4GLKA

Structure and activity of abiq, a lactococcal anti-phage endoribonuclease belonging to the type-iii toxin-antitoxin system
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
165
Chain Sequence
GTLRFFTVTDEYIAYLRKFESKVHYQYENNASTYVGVVLKKNDFNYFIPLLSYNPEKDKAMKKRSRIVTRLFEIGNINNPLGYLLHHNMIPVPDSELIPLPLDLKKPKHKMMQKQLIYMKSISEKIENKSEVVYRKAAHEKDGYYLKFSCDFKLLEAKATLYSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AbiQ
publication title Structure and activity of AbiQ, a lactococcal endoribonuclease belonging to the type III toxin-antitoxin system.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 55
structure length 165
sequence length 168
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4glkA00
4GLKA 4RMOA 4ATOA 2XDDA 2XDBA 2XD0A
chains in the Genus database with same CATH superfamily
4JJDA 2H3EB 3VYHB 1QQJA 2ZZDA 3RKXA 4NL3A 2RQVA 4M7AE 4C8QA 1X69A 3PTAA 2FRWA 1VQ4Q 2JMCA 1C1AA 5GAN7 4JZ3A 2JTFA 3MP6A 1PM3A 2L3RA 3A8HB 4KGXB 2EQMA 4LD9K 1YIJT 2R5AA 1G3WA 1BIAA 5AYFA 1MGQA 2M9UA 2K6DA 1ZX6A 3REBB 2CZ6B 1UB4A 5CIUA 4PL6A 2O01E 1K8AU 4RUGA 4Z88A 4QKUA 4Z89A 1G8XA 2QTVA 2DNUA 1N8RU 2JJ9A 1LVKA 4X34A 1VQ7A 2KROA 5GAMe 3ZBDA 3VJPA 3UPUA 3E9FA 1M8VA 3C4SA 4IUTA 1Q86R 2K5FA 3CCUQ 3A8MB 4ELYC 1D1CA 1WXUA 4PLLA 1W1FA 4LUEA 1R0BG 2DIQA 3MEVA 4F14A 1K9MU 1FMVA 5C6SA 4KUIA 3PVLA 4HVVA 1ACMB 1KQSS 2Y4XA 2KXDA 1TH7A 1Q81C 2Z0WA 1B34B 4XTVA 2XDBA 2OAWA 1WQWA 1JU5C 1MUZA 4VUBA 2EWNA 2OTJT 3DB3A 1ZSZB 5GMKi 2EYYA 1VQ5T 2DD5A 4MDWA 3G6ET 3G71A 3O8VA 2QAZA 4XK8E 1NPRA 1XJWB 5GMKj 1OULA 2ENMA 3ZL7C 2JNGA 3H6ZA 3V8KA 3CC7A 3CCRQ 4RTUA 1VQNQ 1OI1A 4PJOA 3ULRB 1M90U 1QCNA 2MIOA 1GCPA 3CPFA 4X9CA 1GRIA 1LCKA 1S72T 2DILA 2BZXA 3VS4A 1M90R 1WA7A 1QP3A 3CCMA 5GAOn 4NOYA 3UT1A 4CC3A 2KNBB 2XIDA 1DJ7B 4MZPA 1OU9A 1UDLA 2VKNA 2ZAEA 1G5VA 3CQTA 1VQOA 5FROA 1QMCA 3DKMA 3OS2A 3CD6A 3CCSA 2C0TA 3CMEA 3Q1JA 4RTVA 4M7AF 4EPCA 3TEEA 2VYTA 2A3LA 4J7IA 2QEXA 4JS5A 3QWXX 3LH5A 5LJ5j 3PGGA 5CKFA 4ME7A 1KQSP 2NUTA 3RESA 1WI7A 4M77E 1M27C 1PKTA 2WACA 1C0MA 2RI3A 4RTTA 1KD1U 5LJ3j 1PHTA 2NUZA 1JJ2A 1G3YA 1BIBA 1ZBJA 1ZSZC 2E70A 2BKDN 2F1LA 2QG9B 4LDUA 3WXMB 4OMNA 1AWXA 3M55A 3QG1A 4HCBA 4EIKA 1YFNA 2BUDA 4N0AC 4OB0B 2DJZA 2RMOA 4C5IA 4PFOA 3CCEQ 1K73U 3TSZA 2HL5C 2QA4T 3P8DA 4KGVB 1MMAA 4JRIA 1K73R 1G3SA 5KH6A 2QGFB 3JCMQ 2K2MA 3QPHA 1SEMA 4E7JA 1M2VB 2YLCA 1BK2A 5CAIA 1FX7A 2GQIA 1TXQA 3HRUA 2VXEA 1SRMA 2AK5A 4PLIA 2VASA 3GNFB 4ANJA 2V8IA 2K57A 1KC8C 4LUDA 3OW2A 3IQLA 1VQMQ 1SSFA 2E65A 5GAMh 1D3BB 1QP2A 2O2OA 3TQ7P 4ZGEB 1ABOA 4LXCA 5D6WA 1RI0A 1M5Q1 2CUDA 2CZ1B 4QQDA 4DBRA 4O6JA 1K76A 3MEUA 5KYWA 1IB8A 4FYXB 3HFOA 3SHWA 3THKA 4C92G 2GFUA 1D0YA 3V7CA 3E2UA 1VQNT 3UA6A 3I56Q 1GXIE 4NL2A 1VQ5A 2DYBA 4XU2A 3VS6A 1NEGA 1KHIA 4F17A 2VUBA 2DVJA 5GANg 2DXCA 4FL6A 5GAOp 3JB9I 1OV3A 5KYYA 4PK4A 2O9VA 3VV0A 4EMKA 1XNIA 4WF2A 4Y28E 2GBQA 4QVDA 2E41A 2YUQA 2QTXA 2JS0A 2DEQA 3OA6A 4M77F 2M02A 2XICA 2RM4A 2VC8A 2DFUA 3EFOB 2P0QA 3CCLQ 4UC4A 3I55T 1Y0MA 5M9OA 3JSCA 2E3IA 1I5LA 2HSPA 1R8OB 4LN2A 4HXJA 3MEWA 1AWWA 1OPKA 1IZ6A 4DEXA 3CC2A 2K3BA 2XKOC 2AIRB 1X75C 4BY6B 2LCCA 3NPFA 4XU0A 1WHKA 3UATA 2YDLA 4FYVB 2LCSA 1BBZA 2RJDA 2MYSA 1P92A 1RLQC 1FMWA 1BKBA 5L8RE 1QCFA 4O5VA 1BI3A 1NEBA 2RJFA 8ATCB 3SDZA 3A1PA 1VQ4A 1VQ9Q 4QQ6A 2CKKA 3CMAT 5FLXE 2SRCA 2EYXA 1M3CA 2EJFA 3C0CA 3M4GA 4OMFB 1KFZA 1M1KR 3KUFA 4IUPA 2LTOA 1TS9A 3VS1A 3QYGB 1JBMA 1WJQA 3CCJQ 4BACA 2V26A 4M75E 1SPKA 2K5LA 1X6BA 5FU6B 2O88A 4PJNA 2GTJA 2JTMA 5FWCA 4N4HA 5GAOm 3PIPA 2JM8A 1I8FA 4OP0A 5GAN5 3M53A 2EFIA 3ZFJA 2LJ0A 3TSWA 3GPLA 2CDTA 4J8OA 4IUVA 2KK4A 3EGDA 3CCUA 3M0TA 4EDUA 1FWZA 4C8QG 1X2KA 5GAMf 2NLUA 4B9WA 2C06A 1V76A 2YXYA 4RG8A 1SKUB 1NM7A 1XQHA 4FW2A 2YSQA 4A63B 3EFRA 3QDRB 2O4XB 1E7OA 1ZUUA 1KK7A 1BCOA 4K11A 3UF4A 3KBGA 3EG1A 1LPLA 3QWYA 4E7IA 1W2BA 3OMCA 1QKWA 1M4ZA 2I0NA 4CI0C 5GAOq 3M5AA 3A98A 1PWTA 2DZCA 2BZYA 5D6YA 4KUDK 1MV3A 5GAN4 3S3OA 1UHFA 1H92A 2GGRA 4DBHA 2LT1A 2PVDB 2C0IA 3OYBA 3CCRA 1VQNA 5LJ5g 3H0IA 2GFAA 1IXDA 4KT0E 3C95A 1EZZB 1TUCA 2K3XA 4WCIA 3CCVQ 2EAYA 2MAMA 1IREB 1QW1A 4KBMB 2ED1A 1W4SA 2K5IA 3LWHA 3HP9A 2DXBA 2P4TA 2AHJB 2DA9A 2EIFA 5FU6C 3L2WA 2HAXA 1VQ7T 2DAQA 4C92A 2LQWA 5KE3A 1XOVA 3UWNA 4R55A 1RUWA 5CQYA 2M16A 5IHNA 3LGLA 3JCMg 2CT4A 3U23A 1NYFA 4D8KA 2KGTA 1WGSA 1G3TA 1QVFA 2D0NA 3SB2A 1Y07A 1Y57A 5FRNA 2E5QA 2MI6A 4D8DA 3JB9H 4OMQA 1YBYA 3JCMV 2L89A 1TSFA 1MNEA 4WTOB 2DYIA 1ZUKA 4M75F 1B07A 2FG0A 5KYNA 2ZPHB 2GQVA 2F5KA 1VQ9T 3MKDA 4A4EA 1KHCA 3M0QA 5CKHA 2COZA 2ROTA 2D8JA 1S1NA 1VQLQ 4C8QC 3CC7T 4BD3A 1WHJA 3OS0A 4PJOB 4FM4B 2KRNA 3CCEA 3CCMT 5I22A 2DERA 4GY5A 1G83A 2P0PA 2MWPA 2BZ8A 5IT9E 1UJYA 2LZ6B 1VQOT 1AEYA 5D7UA 2ATCB 4C0GA 2F2VA 3RKWA 1VQPQ 2PVOB 2DTHA 4ZGDB 2LJ1A 3CCST 3MP1A 3CMET 3LWIA 2AZVA 4AT1B 3HSBA 4XAXB 2P4RA 1PD0A 1VQMA 3MPUB 1BYMA 3OY9A 1H8KA 2X3XD 2NWMA 4E47A 2CSIA 1OX8A 3CC4Q 4FT2A 1SHFA 5IXFA 1PNJA 2XHCA 4AFZC 3OYIA 4E7LA 3G7ZA 2LMJA 2EKHA 1BI1A 4AFSC 3DLMA 4DEYA 2NUTB 5GANj 1Q7YU 2ZCFB 1H3HA 1LNXA 5GAMj 3I56A 1OOTA 4M78A 1W6XA 2L2PA 4RG2A 1U1TA 5AT1B 2D8HA 3CBPA 4BDZA 4DBQA 2DKGA 4J83A 4P5NA 3VU3C 4PJOC 5IXBA 1UGSB 4ORZA 2DRKA 4BI3A 3AHUA 3VS3A 1JJ2S 2MOXA 2CGHA 3TU4K 2QQAA 3URGA 1QVGA 3M0PA 4QW2A 2R58A 4PJOD 1UE9A 4A4FA 4JPBW 1Q86C 2RD1A 4MMLA 4M7DA 1K8AR 3CCLA 3OYCA 2DTOA 4HCKA 1D1BA 2QASA 1N8RR 4R56A 4A4GA 1I1JA 3V7RA 5GJVB 4PFZA 1NJIU 2CREA 2FPEA 1YJ9Q 4V2SA 3H0FA 1NJIR 2HQEA 5HY6A 3SWNA 2YWWA 1V29B 3O5ZA 4Y92A 1AZGB 2YUPA 3QBYA 3JCMX 1YJWQ 4ZTFA 2JZ2A 1K9MR 2KYBA 2L0AA 4JDSA 5KYWB 5DLQE 2L3SA 2GCXA 4F7UA 2K3YA 6AT1B 2X51A 2E12A 4B9XA 3OW2S 1U8RA 2QI2A 5J26A 1RAGB 1VQ9A 2DL8A 1HSQA 2JOYA 5CKEA 1RAFB 2J6FA 3MHXA 3PMIA 2EW3A 5DM7R 1Q81U 3EHRA 1KQ1A 3SD4A 1M90C 4XU1A 4OGCA 2A7YA 4Z8AA 3QZ9B 5KYYB 3ZEHA 2G6FX 3X25B 1NPPA 4E7ZA 3WVDB 3QZ5B 4EMKB 4ELZC 2E4HA 1JJ2P 4FW1A 4DA4A 2ED0A 3M0UA 4JUVA 4ZNXA 3S3NA 2HSEB 3F70A 1VIEA 1T0HA 2YHTA 4JRQA 1N9RA 2P0KA 3CC2T 4FSXA 3A8OB 2F2WA 3EGUA 5LL6S 2CP7A 1WXTA 2L3PA 2FHDA 2OTLQ 4PNOA 2VWFA 3M57A 5HK3A 3G4SQ 7AT1B 1JB0E 3REAB 2ZPGB 3PFSA 1AWOA 1VYVA 2B8AA 2F5TX 3HL8A 1UTIA 1RADB 2EKOA 1RACB 5IN1A 2DX1A 4RCBA 1OQKA 4RTZA 3MP8A 1VQ4T 3OW2P 3PIOA 1KD1R 2NUPA 4LE9A 3TCJA 1QCOA 4OGEA 2ESWA 2RQRA 2HMAA 5GMKm 2VXFA 3L2VA 3CCVA 4JJNK 5KYXA 2KI7A 3S3MA 3J7AF 1ARKA 5CO7A 4HCZA 2DVEA 2YRDA 5FU7C 2D0QB 5GANd 2RF0A 3L2UA 4ZTJA 1K73C 1O9SA 2D1XA 2HD0A 2QGGA 5GAOl 3PMTA 4FIBA 2QXFA 2X4YA 4EMKC 2L8DA 1EFNA 3CCUT 2XG8D 1WJRA 4PJMA 3EGDB 2XMFA 3NGPA 2DRMA 3JCMJ 1N5ZA 3CEYA 1PRLC 2RHIA 2EQIA 1YJWT 2KYMA 3JB9G 3BY7A 2J05A 2ZPIB 2EJGA 1VQKQ 1TWBA 5LJ3e 1XTDA 1AOJA 2X4WA 5FRMA 3M56A 3I5RA 4M77G 3L2QA 4AFQC 3GP8A 2Y90A 1C6VX 2AT1B 2HZYA 4GLKA 1G2BA 1VQLA 2DZ9A 3CCRT 4J9IA 2E1HA 1UGQB 2O9SA 2RQWA 1YI2Q 1SRLA 3FJPA 1ZA1B 4J9BA 4IIOA 2RI5A 3OQ5A 2B86A 2DM1A 3FRNA 3QO3A 4C5EA 1X2QA 1SSHA 1W2BS 2LRQA 2PZ1A 3VYGA 3C12A 1M8MA 3C94A 2MK5A 1CSKA 2X9HA 4RTWA 5EC7A 5GAMg 3SEMA 3OYFA 4C92B 2LP5A 1VQPA 5CKDA 3HKSA 2PNIA 2JT4A 2DTIA 4DBFA 2CH4A 1K1ZA 1TUDA 4C0DB 1BCMA 1PCXA 3A5ZB 1B3QA 3NTHA 3PNWC 1I81A 2WSEE 1WJSA 1LOJA 4M7AA 3CPWA 3NTIA 2FO0A 2OTLT 1VQ8Q 1TUGB 2CSQA 2DO3A 2LNHB 2FZKB 5I11A 4J9GA 4BUGA 3CC4A 1VQ6Q 3KXTA 2XD0A 3QKJA 1UG1A 1RABB 2YUOA 1KIKA 1M9SA 4LDVA 4XTYA 3EFSA 2KXCA 4HVWA 2V1QA 1I07A 3GNGA 4FYYB 1ZQ1A 1ZSGA 3GOXA 3OS5A 4JS4A 2RK1A 1QVFS 1WIEA 3FB9A 2ZGWA 1YHQQ 1M1KC 3CCQQ 1M1GA 1VYUA 3OMGA 3HPWA 2EJ9A 2ROLA 5LJ5d 4NS5A 3CCET 3OSSC 4KH1B 3QXEB 2DETA 2E64A 1W2BP 3RMQA 3VS2A 1WLPB 3M0SA 3JRZA 4BI8B 1JQQA 1X01A 1UGPB 5LJ3d 1JXOA 3RDVA 3G71Q 4M77C 3X26B 4C92C 2XDPA 4QVZA 2V8KA 3D7SB 4JJCA 3EG9A 1K0SA 4EMGA 2EGEA 2XDDA 3CBMA 4C0DC 4M78G 2RPNA 4DOWA 2QYZA 1MMNA 2CS7A 2OX7A 1VQMT 2FZCB 1YJ9A 1HYOA 1KJWA 1EX4A 4C92D 2CP0A 3CBOA 2EBPA 2YRCA 2CP6A 4FCYA 2DJQA 3E1SA 3INZA 4IUQA 1YJWA 1Y7XA 1E6GA 2V8JA 1MV0B 1QLYA 2RNAA 5C0MA 1Q82U 1Q82R 2DL7A 2JW4A 2K79A 3OYYA 3I56T 4M7DG 2MPXC 2H8HA 1H3ZA 3CXCA 1WX6A 4M78B 5LJ3h 1QVFP 3BW1A 4PJOE 2QK0A 4E7KA 4C8QB 4CRIA 4XTXA 2DL5A 1YITQ 3PT9A 5A0GA 5GAN2 1ZBXA 4M75G 2LC4A 1JO8A 1YJNQ 4BE0A 2XK0A 4HT8A 2RHUA 2RQUA 2RJCA 4OB2B 3LX7A 2JUFA 4M77A 1WXBA 3OB9A 2A08A 4F7UG 3CCLT 1VQ8T 4M7DB 3FDRA 1UUEA 2HCKA 4C8QF 2CZ7B 1GBRA 5KYUA 1VQ6T 2GNCA 2EGCA 3NTKA 1OEBA 2CUBA 3M58A 2FPFA 3VUZA 1U1SA 1MNDA 3E19A 2OTLA 1I0CA 2EPDA 1WHHA 2KVQG 4N4IA 1Y71A 3V8LA 3SWNB 3G4SA 1QVGS 1K4US 1YIJQ 3JCMP 2E6NA 2DBKA 1Q95G 1YN8A 2IIMA 2KSSA 4J9CA 4ESRA 1NYGA 4BI4A 2CP3A 4DQ2A 4GLMA 2VGNA 1YHQT 4F7UB 4J9FA 2HDAA 2VVKA 2LX7A 3J81E 1Z9ZA 3HRSA 5CR2A 3AT1B 3VRYA 1WFWA 2CP5A 2QQSA 4M78C 4HA8A 5D6XA 3CCJT 2I2LA 3V8JA 1UECA 1GCQC 3QJ6A 4A54A 3A8GB 1D1AA 2HQXA 2ZPBB 4EMHA 3X28B 2GF7A 4IURA 1V1CA 4M78D 1X6OA 4J9EA 2OJ2A 3OBYA 4C8QD 2DK3A 3JCMW 2OTJQ 2A37A 1VQ5Q 1WNLA 4M7DC 2QDYB 3H9NA 3G6EQ 3BE3A 4PJLA 1GBQA 1U3OA 2HBWA 2KY9A 5IH2A 4RMOA 4PJOF 1ZA2B 5LJ5f 4M7DD 3HRTA 2DLPA 2HQHA 1VQKA 1S72Q 4BB7A 2K4YA 3SWNC 2MWOA 4PFPA 1QVGP 2CP2A 4M75C 3VUBA 2M0OA 3OYMA 1AZEA 5LJ3f 5A0LA 2RHYA 2RK2A 1OU8A 4OB3B 1Q7YR 2GTOA 2LCLA 3QUIA 3VRZA 1VIFA 4DOVA 2NUPB 2YUNA 4LD6A 1GCQA 2C0OA 3CCVT 2X3WD 3WVEB 1YJNT 1J3TA 5KYXB 4RTYA 5GMKl 1PRMC 1K9AA 3L2ZA 3RUXA 2O31A 3NMZC 2PU9B 1ABQA 2FL7A 1CKBA 2Y4YA 3QHSA 2KBTA 2PUOB 1K8AC 1M2OA 1HD3A 2E6ZA 5CKBA 1N8RC 1MHNA 1BU1A 3RNJA 1U5SA 4RKUE 4RCCA 2PTKA 1OX9A 5J3BA 1FMKA 1VQ8A 2EQKA 3BFMA 5HK0A 1NJIC 2A36A 3JCMb 4OMPA 1M30A 3X20B 5GJWB 2EVRA 2LQKA 4JLGA 1VQ6A 2DL4A 5EG2A 4AG1C 5GANe 2KAFA 5CVIA 1K9MC 5IAYA 4XQ3A 4M75A 3OYDA 2RQTA 1Q86U 1BI2A 2KE9A 2KMTA 2QA4Q 2JM9A 2E5KA 4BE1A 2FEIA 3TVTA 1SG5A 2MCNA 2DPPB 1YCYA 2X35A 3MCAB 4IKFA 3UDCA 1YHQA 1VQLT 3CCQA 2IVWA 4D6WA 1Y96A 4L59A 1IGQA 4M7AG 4ZN3A 3OSVA 1YWOA 2R5MA 4CC7A 4KULA 3MEAA 4FSSA 1D0XA 2RA2A 1KSWA 2PUKB 4L6V5 3CCJA 1PC0A 2A28A 5FU7B 2W10A 2YT6A 3BDLA 3N5BB 1TTHB 3OYAA 1Q81R 1WYXA 1HJDA 1VQPT 3EGXA 3X24B 1MMDA 1UFFA 3RERA 1M3BA 3OYHA 1RAAB 3JB9J 4II1A 1JRIA 3S6WA 3MO8A 4M7AB 4IUUA 1SF9A 3H0HA 3GBQA 5I2MA 1KQ2A 1WQ7A 1VYTA 3CC4T 2RI2A 4JJBA 2K2VA 2JXBA 3H8ZA 1VUBA 2J7IA 4Y91A 3ER0A 3BDUA 5DY9A 3FJ5A 3CPWS 2CZ0B 4J9DA 4E2FB 2CYZB 2LVMA 4HKEA 5GMKe 3JAME 4GBQA 3M0RA 2M51A 1KD1C 4ZN1A 2J06A 3OYLA 3OYJA 1QVPA 4XU3A 3I55Q 1AHJB 2K7AA 1YITA 2V1RA 5KE2A 5GAN8 2L5QA 1Z9QA 3VS5A 4LDWA 3DB4A 9ATCB 3OYEA 4XTWA 1WDXA 2FYKA 2COWA 5ECAA 3OYGA 1YJNA 1RLPC 2OAUA 3I9QA 4C92E 2KT8A 1YWPA 3PVQA 3LLRA 3QIIA 5HKCA 2M0YA 4N4GA 5GAMd 1ZLMA 4MZMA 2FRYA 2F2XA 1I5OB 2W0ZA 3EG9B 1NG2A 4B6MA 5DLOA 1YJ9T 4F04B 1A0NB 3CMAQ 1RAHB 1NLOC 4QQGA 4M7AC 5LJ5e 4RTXA 2X4JA 4AMCA 2QQ9A 2BE9B 5KCOA 1YIJA 2DD4A 2EYQA 2EGAA 3RBBB 1VA7A 4M7AD 5A0DA 2RO0A 1KQSA 3L2RA 2F69A 1NZ9A 4PJJA 2EYZA 2NYSA 1ZHIA 1WHGA 5GANh 3VS7A 2LX9A 3CPWP 1NLPC 1M3AA 4AFUC 4CC2A 1SHGA 1KC8U 5GAN6 3JCMe 3FIFA 4LNPA 2EQJA 1F1BB 3QSUA 4FYWB 3A8LB 1KC8R 1B7TA 2CT3A 2KDSA 3OYKA 1CKAA 4F16A 1B34A 2BTTA 2X4XA 4OMOA 1RAEB 4L5GA 3V7SA 1T0JA 3VS0A 3LH0A 2RHXA 1IHWA 3NFCA 4MDXA 5I2SA 2VGMA 1YCSB 3CXCS 1ZSZA 4JRKA 2OTJA 2VB6A 1UJ0A 5I21A 1NBEB 2LQNA 5FWBA 4M77B 4C0FA 2HNIA 4PKCC 2J6OA 4Z02A 3G6EA 4OMLA 2DIGA 1UHCA 1K0XA 2FZGB 1D0ZA 3TREA 2CH4W 2KQWA 5KYUB 1FXXA 3HTRA 3G1JA 2WSFE 4N0AA 4LDXA 4KH0B 1W70A 3JB9F 3G4ST 2ECZA 2LNVA 1RAIB 2P84A 3HHTB 1S72A 1X6GA 2YRVA 3J80E 2LQ8A 4MZTA 2FPDA 1OZ3A 4JLIA 2RH2A 8AT1B 4C92F 5GAN3 1VQ7Q 2DE0X 4M78E 2DF6A 3R6OA 4HVUA 4C8QE 4C5HA 2DBMA 3OS1A 3EAEA 2KEAA 2KRMA 2ZPEB 3E9GA 2HBPA 1JEGA 3NHNA 2AZSA 4XTUA 1AVZC 4X1VA 2DXTA 1O75A 2LDMA 1TOVA 3H41A 4QVCA 2AKKA 5GMKh 2FVUA 4CC4B 1X43A 2DL3A 1WPYA 3META 2JN0A 3T9NA 3R6NA 2D9TA 2LT4A 4J6XA 1PSEA 4M7DE 1AT1B 2EQUA 3L42A 3RR6A 3RMSA 1QKXA 1UGVA 2R57A 1M1KU 5GAOr 3CXCP 1YNZA 2JS2A 3EH2A 4KRTA 4OVAA 3JB9D 2EYWA 2HKNA 2XU8A 3QDFA 4M4ZA 3CC7Q 1HXDA 1VOMA 4J6WA 3EH1A 3JCMd 1GFDA 4M77D 4C5GA 1VQKT 3DLLA 3GLXA 3M59A 1LJOA 2PQWA 3CCMQ 2QA4A 2IPOB 4F7UE 5GANf 1FYNA 1M2VA 1Q82C 5LJ5h 1VQOQ 1IGUA 3M54A 5CQXA 3CD6Q 1BI0A 3KFVA 3M9QA 1OYXA 5J39A 3CCSQ 1GFCA 3CMEQ 1YI2T 1TG0A 4OF1A 1WHMA 1UGRB 2ABLA 4HCCA 2HL3A 1IO6A 4YTLA 2HKQB 1D3BA 3OBWA 2QEXQ 2BIVA 4BY6C 3FLGA 2RHZA 3I5SA 2JVVA 3EG2A 1AD5A 4Q5WA 2WSCE 4TVRA 2DEUA 3JCMh 2SEMA 1QWFA 4FT4A 2LJ3A 4JZ4A 3QYHB 3P8HA 1WZOA 4E6RA 4J7FA 1JXMA 1T3SA 4A4KA 2QQRA 2H3JA 1PG5B 4M78F 4A4HA 2G3RA 1YP5A 1M1FA 4HT9A 5KCHA 1IHVA 1E6HA 4LDYA 4AG2C 3LYIA 4J6YA 1WHLA 3I35A 1H641 2E3HA 5LJ3g 2D6FA 1BB9A 3JV3A 1QWEA 2L3QA 4M75B 3GIBA 1PKSA 4X9DA 3FEOA 2COYA 4M7DF 3EFOA 2VV5A 2RB6A 1X27A 3FC3A 3CCQT 2DMOA 3I55A 4E7HA 1EIFA 1Y96B 4J5YA 1HK9A 4OB1B 4PJOG 3LW5E 5FW9A 1U06A 2A0FB 2RJEA 4BE2A 1PD1A 1KG1A 2XI9A 4A53A 4OMMA 5CK9A 3EG3A 1OZ2A 3HFNA 3L1AA 4R0KA 3VKIA 2M1HA 3SFMA 3JCMc 4BDYA 2FB7A 3QJYA 4FU6A 3G71T 3RIRA 5IHIA 4MMKA 2BE7D 2KR3A 4F7UF 3EGXB 1UEBA 2QQBA 1IRXA 2KT1A 2HEQA 2JTEA 5A2QE 2DXUA 3ME9A 2AKLA 3CMAA 2OI3A 3UA7A 2J6KA 4C0ZA 2MMPA 3PE0A 1AWJA 2MF2A 2IG0A 4QT7A 1PSFA 1OPLA 2YLBA 3P8BB 2JMAA 1D09B 2RN8A 2E10A 2QDLA 3EHQA 1ZUYA 3CD6T 3MJXA 3LGFA 4J9HA 4ZGJB 4IIMA 3RKYA 1N27A 1Q7YC 1N9SA 5L23A 4E7SA 1RI9A 4M75D 1N6AA 2QEXT 1NE8A 1YITT 1I4K1 4JRPA 1MMGA 1R0CB 1YI2A 2PVGB 4KGZB 3CC2Q 4XTZA 3JCMf 4ATOA 1GL5A 2O4XA 3EG0A 3GF5A 3OYNA 2KRSA 3ASKA 2ZPFB 1RL2A 5HCKA 1R77A 5IHKA 5CCAA 1TU0B 2K9GA 1T3LA 3M4YA
chains in the Genus database with same CATH topology
3HP9A 2DXBA 2P4TA 4BUGA 4ZN1A 2AHJB 3OYLA 3OYJA 1QVPA 2EIFA 4XU3A 5FU6C 3L2WA 3KXTA 2HAXA 3CC4A 3VYHB 1AHJB 2ZZDA 3RKXA 4NL3A 1VQ7T 2XD0A 2DAQA 4C8QA 1YITA 4M7AE 3QKJA 5KE2A 4C92A 5KE3A 5GAN8 1XOVA 3PTAA 2L5QA 3UWNA 4R55A 1M9SA 4LDWA 5GAN7 4LDVA 5CQYA 3DB4A 4XTYA 3OYEA 3EFSA 4XTWA 2FYKA 2M16A 2JTFA 3MP6A 1YJNA 3OYGA 3A8HB 2L3RA 3GNGA 3LGLA 2EQMA 4LD9K 3JCMg 1ZQ1A 2OAUA 4C92E 3GOXA 2R5AA 3OS5A 1YIJT 1G3WA 4JS4A 1BIAA 2RK1A 5AYFA 1QVFS 1MGQA 3FB9A 3LLRA 1WGSA 2M9UA 1G3TA 2ZGWA 1QVFA 2CZ6B 1UB4A 3QIIA 5CIUA 3SB2A 5HKCA 1Y07A 2O01E 4PL6A 1K8AU 1M1KC 5FRNA 2E5QA 2MI6A 4N4GA 5GAMd 1M1GA 1N8RU 4MZMA 3JB9H 4X34A 1YBYA 3OMGA 2L89A 3JCMV 1VQ7A 3HPWA 2EJ9A 5GAMe 3ZBDA 4M75F 3VJPA 5LJ5d 5DLOA 4NS5A 1YJ9T 3CCET 3OSSC 3UPUA 3E9FA 1M8VA 3C4SA 4IUTA 2K5FA 2ZPHB 3A8MB 3QXEB 4ELYC 4QQGA 4PLLA 4M7AC 2GQVA 2F5KA 5LJ5e 2X4JA 2E64A 1VQ9T 2QQ9A 5KCOA 4A4EA 3RMQA 1KHCA 5CKHA 1YIJA 2DD4A 3JRZA 4BI8B 2DIQA 2EYQA 3MEVA 1X01A 1UGPB 1K9MU 5LJ3d 5C6SA 4KUIA 4M77C 4C8QC 3X26B 3CC7T 4BD3A 4M7AD 4C92C 5A0DA 2XDPA 4QVZA 2RO0A 1KQSS 2V8KA 2Y4XA 3OS0A 1KQSA 1TH7A 1Q81C 4EMGA 3L2RA 1B34B 1NZ9A 2F69A 4FM4B 3CBMA 4XTVA 2XDDA 2XDBA 4C0DC 1ZHIA 4M78G 1WQWA 4DOWA 2CS7A 1VQMT 5GANh 3CCEA 2LX9A 3CCMT 1YJ9A 4VUBA 2OTJT 2EWNA 3DB3A 4C92D 4GY5A 2P0PA 3CBOA 5GMKi 1KC8U 2MWPA 5GAN6 3JCMe 1VQ5T 2DD5A 3FIFA 4MDWA 5IT9E 3E1SA 3INZA 2EQJA 3G6ET 3G71A 1VQOT 3QSUA 3O8VA 4IUQA 1YJWA 1Y7XA 2V8JA 3A8LB 4XK8E 4C0GA 1NPRA 5GMKj 2KDSA 3OYKA 2JNGA 3RKWA 5C0MA 2PVOB 3H6ZA 3V8KA 3CC7A 2DTHA 4ZGDB 1Q82U 3CCST 3MP1A 3CMET 1OI1A 4PJOA 1B34A 2X4XA 3LWIA 1M90U 3CPFA 4L5GA 3V7SA 3LH0A 4X9CA 2RHXA 3NFCA 1S72T 3HSBA 4XAXB 3OYYA 3I56T 4M7DG 4MDXA 1VQMA 5I2SA 1QP3A 3CCMA 2VGMA 5GAOn 4NOYA 3UT1A 3CXCS 4JRKA 3OY9A 2OTJA 1BYMA 1H3ZA 3CXCA 5LJ3h 4M78B 5I21A 3BW1A 4E47A 1DJ7B 2XIDA 4MZPA 4M77B 4C0FA 4E7KA 2HNIA 4C8QB 4PJOE 4PKCC 4FT2A 4CRIA 4Z02A 1G5VA 4XTXA 3G6EA 2DIGA 2XHCA 5FROA 3OYIA 1VQOA 4E7LA 3G7ZA 3PT9A 3TREA 3DKMA 2KQWA 1BI1A 5A0GA 3DLMA 1FXXA 3OS2A 5GAN2 5GANj 3CD6A 1ZBXA 1Q7YU 2WSFE 4M75G 4N0AA 4LDXA 2LC4A 3CCSA 3CMEA 4BE0A 3JB9F 2ZCFB 2XK0A 3G4ST 4HT8A 3Q1JA 4M7AF 2RHUA 1LNXA 2LNVA 4EPCA 3HHTB 5GAMj 2YRVA 1S72A 3TEEA 3I56A 2VYTA 2A3LA 2RJCA 3J80E 4J7IA 4OB2B 3LX7A 4M78A 2QEXA 2LQ8A 4MZTA 2JUFA 4M77A 4JS5A 3OB9A 4RG2A 1U1TA 4F7UG 3CCLT 1VQ8T 1OZ3A 3FDRA 3PGGA 5CKFA 5LJ5j 2OTLA 4M7DB 3CBPA 4JLIA 2RH2A 2CZ7B 4C8QF 4BDZA 4C92F 5GAN3 4ME7A 2DKGA 1VQ6T 4J83A 4P5NA 4M78E 3VU3C 3NTKA 3RESA 3R6OA 4PJOC 4M77E 4C8QE 4C5HA 3M58A 1UGSB 3OS1A 2WACA 2RI3A 3EAEA 4BI3A 1KD1U 3AHUA 3VUZA 1U1SA 3E19A 5LJ3j 2ZPEB 3E9GA 2HBPA 1JJ2S 2CGHA 3TU4K 4N4IA 1G3YA 2KVQG 1Y71A 2QQAA 3SWNB 3V8LA 3G4SA 3URGA 1JJ2A 1QVGS 1BIBA 4KBMB 1QVGA 3JCMP 2E6NA 4QW2A 2R58A 2E70A 4PJOD 4XTUA 4A4FA 1Q86C 2BKDN 2RD1A 4MMLA 2DXTA 1O75A 2LDMA 4M7DA 2KSSA 4QVCA 4LDUA 3CCLA 4BI4A 2DTOA 5GMKh 3OYCA 2FVUA 3WXMB 4R56A 4A4GA 3M55A 3QG1A 1WPYA 3META 3V7RA 2VGNA 4DQ2A 2JN0A 1YHQT 4HCBA 3T9NA 2D9TA 4F7UB 2LT4A 4J6XA 1NJIU 2BUDA 4N0AC 4OB0B 1PSEA 4M7DE 2DJZA 4C5IA 4V2SA 1K73U 2EQUA 3L42A 2HQEA 3RMSA 3P8DA 5HY6A 3HRSA 5CR2A 3J81E 3SWNA 2R57A 2QA4T 1M1KU 5GAOr 1V29B 2QQSA 4JRIA 1G3SA 5KH6A 4M78C 3JCMQ 4HA8A 4OVAA 5D6XA 3CCJT 3JB9D 2I2LA 3QPHA 3V8JA 4A54A 3QBYA 3QJ6A 4E7JA 3JCMX 3A8GB 2YLCA 4ZTFA 2JZ2A 2HQXA 5CAIA 4JDSA 1FX7A 2ZPBB 5DLQE 4EMHA 3X28B 2XU8A 3HRUA 2VXEA 2GF7A 4IURA 1VQKT 4PJOB 2GCXA 1HXDA 4PLIA 3GNFB 4F7UA 2K3YA 4J6WA 2V8IA 4M78D 1X6OA 3JCMd 4M77D 3OBYA 2E12A 4B9XA 2K57A 4C8QD 4C5GA 3DLLA 3OW2S 1U8RA 3GLXA 2QI2A 3M59A 3OW2A 1KC8C 5J26A 2DK3A 1VQ9A 1LJOA 2JOYA 2PQWA 3JCMW 1SSFA 5CKEA 2E65A 5GAMh 1D3BB 2QA4A 1QP2A 4F7UE 4ZGEB 5GANf 3MHXA 5D6WA 1RI0A 1M5Q1 3PMIA 1WNLA 2CZ1B 1Q82C 4M7DC 4QQDA 2QDYB 4O6JA 5LJ5h 3MEUA 5DM7R 1Q81U 1KQ1A 3SD4A 1M90C 4XU1A 3M54A 4OGCA 3HFOA 5CQXA 4C92G 2GFUA 3V7CA 2KY9A 2A7YA 4RMOA 1BI0A 3M9QA 1OYXA 3QZ9B 4PJOF 5J39A 3ZEHA 3X25B 1NPPA 1YI2T 3WVDB 3QZ5B 5LJ5f 4M7DD 4OF1A 3HRTA 4ELZC 4EMKB 1UGRB 1VQKA 1VQNT 4HCCA 4BB7A 2K4YA 3SWNC 4DA4A 2MWOA 1GXIE 4NL2A 4YTLA 1D3BA 1VQ5A 4M75C 4XU2A 3VUBA 3OBWA 2M0OA 3OYMA 2BIVA 4JUVA 5GAOl 1KHIA 4BY6C 3S3NA 3FLGA 2VUBA 2RHZA 3F70A 1VIEA 2JVVA 5LJ3f 4Q5WA 2YHTA 2WSCE 5GANg 4TVRA 5A0LA 2RHYA 2RK2A 2DXCA 4FL6A 5GAOp 3JCMh 4JRQA 3JB9I 1N9RA 2P0KA 4FT4A 3CC2T 4OB3B 4FSXA 3A8OB 5LL6S 3QYHB 2LCLA 3QUIA 3VV0A 4EMKA 1VIFA 2FHDA 3P8HA 4PNOA 1XNIA 3M57A 4WF2A 4Y28E 4DOVA 5HK3A 4J7FA 4LD6A 4QVDA 2E41A 4A4KA 2QQRA 1JB0E 3CCVT 2QTXA 3WVEB 2H3JA 1YJNT 4M78F 4A4HA 2ZPGB 2G3RA 2DEQA 3OA6A 4M77F 3PFSA 1M1FA 4HT9A 2B8AA 2RM4A 2VC8A 2XICA 5KCHA 5GMKl 2F5TX 4LDYA 3HL8A 3L2ZA 2P0QA 3LYIA 4UC4A 3I55T 4J6YA 5M9OA 3JSCA 2EKOA 3RUXA 1I5LA 2PU9B 1R8OB 2FL7A 5IN1A 3MEWA 2Y4YA 4RCBA 1H641 3MP8A 5LJ3g 3QHSA 1VQ4T 1IZ6A 2PUOB 1K8AC 2D6FA 2E6ZA 3CC2A 3PIOA 2XKOC 5CKBA 4M75B 1N8RC 3GIBA 1MHNA 1X75C 4BY6B 3TCJA 4OGEA 2LCCA 4X9DA 4RKUE 4RCCA 5GMKm 5J3BA 2VXFA 3FEOA 3L2VA 3CCVA 4XU0A 4JJNK 3S3MA 2EQKA 1VQ8A 3BFMA 3J7AF 5CO7A 5HK0A 4M7DF 1NJIC 4HCZA 2DVEA 2VV5A 5FU7C 2D0QB 2RB6A 3FC3A 3JCMb 5GANd 3CCQT 2RJDA 3X20B 1P92A 2LQKA 4JLGA 3L2UA 4ZTJA 1VQ6A 1K73C 3I55A 4E7HA 1EIFA 1BKBA 1Y96B 1O9SA 5L8RE 5EG2A 4J5YA 2HD0A 4O5VA 5GANe 1HK9A 2KAFA 3PMTA 4OB1B 4FIBA 3LW5E 5CVIA 2QXFA 4PJOG 1BI3A 1K9MC 2X4YA 5IAYA 2RJFA 3SDZA 4XQ3A 4EMKC 2RJEA 1VQ4A 2L8DA 4M75A 4BE2A 4QQ6A 3OYDA 2CKKA 3CMAT 1KG1A 2XI9A 5FLXE 2XG8D 1WJRA 3CCUT 1BI2A 1Q86U 2EJFA 4OMFB 2KMTA 3M4GA 4A53A 3KUFA 4IUPA 5CK9A 4BE1A 1OZ2A 2LTOA 3HFNA 3L1AA 3QYGB 1JBMA 1WJQA 3VKIA 4BACA 2M1HA 3SFMA 3JCMc 2DPPB 4BDYA 1YCYA 2FB7A 2X35A 4M75E 3MCAB 4IKFA 3JCMJ 2K5LA 3QJYA 3CEYA 4FU6A 5FU6B 3UDCA 3G71T 1YHQA 1VQLT 2RHIA 3RIRA 1YJWT 3CCQA 2IVWA 2JTMA 4D6WA 1Y96A 4L59A 4N4HA 4MMKA 5GAOm 4F7UF 3JB9G 3PIPA 3BY7A 1UEBA 2QQBA 4M7AG 4ZN3A 2ZPIB 1I8FA 2EJGA 3OSVA 4OP0A 2R5MA 3M53A 5GAN5 5A2QE 2DXUA 5LJ3e 1XTDA 2EFIA 3ZFJA 3GPLA 4KULA 3MEAA 2X4WA 3ME9A 4J8OA 4IUVA 2RA2A 2KK4A 2PUKB 4L6V5 3CMAA 3CCJA 3CCUA 4EDUA 5FU7B 5FRMA 3M56A 1FWZA 4M77G 4C8QG 4C0ZA 2NLUA 2MMPA 3BDLA 5GAMf 3L2QA 3GP8A 2Y90A 3N5BB 4B9WA 2C06A 2MF2A 4RG8A 2IG0A 3OYAA 1PSFA 1VQPT 2YLBA 4GLKA 3P8BB 1XQHA 1VQLA 2DZ9A 2E10A 3X24B 3CCRT 2E1HA 1UGQB 3RERA 3EFRA 3QDRB 3OYHA 2O4XB 3JB9J 3FJPA 3CD6T 4II1A 1JRIA 3LGFA 2RI5A 3OQ5A 4ZGJB 3FRNA 3S6WA 3KBGA 3MO8A 3QO3A 4M7AB 4IUUA 3RKYA 1N27A 4C5EA 1Q7YC 1N9SA 5I2MA 1KQ2A 1W2BS 1WQ7A 2LRQA 3VYGA 4E7IA 3CC4T 3OMCA 3C12A 3C94A 1W2BA 4M75D 1N6AA 2RI2A 1NE8A 2QEXT 1M4ZA 1YITT 4CI0C 5GAOq 1I4K1 4JRPA 3M5AA 2K2VA 2DZCA 5GAMg 5D6YA 3OYFA 4KUDK 4C92B 5GAN4 1YI2A 1VQPA 2PVGB 3HKSA 5CKDA 3H8ZA 3S3OA 4XTZA 3JCMf 4ATOA 1VUBA 2DTIA 2LT1A 2PVDB 3OYBA 3CCRA 1VQNA 2O4XA 4Y91A 3GF5A 5LJ5g 2GFAA 3BDUA 3ER0A 4C0DB 3A5ZB 4KT0E 5DY9A 3NTHA 3OYNA 3C95A 3PNWC 1I81A 3CPWS 2WSEE 1WJSA 3ASKA 1LOJA 2ZPFB 4M7AA 3CPWA 2CZ0B 1RL2A 2K3XA 3NTIA 2OTLT 2EAYA 2MAMA 2CYZB 1IREB 2LVMA 4HKEA 5CCAA 2DO3A 1QW1A 5GMKe 3JAME 3M4YA 1W4SA 1KD1C 2K5IA 3LWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLK A;  4RMO A;  4ATO A;  2XDD A;  2XDB A;  2XD0 A; 
#chains in the Genus database with same CATH topology
 4JJD A;  2H3E B;  3VYH B;  1QQJ A;  2ZZD A;  3RKX A;  4NL3 A;  2RQV A;  4M7A E;  4C8Q A;  1X69 A;  3PTA A;  2FRW A;  1VQ4 Q;  2JMC A;  1C1A A;  5GAN 7;  4JZ3 A;  2JTF A;  3MP6 A;  1PM3 A;  2L3R A;  3A8H B;  4KGX B;  2EQM A;  4LD9 K;  1YIJ T;  2R5A A;  1G3W A;  1BIA A;  5AYF A;  1MGQ A;  2M9U A;  2K6D A;  1ZX6 A;  3REB B;  2CZ6 B;  1UB4 A;  5CIU A;  4PL6 A;  2O01 E;  1K8A U;  4RUG A;  4Z88 A;  4QKU A;  4Z89 A;  1G8X A;  2QTV A;  2DNU A;  1N8R U;  2JJ9 A;  1LVK A;  4X34 A;  1VQ7 A;  2KRO A;  5GAM e;  3ZBD A;  3VJP A;  3UPU A;  3E9F A;  1M8V A;  3C4S A;  4IUT A;  1Q86 R;  2K5F A;  3CCU Q;  3A8M B;  4ELY C;  1D1C A;  1WXU A;  4PLL A;  1W1F A;  4LUE A;  1R0B G;  2DIQ A;  3MEV A;  4F14 A;  1K9M U;  1FMV A;  5C6S A;  4KUI A;  3PVL A;  4HVV A;  1ACM B;  1KQS S;  2Y4X A;  2KXD A;  1TH7 A;  1Q81 C;  2Z0W A;  1B34 B;  4XTV A;  2XDB A;  2OAW A;  1WQW A;  1JU5 C;  1MUZ A;  4VUB A;  2EWN A;  2OTJ T;  3DB3 A;  1ZSZ B;  5GMK i;  2EYY A;  1VQ5 T;  2DD5 A;  4MDW A;  3G6E T;  3G71 A;  3O8V A;  2QAZ A;  4XK8 E;  1NPR A;  1XJW B;  5GMK j;  1OUL A;  2ENM A;  3ZL7 C;  2JNG A;  3H6Z A;  3V8K A;  3CC7 A;  3CCR Q;  4RTU A;  1VQN Q;  1OI1 A;  4PJO A;  3ULR B;  1M90 U;  1QCN A;  2MIO A;  1GCP A;  3CPF A;  4X9C A;  1GRI A;  1LCK A;  1S72 T;  2DIL A;  2BZX A;  3VS4 A;  1M90 R;  1WA7 A;  1QP3 A;  3CCM A;  5GAO n;  4NOY A;  3UT1 A;  4CC3 A;  2KNB B;  2XID A;  1DJ7 B;  4MZP A;  1OU9 A;  1UDL A;  2VKN A;  2ZAE A;  1G5V A;  3CQT A;  1VQO A;  5FRO A;  1QMC A;  3DKM A;  3OS2 A;  3CD6 A;  3CCS A;  2C0T A;  3CME A;  3Q1J A;  4RTV A;  4M7A F;  4EPC A;  3TEE A;  2VYT A;  2A3L A;  4J7I A;  2QEX A;  4JS5 A;  3QWX X;  3LH5 A;  5LJ5 j;  3PGG A;  5CKF A;  4ME7 A;  1KQS P;  2NUT A;  3RES A;  1WI7 A;  4M77 E;  1M27 C;  1PKT A;  2WAC A;  1C0M A;  2RI3 A;  4RTT A;  1KD1 U;  5LJ3 j;  1PHT A;  2NUZ A;  1JJ2 A;  1G3Y A;  1BIB A;  1ZBJ A;  1ZSZ C;  2E70 A;  2BKD N;  2F1L A;  2QG9 B;  4LDU A;  3WXM B;  4OMN A;  1AWX A;  3M55 A;  3QG1 A;  4HCB A;  4EIK A;  1YFN A;  2BUD A;  4N0A C;  4OB0 B;  2DJZ A;  2RMO A;  4C5I A;  4PFO A;  3CCE Q;  1K73 U;  3TSZ A;  2HL5 C;  2QA4 T;  3P8D A;  4KGV B;  1MMA A;  4JRI A;  1K73 R;  1G3S A;  5KH6 A;  2QGF B;  3JCM Q;  2K2M A;  3QPH A;  1SEM A;  4E7J A;  1M2V B;  2YLC A;  1BK2 A;  5CAI A;  1FX7 A;  2GQI A;  1TXQ A;  3HRU A;  2VXE A;  1SRM A;  2AK5 A;  4PLI A;  2VAS A;  3GNF B;  4ANJ A;  2V8I A;  2K57 A;  1KC8 C;  4LUD A;  3OW2 A;  3IQL A;  1VQM Q;  1SSF A;  2E65 A;  5GAM h;  1D3B B;  1QP2 A;  2O2O A;  3TQ7 P;  4ZGE B;  1ABO A;  4LXC A;  5D6W A;  1RI0 A;  1M5Q 1;  2CUD A;  2CZ1 B;  4QQD A;  4DBR A;  4O6J A;  1K76 A;  3MEU A;  5KYW A;  1IB8 A;  4FYX B;  3HFO A;  3SHW A;  3THK A;  4C92 G;  2GFU A;  1D0Y A;  3V7C A;  3E2U A;  1VQN T;  3UA6 A;  3I56 Q;  1GXI E;  4NL2 A;  1VQ5 A;  2DYB A;  4XU2 A;  3VS6 A;  1NEG A;  1KHI A;  4F17 A;  2VUB A;  2DVJ A;  5GAN g;  2DXC A;  4FL6 A;  5GAO p;  3JB9 I;  1OV3 A;  5KYY A;  4PK4 A;  2O9V A;  3VV0 A;  4EMK A;  1XNI A;  4WF2 A;  4Y28 E;  2GBQ A;  4QVD A;  2E41 A;  2YUQ A;  2QTX A;  2JS0 A;  2DEQ A;  3OA6 A;  4M77 F;  2M02 A;  2XIC A;  2RM4 A;  2VC8 A;  2DFU A;  3EFO B;  2P0Q A;  3CCL Q;  4UC4 A;  3I55 T;  1Y0M A;  5M9O A;  3JSC A;  2E3I A;  1I5L A;  2HSP A;  1R8O B;  4LN2 A;  4HXJ A;  3MEW A;  1AWW A;  1OPK A;  1IZ6 A;  4DEX A;  3CC2 A;  2K3B A;  2XKO C;  2AIR B;  1X75 C;  4BY6 B;  2LCC A;  3NPF A;  4XU0 A;  1WHK A;  3UAT A;  2YDL A;  4FYV B;  2LCS A;  1BBZ A;  2RJD A;  2MYS A;  1P92 A;  1RLQ C;  1FMW A;  1BKB A;  5L8R E;  1QCF A;  4O5V A;  1BI3 A;  1NEB A;  2RJF A;  8ATC B;  3SDZ A;  3A1P A;  1VQ4 A;  1VQ9 Q;  4QQ6 A;  2CKK A;  3CMA T;  5FLX E;  2SRC A;  2EYX A;  1M3C A;  2EJF A;  3C0C A;  3M4G A;  4OMF B;  1KFZ A;  1M1K R;  3KUF A;  4IUP A;  2LTO A;  1TS9 A;  3VS1 A;  3QYG B;  1JBM A;  1WJQ A;  3CCJ Q;  4BAC A;  2V26 A;  4M75 E;  1SPK A;  2K5L A;  1X6B A;  5FU6 B;  2O88 A;  4PJN A;  2GTJ A;  2JTM A;  5FWC A;  4N4H A;  5GAO m;  3PIP A;  2JM8 A;  1I8F A;  4OP0 A;  5GAN 5;  3M53 A;  2EFI A;  3ZFJ A;  2LJ0 A;  3TSW A;  3GPL A;  2CDT A;  4J8O A;  4IUV A;  2KK4 A;  3EGD A;  3CCU A;  3M0T A;  4EDU A;  1FWZ A;  4C8Q G;  1X2K A;  5GAM f;  2NLU A;  4B9W A;  2C06 A;  1V76 A;  2YXY A;  4RG8 A;  1SKU B;  1NM7 A;  1XQH A;  4FW2 A;  2YSQ A;  4A63 B;  3EFR A;  3QDR B;  2O4X B;  1E7O A;  1ZUU A;  1KK7 A;  1BCO A;  4K11 A;  3UF4 A;  3KBG A;  3EG1 A;  1LPL A;  3QWY A;  4E7I A;  1W2B A;  3OMC A;  1QKW A;  1M4Z A;  2I0N A;  4CI0 C;  5GAO q;  3M5A A;  3A98 A;  1PWT A;  2DZC A;  2BZY A;  5D6Y A;  4KUD K;  1MV3 A;  5GAN 4;  3S3O A;  1UHF A;  1H92 A;  2GGR A;  4DBH A;  2LT1 A;  2PVD B;  2C0I A;  3OYB A;  3CCR A;  1VQN A;  5LJ5 g;  3H0I A;  2GFA A;  1IXD A;  4KT0 E;  3C95 A;  1EZZ B;  1TUC A;  2K3X A;  4WCI A;  3CCV Q;  2EAY A;  2MAM A;  1IRE B;  1QW1 A;  4KBM B;  2ED1 A;  1W4S A;  2K5I A;  3LWH A;  3HP9 A;  2DXB A;  2P4T A;  2AHJ B;  2DA9 A;  2EIF A;  5FU6 C;  3L2W A;  2HAX A;  1VQ7 T;  2DAQ A;  4C92 A;  2LQW A;  5KE3 A;  1XOV A;  3UWN A;  4R55 A;  1RUW A;  5CQY A;  2M16 A;  5IHN A;  3LGL A;  3JCM g;  2CT4 A;  3U23 A;  1NYF A;  4D8K A;  2KGT A;  1WGS A;  1G3T A;  1QVF A;  2D0N A;  3SB2 A;  1Y07 A;  1Y57 A;  5FRN A;  2E5Q A;  2MI6 A;  4D8D A;  3JB9 H;  4OMQ A;  1YBY A;  3JCM V;  2L89 A;  1TSF A;  1MNE A;  4WTO B;  2DYI A;  1ZUK A;  4M75 F;  1B07 A;  2FG0 A;  5KYN A;  2ZPH B;  2GQV A;  2F5K A;  1VQ9 T;  3MKD A;  4A4E A;  1KHC A;  3M0Q A;  5CKH A;  2COZ A;  2ROT A;  2D8J A;  1S1N A;  1VQL Q;  4C8Q C;  3CC7 T;  4BD3 A;  1WHJ A;  3OS0 A;  4PJO B;  4FM4 B;  2KRN A;  3CCE A;  3CCM T;  5I22 A;  2DER A;  4GY5 A;  1G83 A;  2P0P A;  2MWP A;  2BZ8 A;  5IT9 E;  1UJY A;  2LZ6 B;  1VQO T;  1AEY A;  5D7U A;  2ATC B;  4C0G A;  2F2V A;  3RKW A;  1VQP Q;  2PVO B;  2DTH A;  4ZGD B;  2LJ1 A;  3CCS T;  3MP1 A;  3CME T;  3LWI A;  2AZV A;  4AT1 B;  3HSB A;  4XAX B;  2P4R A;  1PD0 A;  1VQM A;  3MPU B;  1BYM A;  3OY9 A;  1H8K A;  2X3X D;  2NWM A;  4E47 A;  2CSI A;  1OX8 A;  3CC4 Q;  4FT2 A;  1SHF A;  5IXF A;  1PNJ A;  2XHC A;  4AFZ C;  3OYI A;  4E7L A;  3G7Z A;  2LMJ A;  2EKH A;  1BI1 A;  4AFS C;  3DLM A;  4DEY A;  2NUT B;  5GAN j;  1Q7Y U;  2ZCF B;  1H3H A;  1LNX A;  5GAM j;  3I56 A;  1OOT A;  4M78 A;  1W6X A;  2L2P A;  4RG2 A;  1U1T A;  5AT1 B;  2D8H A;  3CBP A;  4BDZ A;  4DBQ A;  2DKG A;  4J83 A;  4P5N A;  3VU3 C;  4PJO C;  5IXB A;  1UGS B;  4ORZ A;  2DRK A;  4BI3 A;  3AHU A;  3VS3 A;  1JJ2 S;  2MOX A;  2CGH A;  3TU4 K;  2QQA A;  3URG A;  1QVG A;  3M0P A;  4QW2 A;  2R58 A;  4PJO D;  1UE9 A;  4A4F A;  4JPB W;  1Q86 C;  2RD1 A;  4MML A;  4M7D A;  1K8A R;  3CCL A;  3OYC A;  2DTO A;  4HCK A;  1D1B A;  2QAS A;  1N8R R;  4R56 A;  4A4G A;  1I1J A;  3V7R A;  5GJV B;  4PFZ A;  1NJI U;  2CRE A;  2FPE A;  1YJ9 Q;  4V2S A;  3H0F A;  1NJI R;  2HQE A;  5HY6 A;  3SWN A;  2YWW A;  1V29 B;  3O5Z A;  4Y92 A;  1AZG B;  2YUP A;  3QBY A;  3JCM X;  1YJW Q;  4ZTF A;  2JZ2 A;  1K9M R;  2KYB A;  2L0A A;  4JDS A;  5KYW B;  5DLQ E;  2L3S A;  2GCX A;  4F7U A;  2K3Y A;  6AT1 B;  2X51 A;  2E12 A;  4B9X A;  3OW2 S;  1U8R A;  2QI2 A;  5J26 A;  1RAG B;  1VQ9 A;  2DL8 A;  1HSQ A;  2JOY A;  5CKE A;  1RAF B;  2J6F A;  3MHX A;  3PMI A;  2EW3 A;  5DM7 R;  1Q81 U;  3EHR A;  1KQ1 A;  3SD4 A;  1M90 C;  4XU1 A;  4OGC A;  2A7Y A;  4Z8A A;  3QZ9 B;  5KYY B;  3ZEH A;  2G6F X;  3X25 B;  1NPP A;  4E7Z A;  3WVD B;  3QZ5 B;  4EMK B;  4ELZ C;  2E4H A;  1JJ2 P;  4FW1 A;  4DA4 A;  2ED0 A;  3M0U A;  4JUV A;  4ZNX A;  3S3N A;  2HSE B;  3F70 A;  1VIE A;  1T0H A;  2YHT A;  4JRQ A;  1N9R A;  2P0K A;  3CC2 T;  4FSX A;  3A8O B;  2F2W A;  3EGU A;  5LL6 S;  2CP7 A;  1WXT A;  2L3P A;  2FHD A;  2OTL Q;  4PNO A;  2VWF A;  3M57 A;  5HK3 A;  3G4S Q;  7AT1 B;  1JB0 E;  3REA B;  2ZPG B;  3PFS A;  1AWO A;  1VYV A;  2B8A A;  2F5T X;  3HL8 A;  1UTI A;  1RAD B;  2EKO A;  1RAC B;  5IN1 A;  2DX1 A;  4RCB A;  1OQK A;  4RTZ A;  3MP8 A;  1VQ4 T;  3OW2 P;  3PIO A;  1KD1 R;  2NUP A;  4LE9 A;  3TCJ A;  1QCO A;  4OGE A;  2ESW A;  2RQR A;  2HMA A;  5GMK m;  2VXF A;  3L2V A;  3CCV A;  4JJN K;  5KYX A;  2KI7 A;  3S3M A;  3J7A F;  1ARK A;  5CO7 A;  4HCZ A;  2DVE A;  2YRD A;  5FU7 C;  2D0Q B;  5GAN d;  2RF0 A;  3L2U A;  4ZTJ A;  1K73 C;  1O9S A;  2D1X A;  2HD0 A;  2QGG A;  5GAO l;  3PMT A;  4FIB A;  2QXF A;  2X4Y A;  4EMK C;  2L8D A;  1EFN A;  3CCU T;  2XG8 D;  1WJR A;  4PJM A;  3EGD B;  2XMF A;  3NGP A;  2DRM A;  3JCM J;  1N5Z A;  3CEY A;  1PRL C;  2RHI A;  2EQI A;  1YJW T;  2KYM A;  3JB9 G;  3BY7 A;  2J05 A;  2ZPI B;  2EJG A;  1VQK Q;  1TWB A;  5LJ3 e;  1XTD A;  1AOJ A;  2X4W A;  5FRM A;  3M56 A;  3I5R A;  4M77 G;  3L2Q A;  4AFQ C;  3GP8 A;  2Y90 A;  1C6V X;  2AT1 B;  2HZY A;  4GLK A;  1G2B A;  1VQL A;  2DZ9 A;  3CCR T;  4J9I A;  2E1H A;  1UGQ B;  2O9S A;  2RQW A;  1YI2 Q;  1SRL A;  3FJP A;  1ZA1 B;  4J9B A;  4IIO A;  2RI5 A;  3OQ5 A;  2B86 A;  2DM1 A;  3FRN A;  3QO3 A;  4C5E A;  1X2Q A;  1SSH A;  1W2B S;  2LRQ A;  2PZ1 A;  3VYG A;  3C12 A;  1M8M A;  3C94 A;  2MK5 A;  1CSK A;  2X9H A;  4RTW A;  5EC7 A;  5GAM g;  3SEM A;  3OYF A;  4C92 B;  2LP5 A;  1VQP A;  5CKD A;  3HKS A;  2PNI A;  2JT4 A;  2DTI A;  4DBF A;  2CH4 A;  1K1Z A;  1TUD A;  4C0D B;  1BCM A;  1PCX A;  3A5Z B;  1B3Q A;  3NTH A;  3PNW C;  1I81 A;  2WSE E;  1WJS A;  1LOJ A;  4M7A A;  3CPW A;  3NTI A;  2FO0 A;  2OTL T;  1VQ8 Q;  1TUG B;  2CSQ A;  2DO3 A;  2LNH B;  2FZK B;  5I11 A;  4J9G A;  4BUG A;  3CC4 A;  1VQ6 Q;  3KXT A;  2XD0 A;  3QKJ A;  1UG1 A;  1RAB B;  2YUO A;  1KIK A;  1M9S A;  4LDV A;  4XTY A;  3EFS A;  2KXC A;  4HVW A;  2V1Q A;  1I07 A;  3GNG A;  4FYY B;  1ZQ1 A;  1ZSG A;  3GOX A;  3OS5 A;  4JS4 A;  2RK1 A;  1QVF S;  1WIE A;  3FB9 A;  2ZGW A;  1YHQ Q;  1M1K C;  3CCQ Q;  1M1G A;  1VYU A;  3OMG A;  3HPW A;  2EJ9 A;  2ROL A;  5LJ5 d;  4NS5 A;  3CCE T;  3OSS C;  4KH1 B;  3QXE B;  2DET A;  2E64 A;  1W2B P;  3RMQ A;  3VS2 A;  1WLP B;  3M0S A;  3JRZ A;  4BI8 B;  1JQQ A;  1X01 A;  1UGP B;  5LJ3 d;  1JXO A;  3RDV A;  3G71 Q;  4M77 C;  3X26 B;  4C92 C;  2XDP A;  4QVZ A;  2V8K A;  3D7S B;  4JJC A;  3EG9 A;  1K0S A;  4EMG A;  2EGE A;  2XDD A;  3CBM A;  4C0D C;  4M78 G;  2RPN A;  4DOW A;  2QYZ A;  1MMN A;  2CS7 A;  2OX7 A;  1VQM T;  2FZC B;  1YJ9 A;  1HYO A;  1KJW A;  1EX4 A;  4C92 D;  2CP0 A;  3CBO A;  2EBP A;  2YRC A;  2CP6 A;  4FCY A;  2DJQ A;  3E1S A;  3INZ A;  4IUQ A;  1YJW A;  1Y7X A;  1E6G A;  2V8J A;  1MV0 B;  1QLY A;  2RNA A;  5C0M A;  1Q82 U;  1Q82 R;  2DL7 A;  2JW4 A;  2K79 A;  3OYY A;  3I56 T;  4M7D G;  2MPX C;  2H8H A;  1H3Z A;  3CXC A;  1WX6 A;  4M78 B;  5LJ3 h;  1QVF P;  3BW1 A;  4PJO E;  2QK0 A;  4E7K A;  4C8Q B;  4CRI A;  4XTX A;  2DL5 A;  1YIT Q;  3PT9 A;  5A0G A;  5GAN 2;  1ZBX A;  4M75 G;  2LC4 A;  1JO8 A;  1YJN Q;  4BE0 A;  2XK0 A;  4HT8 A;  2RHU A;  2RQU A;  2RJC A;  4OB2 B;  3LX7 A;  2JUF A;  4M77 A;  1WXB A;  3OB9 A;  2A08 A;  4F7U G;  3CCL T;  1VQ8 T;  4M7D B;  3FDR A;  1UUE A;  2HCK A;  4C8Q F;  2CZ7 B;  1GBR A;  5KYU A;  1VQ6 T;  2GNC A;  2EGC A;  3NTK A;  1OEB A;  2CUB A;  3M58 A;  2FPF A;  3VUZ A;  1U1S A;  1MND A;  3E19 A;  2OTL A;  1I0C A;  2EPD A;  1WHH A;  2KVQ G;  4N4I A;  1Y71 A;  3V8L A;  3SWN B;  3G4S A;  1QVG S;  1K4U S;  1YIJ Q;  3JCM P;  2E6N A;  2DBK A;  1Q95 G;  1YN8 A;  2IIM A;  2KSS A;  4J9C A;  4ESR A;  1NYG A;  4BI4 A;  2CP3 A;  4DQ2 A;  4GLM A;  2VGN A;  1YHQ T;  4F7U B;  4J9F A;  2HDA A;  2VVK A;  2LX7 A;  3J81 E;  1Z9Z A;  3HRS A;  5CR2 A;  3AT1 B;  3VRY A;  1WFW A;  2CP5 A;  2QQS A;  4M78 C;  4HA8 A;  5D6X A;  3CCJ T;  2I2L A;  3V8J A;  1UEC A;  1GCQ C;  3QJ6 A;  4A54 A;  3A8G B;  1D1A A;  2HQX A;  2ZPB B;  4EMH A;  3X28 B;  2GF7 A;  4IUR A;  1V1C A;  4M78 D;  1X6O A;  4J9E A;  2OJ2 A;  3OBY A;  4C8Q D;  2DK3 A;  3JCM W;  2OTJ Q;  2A37 A;  1VQ5 Q;  1WNL A;  4M7D C;  2QDY B;  3H9N A;  3G6E Q;  3BE3 A;  4PJL A;  1GBQ A;  1U3O A;  2HBW A;  2KY9 A;  5IH2 A;  4RMO A;  4PJO F;  1ZA2 B;  5LJ5 f;  4M7D D;  3HRT A;  2DLP A;  2HQH A;  1VQK A;  1S72 Q;  4BB7 A;  2K4Y A;  3SWN C;  2MWO A;  4PFP A;  1QVG P;  2CP2 A;  4M75 C;  3VUB A;  2M0O A;  3OYM A;  1AZE A;  5LJ3 f;  5A0L A;  2RHY A;  2RK2 A;  1OU8 A;  4OB3 B;  1Q7Y R;  2GTO A;  2LCL A;  3QUI A;  3VRZ A;  1VIF A;  4DOV A;  2NUP B;  2YUN A;  4LD6 A;  1GCQ A;  2C0O A;  3CCV T;  2X3W D;  3WVE B;  1YJN T;  1J3T A;  5KYX B;  4RTY A;  5GMK l;  1PRM C;  1K9A A;  3L2Z A;  3RUX A;  2O31 A;  3NMZ C;  2PU9 B;  1ABQ A;  2FL7 A;  1CKB A;  2Y4Y A;  3QHS A;  2KBT A;  2PUO B;  1K8A C;  1M2O A;  1HD3 A;  2E6Z A;  5CKB A;  1N8R C;  1MHN A;  1BU1 A;  3RNJ A;  1U5S A;  4RKU E;  4RCC A;  2PTK A;  1OX9 A;  5J3B A;  1FMK A;  1VQ8 A;  2EQK A;  3BFM A;  5HK0 A;  1NJI C;  2A36 A;  3JCM b;  4OMP A;  1M30 A;  3X20 B;  5GJW B;  2EVR A;  2LQK A;  4JLG A;  1VQ6 A;  2DL4 A;  5EG2 A;  4AG1 C;  5GAN e;  2KAF A;  5CVI A;  1K9M C;  5IAY A;  4XQ3 A;  4M75 A;  3OYD A;  2RQT A;  1Q86 U;  1BI2 A;  2KE9 A;  2KMT A;  2QA4 Q;  2JM9 A;  2E5K A;  4BE1 A;  2FEI A;  3TVT A;  1SG5 A;  2MCN A;  2DPP B;  1YCY A;  2X35 A;  3MCA B;  4IKF A;  3UDC A;  1YHQ A;  1VQL T;  3CCQ A;  2IVW A;  4D6W A;  1Y96 A;  4L59 A;  1IGQ A;  4M7A G;  4ZN3 A;  3OSV A;  1YWO A;  2R5M A;  4CC7 A;  4KUL A;  3MEA A;  4FSS A;  1D0X A;  2RA2 A;  1KSW A;  2PUK B;  4L6V 5;  3CCJ A;  1PC0 A;  2A28 A;  5FU7 B;  2W10 A;  2YT6 A;  3BDL A;  3N5B B;  1TTH B;  3OYA A;  1Q81 R;  1WYX A;  1HJD A;  1VQP T;  3EGX A;  3X24 B;  1MMD A;  1UFF A;  3RER A;  1M3B A;  3OYH A;  1RAA B;  3JB9 J;  4II1 A;  1JRI A;  3S6W A;  3MO8 A;  4M7A B;  4IUU A;  1SF9 A;  3H0H A;  3GBQ A;  5I2M A;  1KQ2 A;  1WQ7 A;  1VYT A;  3CC4 T;  2RI2 A;  4JJB A;  2K2V A;  2JXB A;  3H8Z A;  1VUB A;  2J7I A;  4Y91 A;  3ER0 A;  3BDU A;  5DY9 A;  3FJ5 A;  3CPW S;  2CZ0 B;  4J9D A;  4E2F B;  2CYZ B;  2LVM A;  4HKE A;  5GMK e;  3JAM E;  4GBQ A;  3M0R A;  2M51 A;  1KD1 C;  4ZN1 A;  2J06 A;  3OYL A;  3OYJ A;  1QVP A;  4XU3 A;  3I55 Q;  1AHJ B;  2K7A A;  1YIT A;  2V1R A;  5KE2 A;  5GAN 8;  2L5Q A;  1Z9Q A;  3VS5 A;  4LDW A;  3DB4 A;  9ATC B;  3OYE A;  4XTW A;  1WDX A;  2FYK A;  2COW A;  5ECA A;  3OYG A;  1YJN A;  1RLP C;  2OAU A;  3I9Q A;  4C92 E;  2KT8 A;  1YWP A;  3PVQ A;  3LLR A;  3QII A;  5HKC A;  2M0Y A;  4N4G A;  5GAM d;  1ZLM A;  4MZM A;  2FRY A;  2F2X A;  1I5O B;  2W0Z A;  3EG9 B;  1NG2 A;  4B6M A;  5DLO A;  1YJ9 T;  4F04 B;  1A0N B;  3CMA Q;  1RAH B;  1NLO C;  4QQG A;  4M7A C;  5LJ5 e;  4RTX A;  2X4J A;  4AMC A;  2QQ9 A;  2BE9 B;  5KCO A;  1YIJ A;  2DD4 A;  2EYQ A;  2EGA A;  3RBB B;  1VA7 A;  4M7A D;  5A0D A;  2RO0 A;  1KQS A;  3L2R A;  2F69 A;  1NZ9 A;  4PJJ A;  2EYZ A;  2NYS A;  1ZHI A;  1WHG A;  5GAN h;  3VS7 A;  2LX9 A;  3CPW P;  1NLP C;  1M3A A;  4AFU C;  4CC2 A;  1SHG A;  1KC8 U;  5GAN 6;  3JCM e;  3FIF A;  4LNP A;  2EQJ A;  1F1B B;  3QSU A;  4FYW B;  3A8L B;  1KC8 R;  1B7T A;  2CT3 A;  2KDS A;  3OYK A;  1CKA A;  4F16 A;  1B34 A;  2BTT A;  2X4X A;  4OMO A;  1RAE B;  4L5G A;  3V7S A;  1T0J A;  3VS0 A;  3LH0 A;  2RHX A;  1IHW A;  3NFC A;  4MDX A;  5I2S A;  2VGM A;  1YCS B;  3CXC S;  1ZSZ A;  4JRK A;  2OTJ A;  2VB6 A;  1UJ0 A;  5I21 A;  1NBE B;  2LQN A;  5FWB A;  4M77 B;  4C0F A;  2HNI A;  4PKC C;  2J6O A;  4Z02 A;  3G6E A;  4OML A;  2DIG A;  1UHC A;  1K0X A;  2FZG B;  1D0Z A;  3TRE A;  2CH4 W;  2KQW A;  5KYU B;  1FXX A;  3HTR A;  3G1J A;  2WSF E;  4N0A A;  4LDX A;  4KH0 B;  1W70 A;  3JB9 F;  3G4S T;  2ECZ A;  2LNV A;  1RAI B;  2P84 A;  3HHT B;  1S72 A;  1X6G A;  2YRV A;  3J80 E;  2LQ8 A;  4MZT A;  2FPD A;  1OZ3 A;  4JLI A;  2RH2 A;  8AT1 B;  4C92 F;  5GAN 3;  1VQ7 Q;  2DE0 X;  4M78 E;  2DF6 A;  3R6O A;  4HVU A;  4C8Q E;  4C5H A;  2DBM A;  3OS1 A;  3EAE A;  2KEA A;  2KRM A;  2ZPE B;  3E9G A;  2HBP A;  1JEG A;  3NHN A;  2AZS A;  4XTU A;  1AVZ C;  4X1V A;  2DXT A;  1O75 A;  2LDM A;  1TOV A;  3H41 A;  4QVC A;  2AKK A;  5GMK h;  2FVU A;  4CC4 B;  1X43 A;  2DL3 A;  1WPY A;  3MET A;  2JN0 A;  3T9N A;  3R6N A;  2D9T A;  2LT4 A;  4J6X A;  1PSE A;  4M7D E;  1AT1 B;  2EQU A;  3L42 A;  3RR6 A;  3RMS A;  1QKX A;  1UGV A;  2R57 A;  1M1K U;  5GAO r;  3CXC P;  1YNZ A;  2JS2 A;  3EH2 A;  4KRT A;  4OVA A;  3JB9 D;  2EYW A;  2HKN A;  2XU8 A;  3QDF A;  4M4Z A;  3CC7 Q;  1HXD A;  1VOM A;  4J6W A;  3EH1 A;  3JCM d;  1GFD A;  4M77 D;  4C5G A;  1VQK T;  3DLL A;  3GLX A;  3M59 A;  1LJO A;  2PQW A;  3CCM Q;  2QA4 A;  2IPO B;  4F7U E;  5GAN f;  1FYN A;  1M2V A;  1Q82 C;  5LJ5 h;  1VQO Q;  1IGU A;  3M54 A;  5CQX A;  3CD6 Q;  1BI0 A;  3KFV A;  3M9Q A;  1OYX A;  5J39 A;  3CCS Q;  1GFC A;  3CME Q;  1YI2 T;  1TG0 A;  4OF1 A;  1WHM A;  1UGR B;  2ABL A;  4HCC A;  2HL3 A;  1IO6 A;  4YTL A;  2HKQ B;  1D3B A;  3OBW A;  2QEX Q;  2BIV A;  4BY6 C;  3FLG A;  2RHZ A;  3I5S A;  2JVV A;  3EG2 A;  1AD5 A;  4Q5W A;  2WSC E;  4TVR A;  2DEU A;  3JCM h;  2SEM A;  1QWF A;  4FT4 A;  2LJ3 A;  4JZ4 A;  3QYH B;  3P8H A;  1WZO A;  4E6R A;  4J7F A;  1JXM A;  1T3S A;  4A4K A;  2QQR A;  2H3J A;  1PG5 B;  4M78 F;  4A4H A;  2G3R A;  1YP5 A;  1M1F A;  4HT9 A;  5KCH A;  1IHV A;  1E6H A;  4LDY A;  4AG2 C;  3LYI A;  4J6Y A;  1WHL A;  3I35 A;  1H64 1;  2E3H A;  5LJ3 g;  2D6F A;  1BB9 A;  3JV3 A;  1QWE A;  2L3Q A;  4M75 B;  3GIB A;  1PKS A;  4X9D A;  3FEO A;  2COY A;  4M7D F;  3EFO A;  2VV5 A;  2RB6 A;  1X27 A;  3FC3 A;  3CCQ T;  2DMO A;  3I55 A;  4E7H A;  1EIF A;  1Y96 B;  4J5Y A;  1HK9 A;  4OB1 B;  4PJO G;  3LW5 E;  5FW9 A;  1U06 A;  2A0F B;  2RJE A;  4BE2 A;  1PD1 A;  1KG1 A;  2XI9 A;  4A53 A;  4OMM A;  5CK9 A;  3EG3 A;  1OZ2 A;  3HFN A;  3L1A A;  4R0K A;  3VKI A;  2M1H A;  3SFM A;  3JCM c;  4BDY A;  2FB7 A;  3QJY A;  4FU6 A;  3G71 T;  3RIR A;  5IHI A;  4MMK A;  2BE7 D;  2KR3 A;  4F7U F;  3EGX B;  1UEB A;  2QQB A;  1IRX A;  2KT1 A;  2HEQ A;  2JTE A;  5A2Q E;  2DXU A;  3ME9 A;  2AKL A;  3CMA A;  2OI3 A;  3UA7 A;  2J6K A;  4C0Z A;  2MMP A;  3PE0 A;  1AWJ A;  2MF2 A;  2IG0 A;  4QT7 A;  1PSF A;  1OPL A;  2YLB A;  3P8B B;  2JMA A;  1D09 B;  2RN8 A;  2E10 A;  2QDL A;  3EHQ A;  1ZUY A;  3CD6 T;  3MJX A;  3LGF A;  4J9H A;  4ZGJ B;  4IIM A;  3RKY A;  1N27 A;  1Q7Y C;  1N9S A;  5L23 A;  4E7S A;  1RI9 A;  4M75 D;  1N6A A;  2QEX T;  1NE8 A;  1YIT T;  1I4K 1;  4JRP A;  1MMG A;  1R0C B;  1YI2 A;  2PVG B;  4KGZ B;  3CC2 Q;  4XTZ A;  3JCM f;  4ATO A;  1GL5 A;  2O4X A;  3EG0 A;  3GF5 A;  3OYN A;  2KRS A;  3ASK A;  2ZPF B;  1RL2 A;  5HCK A;  1R77 A;  5IHK A;  5CCA A;  1TU0 B;  2K9G A;  1T3L A;  3M4Y A; 
#chains in the Genus database with same CATH homology
 3HP9 A;  2DXB A;  2P4T A;  4BUG A;  4ZN1 A;  2AHJ B;  3OYL A;  3OYJ A;  1QVP A;  2EIF A;  4XU3 A;  5FU6 C;  3L2W A;  3KXT A;  2HAX A;  3CC4 A;  3VYH B;  1AHJ B;  2ZZD A;  3RKX A;  4NL3 A;  1VQ7 T;  2XD0 A;  2DAQ A;  4C8Q A;  1YIT A;  4M7A E;  3QKJ A;  5KE2 A;  4C92 A;  5KE3 A;  5GAN 8;  1XOV A;  3PTA A;  2L5Q A;  3UWN A;  4R55 A;  1M9S A;  4LDW A;  5GAN 7;  4LDV A;  5CQY A;  3DB4 A;  4XTY A;  3OYE A;  3EFS A;  4XTW A;  2FYK A;  2M16 A;  2JTF A;  3MP6 A;  1YJN A;  3OYG A;  3A8H B;  2L3R A;  3GNG A;  3LGL A;  2EQM A;  4LD9 K;  3JCM g;  1ZQ1 A;  2OAU A;  4C92 E;  3GOX A;  2R5A A;  3OS5 A;  1YIJ T;  1G3W A;  4JS4 A;  1BIA A;  2RK1 A;  5AYF A;  1QVF S;  1MGQ A;  3FB9 A;  3LLR A;  1WGS A;  2M9U A;  1G3T A;  2ZGW A;  1QVF A;  2CZ6 B;  1UB4 A;  3QII A;  5CIU A;  3SB2 A;  5HKC A;  1Y07 A;  2O01 E;  4PL6 A;  1K8A U;  1M1K C;  5FRN A;  2E5Q A;  2MI6 A;  4N4G A;  5GAM d;  1M1G A;  1N8R U;  4MZM A;  3JB9 H;  4X34 A;  1YBY A;  3OMG A;  2L89 A;  3JCM V;  1VQ7 A;  3HPW A;  2EJ9 A;  5GAM e;  3ZBD A;  4M75 F;  3VJP A;  5LJ5 d;  5DLO A;  4NS5 A;  1YJ9 T;  3CCE T;  3OSS C;  3UPU A;  3E9F A;  1M8V A;  3C4S A;  4IUT A;  2K5F A;  2ZPH B;  3A8M B;  3QXE B;  4ELY C;  4QQG A;  4PLL A;  4M7A C;  2GQV A;  2F5K A;  5LJ5 e;  2X4J A;  2E64 A;  1VQ9 T;  2QQ9 A;  5KCO A;  4A4E A;  3RMQ A;  1KHC A;  5CKH A;  1YIJ A;  2DD4 A;  3JRZ A;  4BI8 B;  2DIQ A;  2EYQ A;  3MEV A;  1X01 A;  1UGP B;  1K9M U;  5LJ3 d;  5C6S A;  4KUI A;  4M77 C;  4C8Q C;  3X26 B;  3CC7 T;  4BD3 A;  4M7A D;  4C92 C;  5A0D A;  2XDP A;  4QVZ A;  2RO0 A;  1KQS S;  2V8K A;  2Y4X A;  3OS0 A;  1KQS A;  1TH7 A;  1Q81 C;  4EMG A;  3L2R A;  1B34 B;  1NZ9 A;  2F69 A;  4FM4 B;  3CBM A;  4XTV A;  2XDD A;  2XDB A;  4C0D C;  1ZHI A;  4M78 G;  1WQW A;  4DOW A;  2CS7 A;  1VQM T;  5GAN h;  3CCE A;  2LX9 A;  3CCM T;  1YJ9 A;  4VUB A;  2OTJ T;  2EWN A;  3DB3 A;  4C92 D;  4GY5 A;  2P0P A;  3CBO A;  5GMK i;  1KC8 U;  2MWP A;  5GAN 6;  3JCM e;  1VQ5 T;  2DD5 A;  3FIF A;  4MDW A;  5IT9 E;  3E1S A;  3INZ A;  2EQJ A;  3G6E T;  3G71 A;  1VQO T;  3QSU A;  3O8V A;  4IUQ A;  1YJW A;  1Y7X A;  2V8J A;  3A8L B;  4XK8 E;  4C0G A;  1NPR A;  5GMK j;  2KDS A;  3OYK A;  2JNG A;  3RKW A;  5C0M A;  2PVO B;  3H6Z A;  3V8K A;  3CC7 A;  2DTH A;  4ZGD B;  1Q82 U;  3CCS T;  3MP1 A;  3CME T;  1OI1 A;  4PJO A;  1B34 A;  2X4X A;  3LWI A;  1M90 U;  3CPF A;  4L5G A;  3V7S A;  3LH0 A;  4X9C A;  2RHX A;  3NFC A;  1S72 T;  3HSB A;  4XAX B;  3OYY A;  3I56 T;  4M7D G;  4MDX A;  1VQM A;  5I2S A;  1QP3 A;  3CCM A;  2VGM A;  5GAO n;  4NOY A;  3UT1 A;  3CXC S;  4JRK A;  3OY9 A;  2OTJ A;  1BYM A;  1H3Z A;  3CXC A;  5LJ3 h;  4M78 B;  5I21 A;  3BW1 A;  4E47 A;  1DJ7 B;  2XID A;  4MZP A;  4M77 B;  4C0F A;  4E7K A;  2HNI A;  4C8Q B;  4PJO E;  4PKC C;  4FT2 A;  4CRI A;  4Z02 A;  1G5V A;  4XTX A;  3G6E A;  2DIG A;  2XHC A;  5FRO A;  3OYI A;  1VQO A;  4E7L A;  3G7Z A;  3PT9 A;  3TRE A;  3DKM A;  2KQW A;  1BI1 A;  5A0G A;  3DLM A;  1FXX A;  3OS2 A;  5GAN 2;  5GAN j;  3CD6 A;  1ZBX A;  1Q7Y U;  2WSF E;  4M75 G;  4N0A A;  4LDX A;  2LC4 A;  3CCS A;  3CME A;  4BE0 A;  3JB9 F;  2ZCF B;  2XK0 A;  3G4S T;  4HT8 A;  3Q1J A;  4M7A F;  2RHU A;  1LNX A;  2LNV A;  4EPC A;  3HHT B;  5GAM j;  2YRV A;  1S72 A;  3TEE A;  3I56 A;  2VYT A;  2A3L A;  2RJC A;  3J80 E;  4J7I A;  4OB2 B;  3LX7 A;  4M78 A;  2QEX A;  2LQ8 A;  4MZT A;  2JUF A;  4M77 A;  4JS5 A;  3OB9 A;  4RG2 A;  1U1T A;  4F7U G;  3CCL T;  1VQ8 T;  1OZ3 A;  3FDR A;  3PGG A;  5CKF A;  5LJ5 j;  2OTL A;  4M7D B;  3CBP A;  4JLI A;  2RH2 A;  2CZ7 B;  4C8Q F;  4BDZ A;  4C92 F;  5GAN 3;  4ME7 A;  2DKG A;  1VQ6 T;  4J83 A;  4P5N A;  4M78 E;  3VU3 C;  3NTK A;  3RES A;  3R6O A;  4PJO C;  4M77 E;  4C8Q E;  4C5H A;  3M58 A;  1UGS B;  3OS1 A;  2WAC A;  2RI3 A;  3EAE A;  4BI3 A;  1KD1 U;  3AHU A;  3VUZ A;  1U1S A;  3E19 A;  5LJ3 j;  2ZPE B;  3E9G A;  2HBP A;  1JJ2 S;  2CGH A;  3TU4 K;  4N4I A;  1G3Y A;  2KVQ G;  1Y71 A;  2QQA A;  3SWN B;  3V8L A;  3G4S A;  3URG A;  1JJ2 A;  1QVG S;  1BIB A;  4KBM B;  1QVG A;  3JCM P;  2E6N A;  4QW2 A;  2R58 A;  2E70 A;  4PJO D;  4XTU A;  4A4F A;  1Q86 C;  2BKD N;  2RD1 A;  4MML A;  2DXT A;  1O75 A;  2LDM A;  4M7D A;  2KSS A;  4QVC A;  4LDU A;  3CCL A;  4BI4 A;  2DTO A;  5GMK h;  3OYC A;  2FVU A;  3WXM B;  4R56 A;  4A4G A;  3M55 A;  3QG1 A;  1WPY A;  3MET A;  3V7R A;  2VGN A;  4DQ2 A;  2JN0 A;  1YHQ T;  4HCB A;  3T9N A;  2D9T A;  4F7U B;  2LT4 A;  4J6X A;  1NJI U;  2BUD A;  4N0A C;  4OB0 B;  1PSE A;  4M7D E;  2DJZ A;  4C5I A;  4V2S A;  1K73 U;  2EQU A;  3L42 A;  2HQE A;  3RMS A;  3P8D A;  5HY6 A;  3HRS A;  5CR2 A;  3J81 E;  3SWN A;  2R57 A;  2QA4 T;  1M1K U;  5GAO r;  1V29 B;  2QQS A;  4JRI A;  1G3S A;  5KH6 A;  4M78 C;  3JCM Q;  4HA8 A;  4OVA A;  5D6X A;  3CCJ T;  3JB9 D;  2I2L A;  3QPH A;  3V8J A;  4A54 A;  3QBY A;  3QJ6 A;  4E7J A;  3JCM X;  3A8G B;  2YLC A;  4ZTF A;  2JZ2 A;  2HQX A;  5CAI A;  4JDS A;  1FX7 A;  2ZPB B;  5DLQ E;  4EMH A;  3X28 B;  2XU8 A;  3HRU A;  2VXE A;  2GF7 A;  4IUR A;  1VQK T;  4PJO B;  2GCX A;  1HXD A;  4PLI A;  3GNF B;  4F7U A;  2K3Y A;  4J6W A;  2V8I A;  4M78 D;  1X6O A;  3JCM d;  4M77 D;  3OBY A;  2E12 A;  4B9X A;  2K57 A;  4C8Q D;  4C5G A;  3DLL A;  3OW2 S;  1U8R A;  3GLX A;  2QI2 A;  3M59 A;  3OW2 A;  1KC8 C;  5J26 A;  2DK3 A;  1VQ9 A;  1LJO A;  2JOY A;  2PQW A;  3JCM W;  1SSF A;  5CKE A;  2E65 A;  5GAM h;  1D3B B;  2QA4 A;  1QP2 A;  4F7U E;  4ZGE B;  5GAN f;  3MHX A;  5D6W A;  1RI0 A;  1M5Q 1;  3PMI A;  1WNL A;  2CZ1 B;  1Q82 C;  4M7D C;  4QQD A;  2QDY B;  4O6J A;  5LJ5 h;  3MEU A;  5DM7 R;  1Q81 U;  1KQ1 A;  3SD4 A;  1M90 C;  4XU1 A;  3M54 A;  4OGC A;  3HFO A;  5CQX A;  4C92 G;  2GFU A;  3V7C A;  2KY9 A;  2A7Y A;  4RMO A;  1BI0 A;  3M9Q A;  1OYX A;  3QZ9 B;  4PJO F;  5J39 A;  3ZEH A;  3X25 B;  1NPP A;  1YI2 T;  3WVD B;  3QZ5 B;  5LJ5 f;  4M7D D;  4OF1 A;  3HRT A;  4ELZ C;  4EMK B;  1UGR B;  1VQK A;  1VQN T;  4HCC A;  4BB7 A;  2K4Y A;  3SWN C;  4DA4 A;  2MWO A;  1GXI E;  4NL2 A;  4YTL A;  1D3B A;  1VQ5 A;  4M75 C;  4XU2 A;  3VUB A;  3OBW A;  2M0O A;  3OYM A;  2BIV A;  4JUV A;  5GAO l;  1KHI A;  4BY6 C;  3S3N A;  3FLG A;  2VUB A;  2RHZ A;  3F70 A;  1VIE A;  2JVV A;  5LJ3 f;  4Q5W A;  2YHT A;  2WSC E;  5GAN g;  4TVR A;  5A0L A;  2RHY A;  2RK2 A;  2DXC A;  4FL6 A;  5GAO p;  3JCM h;  4JRQ A;  3JB9 I;  1N9R A;  2P0K A;  4FT4 A;  3CC2 T;  4OB3 B;  4FSX A;  3A8O B;  5LL6 S;  3QYH B;  2LCL A;  3QUI A;  3VV0 A;  4EMK A;  1VIF A;  2FHD A;  3P8H A;  4PNO A;  1XNI A;  3M57 A;  4WF2 A;  4Y28 E;  4DOV A;  5HK3 A;  4J7F A;  4LD6 A;  4QVD A;  2E41 A;  4A4K A;  2QQR A;  1JB0 E;  3CCV T;  2QTX A;  3WVE B;  2H3J A;  1YJN T;  4M78 F;  4A4H A;  2ZPG B;  2G3R A;  2DEQ A;  3OA6 A;  4M77 F;  3PFS A;  1M1F A;  4HT9 A;  2B8A A;  2RM4 A;  2VC8 A;  2XIC A;  5KCH A;  5GMK l;  2F5T X;  4LDY A;  3HL8 A;  3L2Z A;  2P0Q A;  3LYI A;  4UC4 A;  3I55 T;  4J6Y A;  5M9O A;  3JSC A;  2EKO A;  3RUX A;  1I5L A;  2PU9 B;  1R8O B;  2FL7 A;  5IN1 A;  3MEW A;  2Y4Y A;  4RCB A;  1H64 1;  3MP8 A;  5LJ3 g;  3QHS A;  1VQ4 T;  1IZ6 A;  2PUO B;  1K8A C;  2D6F A;  2E6Z A;  3CC2 A;  3PIO A;  2XKO C;  5CKB A;  4M75 B;  1N8R C;  3GIB A;  1MHN A;  1X75 C;  4BY6 B;  3TCJ A;  4OGE A;  2LCC A;  4X9D A;  4RKU E;  4RCC A;  5GMK m;  5J3B A;  2VXF A;  3FEO A;  3L2V A;  3CCV A;  4XU0 A;  4JJN K;  3S3M A;  2EQK A;  1VQ8 A;  3BFM A;  3J7A F;  5CO7 A;  5HK0 A;  4M7D F;  1NJI C;  4HCZ A;  2DVE A;  2VV5 A;  5FU7 C;  2D0Q B;  2RB6 A;  3FC3 A;  3JCM b;  5GAN d;  3CCQ T;  2RJD A;  3X20 B;  1P92 A;  2LQK A;  4JLG A;  3L2U A;  4ZTJ A;  1VQ6 A;  1K73 C;  3I55 A;  4E7H A;  1EIF A;  1BKB A;  1Y96 B;  1O9S A;  5L8R E;  5EG2 A;  4J5Y A;  2HD0 A;  4O5V A;  5GAN e;  1HK9 A;  2KAF A;  3PMT A;  4OB1 B;  4FIB A;  3LW5 E;  5CVI A;  2QXF A;  4PJO G;  1BI3 A;  1K9M C;  2X4Y A;  5IAY A;  2RJF A;  3SDZ A;  4XQ3 A;  4EMK C;  2RJE A;  1VQ4 A;  2L8D A;  4M75 A;  4BE2 A;  4QQ6 A;  3OYD A;  2CKK A;  3CMA T;  1KG1 A;  2XI9 A;  5FLX E;  2XG8 D;  1WJR A;  3CCU T;  1BI2 A;  1Q86 U;  2EJF A;  4OMF B;  2KMT A;  3M4G A;  4A53 A;  3KUF A;  4IUP A;  5CK9 A;  4BE1 A;  1OZ2 A;  2LTO A;  3HFN A;  3L1A A;  3QYG B;  1JBM A;  1WJQ A;  3VKI A;  4BAC A;  2M1H A;  3SFM A;  3JCM c;  2DPP B;  4BDY A;  1YCY A;  2FB7 A;  2X35 A;  4M75 E;  3MCA B;  4IKF A;  3JCM J;  2K5L A;  3QJY A;  3CEY A;  4FU6 A;  5FU6 B;  3UDC A;  3G71 T;  1YHQ A;  1VQL T;  2RHI A;  3RIR A;  1YJW T;  3CCQ A;  2IVW A;  2JTM A;  4D6W A;  1Y96 A;  4L59 A;  4N4H A;  4MMK A;  5GAO m;  4F7U F;  3JB9 G;  3PIP A;  3BY7 A;  1UEB A;  2QQB A;  4M7A G;  4ZN3 A;  2ZPI B;  1I8F A;  2EJG A;  3OSV A;  4OP0 A;  2R5M A;  3M53 A;  5GAN 5;  5A2Q E;  2DXU A;  5LJ3 e;  1XTD A;  2EFI A;  3ZFJ A;  3GPL A;  4KUL A;  3MEA A;  2X4W A;  3ME9 A;  4J8O A;  4IUV A;  2RA2 A;  2KK4 A;  2PUK B;  4L6V 5;  3CMA A;  3CCJ A;  3CCU A;  4EDU A;  5FU7 B;  5FRM A;  3M56 A;  1FWZ A;  4M77 G;  4C8Q G;  4C0Z A;  2NLU A;  2MMP A;  3BDL A;  5GAM f;  3L2Q A;  3GP8 A;  2Y90 A;  3N5B B;  4B9W A;  2C06 A;  2MF2 A;  4RG8 A;  2IG0 A;  3OYA A;  1PSF A;  1VQP T;  2YLB A;  4GLK A;  3P8B B;  1XQH A;  1VQL A;  2DZ9 A;  2E10 A;  3X24 B;  3CCR T;  2E1H A;  1UGQ B;  3RER A;  3EFR A;  3QDR B;  3OYH A;  2O4X B;  3JB9 J;  3FJP A;  3CD6 T;  4II1 A;  1JRI A;  3LGF A;  2RI5 A;  3OQ5 A;  4ZGJ B;  3FRN A;  3S6W A;  3KBG A;  3MO8 A;  3QO3 A;  4M7A B;  4IUU A;  3RKY A;  1N27 A;  4C5E A;  1Q7Y C;  1N9S A;  5I2M A;  1KQ2 A;  1W2B S;  1WQ7 A;  2LRQ A;  3VYG A;  4E7I A;  3CC4 T;  3OMC A;  3C12 A;  3C94 A;  1W2B A;  4M75 D;  1N6A A;  2RI2 A;  1NE8 A;  2QEX T;  1M4Z A;  1YIT T;  4CI0 C;  5GAO q;  1I4K 1;  4JRP A;  3M5A A;  2K2V A;  2DZC A;  5GAM g;  5D6Y A;  3OYF A;  4KUD K;  4C92 B;  5GAN 4;  1YI2 A;  1VQP A;  2PVG B;  3HKS A;  5CKD A;  3H8Z A;  3S3O A;  4XTZ A;  3JCM f;  4ATO A;  1VUB A;  2DTI A;  2LT1 A;  2PVD B;  3OYB A;  3CCR A;  1VQN A;  2O4X A;  4Y91 A;  3GF5 A;  5LJ5 g;  2GFA A;  3BDU A;  3ER0 A;  4C0D B;  3A5Z B;  4KT0 E;  5DY9 A;  3NTH A;  3OYN A;  3C95 A;  3PNW C;  1I81 A;  3CPW S;  2WSE E;  1WJS A;  3ASK A;  1LOJ A;  2ZPF B;  4M7A A;  3CPW A;  2CZ0 B;  1RL2 A;  2K3X A;  3NTI A;  2OTL T;  2EAY A;  2MAM A;  2CYZ B;  1IRE B;  2LVM A;  4HKE A;  5CCA A;  2DO3 A;  1QW1 A;  5GMK e;  3JAM E;  3M4Y A;  1W4S A;  1KD1 C;  2K5I A;  3LWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...