4GLKA

Structure and activity of abiq, a lactococcal anti-phage endoribonuclease belonging to the type-iii toxin-antitoxin system
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
165
Chain Sequence
b'GTLRFFTVTDEYIAYLRKFESKVHYQYENNASTYVGVVLKKNDFNYFIPLLSYNPEKDKAMKKRSRIVTRLFEIGNINNPLGYLLHHNMIPVPDSELIPLPLDLKKPKHKMMQKQLIYMKSISEKIENKSEVVYRKAAHEKDGYYLKFSCDFKLLEAKATLYSKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AbiQ
molecule tags Hydrolase
source organism Lactococcus lactis
publication title Structure and activity of AbiQ, a lactococcal endoribonuclease belonging to the type III toxin-antitoxin system.
pubmed doi rcsb
total genus 55
structure length 165
sequence length 168
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4glkA00
2XDBA 4RMOA 4GLKA 4ATOA 2XD0A 2XDDA
chains in the Genus database with same CATH superfamily
2WSFE 4QVZA 2NUZA 3X26B 4PJMA 4CC3A 2E12A 3L2WA 3L2RA 3I56A 1SRMA 3OMGA 3H41A 3G71Q 1KSWA 1BK2A 1LCKA 2R58A 3RR6A 4PK4A 1YJWQ 1Q82R 4HA8A 3CCRQ 4F7UB 2KGTA 3A8GB 3EHQA 4OMMA 1AWJA 3D7SB 1WJQA 4C8QA 2O9SA 1G5VA 1K8AU 4E7SA 2KRNA 1M30A 3VS2A 1WX6A 1G83A 1UHCA 1B3QA 4O5VA 1VQPA 5GAN7 2MAMA 4M78E 1D1BA 3VUZA 1VQLT 1VQPQ 4IUUA 3QWXX 3EGXA 4GY5A 4NL2A 1PSEA 2DRMA 3JCMW 4M75E 4C8QC 4B9WA 1PC0A 4BE2A 1VOMA 1VQ7T 4FYVB 5LJ3f 3V7CA 1TXQA 2JVVA 1WJRA 4HCBA 3M4YA 1Y57A 5IT9E 2PVGB 3NTIA 1JJ2P 1OX9A 2FRYA 5FROA 1VQKT 3I55T 1VQ4A 3Q1JA 3OW2P 2RJEA 5FLXE 3CCQA 5HK0A 2RN8A 1UFFA 2EQUA 1M90U 3O8VA 2DXCA 1YJNQ 2AZSA 3QZ9B 4OGCA 3NHNA 1M8VA 3EGXB 2LNHB 5KYYA 2DRKA 4M78C 2RNAA 1X69A 1QCOA 4M75F 2LMJA 2K5FA 1JQQA 1HYOA 4Y92A 2DIGA 1O9SA 2KXDA 4ZN1A 5CCAA 1KC8R 1YIJQ 3I5RA 1D3BA 1WPYA 2QTVA 4AFQC 1Q86C 4DQ2A 1IXDA 3MHXA 1M27C 1KQSP 1MNDA 2LVMA 4CRIA 2E41A 1B34A 1WFWA 7AT1B 2OTJA 4QVDA 2C0TA 1B07A 4JRQA 3G4SA 2AT1B 1OV3A 2CT4A 3RMSA 5GAMh 2HBWA 1EIFA 2J6OA 4M77C 1NYFA 3KXTA 1SEMA 1EZZB 2JS2A 4FYWB 1JBMA 4FW1A 3H6ZA 3CCVA 4B9XA 1D3BB 3CCUQ 3CXCA 3OBYA 4EMKC 4X34A 4OVAA 2EYXA 2ROLA 1NBEB 4KT0E 1IHVA 3M55A 4CC4B 3OYJA 2BZXA 1AWXA 2EJGA 2HQEA 5LJ3g 1AZGB 1VQOT 1M3AA 2J6FA 1B34B 4C92A 3V8JA 2OI3A 3CXCS 3VKIA 3CPWA 2L8DA 4HVVA 4RTXA 2QASA 3KBGA 1GBRA 1LOJA 4DBQA 2MPXC 2O31A 3LGLA 2CSIA 3PVQA 4X9CA 1N8RR 2DETA 2JTFA 2RHIA 4EMKB 2KMTA 3TEEA 1WDXA 2KYMA 3E9GA 1QWEA 3VRZA 3GPLA 4OF1A 3A1PA 3DKMA 3H0HA 4ANJA 2JJ9A 4JRPA 1UUEA 4M77B 1VQ5T 3H0IA 4C8QE 2DO3A 3VYGA 4C92B 1ABOA 4R55A 2KXCA 2P4RA 1ZLMA 1N6AA 3CCJA 3EG9A 5GANj 1TS9A 2ECZA 2X3XD 1NJIC 3GNFB 4DBRA 1QVFA 5GANe 1I5OB 4RG8A 3INZA 4OP0A 2ROTA 5GAOn 1XNIA 5CO7A 4R0KA 2LDMA 5IXFA 1C6VX 3RKXA 1BYMA 1WIEA 2X51A 4II1A 5CKDA 1MMAA 3CCJQ 2DTOA 4J6YA 3CC7Q 1PSFA 1M1KR 1AZEA 1RAAB 2DZCA 4N4GA 2WSEE 1OX8A 3VU3C 3CBMA 3QDRB 4PFOA 4X9DA 4C8QD 3OW2A 2LT4A 3HPWA 1R0BG 3CC4T 1K9MC 5GMKi 3CCRA 2EQKA 4RTTA 2CSQA 2FG0A 4KGXB 4M77F 2P0QA 4FSXA 4FT4A 4PJOE 1QP2A 1M2VA 5CKEA 3OYBA 2PNIA 2LJ0A 4C8QF 5GAMj 3JV3A 4BD3A 1JXOA 5GAMg 4A54A 1XTDA 2JS0A 2CP5A 5CKFA 1VIFA 1BIBA 2ED1A 4J7FA 4D8DA 2CUBA 4C92C 3FJPA 4EPCA 1Q95G 2I0NA 2NWMA 1I4K1 4C8QB 2FRWA 2KQWA 1Q81R 2RQTA 2DJZA 1VQ9Q 4HT9A 2X3WD 2F69A 1PRMC 4A4FA 3VS0A 1OQKA 2CZ6B 3JB9H 2G3RA 1UGRB 1X43A 1SF9A 2AHJB 1QVFP 1H92A 1M3BA 1AD5A 2QTXA 1PRLC 1GL5A 5J26A 1VQ5Q 1KHIA 2O88A 4Y28E 2C0IA 2DL4A 3SFMA 2KR3A 1WHLA 4F7UF 3WVDB 4EIKA 2GF7A 4KRTA 2CH4W 3LW5E 3NPFA 1U1TA 4PLLA 4NOYA 4VUBA 3JB9D 1CKAA 2EJFA 1UGSB 3KFVA 3WVEB 1K73C 4DEYA 1OI1A 4E47A 1BI0A 5CKHA 4AFSC 3CCVT 3QIIA 1T3SA 1MNEA 2MWPA 4V2SA 2VUBA 4ZTFA 6AT1B 1Z9QA 5FWCA 4M78A 1YWOA 4QVCA 3BDUA 3CQTA 1D09B 2QQBA 3HTRA 2E70A 1Q86U 2ZZDA 4OMPA 2YRCA 1WNLA 3JRZA 4QT7A 1PCXA 4M7DD 1WYXA 1UE9A 3ZL7C 3I56Q 3OYGA 4IUQA 2QDLA 4XTVA 2Y90A 4KULA 3I9QA 2DERA 1VYTA 1W70A 4PJOB 5IN1A 2VWFA 4XU0A 2DTIA 1K8AC 5CR2A 3L2UA 2M0OA 3MCAB 2CT3A 4PFPA 1Y0MA 3MJXA 1UDLA 4J9HA 1VA7A 1SHGA 1OZ3A 2KBTA 4B6MA 1RACB 4M78B 1BB9A 2K4YA 4F17A 2EAYA 3UDCA 1AT1B 1NJIU 2EGEA 2AKLA 2HBPA 3RBBB 3E19A 2C0OA 3CPFA 4XU1A 5LJ3j 4C0FA 3SDZA 2I2LA 3MP1A 2J05A 4C0DC 3BE3A 2JTMA 3MEWA 4M77G 2YRDA 2F1LA 4BE0A 2BZYA 2COZA 2QEXQ 2XK0A 4ATOA 2F5TX 2JXBA 1YIJT 3VS6A 2NUPA 4K11A 2DK3A 5I2SA 5IHKA 5DLOA 2IVWA 2DF6A 3JCMe 4JJNK 1HXDA 4WF2A 5FU6B 1BI2A 4OMNA 2H3JA 1VQNT 2HL3A 2RMOA 1N8RU 4OB1B 4ZGJB 1W4SA 2RH2A 2JW4A 1WJSA 1JRIA 2F2XA 1GCPA 1UGPB 2DIQA 5GANd 3I5SA 4E7JA 5FU7B 4J83A 1PHTA 4AMCA 2OAUA 4M7AB 3JCMb 4JRKA 2MMPA 2QQSA 5LJ5d 2HSEB 3QDFA 3RNJA 3I55Q 1LPLA 3RUXA 4LN2A 2O01E 2DXTA 2BUDA 3QO3A 4J9IA 5GMKh 4ZGEB 2F2WA 3HL8A 2XIDA 5A2QE 3G7ZA 1V1CA 3EFRA 1JB0E 2K2VA 2YHTA 3RIRA 3RKWA 1Y96A 1I8FA 2QXFA 2LQWA 4DBFA 5HCKA 4BDZA 2EVRA 4FCYA 3ZEHA 3M59A 5KH6A 3M0UA 2L2PA 2CZ1B 4OMOA 2A7YA 1VQ6Q 2NUTB 3VV0A 4DOWA 2RK1A 4M7AA 3JCMJ 4X1VA 2EQJA 3OB9A 1BI3A 2GFUA 2RD1A 1KJWA 5GMKe 1WGSA 4ME7A 3IQLA 3JB9F 2IPOB 2D9TA 3VS7A 1YJ9T 4IKFA 2ZPEB 2VYTA 3A8HB 4BI4A 4RCBA 4M7DA 3RESA 3OA6A 1QVPA 4M7AD 3LLRA 2E6ZA 2PUOB 1KC8U 5CK9A 4WCIA 1A0NB 1YHQQ 1MUZA 1I1JA 4MZTA 3JCMg 4GLKA 3F70A 2KSSA 4QQDA 1QVGA 1VQLQ 3M58A 2HKQB 4KBMB 4M4ZA 2KEAA 2VGMA 5A0LA 4N4HA 1UG1A 2RK2A 2PQWA 5C0MA 1UGQB 5C6SA 2SEMA 1B7TA 2JNGA 1V76A 4LE9A 1FYNA 4XTZA 4MZMA 1BU1A 2EYYA 3PNWC 1IREB 1NEBA 3VS3A 2HL5C 2RA2A 3URGA 1JO8A 3EFSA 4J8OA 5GAOr 2L5QA 1MMGA 2RQWA 3OS5A 4E7ZA 1ZA2B 1BCOA 1YJWA 2HQXA 1RAFB 2X4WA 5LL6S 2CZ7B 1UGVA 1D0XA 5GANf 1X75C 2EPDA 5GANh 3OYLA 2P84A 4OB0B 3GIBA 2OAWA 1Q7YR 2EYQA 3M0RA 5IH2A 4LUEA 4E7IA 5FU7C 4IUVA 4Q5WA 1YJNT 2L3QA 2SRCA 2Y4XA 2HQHA 1S72A 3CCEQ 3QYGB 3TVTA 1SG5A 2HMAA 5GAN3 2RHZA 1Q81U 4PNOA 1ABQA 3UWNA 4J9BA 5GJVB 1M1GA 4JPBW 1QKWA 1U8RA 4P5NA 5AYFA 3CCMT 4MMKA 1YNZA 5HKCA 3M9QA 3EHRA 3X20B 2CREA 1YITA 1J3TA 5IHNA 2EYWA 4RG2A 5CQXA 5I11A 4IIMA 1M2OA 4DEXA 3CC7A 1Q82U 3A8MB 1QVGP 2MI6A 1JJ2S 2LRQA 4JUVA 4FU6A 2YLBA 3GBQA 5I2MA 1FX7A 1K73R 5I22A 4BE1A 1OPLA 5FRMA 2CP3A 3G71A 3RDVA 3V7RA 2RI2A 1BBZA 3R6OA 2VKNA 3I56T 3M4GA 2E10A 3OYYA 2RQVA 3M0SA 3PE0A 2DD5A 1WHJA 2OJ2A 3HRUA 2KY9A 1K4US 4J6XA 1Q82C 3REBB 3CPWP 4LDWA 1K9MU 1RAEB 4QQ6A 3OS2A 1VQ9A 2A3LA 3GNGA 2RB6A 3CCLQ 2OTLQ 5GAMe 4EDUA 1IO6A 4RTYA 4F7UG 4QW2A 4AT1B 2HZYA 2A36A 2BKDN 3C0CA 3OYMA 1WHMA 3CCQQ 3VUBA 3JB9I 2XD0A 1QQJA 2QA4T 5LJ3d 1G3TA 1W2BP 2K5LA 4ELZC 5KCOA 1HSQA 1SSFA 2W10A 3JCMc 5KYNA 1YN8A 1YBYA 2FL7A 1AHJB 2RO0A 5J3BA 1QWFA 1MV3A 3VS4A 2XHCA 2FEIA 3QSUA 3EG0A 4M7DE 2NUPB 1VQKQ 1K0SA 3CCLA 1GFDA 4HXJA 5GAMd 3TCJA 4C5GA 3P8DA 3ER0A 1TUCA 3AT1B 2QDYB 3DLLA 3CCET 1KC8C 4DA4A 2XG8D 3U23A 1YCYA 3CCJT 3V8LA 2CP0A 1K76A 5GAOm 3CCQT 1U06A 2HDAA 2ZAEA 5GANg 3OY9A 3GF5A 1SRLA 2EQMA 4M75C 1BKBA 2EWNA 3A8LB 4IIOA 3TSWA 3CCST 1KD1C 2PZ1A 1Z9ZA 4RTUA 3REAB 3NFCA 2B8AA 2L89A 2LCCA 1OEBA 2DNUA 2Z0WA 2C06A 1MMNA 3QKJA 3G1JA 2MK5A 3OS0A 4GLMA 2KI7A 1TSFA 3V7SA 4JDSA 3DB4A 3PFSA 2EGCA 4IUPA 2R5AA 4PFZA 4BY6C 3PIOA 5GMKj 2HD0A 2DYBA 3PIPA 2JZ2A 2ZPIB 2DEUA 4M7DG 1V29B 1WHGA 1ZSZA 2PVDB 4Z89A 2M51A 3VJPA 3BW1A 3LWHA 1Y7XA 3VRYA 4Y91A 3JCMd 5KYYB 4BI8B 3CMAA 5FWBA 4Z88A 3G4ST 3EG1A 2XDDA 1KK7A 4PJOG 3S3NA 3HKSA 5IXBA 1WHHA 4M7DB 3I35A 1BI1A 1D1CA 2VV5A 4D8KA 4LNPA 3EAEA 4Z8AA 2YT6A 1IZ6A 4DBHA 3CC2T 1UEBA 2H3EB 2X9HA 5DLQE 2V26A 2HKNA 1KIKA 1I0CA 1H8KA 1G3SA 4C92E 2L3RA 4JJBA 2DPPB 1RLQC 3HHTB 1N5ZA 1FXXA 1ZSZB 1T0JA 3FIFA 1M5Q1 1VQ7A 3JCMQ 1U3OA 5LJ3e 2QQAA 4PJOF 2Y4YA 3P8BB 3X28B 3C12A 1VQKA 3WXMB 1GRIA 2QQ9A 1PD1A 2ENMA 5GAMf 1M9SA 2J7IA 3QG1A 5DM7R 1RABB 1DJ7B 4O6JA 2EKOA 5KYWB 4PJJA 3ZBDA 1X6OA 3UA6A 3UT1A 2FPDA 2RHXA 3FDRA 1NLOC 1WI7A 1YIJA 4JLIA 3MKDA 1UHFA 1Y96B 1HJDA 3CPWS 1Y71A 1OU9A 1P92A 1RLPC 5LJ5j 1IHWA 1RAIB 2BTTA 2OTLT 1GBQA 4QKUA 1ZA1B 3OYIA 1MHNA 1AEYA 5EC7A 2DTHA 4XTYA 4PKCC 3QUIA 4OMFB 2JUFA 2EFIA 2LCLA 3TSZA 2P0KA 2CP6A 2PU9B 1K9MR 1C0MA 1XQHA 2QA4Q 2FO0A 4N0AC 2DM1A 4ZN3A 2DKGA 2RHUA 1F1BB 4RTWA 1M1KU 4RUGA 3CC4Q 1VQ4Q 3DLMA 2YDLA 3MO8A 1PM3A 2KROA 4LDXA 3EG9B 1VIEA 1RAGB 1KFZA 1O75A 2WACA 3UF4A 3KUFA 5FW9A 2P4TA 3MEVA 4XK8E 1FMVA 3M54A 2LTOA 2LQKA 2M1HA 4XAXB 1WA7A 4A4HA 1ZHIA 1UB4A 1YI2Q 1EX4A 4OMQA 3C4SA 4JS4A 2ESWA 3SD4A 2FYKA 5GMKm 3NTKA 3CMET 2IG0A 4RTVA 3CCSA 4JRIA 4RKUE 5CIUA 2NYSA 2CGHA 1E6HA 5CVIA 5GMKl 4IUTA 3JCMP 1U5SA 2RI5A 2DLPA 5GAN2 1S1NA 1KD1R 1Q81C 1QCFA 2EQIA 3VYHB 1N8RC 3M57A 1N9RA 1NE8A 2DL7A 4LDYA 2KYBA 1Q7YU 2QGGA 2D0NA 4GBQA 1Y07A 1EFNA 3PGGA 4KGVB 3CCMQ 2PVOB 3X25B 3ASKA 2LNVA 3G6ET 3J7AF 1HK9A 3SWNC 2LJ3A 1K0XA 4N4IA 5ECAA 4CI0C 3EH1A 1D1AA 1MV0B 1WHKA 2VB6A 4J6WA 1VQ6T 2K5IA 4MDXA 2KT1A 3HFNA 1X01A 1NJIR 3EFOB 1FWZA 2COWA 2QEXT 2JMCA 2RQUA 2EKHA 5GJWB 3A5ZB 1RADB 1YI2A 5DY9A 1FMKA 2XI9A 1LVKA 2LP5A 5FRNA 2VASA 1MMDA 4M7AG 3NTHA 4J9CA 3R6NA 1S72Q 3UATA 3GOXA 3CCSQ 2X4YA 2YSQA 2HSPA 2K9GA 2V8KA 1K1ZA 4KUIA 2FHDA 1YITQ 1YHQT 2A0FB 5M9OA 3CC4A 3JCMf 3LYIA 2G6FX 4BY6B 1M4ZA 5FU6C 1KG1A 2E6NA 1NEGA 4FYXB 2QG9B 1M90C 1KQ1A 4XTWA 4A4EA 1I81A 1YJ9Q 4KH1B 4M77E 5L23A 2L0AA 2LT1A 2CH4A 3QJ6A 3TREA 2ZGWA 3META 4AG1C 2EYZA 1T0HA 1ZUKA 2YRVA 4FSSA 4JJDA 1JJ2A 2AK5A 4M78D 4PJOC 1GCQA 1G8XA 3EG2A 2E65A 3LH0A 3J81E 2RJFA 4M75D 2A37A 2QAZA 3M0TA 4A53A 1UTIA 4C92F 2CUDA 3QJYA 3THKA 1W2BS 2GTJA 1K73U 3JAME 1VQ8Q 1GCQC 1LJOA 3FJ5A 5D7UA 4PJOA 4TVRA 2KNBB 1K9AA 4OB3B 5D6XA 2ATCB 3LX7A 2J6KA 4J7IA 3SB2A 2J06A 1X27A 3G6EA 1VYUA 3S3MA 2PTKA 4LUDA 1NYGA 2GGRA 1TU0B 1YP5A 2JOYA 2JM8A 1XJWB 2VVKA 1OYXA 1YJWT 1NPPA 4HKEA 3QXEB 1C1AA 4J9EA 4C5IA 4XTXA 4AG2C 3OYAA 4MZPA 4PL6A 4C92G 1AVZC 3JCMh 4M77D 1IGQA 2ZPBB 1YJNA 5HK3A 4FM4B 2KT8A 4HCCA 2DAQA 1QMCA 4KGZB 2DXBA 1PWTA 2GTOA 1VQ5A 2O4XA 1TH7A 2BIVA 1WLPB 2XKOC 3EG3A 3MP6A 4M75B 2L3PA 2XU8A 5LJ5f 2YWWA 1QVFS 1VQMT 4M78F 3MP8A 2P0PA 2V1QA 5D6YA 1VQOA 1UJ0A 1M3CA 2DL3A 1W1FA 1SHFA 2X4JA 3M0PA 2DFUA 1I5LA 4BUGA 4NS5A 2XDPA 1H3ZA 3J80E 1CKBA 2QQRA 3SWNA 3HFOA 3FC3A 2KE9A 4A63B 1VYVA 1SSHA 2V8JA 1OOTA 3L42A 3A8OB 4BI3A 3CC2Q 3C94A 3CCLT 2O4XB 1VQMA 4JZ4A 3L1AA 2KAFA 4F14A 2DZ9A 1BCMA 3CD6Q 8ATCB 1TG0A 2VGNA 3EGUA 2JN0A 1PKSA 3P8HA 1OU8A 2JT4A 3M0QA 2O2OA 3OSVA 4MMLA 3CBPA 2BE7D 3JB9G 1VQ8A 1QW1A 2GQVA 1G3WA 2CZ0B 2JM9A 2EBPA 2K2MA 2LC4A 1YI2T 1VQLA 1WQ7A 3FB9A 2DX1A 4IURA 4J9DA 3E2UA 3CD6T 4CC2A 1YITT 3AHUA 5L8RE 1IRXA 4A4GA 1YHQA 5AT1B 4OMLA 3CMEA 3OYDA 2CS7A 4PLIA 4AFZC 4YTLA 3I55A 1VQ4T 2COYA 1H3HA 3OYFA 2K6DA 4KUDK 2FB7A 5GAOl 3M56A 1ZQ1A 2K3BA 3OYHA 4N0AA 3RKYA 1NLPC 1H641 5KYUB 4M7AC 2ZCFB 4C92D 3PMTA 4E2FB 1PD0A 2WSCE 4EMHA 2OTLA 3G6EQ 1VQ6A 3PMIA 1KQSS 2EGAA 2QK0A 3OQ5A 3ZFJA 2NLUA 2DBKA 5LJ5h 3RERA 2FZCB 2E5KA 1WXTA 5CAIA 1TWBA 4FIBA 4LDUA 3CD6A 1YWPA 1RI9A 1TUGB 3T9NA 2DEQA 1JEGA 3CMAQ 2ED0A 1QLYA 4C8QG 2HNIA 3PTAA 5CKBA 2A08A 4M75G 2QI2A 5KYUA 4EMGA 4HCZA 1VQPT 2RQRA 3OSSC 1ZBXA 4XU3A 1MGQA 3EGDA 3JB9J 3TU4K 3NGPA 4M78G 2LQNA 4M7AE 1VQ7Q 1WXUA 8AT1B 1R8OB 4Z02A 1SKUB 3DB3A 3MEAA 5GAN4 3QPHA 3VS5A 4F7UA 1WXBA 2VXEA 2X35A 3VS1A 3O5ZA 3OYKA 3CCEA 3E1SA 3QYHB 3CBOA 1FMWA 5I21A 3OYNA 4JS5A 4LDVA 3ME9A 4E7LA 3M5AA 2M02A 2JMAA 3BDLA 2ABLA 2RM4A 2E5QA 3CXCP 4UC4A 2GCXA 4RMOA 4ZGDB 1OPKA 4ZNXA 4HVWA 4PJLA 2LX9A 2QA4A 1U1SA 3PT9A 2CYZB 4F16A 2AIRB 2DBMA 1ZSZC 1OULA 2BZ8A 1AWWA 3QWYA 4JJCA 2GQIA 2FZKB 1PG5B 4RTZA 1WZOA 4M7AF 2H8HA 1M1FA 4J9FA 3UA7A 3EFOA 3M53A 4WTOB 1KD1U 2CDTA 2LJ1A 4C0GA 4F7UE 4L59A 4ELYC 2KK4A 1ARKA 3QBYA 1VQ9T 2VXFA 2E64A 1VQNA 2EJ9A 2GNCA 4BDYA 2A28A 2EIFA 2D8JA 1UJYA 4MDWA 2W0ZA 3HRSA 3OYEA 1D0ZA 1TOVA 2K79A 1JXMA 3QZ5B 4L5GA 4M75A 2DVEA 2E4HA 2YXYA 2YUOA 5KCHA 2PUKB 4XQ3A 2RHYA 4FW2A 2MWOA 5GAOp 3E9FA 5HY6A 1OZ2A 2D8HA 4OB2B 1IB8A 3ULRB 2DMOA 1GFCA 2CP2A 2RF0A 5KE2A 2V8IA 4ESRA 4E6RA 2L3SA 5A0DA 2OTJQ 1M1KC 4BB7A 2QEXA 4FL6A 4KH0B 4C0DB 2LX7A 4J9GA 2YLCA 3S3OA 1JU5C 2DYIA 2R57A 2O9VA 1PKTA 4XU2A 2K7AA 4D6WA 1LNXA 4M7DF 1SPKA 3L2QA 1Q86R 1ZUUA 2MOXA 3A98A 1QVGS 2E3HA 1W2BA 1M8MA 2DE0X 2OTJT 2VC8A 1KQSA 1W6XA 2K3XA 2KRMA 2ZPGB 5LJ5e 1NPRA 3V8KA 4C5HA 4C5EA 3CMAT 2XICA 2FZGB 2GBQA 1GXIE 1D0YA 1HD3A 3C95A 9ATCB 2MCNA 1M90R 1VQ8T 2DL5A 5GAN5 1VQMQ 1G3YA 3TQ7P 5GAN8 3CC2A 3LGFA 4RCCA 2NUTA 3JSCA 1ZUYA 4J5YA 1TUDA 5IHIA 3LWIA 5KYXA 3HSBA 1G2BA 2K57A 1NZ9A 3G4SQ 4HVUA 3SEMA 4E7KA 2KVQG 1YFNA 3GP8A 1VQOQ 4A4KA 4R56A 3GLXA 2DD4A 2DILA 1QKXA 1YJ9A 4L6V5 1VUBA 1RL2A 2V1RA 4XTUA 3SWNB 2MF2A 2LZ6B 4CC7A 5GAN6 3FRNA 3N5BB 1K8AR 4ORZA 1KQ2A 4LXCA 2KRSA 2DL8A 3JCMV 2ZPHB 2DVJA 1X2KA 2OX7A 2RPNA 3H8ZA 3EH2A 2KDSA 1TTHB 2M16A 2YUNA 2AKKA 5KYXB 5KYWA 1PNJA 4LD6A 4PJNA 4F04B 5IAYA 2M0YA 5GAOq 3JCMX 3OS1A 4BACA 1R0CB 1XOVA 2RJDA 4PJOD 1BIAA 5KE3A 3CCUT 2XDBA 2HEQA 2YUPA 1X6BA 5EG2A 3MPUB 2JTEA 1RI0A 3L2VA 3FLGA 3OYCA 2D0QB 1N9SA 1N27A 3CC7T 2MIOA 2ZPFB 2K3YA 1NG2A 1RUWA 1M2VB 1YCSB 2DA9A 3CCRT 4NL3A 2X4XA 3L2ZA 2E3IA 3X24B 3OBWA 2EW3A 2RI3A 3CMEQ 3HP9A 2QGFB 3BFMA 3CCMA 2FPFA 2CKKA 5CQYA 1QCNA 1WQWA 1E7OA 1X2QA 1R77A 2DXUA 4EMKA 3CCVQ 1KHCA 3S6WA 1AWOA 3NMZC 2F5KA 3BY7A 2BE9B 1S72T 5LJ3h 4M7DC 2XMFA 4ZTJA 3QHSA 1E6GA 4JLGA 1I07A 2RJCA 4M77A 1ZBJA 4JZ3A 5J39A 4FT2A 5LJ5g 3LH5A 2HAXA 1VQNQ 1ZX6A 1ZSGA 2GFAA 4E7HA 2D6FA 2DJQA 2FPEA 3OW2S 5A0GA 2M9UA 2IIMA 4FYYB 4LD9K 1NM7A 1AOJA 3CEYA 3RMQA 2MYSA 2E1HA 3OMCA 3PVLA 4C0ZA 1QP3A 4OGEA 2F2VA 5D6WA 1T3LA 3MEUA 4HCKA 2YUQA 1IGUA 2LCSA 2AZVA 2FVUA 3G71T 1Q7YC 1CSKA 3SHWA 3FEOA 3H9NA 2CP7A 3HRTA 4DOVA 4QQGA 2D1XA 2B86A 1X6GA 2QYZA 2HCKA 1RAHB 3UPUA 4HT8A 1ACMB 3H0FA 3CCUA 2R5MA 3EGDB 1UECA 2LQ8A 4AFUC
chains in the Genus database with same CATH topology
2WSFE 4QVZA 3P8BB 3X28B 1VQ6A 2HBPA 3C12A 3E19A 3PMIA 3X26B 1VQKA 1KQSS 2E12A 3CPFA 3OQ5A 3L2WA 3ZFJA 2NLUA 3WXMB 5LJ5h 3L2RA 3RERA 3I56A 4XU1A 2QQ9A 5LJ3j 3OMGA 4C0FA 3SDZA 5CAIA 4FIBA 2I2LA 3MP1A 5GAMf 2R58A 4LDUA 4C0DC 1M9SA 3CD6A 2JTMA 3MEWA 4HA8A 3QG1A 4M77G 4M7DA 4BE0A 5DM7R 1DJ7B 3T9NA 4O6JA 2DEQA 4F7UB 2XK0A 4ATOA 2F5TX 2EKOA 3A8GB 1YIJT 3ZBDA 1X6OA 2DK3A 2HNIA 5CKBA 3UT1A 4C8QG 1WJQA 2RHXA 4C8QA 3FDRA 5I2SA 3PTAA 1VQ4A 1G5VA 5DLOA 1YIJA 4M75G 2QI2A 2IVWA 4JLIA 4EMGA 1K8AU 3JCMe 4HCZA 4JJNK 1HXDA 1Y96B 1VQPT 4WF2A 3OSSC 3CPWS 1ZBXA 1Y71A 5FU6B 1BI2A 1MGQA 4XU3A 2H3JA 1VQNT 1P92A 5LJ5j 1N8RU 4O5VA 4OB1B 4ZGJB 1W4SA 1VQPA 2RH2A 3JB9J 2OTLT 3TU4K 1WJSA 1JRIA 4M78G 5GAN7 2MAMA 4M78E 4M7AE 3VUZA 1VQLT 1UGPB 2DIQA 5GANd 1MHNA 3OYIA 2DTHA 4XTYA 4IUUA 4PKCC 3QUIA 4E7JA 5FU7B 4J83A 4OMFB 2JUFA 2EFIA 2LCLA 2OAUA 2P0KA 4GY5A 4NL2A 4M7AB 1PSEA 1R8OB 2PU9B 3JCMb 4JRKA 4Z02A 3JCMW 4M75E 3DB3A 1XQHA 2MMPA 4C8QC 4B9WA 2QQSA 5LJ5d 3MEAA 4N0AC 5GAN4 4BE2A 3QPHA 4ZN3A 1VQ7T 4F7UA 2DKGA 5LJ3f 3V7CA 2VXEA 2RHUA 3RUXA 2JVVA 2X35A 2O01E 1M1KU 2DXTA 1WJRA 2BUDA 3QO3A 4HCBA 3OYKA 3M4YA 5GMKh 4ZGEB 3CCEA 3DLMA 3E1SA 3CBOA 2XIDA 3HL8A 2PVGB 3QYHB 3NTIA 5A2QE 3MO8A 5IT9E 5I21A 3G7ZA 4LDXA 3OYNA 4JS5A 1VIEA 4LDVA 5FROA 3ME9A 3EFRA 1JB0E 2K2VA 2YHTA 3RIRA 3RKWA 3I55T 1Y96A 3Q1JA 4E7LA 1I8FA 2RJEA 5FLXE 2QXFA 3M5AA 3CCQA 2WACA 1O75A 3BDLA 4BDZA 2RM4A 5HK0A 2E5QA 3KUFA 2P4TA 2GCXA 4UC4A 3ZEHA 3M59A 4RMOA 3MEVA 2EQUA 1M90U 5KH6A 4XK8E 3O8VA 3M54A 4ZGDB 2LTOA 2DXCA 2LQKA 2M1HA 2CZ1B 4XAXB 4A4HA 2A7YA 3QZ9B 4OGCA 1ZHIA 3VV0A 1UB4A 2LX9A 4DOWA 1M8VA 2RK1A 4M7AA 3JCMJ 3C4SA 4JS4A 2EQJA 3OB9A 1BI3A 2GFUA 1U1SA 2RD1A 5GMKe 4M78C 3SD4A 1WGSA 3PT9A 2QA4A 4ME7A 2CYZB 4M75F 2K5FA 2FYKA 3JB9F 5GMKm 2D9TA 3NTKA 1YJ9T 3CMET 2IG0A 4IKFA 3CCSA 2ZPEB 4JRIA 4RKUE 5CIUA 2VYTA 3A8HB 4BI4A 2CGHA 1O9SA 2DIGA 4RCBA 5CVIA 3RESA 1QVPA 4IUTA 1M1FA 5GMKl 4ZN1A 3LLRA 2RI5A 5CCAA 3JCMP 5GAN2 4M7AD 1D3BA 1WPYA 2E6ZA 2PUOB 1KC8U 5CK9A 3M53A 1Q86C 4DQ2A 1Q81C 1KD1U 3MHXA 4C0GA 2LVMA 4F7UE 4CRIA 4L59A 3VYHB 4ELYC 1N8RC 3M57A 2E41A 1B34A 1N9RA 1NE8A 2KK4A 4MZTA 3JCMg 1VQKT 2OTJA 4GLKA 3QBYA 4LDYA 4QVDA 2VXFA 1VQ9T 1Q7YU 3F70A 2E64A 1VQNA 2EJ9A 2KSSA 1Y07A 4QQDA 4BDYA 1QVGA 3PGGA 2EIFA 4JRQA 3M58A 2PVOB 4KBMB 3X25B 3ASKA 4MDWA 3G4SA 3HRSA 2VGMA 5A0LA 2LNVA 3RMSA 3OYEA 4N4HA 5GAMh 3G6ET 3J7AF 2RK2A 3QZ5B 2PQWA 4L5GA 4M75A 2DVEA 1HK9A 1EIFA 4M77C 1UGQB 3SWNC 5C0MA 5C6SA 5KCHA 3KXTA 2PUKB 4N4IA 2JNGA 4XQ3A 4MZMA 4XTZA 2RHYA 1JBMA 4CI0C 3PNWC 3H6ZA 1IREB 2MWOA 5GAOp 3E9FA 5HY6A 4J6WA 4B9XA 1OZ2A 2K5IA 3CCVA 3HFNA 1VQ6T 4MDXA 4OB2B 1D3BB 1X01A 2RA2A 3URGA 3CXCA 3OBYA 3EFSA 4EMKC 4X34A 4OVAA 1FWZA 5KE2A 2QEXT 4J8OA 2V8IA 5GAOr 3A5ZB 1YI2A 2L5QA 5DY9A 4KT0E 3OYJA 3M55A 3OS5A 5A0DA 2HQEA 2EJGA 1M1KC 5LJ3g 2XI9A 5FRNA 1VQOT 1YJWA 1B34B 4BB7A 2HQXA 4M7AG 2X4WA 3NTHA 5LL6S 4C92A 2CZ7B 2QEXA 4FL6A 3V8JA 5GANf 1X75C 3CXCS 3VKIA 3CPWA 5GANh 3OYLA 2L8DA 4OB0B 4C0DB 3GIBA 3GOXA 3KBGA 2EYQA 1LOJA 2X4YA 2YLCA 4E7IA 3S3OA 5FU7C 4IUVA 4Q5WA 1YJNT 2V8KA 2Y4XA 4KUIA 2FHDA 1S72A 1YHQT 3LGLA 2R57A 5M9OA 4XU2A 3CC4A 3QYGB 4X9CA 3JCMf 3LYIA 4D6WA 5GAN3 4BY6B 2RHZA 1LNXA 1M4ZA 2JTFA 5FU6C 1Q81U 2RHIA 4PNOA 4EMKB 1KG1A 3UWNA 2KMTA 3TEEA 2E6NA 1M1GA 4M7DF 1M90C 1KQ1A 4XTWA 4A4EA 1I81A 3E9GA 3L2QA 1U8RA 4P5NA 4M77E 5AYFA 3CCMT 2LT1A 4MMKA 1QVGS 3GPLA 1W2BA 4OF1A 5HKCA 3DKMA 3M9QA 3X20B 4JRPA 1YITA 2OTJT 3QJ6A 3TREA 4M77B 1VQ5T 2VC8A 1KQSA 4C8QE 2DO3A 2ZGWA 2K3XA 3META 2ZPGB 4RG2A 3VYGA 2YRVA 1NPRA 5CQXA 4C92B 3V8KA 5LJ5e 1JJ2A 4R55A 4C5HA 4C5EA 4M78D 4PJOC 3CMAT 3CC7A 2XICA 1N6AA 3CCJA 1GXIE 5GANj 1Q82U 3A8MB 2E65A 3LH0A 2MI6A 3C95A 2LRQA 1NJIC 1JJ2S 3GNFB 1VQ8T 4JUVA 4FU6A 2YLBA 1QVFA 5GANe 2RJFA 3J81E 4M75D 4RG8A 1FX7A 3INZA 5I2MA 4OP0A 5GAN5 1G3YA 4A53A 5GAOn 5GAN8 4C92F 4BE1A 5FRMA 3QJYA 3CC2A 3LGFA 1XNIA 4RCCA 5CO7A 1W2BS 3G71A 3JSCA 2LDMA 3V7RA 2RI2A 1K73U 3JAME 3R6OA 1BYMA 3RKXA 1LJOA 3I56T 3M4GA 4PJOA 4II1A 5CKDA 4TVRA 2E10A 3OYYA 4J5YA 2DTOA 4J6YA 4OB3B 5D6XA 3LX7A 1PSFA 2DD5A 3HRUA 4J7IA 3SB2A 3LWIA 2KY9A 3G6EA 4J6XA 1Q82C 3HSBA 3S3MA 4M7AF 2K57A 2DZCA 1NZ9A 4LDWA 1K9MU 4E7KA 4N4GA 2WSEE 2JOYA 2KVQG 3VU3C 3CBMA 3QDRB 4QQ6A 3OS2A 4X9DA 4C8QD 3OW2A 3GP8A 2LT4A 1OYXA 3HPWA 4A4KA 4R56A 1NPPA 2A3LA 3GNGA 4HKEA 3QXEB 1YJWT 2RB6A 1VQ9A 4C5IA 4XTXA 3GLXA 3CC4T 5GAMe 1K9MC 4EDUA 2DD4A 3OYAA 5GMKi 4MZPA 4PL6A 4C92G 3CCRA 2EQKA 4F7UG 4M77F 4QW2A 1YJ9A 3JCMh 4M77D 2P0QA 4FSXA 1VUBA 4L6V5 4FT4A 2ZPBB 1YJNA 1RL2A 2BKDN 5HK3A 4XTUA 3OYMA 4FM4B 3SWNB 4PJOE 1QP2A 2MF2A 3VUBA 4HCCA 5CKEA 2DAQA 3JB9I 5GAN6 2XD0A 3FRNA 3N5BB 3OYBA 3OA6A 2QA4T 5LJ3d 4C8QF 1G3TA 5GAMj 2DXBA 2K5LA 4BD3A 5GAMg 4ELZC 1KQ2A 5KCOA 4A54A 1SSFA 3JCMV 1VQ5A 1XTDA 2ZPHB 3JCMc 3H8ZA 5CKFA 2KDSA 1VIFA 1BIBA 2O4XA 1YBYA 2FL7A 4J7FA 1AHJB 2RO0A 1TH7A 5J3BA 2BIVA 2XKOC 3MP6A 4M75B 2XHCA 4C92C 3FJPA 2M16A 4EPCA 3QSUA 2XU8A 5LJ5f 4LD6A 4M7DE 1QVFS 5IAYA 1VQMT 1I4K1 4M78F 3MP8A 2P0PA 4C8QB 3JCMX 5GAOq 3OS1A 2KQWA 5D6YA 5GAMd 4BACA 2DJZA 3TCJA 1XOVA 4C5GA 1VQOA 2RJDA 3ER0A 1BIAA 3P8DA 5KE3A 3CCUT 4HT9A 4PJOD 2XDBA 2X4JA 2F69A 2QDYB 3DLLA 5EG2A 4A4FA 1I5LA 3CCET 1RI0A 1KC8C 4BUGA 4DA4A 4NS5A 2CZ6B 3FLGA 3L2VA 2XG8D 3JB9H 2G3RA 1YCYA 1N9SA 2D0QB 1UGRB 3V8LA 3OYCA 3CCJT 1N27A 3CC7T 5GAOm 3CCQT 2XDPA 2K3YA 2ZPFB 3J80E 1H3ZA 2AHJB 3SWNA 2QQRA 3FC3A 3HFOA 5GANg 3OY9A 3GF5A 2EQMA 4M75C 3CCRT 4NL3A 1BKBA 2EWNA 3A8LB 2V8JA 2QTXA 2X4XA 3L2ZA 3L42A 3A8OB 3CCST 1KD1C 4BI3A 5J26A 3CCLA 3X24B 1KHIA 3C94A 3OBWA 3CCLT 2RI3A 3HP9A 3NFCA 2B8AA 2L89A 2O4XB 1VQMA 2LCCA 3BFMA 3CCMA 4Y28E 2CKKA 3SFMA 5CQYA 3L1AA 2KAFA 1WQWA 2C06A 4F7UF 2DZ9A 3WVDB 2DXUA 3QKJA 4EMKA 1KHCA 3S6WA 2GF7A 2VGNA 3OS0A 2JN0A 3LW5E 4PLLA 1U1TA 3P8HA 4NOYA 2F5KA 4VUBA 3JB9D 3BY7A 2EJFA 1UGSB 3V7SA 1S72T 4JDSA 3WVEB 3DB4A 1K73C 5LJ3h 3PFSA 4IUPA 4M7DC 2R5AA 3OSVA 4BY6C 1OI1A 4E47A 4ZTJA 1BI0A 3QHSA 5CKHA 5GMKj 2HD0A 3PIOA 4JLGA 3PIPA 3QIIA 3CCVT 4MMLA 2RJCA 4M77A 2JZ2A 3CBPA 2MWPA 2ZPIB 5J39A 3JB9G 4M7DG 4V2SA 1V29B 2VUBA 4FT2A 5LJ5g 2PVDB 4ZTFA 1VQ8A 1QW1A 2HAXA 2GQVA 3VJPA 4M78A 1G3WA 3BW1A 3LWHA 1Y7XA 2CZ0B 2GFAA 4QVCA 4E7HA 2D6FA 2LC4A 4Y91A 3JCMd 1YI2T 4BI8B 3BDUA 3OW2S 3CMAA 2QQBA 5A0GA 2E70A 1VQLA 2M9UA 1Q86U 1WQ7A 2ZZDA 3FB9A 3G4ST 4LD9K 2XDDA 4PJOG 4IURA 3CEYA 3S3NA 3HKSA 3RMQA 3CD6T 1WNLA 3JRZA 2E1HA 3OMCA 1YITT 4C0ZA 1QP3A 4OGEA 3AHUA 5L8RE 4M7DB 5D6WA 4M7DD 1BI1A 4A4GA 3MEUA 1YHQA 2VV5A 3OYGA 4IUQA 3CMEA 4XTVA 2Y90A 2FVUA 3EAEA 4KULA 3G71T 1Q7YC 3OYDA 1IZ6A 2CS7A 3CC2T 1UEBA 4PJOB 4PLIA 5IN1A 4YTLA 4XU0A 5DLQE 2DTIA 1K8AC 3FEOA 3I55A 1VQ4T 5CR2A 1G3SA 4C92E 3HRTA 3OYFA 3L2UA 2M0OA 4DOVA 2FB7A 2L3RA 3MCAB 4QQGA 4KUDK 2DPPB 5GAOl 3HHTB 1ZQ1A 3M56A 1FXXA 3OYHA 1OZ3A 4N0AA 3RKYA 1H641 4M7AC 3FIFA 4M78B 2K4YA 1M5Q1 3UPUA 2EAYA 3UDCA 3JCMQ 2ZCFB 4C92D 1VQ7A 5LJ3e 4HT8A 3PMTA 2QQAA 1NJIU 4PJOF 2WSCE 2Y4YA 4EMHA 3CCUA 2OTLA 2R5MA 2LQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDB A;  4RMO A;  4GLK A;  4ATO A;  2XD0 A;  2XDD A; 
#chains in the Genus database with same CATH topology
 2WSF E;  4QVZ A;  2NUZ A;  3X26 B;  4PJM A;  4CC3 A;  2E12 A;  3L2W A;  3L2R A;  3I56 A;  1SRM A;  3OMG A;  3H41 A;  3G71 Q;  1KSW A;  1BK2 A;  1LCK A;  2R58 A;  3RR6 A;  4PK4 A;  1YJW Q;  1Q82 R;  4HA8 A;  3CCR Q;  4F7U B;  2KGT A;  3A8G B;  3EHQ A;  4OMM A;  1AWJ A;  3D7S B;  1WJQ A;  4C8Q A;  2O9S A;  1G5V A;  1K8A U;  4E7S A;  2KRN A;  1M30 A;  3VS2 A;  1WX6 A;  1G83 A;  1UHC A;  1B3Q A;  4O5V A;  1VQP A;  5GAN 7;  2MAM A;  4M78 E;  1D1B A;  3VUZ A;  1VQL T;  1VQP Q;  4IUU A;  3QWX X;  3EGX A;  4GY5 A;  4NL2 A;  1PSE A;  2DRM A;  3JCM W;  4M75 E;  4C8Q C;  4B9W A;  1PC0 A;  4BE2 A;  1VOM A;  1VQ7 T;  4FYV B;  5LJ3 f;  3V7C A;  1TXQ A;  2JVV A;  1WJR A;  4HCB A;  3M4Y A;  1Y57 A;  5IT9 E;  2PVG B;  3NTI A;  1JJ2 P;  1OX9 A;  2FRY A;  5FRO A;  1VQK T;  3I55 T;  1VQ4 A;  3Q1J A;  3OW2 P;  2RJE A;  5FLX E;  3CCQ A;  5HK0 A;  2RN8 A;  1UFF A;  2EQU A;  1M90 U;  3O8V A;  2DXC A;  1YJN Q;  2AZS A;  3QZ9 B;  4OGC A;  3NHN A;  1M8V A;  3EGX B;  2LNH B;  5KYY A;  2DRK A;  4M78 C;  2RNA A;  1X69 A;  1QCO A;  4M75 F;  2LMJ A;  2K5F A;  1JQQ A;  1HYO A;  4Y92 A;  2DIG A;  1O9S A;  2KXD A;  4ZN1 A;  5CCA A;  1KC8 R;  1YIJ Q;  3I5R A;  1D3B A;  1WPY A;  2QTV A;  4AFQ C;  1Q86 C;  4DQ2 A;  1IXD A;  3MHX A;  1M27 C;  1KQS P;  1MND A;  2LVM A;  4CRI A;  2E41 A;  1B34 A;  1WFW A;  7AT1 B;  2OTJ A;  4QVD A;  2C0T A;  1B07 A;  4JRQ A;  3G4S A;  2AT1 B;  1OV3 A;  2CT4 A;  3RMS A;  5GAM h;  2HBW A;  1EIF A;  2J6O A;  4M77 C;  1NYF A;  3KXT A;  1SEM A;  1EZZ B;  2JS2 A;  4FYW B;  1JBM A;  4FW1 A;  3H6Z A;  3CCV A;  4B9X A;  1D3B B;  3CCU Q;  3CXC A;  3OBY A;  4EMK C;  4X34 A;  4OVA A;  2EYX A;  2ROL A;  1NBE B;  4KT0 E;  1IHV A;  3M55 A;  4CC4 B;  3OYJ A;  2BZX A;  1AWX A;  2EJG A;  2HQE A;  5LJ3 g;  1AZG B;  1VQO T;  1M3A A;  2J6F A;  1B34 B;  4C92 A;  3V8J A;  2OI3 A;  3CXC S;  3VKI A;  3CPW A;  2L8D A;  4HVV A;  4RTX A;  2QAS A;  3KBG A;  1GBR A;  1LOJ A;  4DBQ A;  2MPX C;  2O31 A;  3LGL A;  2CSI A;  3PVQ A;  4X9C A;  1N8R R;  2DET A;  2JTF A;  2RHI A;  4EMK B;  2KMT A;  3TEE A;  1WDX A;  2KYM A;  3E9G A;  1QWE A;  3VRZ A;  3GPL A;  4OF1 A;  3A1P A;  3DKM A;  3H0H A;  4ANJ A;  2JJ9 A;  4JRP A;  1UUE A;  4M77 B;  1VQ5 T;  3H0I A;  4C8Q E;  2DO3 A;  3VYG A;  4C92 B;  1ABO A;  4R55 A;  2KXC A;  2P4R A;  1ZLM A;  1N6A A;  3CCJ A;  3EG9 A;  5GAN j;  1TS9 A;  2ECZ A;  2X3X D;  1NJI C;  3GNF B;  4DBR A;  1QVF A;  5GAN e;  1I5O B;  4RG8 A;  3INZ A;  4OP0 A;  2ROT A;  5GAO n;  1XNI A;  5CO7 A;  4R0K A;  2LDM A;  5IXF A;  1C6V X;  3RKX A;  1BYM A;  1WIE A;  2X51 A;  4II1 A;  5CKD A;  1MMA A;  3CCJ Q;  2DTO A;  4J6Y A;  3CC7 Q;  1PSF A;  1M1K R;  1AZE A;  1RAA B;  2DZC A;  4N4G A;  2WSE E;  1OX8 A;  3VU3 C;  3CBM A;  3QDR B;  4PFO A;  4X9D A;  4C8Q D;  3OW2 A;  2LT4 A;  3HPW A;  1R0B G;  3CC4 T;  1K9M C;  5GMK i;  3CCR A;  2EQK A;  4RTT A;  2CSQ A;  2FG0 A;  4KGX B;  4M77 F;  2P0Q A;  4FSX A;  4FT4 A;  4PJO E;  1QP2 A;  1M2V A;  5CKE A;  3OYB A;  2PNI A;  2LJ0 A;  4C8Q F;  5GAM j;  3JV3 A;  4BD3 A;  1JXO A;  5GAM g;  4A54 A;  1XTD A;  2JS0 A;  2CP5 A;  5CKF A;  1VIF A;  1BIB A;  2ED1 A;  4J7F A;  4D8D A;  2CUB A;  4C92 C;  3FJP A;  4EPC A;  1Q95 G;  2I0N A;  2NWM A;  1I4K 1;  4C8Q B;  2FRW A;  2KQW A;  1Q81 R;  2RQT A;  2DJZ A;  1VQ9 Q;  4HT9 A;  2X3W D;  2F69 A;  1PRM C;  4A4F A;  3VS0 A;  1OQK A;  2CZ6 B;  3JB9 H;  2G3R A;  1UGR B;  1X43 A;  1SF9 A;  2AHJ B;  1QVF P;  1H92 A;  1M3B A;  1AD5 A;  2QTX A;  1PRL C;  1GL5 A;  5J26 A;  1VQ5 Q;  1KHI A;  2O88 A;  4Y28 E;  2C0I A;  2DL4 A;  3SFM A;  2KR3 A;  1WHL A;  4F7U F;  3WVD B;  4EIK A;  2GF7 A;  4KRT A;  2CH4 W;  3LW5 E;  3NPF A;  1U1T A;  4PLL A;  4NOY A;  4VUB A;  3JB9 D;  1CKA A;  2EJF A;  1UGS B;  3KFV A;  3WVE B;  1K73 C;  4DEY A;  1OI1 A;  4E47 A;  1BI0 A;  5CKH A;  4AFS C;  3CCV T;  3QII A;  1T3S A;  1MNE A;  2MWP A;  4V2S A;  2VUB A;  4ZTF A;  6AT1 B;  1Z9Q A;  5FWC A;  4M78 A;  1YWO A;  4QVC A;  3BDU A;  3CQT A;  1D09 B;  2QQB A;  3HTR A;  2E70 A;  1Q86 U;  2ZZD A;  4OMP A;  2YRC A;  1WNL A;  3JRZ A;  4QT7 A;  1PCX A;  4M7D D;  1WYX A;  1UE9 A;  3ZL7 C;  3I56 Q;  3OYG A;  4IUQ A;  2QDL A;  4XTV A;  2Y90 A;  4KUL A;  3I9Q A;  2DER A;  1VYT A;  1W70 A;  4PJO B;  5IN1 A;  2VWF A;  4XU0 A;  2DTI A;  1K8A C;  5CR2 A;  3L2U A;  2M0O A;  3MCA B;  2CT3 A;  4PFP A;  1Y0M A;  3MJX A;  1UDL A;  4J9H A;  1VA7 A;  1SHG A;  1OZ3 A;  2KBT A;  4B6M A;  1RAC B;  4M78 B;  1BB9 A;  2K4Y A;  4F17 A;  2EAY A;  3UDC A;  1AT1 B;  1NJI U;  2EGE A;  2AKL A;  2HBP A;  3RBB B;  3E19 A;  2C0O A;  3CPF A;  4XU1 A;  5LJ3 j;  4C0F A;  3SDZ A;  2I2L A;  3MP1 A;  2J05 A;  4C0D C;  3BE3 A;  2JTM A;  3MEW A;  4M77 G;  2YRD A;  2F1L A;  4BE0 A;  2BZY A;  2COZ A;  2QEX Q;  2XK0 A;  4ATO A;  2F5T X;  2JXB A;  1YIJ T;  3VS6 A;  2NUP A;  4K11 A;  2DK3 A;  5I2S A;  5IHK A;  5DLO A;  2IVW A;  2DF6 A;  3JCM e;  4JJN K;  1HXD A;  4WF2 A;  5FU6 B;  1BI2 A;  4OMN A;  2H3J A;  1VQN T;  2HL3 A;  2RMO A;  1N8R U;  4OB1 B;  4ZGJ B;  1W4S A;  2RH2 A;  2JW4 A;  1WJS A;  1JRI A;  2F2X A;  1GCP A;  1UGP B;  2DIQ A;  5GAN d;  3I5S A;  4E7J A;  5FU7 B;  4J83 A;  1PHT A;  4AMC A;  2OAU A;  4M7A B;  3JCM b;  4JRK A;  2MMP A;  2QQS A;  5LJ5 d;  2HSE B;  3QDF A;  3RNJ A;  3I55 Q;  1LPL A;  3RUX A;  4LN2 A;  2O01 E;  2DXT A;  2BUD A;  3QO3 A;  4J9I A;  5GMK h;  4ZGE B;  2F2W A;  3HL8 A;  2XID A;  5A2Q E;  3G7Z A;  1V1C A;  3EFR A;  1JB0 E;  2K2V A;  2YHT A;  3RIR A;  3RKW A;  1Y96 A;  1I8F A;  2QXF A;  2LQW A;  4DBF A;  5HCK A;  4BDZ A;  2EVR A;  4FCY A;  3ZEH A;  3M59 A;  5KH6 A;  3M0U A;  2L2P A;  2CZ1 B;  4OMO A;  2A7Y A;  1VQ6 Q;  2NUT B;  3VV0 A;  4DOW A;  2RK1 A;  4M7A A;  3JCM J;  4X1V A;  2EQJ A;  3OB9 A;  1BI3 A;  2GFU A;  2RD1 A;  1KJW A;  5GMK e;  1WGS A;  4ME7 A;  3IQL A;  3JB9 F;  2IPO B;  2D9T A;  3VS7 A;  1YJ9 T;  4IKF A;  2ZPE B;  2VYT A;  3A8H B;  4BI4 A;  4RCB A;  4M7D A;  3RES A;  3OA6 A;  1QVP A;  4M7A D;  3LLR A;  2E6Z A;  2PUO B;  1KC8 U;  5CK9 A;  4WCI A;  1A0N B;  1YHQ Q;  1MUZ A;  1I1J A;  4MZT A;  3JCM g;  4GLK A;  3F70 A;  2KSS A;  4QQD A;  1QVG A;  1VQL Q;  3M58 A;  2HKQ B;  4KBM B;  4M4Z A;  2KEA A;  2VGM A;  5A0L A;  4N4H A;  1UG1 A;  2RK2 A;  2PQW A;  5C0M A;  1UGQ B;  5C6S A;  2SEM A;  1B7T A;  2JNG A;  1V76 A;  4LE9 A;  1FYN A;  4XTZ A;  4MZM A;  1BU1 A;  2EYY A;  3PNW C;  1IRE B;  1NEB A;  3VS3 A;  2HL5 C;  2RA2 A;  3URG A;  1JO8 A;  3EFS A;  4J8O A;  5GAO r;  2L5Q A;  1MMG A;  2RQW A;  3OS5 A;  4E7Z A;  1ZA2 B;  1BCO A;  1YJW A;  2HQX A;  1RAF B;  2X4W A;  5LL6 S;  2CZ7 B;  1UGV A;  1D0X A;  5GAN f;  1X75 C;  2EPD A;  5GAN h;  3OYL A;  2P84 A;  4OB0 B;  3GIB A;  2OAW A;  1Q7Y R;  2EYQ A;  3M0R A;  5IH2 A;  4LUE A;  4E7I A;  5FU7 C;  4IUV A;  4Q5W A;  1YJN T;  2L3Q A;  2SRC A;  2Y4X A;  2HQH A;  1S72 A;  3CCE Q;  3QYG B;  3TVT A;  1SG5 A;  2HMA A;  5GAN 3;  2RHZ A;  1Q81 U;  4PNO A;  1ABQ A;  3UWN A;  4J9B A;  5GJV B;  1M1G A;  4JPB W;  1QKW A;  1U8R A;  4P5N A;  5AYF A;  3CCM T;  4MMK A;  1YNZ A;  5HKC A;  3M9Q A;  3EHR A;  3X20 B;  2CRE A;  1YIT A;  1J3T A;  5IHN A;  2EYW A;  4RG2 A;  5CQX A;  5I11 A;  4IIM A;  1M2O A;  4DEX A;  3CC7 A;  1Q82 U;  3A8M B;  1QVG P;  2MI6 A;  1JJ2 S;  2LRQ A;  4JUV A;  4FU6 A;  2YLB A;  3GBQ A;  5I2M A;  1FX7 A;  1K73 R;  5I22 A;  4BE1 A;  1OPL A;  5FRM A;  2CP3 A;  3G71 A;  3RDV A;  3V7R A;  2RI2 A;  1BBZ A;  3R6O A;  2VKN A;  3I56 T;  3M4G A;  2E10 A;  3OYY A;  2RQV A;  3M0S A;  3PE0 A;  2DD5 A;  1WHJ A;  2OJ2 A;  3HRU A;  2KY9 A;  1K4U S;  4J6X A;  1Q82 C;  3REB B;  3CPW P;  4LDW A;  1K9M U;  1RAE B;  4QQ6 A;  3OS2 A;  1VQ9 A;  2A3L A;  3GNG A;  2RB6 A;  3CCL Q;  2OTL Q;  5GAM e;  4EDU A;  1IO6 A;  4RTY A;  4F7U G;  4QW2 A;  4AT1 B;  2HZY A;  2A36 A;  2BKD N;  3C0C A;  3OYM A;  1WHM A;  3CCQ Q;  3VUB A;  3JB9 I;  2XD0 A;  1QQJ A;  2QA4 T;  5LJ3 d;  1G3T A;  1W2B P;  2K5L A;  4ELZ C;  5KCO A;  1HSQ A;  1SSF A;  2W10 A;  3JCM c;  5KYN A;  1YN8 A;  1YBY A;  2FL7 A;  1AHJ B;  2RO0 A;  5J3B A;  1QWF A;  1MV3 A;  3VS4 A;  2XHC A;  2FEI A;  3QSU A;  3EG0 A;  4M7D E;  2NUP B;  1VQK Q;  1K0S A;  3CCL A;  1GFD A;  4HXJ A;  5GAM d;  3TCJ A;  4C5G A;  3P8D A;  3ER0 A;  1TUC A;  3AT1 B;  2QDY B;  3DLL A;  3CCE T;  1KC8 C;  4DA4 A;  2XG8 D;  3U23 A;  1YCY A;  3CCJ T;  3V8L A;  2CP0 A;  1K76 A;  5GAO m;  3CCQ T;  1U06 A;  2HDA A;  2ZAE A;  5GAN g;  3OY9 A;  3GF5 A;  1SRL A;  2EQM A;  4M75 C;  1BKB A;  2EWN A;  3A8L B;  4IIO A;  3TSW A;  3CCS T;  1KD1 C;  2PZ1 A;  1Z9Z A;  4RTU A;  3REA B;  3NFC A;  2B8A A;  2L89 A;  2LCC A;  1OEB A;  2DNU A;  2Z0W A;  2C06 A;  1MMN A;  3QKJ A;  3G1J A;  2MK5 A;  3OS0 A;  4GLM A;  2KI7 A;  1TSF A;  3V7S A;  4JDS A;  3DB4 A;  3PFS A;  2EGC A;  4IUP A;  2R5A A;  4PFZ A;  4BY6 C;  3PIO A;  5GMK j;  2HD0 A;  2DYB A;  3PIP A;  2JZ2 A;  2ZPI B;  2DEU A;  4M7D G;  1V29 B;  1WHG A;  1ZSZ A;  2PVD B;  4Z89 A;  2M51 A;  3VJP A;  3BW1 A;  3LWH A;  1Y7X A;  3VRY A;  4Y91 A;  3JCM d;  5KYY B;  4BI8 B;  3CMA A;  5FWB A;  4Z88 A;  3G4S T;  3EG1 A;  2XDD A;  1KK7 A;  4PJO G;  3S3N A;  3HKS A;  5IXB A;  1WHH A;  4M7D B;  3I35 A;  1BI1 A;  1D1C A;  2VV5 A;  4D8K A;  4LNP A;  3EAE A;  4Z8A A;  2YT6 A;  1IZ6 A;  4DBH A;  3CC2 T;  1UEB A;  2H3E B;  2X9H A;  5DLQ E;  2V26 A;  2HKN A;  1KIK A;  1I0C A;  1H8K A;  1G3S A;  4C92 E;  2L3R A;  4JJB A;  2DPP B;  1RLQ C;  3HHT B;  1N5Z A;  1FXX A;  1ZSZ B;  1T0J A;  3FIF A;  1M5Q 1;  1VQ7 A;  3JCM Q;  1U3O A;  5LJ3 e;  2QQA A;  4PJO F;  2Y4Y A;  3P8B B;  3X28 B;  3C12 A;  1VQK A;  3WXM B;  1GRI A;  2QQ9 A;  1PD1 A;  2ENM A;  5GAM f;  1M9S A;  2J7I A;  3QG1 A;  5DM7 R;  1RAB B;  1DJ7 B;  4O6J A;  2EKO A;  5KYW B;  4PJJ A;  3ZBD A;  1X6O A;  3UA6 A;  3UT1 A;  2FPD A;  2RHX A;  3FDR A;  1NLO C;  1WI7 A;  1YIJ A;  4JLI A;  3MKD A;  1UHF A;  1Y96 B;  1HJD A;  3CPW S;  1Y71 A;  1OU9 A;  1P92 A;  1RLP C;  5LJ5 j;  1IHW A;  1RAI B;  2BTT A;  2OTL T;  1GBQ A;  4QKU A;  1ZA1 B;  3OYI A;  1MHN A;  1AEY A;  5EC7 A;  2DTH A;  4XTY A;  4PKC C;  3QUI A;  4OMF B;  2JUF A;  2EFI A;  2LCL A;  3TSZ A;  2P0K A;  2CP6 A;  2PU9 B;  1K9M R;  1C0M A;  1XQH A;  2QA4 Q;  2FO0 A;  4N0A C;  2DM1 A;  4ZN3 A;  2DKG A;  2RHU A;  1F1B B;  4RTW A;  1M1K U;  4RUG A;  3CC4 Q;  1VQ4 Q;  3DLM A;  2YDL A;  3MO8 A;  1PM3 A;  2KRO A;  4LDX A;  3EG9 B;  1VIE A;  1RAG B;  1KFZ A;  1O75 A;  2WAC A;  3UF4 A;  3KUF A;  5FW9 A;  2P4T A;  3MEV A;  4XK8 E;  1FMV A;  3M54 A;  2LTO A;  2LQK A;  2M1H A;  4XAX B;  1WA7 A;  4A4H A;  1ZHI A;  1UB4 A;  1YI2 Q;  1EX4 A;  4OMQ A;  3C4S A;  4JS4 A;  2ESW A;  3SD4 A;  2FYK A;  5GMK m;  3NTK A;  3CME T;  2IG0 A;  4RTV A;  3CCS A;  4JRI A;  4RKU E;  5CIU A;  2NYS A;  2CGH A;  1E6H A;  5CVI A;  5GMK l;  4IUT A;  3JCM P;  1U5S A;  2RI5 A;  2DLP A;  5GAN 2;  1S1N A;  1KD1 R;  1Q81 C;  1QCF A;  2EQI A;  3VYH B;  1N8R C;  3M57 A;  1N9R A;  1NE8 A;  2DL7 A;  4LDY A;  2KYB A;  1Q7Y U;  2QGG A;  2D0N A;  4GBQ A;  1Y07 A;  1EFN A;  3PGG A;  4KGV B;  3CCM Q;  2PVO B;  3X25 B;  3ASK A;  2LNV A;  3G6E T;  3J7A F;  1HK9 A;  3SWN C;  2LJ3 A;  1K0X A;  4N4I A;  5ECA A;  4CI0 C;  3EH1 A;  1D1A A;  1MV0 B;  1WHK A;  2VB6 A;  4J6W A;  1VQ6 T;  2K5I A;  4MDX A;  2KT1 A;  3HFN A;  1X01 A;  1NJI R;  3EFO B;  1FWZ A;  2COW A;  2QEX T;  2JMC A;  2RQU A;  2EKH A;  5GJW B;  3A5Z B;  1RAD B;  1YI2 A;  5DY9 A;  1FMK A;  2XI9 A;  1LVK A;  2LP5 A;  5FRN A;  2VAS A;  1MMD A;  4M7A G;  3NTH A;  4J9C A;  3R6N A;  1S72 Q;  3UAT A;  3GOX A;  3CCS Q;  2X4Y A;  2YSQ A;  2HSP A;  2K9G A;  2V8K A;  1K1Z A;  4KUI A;  2FHD A;  1YIT Q;  1YHQ T;  2A0F B;  5M9O A;  3CC4 A;  3JCM f;  3LYI A;  2G6F X;  4BY6 B;  1M4Z A;  5FU6 C;  1KG1 A;  2E6N A;  1NEG A;  4FYX B;  2QG9 B;  1M90 C;  1KQ1 A;  4XTW A;  4A4E A;  1I81 A;  1YJ9 Q;  4KH1 B;  4M77 E;  5L23 A;  2L0A A;  2LT1 A;  2CH4 A;  3QJ6 A;  3TRE A;  2ZGW A;  3MET A;  4AG1 C;  2EYZ A;  1T0H A;  1ZUK A;  2YRV A;  4FSS A;  4JJD A;  1JJ2 A;  2AK5 A;  4M78 D;  4PJO C;  1GCQ A;  1G8X A;  3EG2 A;  2E65 A;  3LH0 A;  3J81 E;  2RJF A;  4M75 D;  2A37 A;  2QAZ A;  3M0T A;  4A53 A;  1UTI A;  4C92 F;  2CUD A;  3QJY A;  3THK A;  1W2B S;  2GTJ A;  1K73 U;  3JAM E;  1VQ8 Q;  1GCQ C;  1LJO A;  3FJ5 A;  5D7U A;  4PJO A;  4TVR A;  2KNB B;  1K9A A;  4OB3 B;  5D6X A;  2ATC B;  3LX7 A;  2J6K A;  4J7I A;  3SB2 A;  2J06 A;  1X27 A;  3G6E A;  1VYU A;  3S3M A;  2PTK A;  4LUD A;  1NYG A;  2GGR A;  1TU0 B;  1YP5 A;  2JOY A;  2JM8 A;  1XJW B;  2VVK A;  1OYX A;  1YJW T;  1NPP A;  4HKE A;  3QXE B;  1C1A A;  4J9E A;  4C5I A;  4XTX A;  4AG2 C;  3OYA A;  4MZP A;  4PL6 A;  4C92 G;  1AVZ C;  3JCM h;  4M77 D;  1IGQ A;  2ZPB B;  1YJN A;  5HK3 A;  4FM4 B;  2KT8 A;  4HCC A;  2DAQ A;  1QMC A;  4KGZ B;  2DXB A;  1PWT A;  2GTO A;  1VQ5 A;  2O4X A;  1TH7 A;  2BIV A;  1WLP B;  2XKO C;  3EG3 A;  3MP6 A;  4M75 B;  2L3P A;  2XU8 A;  5LJ5 f;  2YWW A;  1QVF S;  1VQM T;  4M78 F;  3MP8 A;  2P0P A;  2V1Q A;  5D6Y A;  1VQO A;  1UJ0 A;  1M3C A;  2DL3 A;  1W1F A;  1SHF A;  2X4J A;  3M0P A;  2DFU A;  1I5L A;  4BUG A;  4NS5 A;  2XDP A;  1H3Z A;  3J80 E;  1CKB A;  2QQR A;  3SWN A;  3HFO A;  3FC3 A;  2KE9 A;  4A63 B;  1VYV A;  1SSH A;  2V8J A;  1OOT A;  3L42 A;  3A8O B;  4BI3 A;  3CC2 Q;  3C94 A;  3CCL T;  2O4X B;  1VQM A;  4JZ4 A;  3L1A A;  2KAF A;  4F14 A;  2DZ9 A;  1BCM A;  3CD6 Q;  8ATC B;  1TG0 A;  2VGN A;  3EGU A;  2JN0 A;  1PKS A;  3P8H A;  1OU8 A;  2JT4 A;  3M0Q A;  2O2O A;  3OSV A;  4MML A;  3CBP A;  2BE7 D;  3JB9 G;  1VQ8 A;  1QW1 A;  2GQV A;  1G3W A;  2CZ0 B;  2JM9 A;  2EBP A;  2K2M A;  2LC4 A;  1YI2 T;  1VQL A;  1WQ7 A;  3FB9 A;  2DX1 A;  4IUR A;  4J9D A;  3E2U A;  3CD6 T;  4CC2 A;  1YIT T;  3AHU A;  5L8R E;  1IRX A;  4A4G A;  1YHQ A;  5AT1 B;  4OML A;  3CME A;  3OYD A;  2CS7 A;  4PLI A;  4AFZ C;  4YTL A;  3I55 A;  1VQ4 T;  2COY A;  1H3H A;  3OYF A;  2K6D A;  4KUD K;  2FB7 A;  5GAO l;  3M56 A;  1ZQ1 A;  2K3B A;  3OYH A;  4N0A A;  3RKY A;  1NLP C;  1H64 1;  5KYU B;  4M7A C;  2ZCF B;  4C92 D;  3PMT A;  4E2F B;  1PD0 A;  2WSC E;  4EMH A;  2OTL A;  3G6E Q;  1VQ6 A;  3PMI A;  1KQS S;  2EGA A;  2QK0 A;  3OQ5 A;  3ZFJ A;  2NLU A;  2DBK A;  5LJ5 h;  3RER A;  2FZC B;  2E5K A;  1WXT A;  5CAI A;  1TWB A;  4FIB A;  4LDU A;  3CD6 A;  1YWP A;  1RI9 A;  1TUG B;  3T9N A;  2DEQ A;  1JEG A;  3CMA Q;  2ED0 A;  1QLY A;  4C8Q G;  2HNI A;  3PTA A;  5CKB A;  2A08 A;  4M75 G;  2QI2 A;  5KYU A;  4EMG A;  4HCZ A;  1VQP T;  2RQR A;  3OSS C;  1ZBX A;  4XU3 A;  1MGQ A;  3EGD A;  3JB9 J;  3TU4 K;  3NGP A;  4M78 G;  2LQN A;  4M7A E;  1VQ7 Q;  1WXU A;  8AT1 B;  1R8O B;  4Z02 A;  1SKU B;  3DB3 A;  3MEA A;  5GAN 4;  3QPH A;  3VS5 A;  4F7U A;  1WXB A;  2VXE A;  2X35 A;  3VS1 A;  3O5Z A;  3OYK A;  3CCE A;  3E1S A;  3QYH B;  3CBO A;  1FMW A;  5I21 A;  3OYN A;  4JS5 A;  4LDV A;  3ME9 A;  4E7L A;  3M5A A;  2M02 A;  2JMA A;  3BDL A;  2ABL A;  2RM4 A;  2E5Q A;  3CXC P;  4UC4 A;  2GCX A;  4RMO A;  4ZGD B;  1OPK A;  4ZNX A;  4HVW A;  4PJL A;  2LX9 A;  2QA4 A;  1U1S A;  3PT9 A;  2CYZ B;  4F16 A;  2AIR B;  2DBM A;  1ZSZ C;  1OUL A;  2BZ8 A;  1AWW A;  3QWY A;  4JJC A;  2GQI A;  2FZK B;  1PG5 B;  4RTZ A;  1WZO A;  4M7A F;  2H8H A;  1M1F A;  4J9F A;  3UA7 A;  3EFO A;  3M53 A;  4WTO B;  1KD1 U;  2CDT A;  2LJ1 A;  4C0G A;  4F7U E;  4L59 A;  4ELY C;  2KK4 A;  1ARK A;  3QBY A;  1VQ9 T;  2VXF A;  2E64 A;  1VQN A;  2EJ9 A;  2GNC A;  4BDY A;  2A28 A;  2EIF A;  2D8J A;  1UJY A;  4MDW A;  2W0Z A;  3HRS A;  3OYE A;  1D0Z A;  1TOV A;  2K79 A;  1JXM A;  3QZ5 B;  4L5G A;  4M75 A;  2DVE A;  2E4H A;  2YXY A;  2YUO A;  5KCH A;  2PUK B;  4XQ3 A;  2RHY A;  4FW2 A;  2MWO A;  5GAO p;  3E9F A;  5HY6 A;  1OZ2 A;  2D8H A;  4OB2 B;  1IB8 A;  3ULR B;  2DMO A;  1GFC A;  2CP2 A;  2RF0 A;  5KE2 A;  2V8I A;  4ESR A;  4E6R A;  2L3S A;  5A0D A;  2OTJ Q;  1M1K C;  4BB7 A;  2QEX A;  4FL6 A;  4KH0 B;  4C0D B;  2LX7 A;  4J9G A;  2YLC A;  3S3O A;  1JU5 C;  2DYI A;  2R57 A;  2O9V A;  1PKT A;  4XU2 A;  2K7A A;  4D6W A;  1LNX A;  4M7D F;  1SPK A;  3L2Q A;  1Q86 R;  1ZUU A;  2MOX A;  3A98 A;  1QVG S;  2E3H A;  1W2B A;  1M8M A;  2DE0 X;  2OTJ T;  2VC8 A;  1KQS A;  1W6X A;  2K3X A;  2KRM A;  2ZPG B;  5LJ5 e;  1NPR A;  3V8K A;  4C5H A;  4C5E A;  3CMA T;  2XIC A;  2FZG B;  2GBQ A;  1GXI E;  1D0Y A;  1HD3 A;  3C95 A;  9ATC B;  2MCN A;  1M90 R;  1VQ8 T;  2DL5 A;  5GAN 5;  1VQM Q;  1G3Y A;  3TQ7 P;  5GAN 8;  3CC2 A;  3LGF A;  4RCC A;  2NUT A;  3JSC A;  1ZUY A;  4J5Y A;  1TUD A;  5IHI A;  3LWI A;  5KYX A;  3HSB A;  1G2B A;  2K57 A;  1NZ9 A;  3G4S Q;  4HVU A;  3SEM A;  4E7K A;  2KVQ G;  1YFN A;  3GP8 A;  1VQO Q;  4A4K A;  4R56 A;  3GLX A;  2DD4 A;  2DIL A;  1QKX A;  1YJ9 A;  4L6V 5;  1VUB A;  1RL2 A;  2V1R A;  4XTU A;  3SWN B;  2MF2 A;  2LZ6 B;  4CC7 A;  5GAN 6;  3FRN A;  3N5B B;  1K8A R;  4ORZ A;  1KQ2 A;  4LXC A;  2KRS A;  2DL8 A;  3JCM V;  2ZPH B;  2DVJ A;  1X2K A;  2OX7 A;  2RPN A;  3H8Z A;  3EH2 A;  2KDS A;  1TTH B;  2M16 A;  2YUN A;  2AKK A;  5KYX B;  5KYW A;  1PNJ A;  4LD6 A;  4PJN A;  4F04 B;  5IAY A;  2M0Y A;  5GAO q;  3JCM X;  3OS1 A;  4BAC A;  1R0C B;  1XOV A;  2RJD A;  4PJO D;  1BIA A;  5KE3 A;  3CCU T;  2XDB A;  2HEQ A;  2YUP A;  1X6B A;  5EG2 A;  3MPU B;  2JTE A;  1RI0 A;  3L2V A;  3FLG A;  3OYC A;  2D0Q B;  1N9S A;  1N27 A;  3CC7 T;  2MIO A;  2ZPF B;  2K3Y A;  1NG2 A;  1RUW A;  1M2V B;  1YCS B;  2DA9 A;  3CCR T;  4NL3 A;  2X4X A;  3L2Z A;  2E3I A;  3X24 B;  3OBW A;  2EW3 A;  2RI3 A;  3CME Q;  3HP9 A;  2QGF B;  3BFM A;  3CCM A;  2FPF A;  2CKK A;  5CQY A;  1QCN A;  1WQW A;  1E7O A;  1X2Q A;  1R77 A;  2DXU A;  4EMK A;  3CCV Q;  1KHC A;  3S6W A;  1AWO A;  3NMZ C;  2F5K A;  3BY7 A;  2BE9 B;  1S72 T;  5LJ3 h;  4M7D C;  2XMF A;  4ZTJ A;  3QHS A;  1E6G A;  4JLG A;  1I07 A;  2RJC A;  4M77 A;  1ZBJ A;  4JZ3 A;  5J39 A;  4FT2 A;  5LJ5 g;  3LH5 A;  2HAX A;  1VQN Q;  1ZX6 A;  1ZSG A;  2GFA A;  4E7H A;  2D6F A;  2DJQ A;  2FPE A;  3OW2 S;  5A0G A;  2M9U A;  2IIM A;  4FYY B;  4LD9 K;  1NM7 A;  1AOJ A;  3CEY A;  3RMQ A;  2MYS A;  2E1H A;  3OMC A;  3PVL A;  4C0Z A;  1QP3 A;  4OGE A;  2F2V A;  5D6W A;  1T3L A;  3MEU A;  4HCK A;  2YUQ A;  1IGU A;  2LCS A;  2AZV A;  2FVU A;  3G71 T;  1Q7Y C;  1CSK A;  3SHW A;  3FEO A;  3H9N A;  2CP7 A;  3HRT A;  4DOV A;  4QQG A;  2D1X A;  2B86 A;  1X6G A;  2QYZ A;  2HCK A;  1RAH B;  3UPU A;  4HT8 A;  1ACM B;  3H0F A;  3CCU A;  2R5M A;  3EGD B;  1UEC A;  2LQ8 A;  4AFU C; 
#chains in the Genus database with same CATH homology
 2WSF E;  4QVZ A;  3P8B B;  3X28 B;  1VQ6 A;  2HBP A;  3C12 A;  3E19 A;  3PMI A;  3X26 B;  1VQK A;  1KQS S;  2E12 A;  3CPF A;  3OQ5 A;  3L2W A;  3ZFJ A;  2NLU A;  3WXM B;  5LJ5 h;  3L2R A;  3RER A;  3I56 A;  4XU1 A;  2QQ9 A;  5LJ3 j;  3OMG A;  4C0F A;  3SDZ A;  5CAI A;  4FIB A;  2I2L A;  3MP1 A;  5GAM f;  2R58 A;  4LDU A;  4C0D C;  1M9S A;  3CD6 A;  2JTM A;  3MEW A;  4HA8 A;  3QG1 A;  4M77 G;  4M7D A;  4BE0 A;  5DM7 R;  1DJ7 B;  3T9N A;  4O6J A;  2DEQ A;  4F7U B;  2XK0 A;  4ATO A;  2F5T X;  2EKO A;  3A8G B;  1YIJ T;  3ZBD A;  1X6O A;  2DK3 A;  2HNI A;  5CKB A;  3UT1 A;  4C8Q G;  1WJQ A;  2RHX A;  4C8Q A;  3FDR A;  5I2S A;  3PTA A;  1VQ4 A;  1G5V A;  5DLO A;  1YIJ A;  4M75 G;  2QI2 A;  2IVW A;  4JLI A;  4EMG A;  1K8A U;  3JCM e;  4HCZ A;  4JJN K;  1HXD A;  1Y96 B;  1VQP T;  4WF2 A;  3OSS C;  3CPW S;  1ZBX A;  1Y71 A;  5FU6 B;  1BI2 A;  1MGQ A;  4XU3 A;  2H3J A;  1VQN T;  1P92 A;  5LJ5 j;  1N8R U;  4O5V A;  4OB1 B;  4ZGJ B;  1W4S A;  1VQP A;  2RH2 A;  3JB9 J;  2OTL T;  3TU4 K;  1WJS A;  1JRI A;  4M78 G;  5GAN 7;  2MAM A;  4M78 E;  4M7A E;  3VUZ A;  1VQL T;  1UGP B;  2DIQ A;  5GAN d;  1MHN A;  3OYI A;  2DTH A;  4XTY A;  4IUU A;  4PKC C;  3QUI A;  4E7J A;  5FU7 B;  4J83 A;  4OMF B;  2JUF A;  2EFI A;  2LCL A;  2OAU A;  2P0K A;  4GY5 A;  4NL2 A;  4M7A B;  1PSE A;  1R8O B;  2PU9 B;  3JCM b;  4JRK A;  4Z02 A;  3JCM W;  4M75 E;  3DB3 A;  1XQH A;  2MMP A;  4C8Q C;  4B9W A;  2QQS A;  5LJ5 d;  3MEA A;  4N0A C;  5GAN 4;  4BE2 A;  3QPH A;  4ZN3 A;  1VQ7 T;  4F7U A;  2DKG A;  5LJ3 f;  3V7C A;  2VXE A;  2RHU A;  3RUX A;  2JVV A;  2X35 A;  2O01 E;  1M1K U;  2DXT A;  1WJR A;  2BUD A;  3QO3 A;  4HCB A;  3OYK A;  3M4Y A;  5GMK h;  4ZGE B;  3CCE A;  3DLM A;  3E1S A;  3CBO A;  2XID A;  3HL8 A;  2PVG B;  3QYH B;  3NTI A;  5A2Q E;  3MO8 A;  5IT9 E;  5I21 A;  3G7Z A;  4LDX A;  3OYN A;  4JS5 A;  1VIE A;  4LDV A;  5FRO A;  3ME9 A;  3EFR A;  1JB0 E;  2K2V A;  2YHT A;  3RIR A;  3RKW A;  3I55 T;  1Y96 A;  3Q1J A;  4E7L A;  1I8F A;  2RJE A;  5FLX E;  2QXF A;  3M5A A;  3CCQ A;  2WAC A;  1O75 A;  3BDL A;  4BDZ A;  2RM4 A;  5HK0 A;  2E5Q A;  3KUF A;  2P4T A;  2GCX A;  4UC4 A;  3ZEH A;  3M59 A;  4RMO A;  3MEV A;  2EQU A;  1M90 U;  5KH6 A;  4XK8 E;  3O8V A;  3M54 A;  4ZGD B;  2LTO A;  2DXC A;  2LQK A;  2M1H A;  2CZ1 B;  4XAX B;  4A4H A;  2A7Y A;  3QZ9 B;  4OGC A;  1ZHI A;  3VV0 A;  1UB4 A;  2LX9 A;  4DOW A;  1M8V A;  2RK1 A;  4M7A A;  3JCM J;  3C4S A;  4JS4 A;  2EQJ A;  3OB9 A;  1BI3 A;  2GFU A;  1U1S A;  2RD1 A;  5GMK e;  4M78 C;  3SD4 A;  1WGS A;  3PT9 A;  2QA4 A;  4ME7 A;  2CYZ B;  4M75 F;  2K5F A;  2FYK A;  3JB9 F;  5GMK m;  2D9T A;  3NTK A;  1YJ9 T;  3CME T;  2IG0 A;  4IKF A;  3CCS A;  2ZPE B;  4JRI A;  4RKU E;  5CIU A;  2VYT A;  3A8H B;  4BI4 A;  2CGH A;  1O9S A;  2DIG A;  4RCB A;  5CVI A;  3RES A;  1QVP A;  4IUT A;  1M1F A;  5GMK l;  4ZN1 A;  3LLR A;  2RI5 A;  5CCA A;  3JCM P;  5GAN 2;  4M7A D;  1D3B A;  1WPY A;  2E6Z A;  2PUO B;  1KC8 U;  5CK9 A;  3M53 A;  1Q86 C;  4DQ2 A;  1Q81 C;  1KD1 U;  3MHX A;  4C0G A;  2LVM A;  4F7U E;  4CRI A;  4L59 A;  3VYH B;  4ELY C;  1N8R C;  3M57 A;  2E41 A;  1B34 A;  1N9R A;  1NE8 A;  2KK4 A;  4MZT A;  3JCM g;  1VQK T;  2OTJ A;  4GLK A;  3QBY A;  4LDY A;  4QVD A;  2VXF A;  1VQ9 T;  1Q7Y U;  3F70 A;  2E64 A;  1VQN A;  2EJ9 A;  2KSS A;  1Y07 A;  4QQD A;  4BDY A;  1QVG A;  3PGG A;  2EIF A;  4JRQ A;  3M58 A;  2PVO B;  4KBM B;  3X25 B;  3ASK A;  4MDW A;  3G4S A;  3HRS A;  2VGM A;  5A0L A;  2LNV A;  3RMS A;  3OYE A;  4N4H A;  5GAM h;  3G6E T;  3J7A F;  2RK2 A;  3QZ5 B;  2PQW A;  4L5G A;  4M75 A;  2DVE A;  1HK9 A;  1EIF A;  4M77 C;  1UGQ B;  3SWN C;  5C0M A;  5C6S A;  5KCH A;  3KXT A;  2PUK B;  4N4I A;  2JNG A;  4XQ3 A;  4MZM A;  4XTZ A;  2RHY A;  1JBM A;  4CI0 C;  3PNW C;  3H6Z A;  1IRE B;  2MWO A;  5GAO p;  3E9F A;  5HY6 A;  4J6W A;  4B9X A;  1OZ2 A;  2K5I A;  3CCV A;  3HFN A;  1VQ6 T;  4MDX A;  4OB2 B;  1D3B B;  1X01 A;  2RA2 A;  3URG A;  3CXC A;  3OBY A;  3EFS A;  4EMK C;  4X34 A;  4OVA A;  1FWZ A;  5KE2 A;  2QEX T;  4J8O A;  2V8I A;  5GAO r;  3A5Z B;  1YI2 A;  2L5Q A;  5DY9 A;  4KT0 E;  3OYJ A;  3M55 A;  3OS5 A;  5A0D A;  2HQE A;  2EJG A;  1M1K C;  5LJ3 g;  2XI9 A;  5FRN A;  1VQO T;  1YJW A;  1B34 B;  4BB7 A;  2HQX A;  4M7A G;  2X4W A;  3NTH A;  5LL6 S;  4C92 A;  2CZ7 B;  2QEX A;  4FL6 A;  3V8J A;  5GAN f;  1X75 C;  3CXC S;  3VKI A;  3CPW A;  5GAN h;  3OYL A;  2L8D A;  4OB0 B;  4C0D B;  3GIB A;  3GOX A;  3KBG A;  2EYQ A;  1LOJ A;  2X4Y A;  2YLC A;  4E7I A;  3S3O A;  5FU7 C;  4IUV A;  4Q5W A;  1YJN T;  2V8K A;  2Y4X A;  4KUI A;  2FHD A;  1S72 A;  1YHQ T;  3LGL A;  2R57 A;  5M9O A;  4XU2 A;  3CC4 A;  3QYG B;  4X9C A;  3JCM f;  3LYI A;  4D6W A;  5GAN 3;  4BY6 B;  2RHZ A;  1LNX A;  1M4Z A;  2JTF A;  5FU6 C;  1Q81 U;  2RHI A;  4PNO A;  4EMK B;  1KG1 A;  3UWN A;  2KMT A;  3TEE A;  2E6N A;  1M1G A;  4M7D F;  1M90 C;  1KQ1 A;  4XTW A;  4A4E A;  1I81 A;  3E9G A;  3L2Q A;  1U8R A;  4P5N A;  4M77 E;  5AYF A;  3CCM T;  2LT1 A;  4MMK A;  1QVG S;  3GPL A;  1W2B A;  4OF1 A;  5HKC A;  3DKM A;  3M9Q A;  3X20 B;  4JRP A;  1YIT A;  2OTJ T;  3QJ6 A;  3TRE A;  4M77 B;  1VQ5 T;  2VC8 A;  1KQS A;  4C8Q E;  2DO3 A;  2ZGW A;  2K3X A;  3MET A;  2ZPG B;  4RG2 A;  3VYG A;  2YRV A;  1NPR A;  5CQX A;  4C92 B;  3V8K A;  5LJ5 e;  1JJ2 A;  4R55 A;  4C5H A;  4C5E A;  4M78 D;  4PJO C;  3CMA T;  3CC7 A;  2XIC A;  1N6A A;  3CCJ A;  1GXI E;  5GAN j;  1Q82 U;  3A8M B;  2E65 A;  3LH0 A;  2MI6 A;  3C95 A;  2LRQ A;  1NJI C;  1JJ2 S;  3GNF B;  1VQ8 T;  4JUV A;  4FU6 A;  2YLB A;  1QVF A;  5GAN e;  2RJF A;  3J81 E;  4M75 D;  4RG8 A;  1FX7 A;  3INZ A;  5I2M A;  4OP0 A;  5GAN 5;  1G3Y A;  4A53 A;  5GAO n;  5GAN 8;  4C92 F;  4BE1 A;  5FRM A;  3QJY A;  3CC2 A;  3LGF A;  1XNI A;  4RCC A;  5CO7 A;  1W2B S;  3G71 A;  3JSC A;  2LDM A;  3V7R A;  2RI2 A;  1K73 U;  3JAM E;  3R6O A;  1BYM A;  3RKX A;  1LJO A;  3I56 T;  3M4G A;  4PJO A;  4II1 A;  5CKD A;  4TVR A;  2E10 A;  3OYY A;  4J5Y A;  2DTO A;  4J6Y A;  4OB3 B;  5D6X A;  3LX7 A;  1PSF A;  2DD5 A;  3HRU A;  4J7I A;  3SB2 A;  3LWI A;  2KY9 A;  3G6E A;  4J6X A;  1Q82 C;  3HSB A;  3S3M A;  4M7A F;  2K57 A;  2DZC A;  1NZ9 A;  4LDW A;  1K9M U;  4E7K A;  4N4G A;  2WSE E;  2JOY A;  2KVQ G;  3VU3 C;  3CBM A;  3QDR B;  4QQ6 A;  3OS2 A;  4X9D A;  4C8Q D;  3OW2 A;  3GP8 A;  2LT4 A;  1OYX A;  3HPW A;  4A4K A;  4R56 A;  1NPP A;  2A3L A;  3GNG A;  4HKE A;  3QXE B;  1YJW T;  2RB6 A;  1VQ9 A;  4C5I A;  4XTX A;  3GLX A;  3CC4 T;  5GAM e;  1K9M C;  4EDU A;  2DD4 A;  3OYA A;  5GMK i;  4MZP A;  4PL6 A;  4C92 G;  3CCR A;  2EQK A;  4F7U G;  4M77 F;  4QW2 A;  1YJ9 A;  3JCM h;  4M77 D;  2P0Q A;  4FSX A;  1VUB A;  4L6V 5;  4FT4 A;  2ZPB B;  1YJN A;  1RL2 A;  2BKD N;  5HK3 A;  4XTU A;  3OYM A;  4FM4 B;  3SWN B;  4PJO E;  1QP2 A;  2MF2 A;  3VUB A;  4HCC A;  5CKE A;  2DAQ A;  3JB9 I;  5GAN 6;  2XD0 A;  3FRN A;  3N5B B;  3OYB A;  3OA6 A;  2QA4 T;  5LJ3 d;  4C8Q F;  1G3T A;  5GAM j;  2DXB A;  2K5L A;  4BD3 A;  5GAM g;  4ELZ C;  1KQ2 A;  5KCO A;  4A54 A;  1SSF A;  3JCM V;  1VQ5 A;  1XTD A;  2ZPH B;  3JCM c;  3H8Z A;  5CKF A;  2KDS A;  1VIF A;  1BIB A;  2O4X A;  1YBY A;  2FL7 A;  4J7F A;  1AHJ B;  2RO0 A;  1TH7 A;  5J3B A;  2BIV A;  2XKO C;  3MP6 A;  4M75 B;  2XHC A;  4C92 C;  3FJP A;  2M16 A;  4EPC A;  3QSU A;  2XU8 A;  5LJ5 f;  4LD6 A;  4M7D E;  1QVF S;  5IAY A;  1VQM T;  1I4K 1;  4M78 F;  3MP8 A;  2P0P A;  4C8Q B;  3JCM X;  5GAO q;  3OS1 A;  2KQW A;  5D6Y A;  5GAM d;  4BAC A;  2DJZ A;  3TCJ A;  1XOV A;  4C5G A;  1VQO A;  2RJD A;  3ER0 A;  1BIA A;  3P8D A;  5KE3 A;  3CCU T;  4HT9 A;  4PJO D;  2XDB A;  2X4J A;  2F69 A;  2QDY B;  3DLL A;  5EG2 A;  4A4F A;  1I5L A;  3CCE T;  1RI0 A;  1KC8 C;  4BUG A;  4DA4 A;  4NS5 A;  2CZ6 B;  3FLG A;  3L2V A;  2XG8 D;  3JB9 H;  2G3R A;  1YCY A;  1N9S A;  2D0Q B;  1UGR B;  3V8L A;  3OYC A;  3CCJ T;  1N27 A;  3CC7 T;  5GAO m;  3CCQ T;  2XDP A;  2K3Y A;  2ZPF B;  3J80 E;  1H3Z A;  2AHJ B;  3SWN A;  2QQR A;  3FC3 A;  3HFO A;  5GAN g;  3OY9 A;  3GF5 A;  2EQM A;  4M75 C;  3CCR T;  4NL3 A;  1BKB A;  2EWN A;  3A8L B;  2V8J A;  2QTX A;  2X4X A;  3L2Z A;  3L42 A;  3A8O B;  3CCS T;  1KD1 C;  4BI3 A;  5J26 A;  3CCL A;  3X24 B;  1KHI A;  3C94 A;  3OBW A;  3CCL T;  2RI3 A;  3HP9 A;  3NFC A;  2B8A A;  2L89 A;  2O4X B;  1VQM A;  2LCC A;  3BFM A;  3CCM A;  4Y28 E;  2CKK A;  3SFM A;  5CQY A;  3L1A A;  2KAF A;  1WQW A;  2C06 A;  4F7U F;  2DZ9 A;  3WVD B;  2DXU A;  3QKJ A;  4EMK A;  1KHC A;  3S6W A;  2GF7 A;  2VGN A;  3OS0 A;  2JN0 A;  3LW5 E;  4PLL A;  1U1T A;  3P8H A;  4NOY A;  2F5K A;  4VUB A;  3JB9 D;  3BY7 A;  2EJF A;  1UGS B;  3V7S A;  1S72 T;  4JDS A;  3WVE B;  3DB4 A;  1K73 C;  5LJ3 h;  3PFS A;  4IUP A;  4M7D C;  2R5A A;  3OSV A;  4BY6 C;  1OI1 A;  4E47 A;  4ZTJ A;  1BI0 A;  3QHS A;  5CKH A;  5GMK j;  2HD0 A;  3PIO A;  4JLG A;  3PIP A;  3QII A;  3CCV T;  4MML A;  2RJC A;  4M77 A;  2JZ2 A;  3CBP A;  2MWP A;  2ZPI B;  5J39 A;  3JB9 G;  4M7D G;  4V2S A;  1V29 B;  2VUB A;  4FT2 A;  5LJ5 g;  2PVD B;  4ZTF A;  1VQ8 A;  1QW1 A;  2HAX A;  2GQV A;  3VJP A;  4M78 A;  1G3W A;  3BW1 A;  3LWH A;  1Y7X A;  2CZ0 B;  2GFA A;  4QVC A;  4E7H A;  2D6F A;  2LC4 A;  4Y91 A;  3JCM d;  1YI2 T;  4BI8 B;  3BDU A;  3OW2 S;  3CMA A;  2QQB A;  5A0G A;  2E70 A;  1VQL A;  2M9U A;  1Q86 U;  1WQ7 A;  2ZZD A;  3FB9 A;  3G4S T;  4LD9 K;  2XDD A;  4PJO G;  4IUR A;  3CEY A;  3S3N A;  3HKS A;  3RMQ A;  3CD6 T;  1WNL A;  3JRZ A;  2E1H A;  3OMC A;  1YIT T;  4C0Z A;  1QP3 A;  4OGE A;  3AHU A;  5L8R E;  4M7D B;  5D6W A;  4M7D D;  1BI1 A;  4A4G A;  3MEU A;  1YHQ A;  2VV5 A;  3OYG A;  4IUQ A;  3CME A;  4XTV A;  2Y90 A;  2FVU A;  3EAE A;  4KUL A;  3G71 T;  1Q7Y C;  3OYD A;  1IZ6 A;  2CS7 A;  3CC2 T;  1UEB A;  4PJO B;  4PLI A;  5IN1 A;  4YTL A;  4XU0 A;  5DLQ E;  2DTI A;  1K8A C;  3FEO A;  3I55 A;  1VQ4 T;  5CR2 A;  1G3S A;  4C92 E;  3HRT A;  3OYF A;  3L2U A;  2M0O A;  4DOV A;  2FB7 A;  2L3R A;  3MCA B;  4QQG A;  4KUD K;  2DPP B;  5GAO l;  3HHT B;  1ZQ1 A;  3M56 A;  1FXX A;  3OYH A;  1OZ3 A;  4N0A A;  3RKY A;  1H64 1;  4M7A C;  3FIF A;  4M78 B;  2K4Y A;  1M5Q 1;  3UPU A;  2EAY A;  3UDC A;  3JCM Q;  2ZCF B;  4C92 D;  1VQ7 A;  5LJ3 e;  4HT8 A;  3PMT A;  2QQA A;  1NJI U;  4PJO F;  2WSC E;  2Y4Y A;  4EMH A;  3CCU A;  2OTL A;  2R5M A;  2LQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...