;  5CK9 A;  4M77 B;  4HCB A;  3X20 B;  2K2V A;  5LJ5 h;  2EKO A;  3P8H A;  5D6Y A;  2BIV A;  4M77 E;  4M7D A;  2LT4 A;  2DZ9 A;  3V7C A;  3QKJ A;  3CPF A;  5EG2 A;  4P5N A;  3JCM J;  1K9M U;  4C8Q D;  4LD9 K;  1W4S A;  2ZCF B;  2LC4 A;  4ZGE B;  2VYT A;  5I2S A;  4BE0 A;  5IAY A;  4MMK A;  4V2S A;  3V8L A;  1KHC A;  2R58 A;  4J6Y A;  4CI0 C;  2PVO B;  3OS1 A;  5GMK m;  2P0K A;  4ZTF A;  5CKB A;  2JNG A;  1VQL T;  4N4G A;  2KK4 A;  3MEA A;  5HK3 A;  3NFC A;  1TH7 A;  2H3J A;  3G4S A;  2IG0 A;  5LJ3 d;  3OYF A;  2LRQ A;  2JN0 A;  5M9O A;  2LVM A;  2RHZ A;  4KT0 E;  4M78 F;  3CCE A;  1N9R A;  5J26 A;  1S72 T;  4J7I A;  3TCJ A;  1NPP A;  4N4H A;  2DVE A;  1LJO A;  4E47 A;  1Y07 A;  4E7L A;  1N8R C;  3M9Q A;  3BFM A;  3OS5 A;  3TEE A;  4XTU A;  2K3X A;  4EMK B;  3P8B B;  5GAM j;  3VU3 C;  4HCC A;  1JJ2 S;  3G4S T;  2DTH A;  3M5A A;  3EAE A;  3M56 A;  4JLI A;  1V29 B;  3LYI A;  3LLR A;  1UGP B;  1UGR B;  3Q1J A;  2YLC A;  5FU7 B;  5L8R E;  4F7U B;  3QHS A;  5GAN 7;  4R55 A;  2HAX A;  3SB2 A;  2HQX A;  4C92 E;  2EAY A;  3PIO A;  4XTW A;  3L2V A;  4ELZ C;  1B34 B;  5GMK h;  3KXT A;  2QEX A;  3J7A F;  3M57 A;  4DQ2 A;  3CCS T;  3CCQ T;  5GAN f;  2RHI A;  2AHJ B;  3GP8 A;  4FT2 A;  1KD1 C;  1VQ6 T;  3L2U A;  4JRP A;  4PJO G;  3OYA A;  2FVU A;  2FL7 A;  5A0G A;  3TRE A;  2P0P A;  4M77 A;  1VQ6 A;  1U8R A;  2BKD N;  3QXE B;  4M7A G;  1N6A A;  2HNI A;  3CPW A;  3CBO A;  3OYI A;  2RI5 A;  1VQN A;  5KCO A;  1M9S A;  2PVD B;  2XHC A;  2JZ2 A;  4IUU A;  2DXT A;  3PT9 A;  3QO3 A;  4RCB A;  3FC3 A;  5LJ3 j;  1FXX A;  2YHT A;  3I55 A;  1VQ4 T;  1Y96 A;  3E9F A;  4HA8 A;  5CKE A;  5GMK l;  1YJ9 T;  5LJ5 d;  3E9G A;  4J7F A;  1LOJ A;  3FIF A;  4QVZ A;  4X9C A;  5GMK i;  2CZ6 B;  2RA2 A;  1G3Y A;  1NJI U;  3DB4 A;  4KUL A;  2QQB A;  4MZM A;  4XTZ A;  5FRN A;  2MWO A;  1PSF A;  5DM7 R;  2X4Y A;  3FRN A;  3QUI A;  4O5V A;  2HQE A;  3JCM X;  3CCE T;  2QXF A;  3GNG A;  5LJ3 f;  1VQP A;  1VIE A;  5LJ5 j;  2JUF A;  3VUZ A;  2DEQ A;  2KDS A;  2A7Y A;  4N4I A;  1IRE B;  2F69 A;  4C92 C;  2RJE A;  2K4Y A;  5KE3 A;  2V8K A;  2LCL A;  1SSF A;  3A8L B;  3CBP A;  3INZ A;  4Q5W A;  4BD3 A;  4ELY C;  3CXC A;  5GAN g;  3CMA A;  3JCM b;  1VQ5 A;  1OZ3 A;  4RG2 A;  4EMK A;  1H3Z A;  1VQ7 A;  3M4Y A;  3HSB A;  3QBY A;  3O8V A;  4XAX B;  3OSV A;  2M1H A;  2EJF A;  1WJS A;  2R57 A;  5LJ3 e;  2DTI A;  2EIF A;  3ER0 A;  3HP9 A;  4Z02 A;  1EIF A;  3LW5 E;  2RK2 A;  2XDP A;  3R6O A;  3WVD B;  2PVG B;  3S3M A;  5GAN j;  3HKS A;  3L2W A;  3VYH B;  1NPR A;  3E1S A;  2RK1 A;  4MDW A;  3N5B B;  1KQS A;  3OMG A;  5GAM h;  4M75 G;  1NZ9 A;  4ZGJ B;  5GMK j;  1ZBX A;  1BI0 A;  4ZTJ A;  1VQO A;  3SFM A;  1VQK T;  2DIG A;  5GAN 8;  3GIB A;  3JCM f;  1WNL A;  4JRK A;  3DLL A;  2GQV A;  1VQM T;  4C0F A;  1RL2 A;  3CME T;  4A4E A;  3CXC S;  1Y7X A;  3QJY A;  3QJ6 A;  2OTJ T;  1YI2 A;  2ZGW A;  1JRI A;  4LDV A;  2EQK A;  4C8Q G;  1YJW T;  1X75 C;  4EMK C;  5GAM d;  4C8Q B;  3CCU A;  4FU6 A;  2LX9 A;  2Y4Y A;  4NL3 A;  5FU6 B;  2E12 A;  2M16 A;  2E41 A;  2M9U A;  3A8M B;  2EJ9 A;  1HK9 A;  3FB9 A;  1Q81 C;  3OS2 A;  5CQX A;  3JB9 H;  3HFN A;  3S6W A;  1G3S A;  4MZT A;  3CC4 A;  3CD6 T;  1KQS S;  5GAM e;  4JRI A;  3EFR A;  2K3Y A;  4OB1 B;  2F5T X;  3OYJ A;  5GAN 6;  4PKC C;  2CZ1 B;  3LGL A;  5CAI A;  1M8V A;  5CVI A;  3CC4 T;  2RB6 A;  3MCA B;  2CKK A;  4E7K A;  1M5Q 1;  4DOW A;  4M78 D;  1WGS A;  2ZPF B;  1N9S A;  2X4W A;  4DOV A;  1M1F A;  3HHT B;  2DIQ A;  1ZHI A;  4BUG A;  1VQ8 T;  3GOX A;  4M7D B;  1JB0 E;  2VC8 A;  2YRV A;  1KD1 U;  4X9D A;  2GCX A;  1M1K U;  1GXI E;  2VXE A;  1Q86 U;  1HXD A;  4D6W A;  1YBY A;  3PGG A;  2RJC A;  3CCJ T;  4HCZ A;  2R5M A;  2RI2 A;  1M1G A;  3URG A;  4IUT A;  3OYG A;  4JJN K;  4OB3 B;  1FX7 A;  3MET A;  4M77 C;  4C8Q F;  5GAN e;  1WJR A;  5D6W A;  2V8J A;  4PJO B;  2V8I A;  4HT8 A;  5CKH A;  4RCC A;  3L42 A;  3A8H B;  4M7D C;  1VUB A;  1PSE A;  3ASK A;  3BY7 A;  3H6Z A;  4FSX A;  3V8K A;  2FB7 A;  3WVE B;  1YCY A;  2QA4 A;  3RUX A;  3JCM P;  1YHQ T;  5HY6 A;  4PL6 A;  2GFA A;  2X35 A;  1Q7Y U;  4KBM B;  3CCM A;  3X25 B;  4F7U E;  3JCM d;  2C06 A;  1WQ7 A;  2RD1 A;  2PQW A;  2OTL A;  2WAC A;  4GLK A;  1X01 A;  2DK3 A;  3JCM W;  2XKO C;  4M78 A;  3OYE A;  3A5Z B;  2DJZ A;  2E6N A;  3GNF B;  4L6V 5;  3TU4 K;  2KMT A;  1BI2 A;  1H64 1;  4M7A B;  3UT1 A;  3JB9 G;  2GFU A;  3JB9 F;  4EMH A;  4XU2 A;  5CO7 A;  5DLO A;  2RM4 A;  3FEO A;  5GAN 2;  3CBM A;  4ZGD B;  2EJG A;  2JTM A;  3C94 A;  3I56 T;  4ZN3 A;  4OMF B;  2QQR A;  4MML A;  5KE2 A;  5A0D A;  3BDU A;  1K9M C;  2LQK A;  4M7D F;  1QVG A;  1YJW A;  2WSC E;  3HRS A;  2CZ0 B;  4PLI A;  2DZC A;  3CC2 T;  2O01 E;  3VKI A;  3CMA T;  3ME9 A;  3OB9 A;  1NE8 A;  2QQS A;  3HL8 A;  1O75 A;  3H8Z A;  3OS0 A;  1OI1 A;  2KQW A;  2MI6 A;  3C12 A;  1P92 A;  3M59 A;  4LDY A;  3JCM h;  1Q82 C;  3OYB A;  1M90 C;  1KHI A;  3MP6 A;  1K73 C;  4E7J A;  2DO3 A;  5KH6 A;  2E64 A;  3S3N A;  1YHQ A;  2QTX A;  5GAM f;  4FT4 A;  4J6W A;  3PNW C;  4J83 A;  3V7S A;  4ME7 A;  2MMP A;  3V7R A;  4NL2 A;  1NJI C;  5C6S A;  3G71 A;  3NTI A;  1Q82 U;  4II1 A;  3G6E A;  2XID A;  3NTH A;  3QYH B;  4MDX A;  1M4Z A;  1OYX A;  3RKX A;  3QYG B;  3VUB A;  3FJP A;  2DXU A;  4JLG A;  3CC7 T;  1VQ7 T;  1JJ2 A;  4M75 D;  4KUI A;  1RI0 A;  2ZPE B;  5CIU A;  3OYN A;  2QA4 T;  3OYK A;  4BY6 C;  3L2Z A;  3X24 B;  3JCM e;  5GMK e;  3QII A;  3HRU A;  1KG1 A;  2X4X A;  2FYK A;  3AHU A;  4PNO A;  4F7U A;  5HKC A;  2RI3 A;  5LJ3 h;  4C5G A;  4MZP A;  2JVV A;  3CEY A;  2PU9 B;  2O4X A;  1W2B A;  1D3B B;  4M77 G;  4QQ6 A;  3CCU T;  4XTY A;  3X26 B;  4M78 E;  3OYH A;  3CC7 A;  2RJD A;  1YI2 T;  4EPC A;  4M77 D;  1YIJ T;  4OB0 B;  4NOY A;  1XNI A;  2XDB A;  3CCM T;  4M7A D;  1JBM A;  1N27 A;  3OSS C;  3E19 A;  2MF2 A;  3CME A;  1QVP A;  3OYD A;  3CC2 A;  2E1H A;  2EQJ A;  2DPP B;  2EQM A;  3RIR A;  3HFO A;  1K8A C;  5D6X A;  1OZ2 A;  4CRI A;  1BI3 A;  2IVW A;  5A0L A;  3JB9 I;  2M0O A;  2RO0 A;  3MP1 A;  5GAN 4;  1U1S A;  3GLX A;  3KUF A;  3SDZ A;  4C0G A;  4ZN1 A;  2DKG A;  2QEX T;  3OA6 A;  1QVF A;  4B9X A;  2DTO A;  1FWZ A;  2XI9 A;  4XK8 E;  4JS5 A;  3UPU A;  3SWN B;  3LGF A;  4X34 A;  2LNV A;  4C0D B;  2CYZ B;  2ZPH B;  3M4G A;  3JCM c;  2CS7 A;  4IUV A;  4QQG A;  1VQ8 A;  2HD0 A;  1BKB A;  5GAO q;  1O9S A;  3PMI A;  3JSC A;  2F5K A;  5J3B A;  4XTV A;  1BIB A;  1S72 A;  1VQM A;  4M7A C;  1WQW A;  3G71 T;  3PFS A;  2LQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...