4GLKA

Structure and activity of abiq, a lactococcal anti-phage endoribonuclease belonging to the type-iii toxin-antitoxin system
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
165
Chain Sequence
GTLRFFTVTDEYIAYLRKFESKVHYQYENNASTYVGVVLKKNDFNYFIPLLSYNPEKDKAMKKRSRIVTRLFEIGNINNPLGYLLHHNMIPVPDSELIPLPLDLKKPKHKMMQKQLIYMKSISEKIENKSEVVYRKAAHEKDGYYLKFSCDFKLLEAKATLYSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and activity of AbiQ, a lactococcal endoribonuclease belonging to the type III toxin-antitoxin system.
pubmed doi rcsb
molecule keywords AbiQ
molecule tags Hydrolase
source organism Lactococcus lactis
total genus 55
structure length 165
sequence length 168
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13958 ToxN_toxin Toxin ToxN, type III toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.890 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4glkA00
2XDDA 2XDBA 2XD0A 4RMOA 4ATOA 4GLKA
chains in the Genus database with same CATH superfamily
3OYCA 1PKSA 1WIEA 4ZGEB 3RIRA 4XTWA 3TEEA 3CCSQ 3INZA 4GLKA 1WDXA 2M0OA 3PMTA 3ER0A 2D6FA 3GBQA 2RQVA 4C0DC 2RB6A 1VQ5T 2F5KA 4F7UB 4IIMA 3OSVA 4QW2A 3PIOA 3HL8A 5J26A 3M4GA 1WJQA 3E19A 1UEBA 3THKA 3CC4T 4L5GA 3BDUA 2VYTA 3VUBA 3A8LB 3M54A 1PD0A 2O88A 2WSCE 1XJWB 2EYZA 3EG1A 3CCLA 4M7AG 3VV0A 1SSFA 4DEXA 1U1TA 4NOYA 2COYA 2J6KA 2A37A 2M9UA 4XU3A 3ASKA 1PD1A 3M0QA 2LTOA 1I0CA 2QA4T 2OAWA 1EZZB 4QVZA 1JBMA 4PJNA 3G7ZA 1BCMA 4JLGA 2LRQA 3JRZA 4C0FA 4LDUA 3META 1S72A 3LGFA 2L0AA 3JCMX 2M16A 1M3BA 3ULRB 3NTIA 4M7AC 4OP0A 4KT0E 2C0OA 1VA7A 3J80E 3EFSA 1IGUA 2AKLA 2DXCA 5GAOn 2E6ZA 3OBWA 5D7UA 4XU1A 2YDLA 1U5SA 4C92G 3CD6Q 2PNIA 5DY9A 4JUVA 2EKOA 1UTIA 4J5YA 4C5GA 2XG8D 1UB4A 1BI0A 2CZ6B 3EG0A 2XDDA 1KQSA 1LCKA 4GLMA 1N27A 2KT1A 4Y91A 3TU4K 4BY6B 2YT6A 4XTXA 3JB9J 4OVAA 1VQKQ 3A1PA 4NS5A 1M8VA 5ECAA 3VYGA 2YHTA 3PVQA 3G6EA 3CMET 2X4YA 3LH0A 4JJBA 4GBQA 2RN8A 4M7DA 2EFIA 2EVRA 5LJ5j 2C0TA 4M75E 1WXUA 1VQ7A 1D1BA 2QQ9A 1Q7YR 4EIKA 5GJWB 3GNFB 3EG9A 2DPPB 3M58A 1M1GA 2KMTA 3X25B 4PLLA 1ZA1B 1U3OA 2QK0A 4J6YA 1RAIB 2BKDN 1Q81R 2YRVA 2CGHA 1IXDA 1HK9A 5DM7R 1WGSA 2C0IA 1YCYA 2KI7A 2HBPA 1OX8A 5CKDA 4PJOG 1RAAB 3M0RA 2BZYA 4MZTA 4X34A 3MO8A 2OTJT 1WQWA 4C5HA 5FROA 1LJOA 5HKCA 1Q82R 2QQSA 1TSFA 4LUEA 4KULA 4CC4B 4ELZC 3I56Q 2J6OA 1WHLA 4J6WA 4D6WA 1H92A 4C8QE 2JM8A 2RI3A 4Z8AA 4M7AF 3UF4A 4PJOC 2HZYA 4XTYA 2JMCA 3JB9D 2K6DA 4CC2A 2LMJA 2FRYA 2KXCA 2ZZDA 4ESRA 1T0JA 2L8DA 4F7UF 4M75D 2LQNA 4DEYA 1VQ9T 2COZA 1VQ5A 4BUGA 2V8KA 1KIKA 4MDXA 1Y0MA 3UA6A 1VQNA 1YITT 3LWHA 4HT8A 1Q86C 1XQHA 4LNPA 2HKQB 1TXQA 1AWJA 2BE9B 2BIVA 2LX7A 3URGA 4QVDA 1C6VX 1V1CA 2BZ8A 1QVGA 4PK4A 3A8HB 1W4SA 5HK3A 3DLMA 2RQWA 5GAN3 3CCLQ 2E4HA 2LX9A 3HPWA 2NUPA 3E2UA 1XOVA 5LL6S 5A2QE 3QG1A 3M57A 2CYZB 1RADB 1UGPB 4ZTJA 5J39A 2A3LA 3X26B 2KXDA 2QA4A 1YJ9A 3FIFA 1WJRA 3ZL7C 3CCQT 4RTYA 2CT3A 2KRNA 3DLLA 1WHHA 2F2XA 4J9BA 2FHDA 1M8MA 4C8QD 3VJPA 2O2OA 4Y28E 2XMFA 1OQKA 3OW2A 2XI9A 2KR3A 3OYGA 2JT4A 1ZQ1A 2ENMA 3JCMQ 2LCCA 2E10A 5GMKi 1KD1R 4HVWA 1PRLC 5GAMg 2PQWA 1AZGB 3R6NA 1UUEA 1NE8A 2DVEA 3CCET 2GQIA 2P84A 2J05A 2JZ2A 2HMAA 3GLXA 5DLQE 3RKWA 2FRWA 1GFCA 5LJ3e 4Y92A 1FWZA 5DLOA 1C1AA 3CQTA 3GP8A 1VIEA 4AFZC 2GCXA 2VUBA 1OULA 2O9SA 4QQDA 2CSIA 4PFPA 1S1NA 4A4KA 3UPUA 2LT1A 8AT1B 2OAUA 5AYFA 3LYIA 3CMEA 2GNCA 3G6EQ 1K73C 4FW1A 4A54A 1VYUA 4C8QB 3CCRQ 3RDVA 2QGGA 1UE9A 3RKYA 3CCMT 5LJ3g 3E9GA 3ZFJA 1ZBXA 4M78G 3CCVT 4J9HA 4FSXA 4M7DG 5GAMf 1SPKA 2ATCB 1NJIR 2LQWA 1UGVA 2YWWA 2Y4YA 2KK4A 1Q86U 1TUCA 3VS4A 2CKKA 4R0KA 3VUZA 2CS7A 4UC4A 2YUNA 1M2VB 4PLIA 2D8HA 2O01E 2GTJA 3OYLA 2EBPA 5GMKe 4HCCA 1UGQB 1RI0A 4OB1B 2OTJA 4FYWB 3OMGA 4F04B 1SRLA 2NUTB 4M78C 4LDVA 3EHQA 5GAN5 1PG5B 4FL6A 2BE7D 3OYYA 1YWPA 2DD4A 1RUWA 1VUBA 2DILA 1MMGA 1V76A 1ZBJA 3RERA 4F14A 4M77C 5CKBA 1E6HA 3QJYA 4M7AA 1KSWA 2ABLA 2MPXC 5D6XA 1B34B 5LJ3f 1QW1A 2RI5A 1G3WA 1OI1A 1QCOA 2R58A 2JTFA 1QMCA 1KJWA 2RA2A 2HNIA 3LH5A 4LN2A 2DEQA 4LDYA 3OB9A 1ZUYA 3QBYA 1M27C 3OYFA 3A98A 2L5QA 3GF5A 2ZGWA 1E7OA 1VQ9A 1VQ5Q 1SSHA 2ZPEB 1YITA 1H8KA 5FLXE 1KHIA 1ZSZB 1I81A 2AHJB 3RR6A 3CC4Q 3DB3A 2E12A 4PL6A 5FU6C 3CPWS 2L89A 2CSQA 2AT1B 3SWNB 4FYXB 1Q7YC 1Q95G 2HAXA 2DZCA 3HHTB 4OB0B 3M4YA 1K73U 3ZBDA 1Q81C 1FYNA 2K4YA 3CD6A 2DE0X 9ATCB 4LUDA 3CCQA 5L8RE 5I2SA 1QCFA 3QO3A 2JJ9A 2XICA 2DL4A 2G6FX 1D1AA 3CPWP 4IUPA 2MAMA 5KYXB 2RO0A 3WVDB 1JO8A 4Q5WA 2P4TA 2GFAA 4JRKA 1G3SA 3H41A 3OYNA 2LCSA 2MK5A 3EGDA 1TWBA 1Q82C 3M59A 2JMAA 3FDRA 4K11A 1YJNT 4C92E 2LQ8A 4DBFA 2F1LA 5A0DA 3CCEA 3WVEB 4J9EA 4M78F 3TREA 1UHCA 3GPLA 4ZGJB 5KCHA 2EYYA 3CCRT 4J7IA 1Y07A 2QXFA 1R77A 1BBZA 3BDLA 1BI2A 4HCZA 4M77F 1VYTA 2YXYA 2DRMA 2VGMA 2RHUA 4WTOB 3VS2A 1IRXA 2QGFB 3MCAB 2CZ7B 5GAOm 1BKBA 1ABOA 5IHKA 3V8KA 1UGRB 4EMHA 1RACB 3OYBA 3OQ5A 4QKUA 5I22A 1PSFA 1ZA2B 3EHRA 3CMEQ 2FPEA 4XTZA 1CKBA 1M2OA 1YIJT 1TTHB 1VQMT 2MYSA 3QPHA 1ABQA 3CCMA 4N0AA 1FX7A 3BW1A 1TU0B 3JCMV 3MKDA 3TVTA 1YHQT 3JCMW 1QVFS 1Y7XA 4OGCA 2RHZA 2FPDA 3CCVA 2HBWA 3QDRB 3I5SA 4E2FB 3CC7T 3MEWA 2AZVA 2JNGA 3O5ZA 4JJCA 4XU0A 1WXTA 3RMQA 1OZ3A 4WF2A 1NBEB 2RNAA 4PJOE 1KQSS 2DBMA 2QQRA 1UDLA 4QQ6A 2M1HA 2J7IA 4C92D 1QLYA 2DMOA 3JV3A 1EIFA 3MEVA 1Q7YU 2OTJQ 3CBPA 1QVFP 3QWYA 3QUIA 4EPCA 3EG3A 5A0GA 2LNHB 4ATOA 1YN8A 1OOTA 3M5AA 3CMAT 1M30A 3OYEA 2O4XB 2HKNA 3UDCA 3E1SA 3DKMA 1VQ4T 3DB4A 4KRTA 2ZCFB 3IQLA 1D1CA 2K5IA 4YTLA 1I5LA 2KVQG 2DK3A 4BACA 1KD1C 3G4ST 4A4EA 1R8OB 1N8RR 1G83A 3MP6A 3L1AA 3PIPA 1UJ0A 1K9MC 4P5NA 5LJ5d 1Q82U 5FU7B 2RI2A 1KK7A 1WFWA 5CIUA 3CCUT 1X2QA 1VQ9Q 2V1RA 4FU6A 2ROTA 2HQEA 3AHUA 1DJ7B 3L2UA 1EFNA 1YITQ 4F7UG 1IHWA 3VS3A 1CSKA 1WYXA 3PTAA 2E1HA 1GBQA 1VQ6T 2DERA 4PJOD 2K9GA 2QASA 4NL2A 4RUGA 1J3TA 2KRSA 4A4FA 3FB9A 4KH1B 1Y96B 2RQUA 4C0ZA 2WACA 4X9CA 5FRNA 1G8XA 1BI1A 2RJCA 3JCMc 3SFMA 1NJIC 3CCQQ 2OTLT 4NL3A 5GAMh 2DX1A 5GMKm 2RQRA 1SG5A 1N9RA 3MEUA 4XAXB 4DBQA 1RAFB 1RLPC 1RABB 2QTVA 4N4GA 2KEAA 3H9NA 2GF7A 3PGGA 1KQ2A 1D0ZA 4GY5A 4V2SA 3NPFA 3OMCA 2LNVA 2KRMA 3JCMJ 4A53A 2ED1A 1YJNA 3REAB 5FU7C 2X51A 5KCOA 2CUBA 3GIBA 1TH7A 4M78A 5CVIA 1IB8A 4FSSA 3C95A 4HVUA 4J8OA 1V29B 3CCEQ 2XDPA 1K9AA 2V8JA 2DTIA 4CRIA 3CCRA 2X4WA 1N5ZA 1NYGA 1O75A 1X6OA 2L3PA 4N4IA 4ZGDB 5FRMA 5HCKA 1BCOA 2ZPFB 2HD0A 4M77A 1NM7A 1QQJA 1Z9ZA 3R6OA 4HCBA 5LJ3h 2QDYB 3NTHA 4EMKB 4C5IA 1TUGB 4O5VA 3T9NA 2P0KA 3SHWA 5CKHA 2X9HA 2EQIA 1KC8R 1VQPT 1XTDA 4A4HA 1U1SA 2F69A 2KE9A 3HTRA 5GAN8 3CXCS 4IUTA 5AT1B 3JSCA 1KD1U 4OMLA 1YBYA 2KAFA 1X75C 1M1KC 4VUBA 5CKFA 3EGXB 3U23A 1ZX6A 4IUUA 5KE2A 1YIJA 3H6ZA 1VQMA 1K9MU 2DZ9A 4FIBA 3L2VA 4OMPA 3CCMQ 1BYMA 2E5QA 4KH0B 5C6SA 4PKCC 2MOXA 2DETA 1YHQA 3H0IA 3I55T 3VS7A 4M7DE 4JLIA 3CCVQ 3QDFA 3V7RA 1JJ2S 2DL7A 1QVPA 4BY6C 3H0HA 4J7FA 3M55A 3FC3A 1YWOA 1M2VA 3RBBB 3CXCP 4BE2A 1M9SA 4PFOA 2YRCA 3S3MA 2DXTA 2XIDA 3KBGA 2EJFA 1VQOT 3HRSA 3HRTA 2DTHA 1N6AA 3OS0A 1B7TA 2EQMA 3F70A 4LD9K 5GMKh 3OYKA 1IREB 2PVDB 1JJ2P 4HCKA 3CMAA 3M0PA 3L2ZA 2CP5A 2KDSA 4N0AC 1NJIU 3MP1A 3C0CA 1VQ4A 2A7YA 4OB2B 3C12A 3LWIA 3CC4A 2GQVA 3A8GB 1NPRA 2ZPGB 1LOJA 4BI4A 3G4SA 3CCJT 4B6MA 2QTXA 4IUVA 1BI3A 2EQUA 2JW4A 3OYHA 1VOMA 1RAGB 2EPDA 2ZPHB 2FZCB 4J6XA 3JCMe 1YJWT 5GAMe 1ZSZA 1YCSB 4RG2A 1R0BG 4B9XA 1I07A 3EH2A 4JRPA 4M7DD 5GAN7 1Z9QA 4JS4A 2IG0A 2VGNA 4KUIA 2CZ1B 4MMLA 2QEXT 3SWNA 1AZEA 2QI2A 2I0NA 1MV0B 1HXDA 5CCAA 1VQ6A 4KGVB 1G2BA 4M75B 3PVLA 4DOVA 1ZLMA 2J06A 3EFOB 3L2RA 1MMAA 2QQAA 3NTKA 1K1ZA 2DBKA 3HRUA 3JCMg 3UA7A 2W0ZA 1M1KU 2XKOC 2L2PA 2OTLA 2XU8A 2EAYA 3CEYA 2F5TX 2I2LA 2V26A 2KGTA 1K76A 2DNUA 5CQYA 3OS2A 3VS6A 4X9DA 3MPUB 1YI2T 1WXBA 2E3IA 4D8DA 4R56A 5KYYA 5GANe 1YJNQ 3QZ5B 2R5AA 3A5ZB 4J9CA 3OBYA 2EKHA 1SHFA 4EDUA 3RMSA 4BDYA 2CH4A 1X2KA 2HSEB 1WI7A 2PUKB 3X20B 1GCQC 3JCMf 3TSWA 3CC2T 2CP0A 2FVUA 2RD1A 4D8KA 1M1FA 4M75C 5GAN2 1VQPA 1M3CA 1I4K1 2AK5A 2VKNA 4E7IA 4M77G 4IIOA 3KUFA 4AFUC 5GANg 1P92A 1N9SA 3FJ5A 4JS5A 1YIJQ 3BE3A 5CAIA 3S3NA 5FWBA 3V7CA 1VQMQ 3M56A 2LCLA 5KYUB 2E64A 1VQ8Q 3FEOA 4C8QG 1YHQQ 4XTVA 1FMWA 3I55A 4BE0A 1W2BS 4C0GA 3CC7Q 4HKEA 2NWMA 2ED0A 2NLUA 2DIQA 4MDWA 2D1XA 2Y90A 2DKGA 3HP9A 2A08A 2JS0A 5GAN6 5GAMj 3J7AF 2EYWA 2OX7A 1T0HA 3MJXA 4L59A 1VQOA 4PFZA 3EH1A 4F17A 4C8QC 2E3HA 4E7SA 4F7UA 3RKXA 2JOYA 1UGSB 5I2MA 3QXEB 3P8BB 4JZ4A 3M0TA 2O4XA 1W2BP 4AFQC 4JRIA 3CMAQ 5GANf 4RTWA 4J9FA 4XTUA 4WCIA 5CKEA 2DXUA 4PNOA 3MEAA 1VQ4Q 1KG1A 2CDTA 4ZN1A 2DM1A 3OS1A 4LDWA 1WHGA 3G4SQ 2ECZA 2LT4A 3QYHB 4BB7A 4LXCA 1OV3A 2L3QA 4M7AE 3VRZA 2K7AA 2NUPB 5LJ3j 3LGLA 2A0FB 1AWOA 1D09B 2EYXA 3CCUQ 1YJWA 1MGQA 1S72T 2DA9A 4J9IA 1KC8C 1NLOC 2F2VA 4F7UE 3JB9F 2NUZA 2CUDA 1LNXA 5IAYA 3VU3C 2LZ6B 3VRYA 5GANj 4M75F 2CT4A 2RHIA 1R0CB 1K0XA 1M3AA 4LD6A 2H3JA 1AD5A 1VQ6Q 3MHXA 2HL3A 4KBMB 3QKJA 2QDLA 5J3BA 2P0PA 4E6RA 1PCXA 2RJDA 2V1QA 1PRMC 4IKFA 2DFUA 1TS9A 1JEGA 2OTLQ 3OYIA 2GTOA 2PVGB 1JQQA 2PUOB 4RTVA 4BDZA 4RTTA 1ZSZC 1AWXA 3QHSA 4E7ZA 1OYXA 1AEYA 2P0QA 3SD4A 2M0YA 2DYIA 3D7SB 2XDBA 5GMKj 4MMKA 1X27A 3SWNC 2X4JA 1HSQA 4HA8A 4RCBA 2L3SA 4M7AD 4MZPA 5KH6A 2YUPA 2JUFA 4OMNA 4C8QF 3O8VA 4C0DB 3CBMA 2EWNA 2FG0A 2RF0A 3VYHB 3OYMA 5IN1A 5GAOp 4FCYA 1VQ8T 2A28A 4XQ3A 2Y4XA 3CC2A 5L23A 1K4US 2RH2A 4LE9A 5GJVB 1NLPC 1VQPQ 2LJ3A 3LW5E 5FW9A 2FZGB 3EGXA 2X35A 2YLCA 4CC7A 2CREA 3REBB 3CPWA 1H3ZA 4AMCA 4AT1B 2DLPA 1OU9A 2DF6A 1X69A 2VVKA 1U06A 2AZSA 4N4HA 3NHNA 3JCMP 1ARKA 3VS5A 5LJ5e 3CBOA 3FRNA 1BK2A 2E70A 4J9DA 2GBQA 3I55Q 1G5VA 2XK0A 4M7AB 1Q81U 1X6BA 1IZ6A 1KC8U 1OX9A 5CK9A 2PU9B 4Z88A 1B3QA 4M4ZA 2H3EB 1SEMA 1VQLT 1B07A 4FYVB 1KQSP 1E6GA 3TSZA 2RHXA 1MNEA 2YRDA 2DTOA 4PJLA 1VQOQ 1K8AR 5GAOq 1K73R 1YP5A 2JVVA 1VQNT 4KGXB 4OF1A 1T3LA 1AHJB 3M53A 5LJ5g 1M90R 1GBRA 1X6GA 2YLBA 4HVVA 2QAZA 1GRIA 1PNJA 3A8OB 2KYMA 2LC4A 4PJJA 4ZNXA 2K5LA 3OSSC 2EJGA 3NGPA 4FT4A 3M0UA 4C92B 4BI8B 3V8LA 3M0SA 3CCJQ 1SHGA 1GL5A 1G3TA 1D3BB 1SF9A 5EC7A 2W10A 4QQGA 3JAME 1YJ9T 4XK8E 3HKSA 2SRCA 7AT1B 4J83A 5IXBA 2D0QB 1YJWQ 1H3HA 4FT2A 2IVWA 3QSUA 4IURA 3G71T 3L2QA 5I11A 3JCMh 1KFZA 1GCQA 5CO7A 2KROA 4JJDA 1SKUB 3X24B 1PM3A 5GAN4 3MP8A 3BY7A 2DL5A 3ME9A 1RI9A 1PHTA 1QVFA 2K3YA 1WNLA 4M75A 2QEXQ 1OZ2A 2FO0A 2HQHA 5LJ5f 4FW2A 1EX4A 3EFOA 3EG2A 2JM9A 4B9WA 5KYWB 4ME7A 1JRIA 3EGDB 3RUXA 2K3BA 1WJSA 2KYBA 2G3RA 2DIGA 1M4ZA 2RMOA 2RJFA 2DL3A 3EFRA 1QVGS 1QP3A 2K2VA 1T3SA 4PJOB 4C92C 5IHIA 1QKXA 2RK1A 3OY9A 1IO6A 3RESA 1YI2Q 2HDAA 2JXBA 1PKTA 2BZXA 4II1A 1W1FA 4C8QA 1JU5C 1LPLA 1BIAA 2HQXA 1GFDA 1QVGP 4KGZB 5GANh 3L2WA 4DBRA 5KYNA 1Y71A 2WSEE 3P8HA 4IUQA 3OW2S 3S6WA 1VQ8A 3UATA 2X3WD 1BU1A 3OS5A 5C0MA 3GNGA 4M78E 3CC2Q 5FWCA 3I35A 1RL2A 3CC7A 1UG1A 1X01A 3QYGB 1WHMA 3OYJA 3CCST 4DA4A 2FPFA 3S3OA 4M77E 4QVCA 3JB9H 2EGCA 2VWFA 3Q1JA 3I9QA 2IIMA 1ZHIA 2DL8A 2K79A 5KYUA 2NUTA 3OW2P 3FJPA 6AT1B 1FMKA 3EAEA 4Z02A 3C94A 1IHVA 2FZKB 1TUDA 4CC3A 1I5OB 1WHKA 3H0FA 1AVZC 2LP5A 1JXOA 3VKIA 4EMKC 1B34A 1WHJA 1OPKA 2NYSA 3HSBA 2KSSA 2PZ1A 2O31A 1VQLA 1QWFA 2HL5C 1D0YA 2CH4W 2DD5A 1O9SA 2YSQA 1K0SA 1NZ9A 3M9QA 2E65A 4AFSC 1XNIA 1ZUUA 2AKKA 1A0NB 4RTXA 1OPLA 2E5KA 4E7JA 5CR2A 1NEBA 2LQKA 3AT1B 4CI0C 3CCUA 2DRKA 4Z89A 3I5RA 1JB0E 2HSPA 2OJ2A 3A8MB 3JB9I 3NMZC 4JJNK 1G3YA 4M78D 2F2WA 2K3XA 4OMQA 4C92F 2DO3A 2FB7A 2XHCA 3PNWC 1WZOA 1TG0A 4E47A 4M77D 2LJ0A 2RPNA 2K57A 2LVMA 1QKWA 1JXMA 3QJ6A 2VB6A 3CD6T 4ZN3A 4A4GA 3CXCA 3QIIA 4JPBW 1RAHB 3OYDA 1S72Q 4KUDK 3G71A 1FMVA 1HD3A 2R57A 2QG9B 1I1JA 2QQBA 4RCCA 2LJ1A 2RQTA 5KYXA 4PJMA 1LVKA 4JDSA 4RTZA 3ZEHA 4ELYC 1VQKT 2IPOB 5GAOl 2DEUA 1NYFA 2M51A 1BIBA 1PC0A 3JCMd 1WPYA 2QYZA 3EGUA 2YUOA 1JJ2A 1ACMB 2L3RA 2JN0A 5GAMd 3JB9G 4JZ3A 5CQXA 1QWEA 3G1JA 2J6FA 3FLGA 2YUQA 3UT1A 4AG2C 2FYKA 5I21A 3JCMb 3KFVA 3HFNA 2EYQA 4MZMA 4J9GA 3L42A 1UHFA 4M75G 2M02A 4RMOA 4M78B 1K9MR 2C06A 2CP7A 4E7LA 4M7DB 1ZUKA 2R5MA 3EG9B 2ZAEA 1HJDA 1NPPA 1OEBA 4M77B 4PJOF 4R55A 4LDXA 1NG2A 2JTMA 2CP3A 1Y57A 1N8RC 1CKAA 2HEQA 1K8AC 1GXIE 2KBTA 1UJYA 2CP6A 1H641 5A0LA 3UWNA 4L6V5 2JS2A 4ANJA 5IT9E 1M90C 1VQ7Q 4EMGA 2K5FA 5LJ3d 3C4SA 2GFUA 2MMPA 4DBHA 3I56T 2P4RA 3WXMB 1U8RA 2EGEA 2DJZA 4ORZA 4F16A 3X28B 2B8AA 2COWA 1MUZA 4OB3B 3VS0A 2X3XD 4BD3A 2D9TA 5GANd 3BFMA 5FU6B 2E41A 1MHNA 3CCSA 1OU8A 1UFFA 1ZSGA 2X4XA 3GOXA 5IHNA 1BB9A 2CP2A 2RK2A 2BTTA 2O9VA 2LDMA 4OMOA 4M7DC 1MV3A 2MCNA 2JTEA 4DOWA 3J81E 1NEGA 4AG1C 1WQ7A 3LLRA 2BUDA 5HK0A 2RM4A 3CPFA 2EIFA 2PVOB 2K2MA 3QWXX 5LJ5h 2ZPBB 2MWPA 2MF2A 3H8ZA 4TVRA 3PMIA 2VV5A 2RJEA 5IH2A 3CCLT 3LX7A 1MMNA 1VQLQ 2VXEA 2SEMA 1D0XA 5D6YA 1KHCA 1IGQA 3CCJA 2ZPIB 1WA7A 3TCJA 4OMFB 2VASA 4HT9A 2KT8A 1M1KR 1VQNQ 1AOJA 2DVJA 4FM4B 2EQJA 3KXTA 2RHYA 3PFSA 1X43A 4JRQA 5GMKl 2DXBA 2XD0A 5KE3A 1VIFA 2HCKA 4HXJA 4OGEA 4C92A 4E7HA 1SRMA 2CZ0B 1D3BA 4XU2A 4BI3A 1WX6A 1RAEB 2QEXA 3SB2A 2EJ9A 1N8RU 1TOVA 2VXFA 1AWWA 1WLPB 1PWTA 1K8AU 5HY6A 1I8FA 2MIOA 4RKUE 2FL7A 2QA4Q 1YJ9Q 1Y96A 2D0NA 3HFOA 3N5BB 1FXXA 2E6NA 1HYOA 1M90U 2GGRA 1F1BB 5EG2A 3PT9A 3G71Q 2DAQA 1AT1B 2PTKA 3V8JA 2KQWA 1MMDA 3SDZA 1PSEA 5KYWA 2ROLA 1VQKA 2A36A 3P8DA 1Q86R 1VYVA 1W2BA 3SEMA 1YFNA 4E7KA 1GCPA 4A63B 3G6ET 2EQKA 2B86A 1YI2A 2D8JA 2DJQA 5KYYB 2V8IA 4M7DF 5D6WA 1W6XA 1VQ7T 4QT7A 4RTUA 2OI3A 5M9OA 2EGAA 3OA6A 5GAOr 4RG8A 2H8HA 1YNZA 4PJOA 1UECA 2FEIA 2WSFE 3TQ7P 4FYYB 1KQ1A 4EMKA 3VS1A 1MNDA 2VC8A 4X1VA 2EW3A 1RLQC 2MWOA 3E9FA 3RNJA 4BE1A 1W70A 1QP2A 1M5Q1 2AIRB 4DQ2A 4O6JA 5IXFA 8ATCB 4ZTFA 2ESWA 2KY9A 3QZ9B 1C0MA 3I56A 3NFCA 3PE0A 4C5EA 2DYBA 2Z0WA 3OYAA 2MI6A 2KNBB 4OMMA 3V7SA 1QCNA
chains in the Genus database with same CATH topology
3OYCA 5FLXE 4ZGEB 1KHIA 1M1KU 2XKOC 1I81A 2AHJB 4II1A 3RIRA 4XTWA 3TEEA 3INZA 4GLKA 4C8QA 2OTLA 3DB3A 2XU8A 2EAYA 3CEYA 1BIAA 2F5TX 2HQXA 2E12A 2M0OA 2I2LA 3PMTA 4PL6A 5FU6C 2L89A 3ER0A 3CPWS 2D6FA 5GANh 5CQYA 3L2WA 3SWNB 3OS2A 4X9DA 1Q7YC 1Y71A 2WSEE 3P8HA 4IUQA 3OW2S 3S6WA 2RB6A 4C0DC 2F5KA 1VQ5T 4F7UB 1VQ8A 3OSVA 1YI2T 4QW2A 3OS5A 5C0MA 3PIOA 2DZCA 3GNGA 4M78E 3HHTB 2HAXA 3HL8A 4OB0B 4R56A 5J26A 3M4YA 1RL2A 3M4GA 1WJQA 3E19A 3CC7A 3ZBDA 1X01A 1K73U 3QYGB 1Q81C 3OYJA 1UEBA 2K4YA 3CCST 3CD6A 4DA4A 3CC4T 3CCQA 5L8RE 5GANe 4L5GA 3QZ5B 5I2SA 3BDUA 3S3OA 2R5AA 3QO3A 4M77E 2VYTA 3A5ZB 4QVCA 3JB9H 2XICA 3OBYA 3VUBA 3A8LB 3M54A 4EDUA 3RMSA 4BDYA 3Q1JA 2WSCE 4M7AG 3CCLA 4IUPA 1ZHIA 2MAMA 3VV0A 1SSFA 2RO0A 3WVDB 1U1TA 4NOYA 4Q5WA 2M9UA 4XU3A 3ASKA 2P4TA 2PUKB 2GFAA 4JRKA 3X20B 3FJPA 1G3SA 3JCMf 3OYNA 4Z02A 3EAEA 3CC2T 2LTOA 2FVUA 3C94A 2RD1A 1Q82C 2QA4T 3M59A 3FDRA 1M1FA 4QVZA 1JBMA 4M75C 5GAN2 1VQPA 1YJNT 4C92E 3JCMP 3G7ZA 2LQ8A 1I4K1 4JLGA 2LRQA 4E7IA 3JRZA 4C0FA 5A0DA 4M77G 3VKIA 4LDUA 3META 1B34A 3KUFA 3WVEB 4EMKC 3CCEA 4M78F 3TREA 1S72A 3LGFA 3GPLA 4ZGJB 5KCHA 3JCMX 5GANg 3CCRT 3HSBA 2KSSA 4J7IA 1Y07A 2M16A 2QXFA 3NTIA 1P92A 4M7AC 1VQLA 4OP0A 4KT0E 1N9SA 3BDLA 4JS5A 5CAIA 3J80E 2DD5A 3S3NA 1BI2A 1O9SA 4HCZA 3V7CA 4M77F 1NZ9A 3M9QA 3EFSA 3M56A 2VGMA 2LCLA 5GAOn 2DXCA 2RHUA 2E6ZA 2E64A 3FEOA 2E65A 3OBWA 4C8QG 3MCAB 2CZ7B 4XTVA 1XNIA 3I55A 5GAOm 4XU1A 1BKBA 3V8KA 4BE0A 1W2BS 1UGRB 4E7JA 4C92G 4C0GA 4EMHA 5CR2A 2LQKA 4HKEA 3OYBA 4CI0C 3OQ5A 3CCUA 1PSFA 5DY9A 4JUVA 2NLUA 2EKOA 1JB0E 4J5YA 4C5GA 2DIQA 4XTZA 2XG8D 3A8MB 4MDWA 3JB9I 4JJNK 1UB4A 1BI0A 2CZ6B 1G3YA 2Y90A 4M78D 2DKGA 3HP9A 2XDDA 1YIJT 1KQSA 2K3XA 4C92F 5GAN6 5GAMj 2DO3A 2FB7A 3J7AF 2XHCA 1N27A 3PNWC 1VQMT 4L59A 4Y91A 3QPHA 3CCMA 4N0AA 1VQOA 3TU4K 4BY6B 1FX7A 3BW1A 3JCMV 4XTXA 3JB9J 4E47A 1YHQT 3JCMW 1QVFS 1Y7XA 4OGCA 2RHZA 4M77D 4OVAA 4C8QC 2K57A 2LVMA 4F7UA 3RKXA 3CCVA 2JOYA 1UGSB 3QDRB 3QXEB 5I2MA 4NS5A 3P8BB 3CC7T 1M8VA 3QJ6A 2O4XA 3MEWA 3VYGA 2YHTA 3CD6T 2JNGA 4JRIA 3G6EA 4XU0A 3CMET 2X4YA 4ZN3A 4A4GA 3LH0A 5GANf 3RMQA 3CXCA 1OZ3A 3QIIA 4WF2A 4XTUA 4M7DA 5CKEA 2DXUA 2EFIA 4PNOA 3MEAA 3OYDA 4KUDK 1KG1A 5LJ5j 4M75E 4ZN1A 3G71A 1VQ7A 4PJOE 2QQ9A 1KQSS 2QQRA 3GNFB 2R57A 3OS1A 2DPPB 4LDWA 3M58A 1M1GA 2M1HA 4QQ6A 2KMTA 4C92D 2QQBA 3MEVA 1EIFA 4RCCA 3X25B 1Q7YU 2LT4A 3QYHB 4PLLA 3CBPA 4JDSA 3ZEHA 4BB7A 4ELYC 1VQKT 5GAOl 3QUIA 4M7AE 4EPCA 4J6YA 2BKDN 5A0GA 1BIBA 3JCMd 1WPYA 2YRVA 1JJ2A 4ATOA 2L3RA 5LJ3j 2JN0A 3M5AA 3CMAT 5GAMd 3JB9G 5CQXA 3LGLA 2CGHA 3OYEA 1HK9A 2O4XB 5DM7R 1WGSA 3FLGA 3E1SA 3UDCA 3UT1A 3DKMA 1YCYA 1VQ4T 1MGQA 3DB4A 1YJWA 2FYKA 5I21A 3JCMb 1S72T 2HBPA 3HFNA 2EYQA 4MZMA 2ZCFB 3L42A 4M75G 5CKDA 4PJOG 4RMOA 2K5IA 4M78B 1KC8C 4YTLA 2C06A 4E7LA 1I5LA 4M7DB 2KVQG 2DK3A 4BACA 4F7UE 1KD1C 3JB9F 4MZTA 4X34A 3MO8A 3G4ST 2OTJT 4A4EA 1R8OB 1WQWA 2R5MA 4C5HA 5FROA 1LNXA 3MP6A 5IAYA 1LJOA 3L1AA 3VU3C 3PIPA 5HKCA 5GANj 1NPPA 2QQSA 4M77B 4M75F 4KULA 4PJOF 2RHIA 4R55A 4LDXA 1K9MC 4P5NA 4LD6A 4ELZC 2H3JA 2JTMA 5LJ5d 1Q82U 4J6WA 3MHXA 4D6WA 5FU7B 2RI2A 5CIUA 1N8RC 4KBMB 3QKJA 3CCUT 4C8QE 1K8AC 5J3BA 2P0PA 2RI3A 4FU6A 4M7AF 1GXIE 2HQEA 3AHUA 1DJ7B 1H641 5A0LA 2RJDA 3L2UA 4PJOC 4IKFA 3UWNA 4L6V5 4F7UG 5IT9E 1M90C 4EMGA 4XTYA 2K5FA 5LJ3d 3C4SA 2GFUA 3OYIA 2PVGB 3PTAA 3JB9D 2MMPA 2PUOB 2E1HA 2ZZDA 3I56T 4BDZA 3QHSA 2L8DA 3WXMB 1VQ6T 1U8RA 4F7UF 1OYXA 2DJZA 4M75D 2P0QA 4PJOD 3SD4A 3X28B 2B8AA 1VQ9T 4NL2A 1VQ5A 2XDBA 4BUGA 2V8KA 4A4FA 4MDXA 5GMKj 4MMKA 4OB3B 3FB9A 1VQNA 4BD3A 1Y96B 3SWNC 2D9TA 2X4JA 4HA8A 4C0ZA 2WACA 4X9CA 1YITT 5GANd 5FRNA 3LWHA 4RCBA 1Q86C 4HT8A 1XQHA 1BI1A 3BFMA 2E41A 5FU6B 2RJCA 4M7AD 3JCMc 4MZPA 1MHNA 5KH6A 3CCSA 3SFMA 1NJIC 2OTLT 4NL3A 2X4XA 5GAMh 3GOXA 2JUFA 2BIVA 3URGA 4C8QF 3O8VA 4QVDA 4C0DB 5GMKm 3CBMA 1QVGA 2EWNA 1N9RA 2RK2A 3MEUA 4XAXB 3A8HB 1W4SA 5HK3A 2LDMA 4N4GA 3DLMA 3VYHB 3OYMA 4M7DC 5GAN3 5IN1A 5GAOp 2LX9A 2GF7A 3PGGA 4DOWA 3J81E 3HPWA 1VQ8T 1KQ2A 3OYGA 4GY5A 1WQ7A 3LLRA 1XOVA 4V2SA 2BUDA 4XQ3A 2Y4XA 5LL6S 3QG1A 3M57A 2CYZB 3OMCA 5HK0A 5A2QE 3CC2A 2RM4A 2LNVA 3CPFA 1UGPB 4ZTJA 2RH2A 2A3LA 2EIFA 3X26B 5J39A 2QA4A 3JCMJ 1YJ9A 4A53A 3FIFA 1WJRA 2PVOB 3CCQT 1YJNA 5FU7C 5LJ5h 5KCOA 3DLLA 2ZPBB 2MWPA 3LW5E 2MF2A 1TH7A 3GIBA 4M78A 5CVIA 3C95A 4J8OA 3H8ZA 1V29B 2FHDA 2X35A 2XDPA 4TVRA 2YLCA 3PMIA 2V8JA 2DTIA 2VV5A 4C8QD 4CRIA 3CCRA 2RJEA 2X4WA 3CPWA 3CCLT 1H3ZA 3LX7A 1O75A 1X6OA 4N4IA 3VJPA 4ZGDB 5FRMA 2VXEA 2ZPFB 4Y28E 2HD0A 5D6YA 1KHCA 4M77A 3OW2A 3CCJA 4N4HA 4HCBA 3R6OA 2XI9A 2ZPIB 5LJ3h 2QDYB 4OMFB 3NTHA 3TCJA 1ZQ1A 5LJ5e 3JCMQ 3CBOA 3FRNA 4HT9A 4EMKB 4C5IA 4O5VA 3T9NA 2LCCA 2P0KA 2E70A 5CKHA 1G5VA 4FM4B 1VQPT 1XTDA 4A4HA 2E10A 1U1SA 2EQJA 5GMKi 2F69A 3KXTA 2RHYA 2XK0A 3PFSA 4M7AB 5GAMg 1Q81U 2PQWA 4JRQA 1NE8A 2DVEA 5GMKl 3CCET 1IZ6A 1KC8U 5CK9A 2DXBA 2JZ2A 5GAN8 2PU9B 4IUTA 3CXCS 3JSCA 1KD1U 3GLXA 1YBYA 2KAFA 1X75C 1M1KC 5KE3A 4VUBA 2XD0A 5CKFA 5DLQE 3RKWA 5LJ3e 1VIFA 4OGEA 1FWZA 4C92A 1VQLT 4IUUA 5KE2A 5DLOA 4E7HA 1YIJA 2CZ0B 2RHXA 3GP8A 1D3BA 4XU2A 4BI3A 3H6ZA 1VQMA 1K9MU 2DZ9A 1VIEA 4FIBA 3L2VA 1BYMA 2DTOA 2QEXA 3SB2A 2E5QA 5C6SA 4PKCC 5GAOq 2EJ9A 1YHQA 2GCXA 2JVVA 2VUBA 3I55T 1N8RU 1VQNT 2VXFA 4OF1A 4M7DE 4JLIA 1AHJB 1K8AU 4QQDA 5HY6A 3V7RA 1JJ2S 1I8FA 3M53A 5LJ5g 4RKUE 1QVPA 2FL7A 4A4KA 1Y96A 2LT1A 4BY6C 3UPUA 4J7FA 2OAUA 2YLBA 3HFOA 3M55A 3N5BB 5AYFA 3LYIA 3FC3A 3CMEA 1FXXA 2E6NA 1K73C 1M90U 3A8OB 4A54A 2LC4A 4BE2A 1M9SA 2K5LA 4C8QB 3OSSC 5EG2A 3S3MA 3PT9A 2DXTA 2DAQA 2EJGA 2XIDA 4FT4A 3CCMT 3RKYA 3KBGA 2EJFA 4C92B 5LJ3g 4BI8B 3HRSA 1VQOT 3V8JA 3V8LA 3HRTA 2KQWA 3SDZA 3E9GA 2DTHA 1PSEA 1G3TA 1D3BB 1N6AA 3ZFJA 3OS0A 1ZBXA 1VQKA 4M78G 3CCVT 2EQMA 4M7DG 4FSXA 3P8DA 4QQGA 3F70A 5GAMf 3JAME 4LD9K 5GMKh 3OYKA 1YJ9T 1IREB 1W2BA 2PVDB 4XK8E 4E7KA 3HKSA 3G6ET 3CMAA 2EQKA 2Y4YA 2KK4A 3L2ZA 4J83A 1Q86U 2KDSA 1YI2A 4N0AC 2CKKA 1NJIU 3VUZA 2CS7A 3MP1A 2D0QB 1VQ4A 4UC4A 2V8IA 2A7YA 4FT2A 2IVWA 5D6WA 4PLIA 4M7DF 4OB2B 3QSUA 2O01E 4IURA 3G71T 3L2QA 1VQ7T 3OYLA 3JCMh 5CO7A 3C12A 3LWIA 3CC4A 5M9OA 2GQVA 3A8GB 1NPRA 2ZPGB 5GMKe 3X24B 4HCCA 1LOJA 1UGQB 4BI4A 1RI0A 4OB1B 3G4SA 3CCJT 5GAN4 3OMGA 3MP8A 3OA6A 5GAOr 3BY7A 4RG8A 2OTJA 2QTXA 3ME9A 4IUVA 1QVFA 2K3YA 1WNLA 4M75A 1OZ2A 1BI3A 4LDVA 4M78C 5LJ5f 5GAN5 4PJOA 2EQUA 2WSFE 4FL6A 3OYHA 3OYYA 2DD4A 4B9WA 1VUBA 1KQ1A 2ZPHB 4EMKA 4ME7A 1JRIA 4J6XA 2VC8A 3JCMe 3RUXA 2MWOA 3RERA 1WJSA 3E9FA 5GAMe 4M77C 5CKBA 3QJYA 1YJWT 4BE1A 4M7AA 1QP2A 2G3RA 4RG2A 2DIGA 1M5Q1 5D6XA 1B34B 5LJ3f 4DQ2A 4B9XA 4JRPA 1QW1A 4M7DD 2RI5A 1G3WA 1OI1A 1M4ZA 2R58A 2JTFA 4O6JA 2RJFA 5GAN7 2RA2A 4JS4A 2VGNA 2IG0A 3EFRA 2HNIA 2CZ1B 4KUIA 4MMLA 2QEXT 3SWNA 1QP3A 4ZTFA 1QVGS 2QI2A 2K2VA 2DEQA 4LDYA 2KY9A 3OB9A 3QZ9B 1HXDA 3I56A 5CCAA 3QBYA 3NFCA 3OYFA 1VQ6A 4M75B 4C5EA 4PJOB 2L5QA 4C92C 3GF5A 2ZGWA 4DOVA 3OYAA 1VQ9A 3L2RA 2MI6A 2QQAA 3NTKA 2ZPEB 2RK1A 3OY9A 3HRUA 3RESA 3V7SA 3JCMg 1YITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDD A;  2XDB A;  2XD0 A;  4RMO A;  4ATO A;  4GLK A; 
#chains in the Genus database with same CATH topology
 3OYC A;  1PKS A;  1WIE A;  4ZGE B;  3RIR A;  4XTW A;  3TEE A;  3CCS Q;  3INZ A;  4GLK A;  1WDX A;  2M0O A;  3PMT A;  3ER0 A;  2D6F A;  3GBQ A;  2RQV A;  4C0D C;  2RB6 A;  1VQ5 T;  2F5K A;  4F7U B;  4IIM A;  3OSV A;  4QW2 A;  3PIO A;  3HL8 A;  5J26 A;  3M4G A;  1WJQ A;  3E19 A;  1UEB A;  3THK A;  3CC4 T;  4L5G A;  3BDU A;  2VYT A;  3VUB A;  3A8L B;  3M54 A;  1PD0 A;  2O88 A;  2WSC E;  1XJW B;  2EYZ A;  3EG1 A;  3CCL A;  4M7A G;  3VV0 A;  1SSF A;  4DEX A;  1U1T A;  4NOY A;  2COY A;  2J6K A;  2A37 A;  2M9U A;  4XU3 A;  3ASK A;  1PD1 A;  3M0Q A;  2LTO A;  1I0C A;  2QA4 T;  2OAW A;  1EZZ B;  4QVZ A;  1JBM A;  4PJN A;  3G7Z A;  1BCM A;  4JLG A;  2LRQ A;  3JRZ A;  4C0F A;  4LDU A;  3MET A;  1S72 A;  3LGF A;  2L0A A;  3JCM X;  2M16 A;  1M3B A;  3ULR B;  3NTI A;  4M7A C;  4OP0 A;  4KT0 E;  2C0O A;  1VA7 A;  3J80 E;  3EFS A;  1IGU A;  2AKL A;  2DXC A;  5GAO n;  2E6Z A;  3OBW A;  5D7U A;  4XU1 A;  2YDL A;  1U5S A;  4C92 G;  3CD6 Q;  2PNI A;  5DY9 A;  4JUV A;  2EKO A;  1UTI A;  4J5Y A;  4C5G A;  2XG8 D;  1UB4 A;  1BI0 A;  2CZ6 B;  3EG0 A;  2XDD A;  1KQS A;  1LCK A;  4GLM A;  1N27 A;  2KT1 A;  4Y91 A;  3TU4 K;  4BY6 B;  2YT6 A;  4XTX A;  3JB9 J;  4OVA A;  1VQK Q;  3A1P A;  4NS5 A;  1M8V A;  5ECA A;  3VYG A;  2YHT A;  3PVQ A;  3G6E A;  3CME T;  2X4Y A;  3LH0 A;  4JJB A;  4GBQ A;  2RN8 A;  4M7D A;  2EFI A;  2EVR A;  5LJ5 j;  2C0T A;  4M75 E;  1WXU A;  1VQ7 A;  1D1B A;  2QQ9 A;  1Q7Y R;  4EIK A;  5GJW B;  3GNF B;  3EG9 A;  2DPP B;  3M58 A;  1M1G A;  2KMT A;  3X25 B;  4PLL A;  1ZA1 B;  1U3O A;  2QK0 A;  4J6Y A;  1RAI B;  2BKD N;  1Q81 R;  2YRV A;  2CGH A;  1IXD A;  1HK9 A;  5DM7 R;  1WGS A;  2C0I A;  1YCY A;  2KI7 A;  2HBP A;  1OX8 A;  5CKD A;  4PJO G;  1RAA B;  3M0R A;  2BZY A;  4MZT A;  4X34 A;  3MO8 A;  2OTJ T;  1WQW A;  4C5H A;  5FRO A;  1LJO A;  5HKC A;  1Q82 R;  2QQS A;  1TSF A;  4LUE A;  4KUL A;  4CC4 B;  4ELZ C;  3I56 Q;  2J6O A;  1WHL A;  4J6W A;  4D6W A;  1H92 A;  4C8Q E;  2JM8 A;  2RI3 A;  4Z8A A;  4M7A F;  3UF4 A;  4PJO C;  2HZY A;  4XTY A;  2JMC A;  3JB9 D;  2K6D A;  4CC2 A;  2LMJ A;  2FRY A;  2KXC A;  2ZZD A;  4ESR A;  1T0J A;  2L8D A;  4F7U F;  4M75 D;  2LQN A;  4DEY A;  1VQ9 T;  2COZ A;  1VQ5 A;  4BUG A;  2V8K A;  1KIK A;  4MDX A;  1Y0M A;  3UA6 A;  1VQN A;  1YIT T;  3LWH A;  4HT8 A;  1Q86 C;  1XQH A;  4LNP A;  2HKQ B;  1TXQ A;  1AWJ A;  2BE9 B;  2BIV A;  2LX7 A;  3URG A;  4QVD A;  1C6V X;  1V1C A;  2BZ8 A;  1QVG A;  4PK4 A;  3A8H B;  1W4S A;  5HK3 A;  3DLM A;  2RQW A;  5GAN 3;  3CCL Q;  2E4H A;  2LX9 A;  3HPW A;  2NUP A;  3E2U A;  1XOV A;  5LL6 S;  5A2Q E;  3QG1 A;  3M57 A;  2CYZ B;  1RAD B;  1UGP B;  4ZTJ A;  5J39 A;  2A3L A;  3X26 B;  2KXD A;  2QA4 A;  1YJ9 A;  3FIF A;  1WJR A;  3ZL7 C;  3CCQ T;  4RTY A;  2CT3 A;  2KRN A;  3DLL A;  1WHH A;  2F2X A;  4J9B A;  2FHD A;  1M8M A;  4C8Q D;  3VJP A;  2O2O A;  4Y28 E;  2XMF A;  1OQK A;  3OW2 A;  2XI9 A;  2KR3 A;  3OYG A;  2JT4 A;  1ZQ1 A;  2ENM A;  3JCM Q;  2LCC A;  2E10 A;  5GMK i;  1KD1 R;  4HVW A;  1PRL C;  5GAM g;  2PQW A;  1AZG B;  3R6N A;  1UUE A;  1NE8 A;  2DVE A;  3CCE T;  2GQI A;  2P84 A;  2J05 A;  2JZ2 A;  2HMA A;  3GLX A;  5DLQ E;  3RKW A;  2FRW A;  1GFC A;  5LJ3 e;  4Y92 A;  1FWZ A;  5DLO A;  1C1A A;  3CQT A;  3GP8 A;  1VIE A;  4AFZ C;  2GCX A;  2VUB A;  1OUL A;  2O9S A;  4QQD A;  2CSI A;  4PFP A;  1S1N A;  4A4K A;  3UPU A;  2LT1 A;  8AT1 B;  2OAU A;  5AYF A;  3LYI A;  3CME A;  2GNC A;  3G6E Q;  1K73 C;  4FW1 A;  4A54 A;  1VYU A;  4C8Q B;  3CCR Q;  3RDV A;  2QGG A;  1UE9 A;  3RKY A;  3CCM T;  5LJ3 g;  3E9G A;  3ZFJ A;  1ZBX A;  4M78 G;  3CCV T;  4J9H A;  4FSX A;  4M7D G;  5GAM f;  1SPK A;  2ATC B;  1NJI R;  2LQW A;  1UGV A;  2YWW A;  2Y4Y A;  2KK4 A;  1Q86 U;  1TUC A;  3VS4 A;  2CKK A;  4R0K A;  3VUZ A;  2CS7 A;  4UC4 A;  2YUN A;  1M2V B;  4PLI A;  2D8H A;  2O01 E;  2GTJ A;  3OYL A;  2EBP A;  5GMK e;  4HCC A;  1UGQ B;  1RI0 A;  4OB1 B;  2OTJ A;  4FYW B;  3OMG A;  4F04 B;  1SRL A;  2NUT B;  4M78 C;  4LDV A;  3EHQ A;  5GAN 5;  1PG5 B;  4FL6 A;  2BE7 D;  3OYY A;  1YWP A;  2DD4 A;  1RUW A;  1VUB A;  2DIL A;  1MMG A;  1V76 A;  1ZBJ A;  3RER A;  4F14 A;  4M77 C;  5CKB A;  1E6H A;  3QJY A;  4M7A A;  1KSW A;  2ABL A;  2MPX C;  5D6X A;  1B34 B;  5LJ3 f;  1QW1 A;  2RI5 A;  1G3W A;  1OI1 A;  1QCO A;  2R58 A;  2JTF A;  1QMC A;  1KJW A;  2RA2 A;  2HNI A;  3LH5 A;  4LN2 A;  2DEQ A;  4LDY A;  3OB9 A;  1ZUY A;  3QBY A;  1M27 C;  3OYF A;  3A98 A;  2L5Q A;  3GF5 A;  2ZGW A;  1E7O A;  1VQ9 A;  1VQ5 Q;  1SSH A;  2ZPE B;  1YIT A;  1H8K A;  5FLX E;  1KHI A;  1ZSZ B;  1I81 A;  2AHJ B;  3RR6 A;  3CC4 Q;  3DB3 A;  2E12 A;  4PL6 A;  5FU6 C;  3CPW S;  2L89 A;  2CSQ A;  2AT1 B;  3SWN B;  4FYX B;  1Q7Y C;  1Q95 G;  2HAX A;  2DZC A;  3HHT B;  4OB0 B;  3M4Y A;  1K73 U;  3ZBD A;  1Q81 C;  1FYN A;  2K4Y A;  3CD6 A;  2DE0 X;  9ATC B;  4LUD A;  3CCQ A;  5L8R E;  5I2S A;  1QCF A;  3QO3 A;  2JJ9 A;  2XIC A;  2DL4 A;  2G6F X;  1D1A A;  3CPW P;  4IUP A;  2MAM A;  5KYX B;  2RO0 A;  3WVD B;  1JO8 A;  4Q5W A;  2P4T A;  2GFA A;  4JRK A;  1G3S A;  3H41 A;  3OYN A;  2LCS A;  2MK5 A;  3EGD A;  1TWB A;  1Q82 C;  3M59 A;  2JMA A;  3FDR A;  4K11 A;  1YJN T;  4C92 E;  2LQ8 A;  4DBF A;  2F1L A;  5A0D A;  3CCE A;  3WVE B;  4J9E A;  4M78 F;  3TRE A;  1UHC A;  3GPL A;  4ZGJ B;  5KCH A;  2EYY A;  3CCR T;  4J7I A;  1Y07 A;  2QXF A;  1R77 A;  1BBZ A;  3BDL A;  1BI2 A;  4HCZ A;  4M77 F;  1VYT A;  2YXY A;  2DRM A;  2VGM A;  2RHU A;  4WTO B;  3VS2 A;  1IRX A;  2QGF B;  3MCA B;  2CZ7 B;  5GAO m;  1BKB A;  1ABO A;  5IHK A;  3V8K A;  1UGR B;  4EMH A;  1RAC B;  3OYB A;  3OQ5 A;  4QKU A;  5I22 A;  1PSF A;  1ZA2 B;  3EHR A;  3CME Q;  2FPE A;  4XTZ A;  1CKB A;  1M2O A;  1YIJ T;  1TTH B;  1VQM T;  2MYS A;  3QPH A;  1ABQ A;  3CCM A;  4N0A A;  1FX7 A;  3BW1 A;  1TU0 B;  3JCM V;  3MKD A;  3TVT A;  1YHQ T;  3JCM W;  1QVF S;  1Y7X A;  4OGC A;  2RHZ A;  2FPD A;  3CCV A;  2HBW A;  3QDR B;  3I5S A;  4E2F B;  3CC7 T;  3MEW A;  2AZV A;  2JNG A;  3O5Z A;  4JJC A;  4XU0 A;  1WXT A;  3RMQ A;  1OZ3 A;  4WF2 A;  1NBE B;  2RNA A;  4PJO E;  1KQS S;  2DBM A;  2QQR A;  1UDL A;  4QQ6 A;  2M1H A;  2J7I A;  4C92 D;  1QLY A;  2DMO A;  3JV3 A;  1EIF A;  3MEV A;  1Q7Y U;  2OTJ Q;  3CBP A;  1QVF P;  3QWY A;  3QUI A;  4EPC A;  3EG3 A;  5A0G A;  2LNH B;  4ATO A;  1YN8 A;  1OOT A;  3M5A A;  3CMA T;  1M30 A;  3OYE A;  2O4X B;  2HKN A;  3UDC A;  3E1S A;  3DKM A;  1VQ4 T;  3DB4 A;  4KRT A;  2ZCF B;  3IQL A;  1D1C A;  2K5I A;  4YTL A;  1I5L A;  2KVQ G;  2DK3 A;  4BAC A;  1KD1 C;  3G4S T;  4A4E A;  1R8O B;  1N8R R;  1G83 A;  3MP6 A;  3L1A A;  3PIP A;  1UJ0 A;  1K9M C;  4P5N A;  5LJ5 d;  1Q82 U;  5FU7 B;  2RI2 A;  1KK7 A;  1WFW A;  5CIU A;  3CCU T;  1X2Q A;  1VQ9 Q;  2V1R A;  4FU6 A;  2ROT A;  2HQE A;  3AHU A;  1DJ7 B;  3L2U A;  1EFN A;  1YIT Q;  4F7U G;  1IHW A;  3VS3 A;  1CSK A;  1WYX A;  3PTA A;  2E1H A;  1GBQ A;  1VQ6 T;  2DER A;  4PJO D;  2K9G A;  2QAS A;  4NL2 A;  4RUG A;  1J3T A;  2KRS A;  4A4F A;  3FB9 A;  4KH1 B;  1Y96 B;  2RQU A;  4C0Z A;  2WAC A;  4X9C A;  5FRN A;  1G8X A;  1BI1 A;  2RJC A;  3JCM c;  3SFM A;  1NJI C;  3CCQ Q;  2OTL T;  4NL3 A;  5GAM h;  2DX1 A;  5GMK m;  2RQR A;  1SG5 A;  1N9R A;  3MEU A;  4XAX B;  4DBQ A;  1RAF B;  1RLP C;  1RAB B;  2QTV A;  4N4G A;  2KEA A;  3H9N A;  2GF7 A;  3PGG A;  1KQ2 A;  1D0Z A;  4GY5 A;  4V2S A;  3NPF A;  3OMC A;  2LNV A;  2KRM A;  3JCM J;  4A53 A;  2ED1 A;  1YJN A;  3REA B;  5FU7 C;  2X51 A;  5KCO A;  2CUB A;  3GIB A;  1TH7 A;  4M78 A;  5CVI A;  1IB8 A;  4FSS A;  3C95 A;  4HVU A;  4J8O A;  1V29 B;  3CCE Q;  2XDP A;  1K9A A;  2V8J A;  2DTI A;  4CRI A;  3CCR A;  2X4W A;  1N5Z A;  1NYG A;  1O75 A;  1X6O A;  2L3P A;  4N4I A;  4ZGD B;  5FRM A;  5HCK A;  1BCO A;  2ZPF B;  2HD0 A;  4M77 A;  1NM7 A;  1QQJ A;  1Z9Z A;  3R6O A;  4HCB A;  5LJ3 h;  2QDY B;  3NTH A;  4EMK B;  4C5I A;  1TUG B;  4O5V A;  3T9N A;  2P0K A;  3SHW A;  5CKH A;  2X9H A;  2EQI A;  1KC8 R;  1VQP T;  1XTD A;  4A4H A;  1U1S A;  2F69 A;  2KE9 A;  3HTR A;  5GAN 8;  3CXC S;  4IUT A;  5AT1 B;  3JSC A;  1KD1 U;  4OML A;  1YBY A;  2KAF A;  1X75 C;  1M1K C;  4VUB A;  5CKF A;  3EGX B;  3U23 A;  1ZX6 A;  4IUU A;  5KE2 A;  1YIJ A;  3H6Z A;  1VQM A;  1K9M U;  2DZ9 A;  4FIB A;  3L2V A;  4OMP A;  3CCM Q;  1BYM A;  2E5Q A;  4KH0 B;  5C6S A;  4PKC C;  2MOX A;  2DET A;  1YHQ A;  3H0I A;  3I55 T;  3VS7 A;  4M7D E;  4JLI A;  3CCV Q;  3QDF A;  3V7R A;  1JJ2 S;  2DL7 A;  1QVP A;  4BY6 C;  3H0H A;  4J7F A;  3M55 A;  3FC3 A;  1YWO A;  1M2V A;  3RBB B;  3CXC P;  4BE2 A;  1M9S A;  4PFO A;  2YRC A;  3S3M A;  2DXT A;  2XID A;  3KBG A;  2EJF A;  1VQO T;  3HRS A;  3HRT A;  2DTH A;  1N6A A;  3OS0 A;  1B7T A;  2EQM A;  3F70 A;  4LD9 K;  5GMK h;  3OYK A;  1IRE B;  2PVD B;  1JJ2 P;  4HCK A;  3CMA A;  3M0P A;  3L2Z A;  2CP5 A;  2KDS A;  4N0A C;  1NJI U;  3MP1 A;  3C0C A;  1VQ4 A;  2A7Y A;  4OB2 B;  3C12 A;  3LWI A;  3CC4 A;  2GQV A;  3A8G B;  1NPR A;  2ZPG B;  1LOJ A;  4BI4 A;  3G4S A;  3CCJ T;  4B6M A;  2QTX A;  4IUV A;  1BI3 A;  2EQU A;  2JW4 A;  3OYH A;  1VOM A;  1RAG B;  2EPD A;  2ZPH B;  2FZC B;  4J6X A;  3JCM e;  1YJW T;  5GAM e;  1ZSZ A;  1YCS B;  4RG2 A;  1R0B G;  4B9X A;  1I07 A;  3EH2 A;  4JRP A;  4M7D D;  5GAN 7;  1Z9Q A;  4JS4 A;  2IG0 A;  2VGN A;  4KUI A;  2CZ1 B;  4MML A;  2QEX T;  3SWN A;  1AZE A;  2QI2 A;  2I0N A;  1MV0 B;  1HXD A;  5CCA A;  1VQ6 A;  4KGV B;  1G2B A;  4M75 B;  3PVL A;  4DOV A;  1ZLM A;  2J06 A;  3EFO B;  3L2R A;  1MMA A;  2QQA A;  3NTK A;  1K1Z A;  2DBK A;  3HRU A;  3JCM g;  3UA7 A;  2W0Z A;  1M1K U;  2XKO C;  2L2P A;  2OTL A;  2XU8 A;  2EAY A;  3CEY A;  2F5T X;  2I2L A;  2V26 A;  2KGT A;  1K76 A;  2DNU A;  5CQY A;  3OS2 A;  3VS6 A;  4X9D A;  3MPU B;  1YI2 T;  1WXB A;  2E3I A;  4D8D A;  4R56 A;  5KYY A;  5GAN e;  1YJN Q;  3QZ5 B;  2R5A A;  3A5Z B;  4J9C A;  3OBY A;  2EKH A;  1SHF A;  4EDU A;  3RMS A;  4BDY A;  2CH4 A;  1X2K A;  2HSE B;  1WI7 A;  2PUK B;  3X20 B;  1GCQ C;  3JCM f;  3TSW A;  3CC2 T;  2CP0 A;  2FVU A;  2RD1 A;  4D8K A;  1M1F A;  4M75 C;  5GAN 2;  1VQP A;  1M3C A;  1I4K 1;  2AK5 A;  2VKN A;  4E7I A;  4M77 G;  4IIO A;  3KUF A;  4AFU C;  5GAN g;  1P92 A;  1N9S A;  3FJ5 A;  4JS5 A;  1YIJ Q;  3BE3 A;  5CAI A;  3S3N A;  5FWB A;  3V7C A;  1VQM Q;  3M56 A;  2LCL A;  5KYU B;  2E64 A;  1VQ8 Q;  3FEO A;  4C8Q G;  1YHQ Q;  4XTV A;  1FMW A;  3I55 A;  4BE0 A;  1W2B S;  4C0G A;  3CC7 Q;  4HKE A;  2NWM A;  2ED0 A;  2NLU A;  2DIQ A;  4MDW A;  2D1X A;  2Y90 A;  2DKG A;  3HP9 A;  2A08 A;  2JS0 A;  5GAN 6;  5GAM j;  3J7A F;  2EYW A;  2OX7 A;  1T0H A;  3MJX A;  4L59 A;  1VQO A;  4PFZ A;  3EH1 A;  4F17 A;  4C8Q C;  2E3H A;  4E7S A;  4F7U A;  3RKX A;  2JOY A;  1UGS B;  5I2M A;  3QXE B;  3P8B B;  4JZ4 A;  3M0T A;  2O4X A;  1W2B P;  4AFQ C;  4JRI A;  3CMA Q;  5GAN f;  4RTW A;  4J9F A;  4XTU A;  4WCI A;  5CKE A;  2DXU A;  4PNO A;  3MEA A;  1VQ4 Q;  1KG1 A;  2CDT A;  4ZN1 A;  2DM1 A;  3OS1 A;  4LDW A;  1WHG A;  3G4S Q;  2ECZ A;  2LT4 A;  3QYH B;  4BB7 A;  4LXC A;  1OV3 A;  2L3Q A;  4M7A E;  3VRZ A;  2K7A A;  2NUP B;  5LJ3 j;  3LGL A;  2A0F B;  1AWO A;  1D09 B;  2EYX A;  3CCU Q;  1YJW A;  1MGQ A;  1S72 T;  2DA9 A;  4J9I A;  1KC8 C;  1NLO C;  2F2V A;  4F7U E;  3JB9 F;  2NUZ A;  2CUD A;  1LNX A;  5IAY A;  3VU3 C;  2LZ6 B;  3VRY A;  5GAN j;  4M75 F;  2CT4 A;  2RHI A;  1R0C B;  1K0X A;  1M3A A;  4LD6 A;  2H3J A;  1AD5 A;  1VQ6 Q;  3MHX A;  2HL3 A;  4KBM B;  3QKJ A;  2QDL A;  5J3B A;  2P0P A;  4E6R A;  1PCX A;  2RJD A;  2V1Q A;  1PRM C;  4IKF A;  2DFU A;  1TS9 A;  1JEG A;  2OTL Q;  3OYI A;  2GTO A;  2PVG B;  1JQQ A;  2PUO B;  4RTV A;  4BDZ A;  4RTT A;  1ZSZ C;  1AWX A;  3QHS A;  4E7Z A;  1OYX A;  1AEY A;  2P0Q A;  3SD4 A;  2M0Y A;  2DYI A;  3D7S B;  2XDB A;  5GMK j;  4MMK A;  1X27 A;  3SWN C;  2X4J A;  1HSQ A;  4HA8 A;  4RCB A;  2L3S A;  4M7A D;  4MZP A;  5KH6 A;  2YUP A;  2JUF A;  4OMN A;  4C8Q F;  3O8V A;  4C0D B;  3CBM A;  2EWN A;  2FG0 A;  2RF0 A;  3VYH B;  3OYM A;  5IN1 A;  5GAO p;  4FCY A;  1VQ8 T;  2A28 A;  4XQ3 A;  2Y4X A;  3CC2 A;  5L23 A;  1K4U S;  2RH2 A;  4LE9 A;  5GJV B;  1NLP C;  1VQP Q;  2LJ3 A;  3LW5 E;  5FW9 A;  2FZG B;  3EGX A;  2X35 A;  2YLC A;  4CC7 A;  2CRE A;  3REB B;  3CPW A;  1H3Z A;  4AMC A;  4AT1 B;  2DLP A;  1OU9 A;  2DF6 A;  1X69 A;  2VVK A;  1U06 A;  2AZS A;  4N4H A;  3NHN A;  3JCM P;  1ARK A;  3VS5 A;  5LJ5 e;  3CBO A;  3FRN A;  1BK2 A;  2E70 A;  4J9D A;  2GBQ A;  3I55 Q;  1G5V A;  2XK0 A;  4M7A B;  1Q81 U;  1X6B A;  1IZ6 A;  1KC8 U;  1OX9 A;  5CK9 A;  2PU9 B;  4Z88 A;  1B3Q A;  4M4Z A;  2H3E B;  1SEM A;  1VQL T;  1B07 A;  4FYV B;  1KQS P;  1E6G A;  3TSZ A;  2RHX A;  1MNE A;  2YRD A;  2DTO A;  4PJL A;  1VQO Q;  1K8A R;  5GAO q;  1K73 R;  1YP5 A;  2JVV A;  1VQN T;  4KGX B;  4OF1 A;  1T3L A;  1AHJ B;  3M53 A;  5LJ5 g;  1M90 R;  1GBR A;  1X6G A;  2YLB A;  4HVV A;  2QAZ A;  1GRI A;  1PNJ A;  3A8O B;  2KYM A;  2LC4 A;  4PJJ A;  4ZNX A;  2K5L A;  3OSS C;  2EJG A;  3NGP A;  4FT4 A;  3M0U A;  4C92 B;  4BI8 B;  3V8L A;  3M0S A;  3CCJ Q;  1SHG A;  1GL5 A;  1G3T A;  1D3B B;  1SF9 A;  5EC7 A;  2W10 A;  4QQG A;  3JAM E;  1YJ9 T;  4XK8 E;  3HKS A;  2SRC A;  7AT1 B;  4J83 A;  5IXB A;  2D0Q B;  1YJW Q;  1H3H A;  4FT2 A;  2IVW A;  3QSU A;  4IUR A;  3G71 T;  3L2Q A;  5I11 A;  3JCM h;  1KFZ A;  1GCQ A;  5CO7 A;  2KRO A;  4JJD A;  1SKU B;  3X24 B;  1PM3 A;  5GAN 4;  3MP8 A;  3BY7 A;  2DL5 A;  3ME9 A;  1RI9 A;  1PHT A;  1QVF A;  2K3Y A;  1WNL A;  4M75 A;  2QEX Q;  1OZ2 A;  2FO0 A;  2HQH A;  5LJ5 f;  4FW2 A;  1EX4 A;  3EFO A;  3EG2 A;  2JM9 A;  4B9W A;  5KYW B;  4ME7 A;  1JRI A;  3EGD B;  3RUX A;  2K3B A;  1WJS A;  2KYB A;  2G3R A;  2DIG A;  1M4Z A;  2RMO A;  2RJF A;  2DL3 A;  3EFR A;  1QVG S;  1QP3 A;  2K2V A;  1T3S A;  4PJO B;  4C92 C;  5IHI A;  1QKX A;  2RK1 A;  3OY9 A;  1IO6 A;  3RES A;  1YI2 Q;  2HDA A;  2JXB A;  1PKT A;  2BZX A;  4II1 A;  1W1F A;  4C8Q A;  1JU5 C;  1LPL A;  1BIA A;  2HQX A;  1GFD A;  1QVG P;  4KGZ B;  5GAN h;  3L2W A;  4DBR A;  5KYN A;  1Y71 A;  2WSE E;  3P8H A;  4IUQ A;  3OW2 S;  3S6W A;  1VQ8 A;  3UAT A;  2X3W D;  1BU1 A;  3OS5 A;  5C0M A;  3GNG A;  4M78 E;  3CC2 Q;  5FWC A;  3I35 A;  1RL2 A;  3CC7 A;  1UG1 A;  1X01 A;  3QYG B;  1WHM A;  3OYJ A;  3CCS T;  4DA4 A;  2FPF A;  3S3O A;  4M77 E;  4QVC A;  3JB9 H;  2EGC A;  2VWF A;  3Q1J A;  3I9Q A;  2IIM A;  1ZHI A;  2DL8 A;  2K79 A;  5KYU A;  2NUT A;  3OW2 P;  3FJP A;  6AT1 B;  1FMK A;  3EAE A;  4Z02 A;  3C94 A;  1IHV A;  2FZK B;  1TUD A;  4CC3 A;  1I5O B;  1WHK A;  3H0F A;  1AVZ C;  2LP5 A;  1JXO A;  3VKI A;  4EMK C;  1B34 A;  1WHJ A;  1OPK A;  2NYS A;  3HSB A;  2KSS A;  2PZ1 A;  2O31 A;  1VQL A;  1QWF A;  2HL5 C;  1D0Y A;  2CH4 W;  2DD5 A;  1O9S A;  2YSQ A;  1K0S A;  1NZ9 A;  3M9Q A;  2E65 A;  4AFS C;  1XNI A;  1ZUU A;  2AKK A;  1A0N B;  4RTX A;  1OPL A;  2E5K A;  4E7J A;  5CR2 A;  1NEB A;  2LQK A;  3AT1 B;  4CI0 C;  3CCU A;  2DRK A;  4Z89 A;  3I5R A;  1JB0 E;  2HSP A;  2OJ2 A;  3A8M B;  3JB9 I;  3NMZ C;  4JJN K;  1G3Y A;  4M78 D;  2F2W A;  2K3X A;  4OMQ A;  4C92 F;  2DO3 A;  2FB7 A;  2XHC A;  3PNW C;  1WZO A;  1TG0 A;  4E47 A;  4M77 D;  2LJ0 A;  2RPN A;  2K57 A;  2LVM A;  1QKW A;  1JXM A;  3QJ6 A;  2VB6 A;  3CD6 T;  4ZN3 A;  4A4G A;  3CXC A;  3QII A;  4JPB W;  1RAH B;  3OYD A;  1S72 Q;  4KUD K;  3G71 A;  1FMV A;  1HD3 A;  2R57 A;  2QG9 B;  1I1J A;  2QQB A;  4RCC A;  2LJ1 A;  2RQT A;  5KYX A;  4PJM A;  1LVK A;  4JDS A;  4RTZ A;  3ZEH A;  4ELY C;  1VQK T;  2IPO B;  5GAO l;  2DEU A;  1NYF A;  2M51 A;  1BIB A;  1PC0 A;  3JCM d;  1WPY A;  2QYZ A;  3EGU A;  2YUO A;  1JJ2 A;  1ACM B;  2L3R A;  2JN0 A;  5GAM d;  3JB9 G;  4JZ3 A;  5CQX A;  1QWE A;  3G1J A;  2J6F A;  3FLG A;  2YUQ A;  3UT1 A;  4AG2 C;  2FYK A;  5I21 A;  3JCM b;  3KFV A;  3HFN A;  2EYQ A;  4MZM A;  4J9G A;  3L42 A;  1UHF A;  4M75 G;  2M02 A;  4RMO A;  4M78 B;  1K9M R;  2C06 A;  2CP7 A;  4E7L A;  4M7D B;  1ZUK A;  2R5M A;  3EG9 B;  2ZAE A;  1HJD A;  1NPP A;  1OEB A;  4M77 B;  4PJO F;  4R55 A;  4LDX A;  1NG2 A;  2JTM A;  2CP3 A;  1Y57 A;  1N8R C;  1CKA A;  2HEQ A;  1K8A C;  1GXI E;  2KBT A;  1UJY A;  2CP6 A;  1H64 1;  5A0L A;  3UWN A;  4L6V 5;  2JS2 A;  4ANJ A;  5IT9 E;  1M90 C;  1VQ7 Q;  4EMG A;  2K5F A;  5LJ3 d;  3C4S A;  2GFU A;  2MMP A;  4DBH A;  3I56 T;  2P4R A;  3WXM B;  1U8R A;  2EGE A;  2DJZ A;  4ORZ A;  4F16 A;  3X28 B;  2B8A A;  2COW A;  1MUZ A;  4OB3 B;  3VS0 A;  2X3X D;  4BD3 A;  2D9T A;  5GAN d;  3BFM A;  5FU6 B;  2E41 A;  1MHN A;  3CCS A;  1OU8 A;  1UFF A;  1ZSG A;  2X4X A;  3GOX A;  5IHN A;  1BB9 A;  2CP2 A;  2RK2 A;  2BTT A;  2O9V A;  2LDM A;  4OMO A;  4M7D C;  1MV3 A;  2MCN A;  2JTE A;  4DOW A;  3J81 E;  1NEG A;  4AG1 C;  1WQ7 A;  3LLR A;  2BUD A;  5HK0 A;  2RM4 A;  3CPF A;  2EIF A;  2PVO B;  2K2M A;  3QWX X;  5LJ5 h;  2ZPB B;  2MWP A;  2MF2 A;  3H8Z A;  4TVR A;  3PMI A;  2VV5 A;  2RJE A;  5IH2 A;  3CCL T;  3LX7 A;  1MMN A;  1VQL Q;  2VXE A;  2SEM A;  1D0X A;  5D6Y A;  1KHC A;  1IGQ A;  3CCJ A;  2ZPI B;  1WA7 A;  3TCJ A;  4OMF B;  2VAS A;  4HT9 A;  2KT8 A;  1M1K R;  1VQN Q;  1AOJ A;  2DVJ A;  4FM4 B;  2EQJ A;  3KXT A;  2RHY A;  3PFS A;  1X43 A;  4JRQ A;  5GMK l;  2DXB A;  2XD0 A;  5KE3 A;  1VIF A;  2HCK A;  4HXJ A;  4OGE A;  4C92 A;  4E7H A;  1SRM A;  2CZ0 B;  1D3B A;  4XU2 A;  4BI3 A;  1WX6 A;  1RAE B;  2QEX A;  3SB2 A;  2EJ9 A;  1N8R U;  1TOV A;  2VXF A;  1AWW A;  1WLP B;  1PWT A;  1K8A U;  5HY6 A;  1I8F A;  2MIO A;  4RKU E;  2FL7 A;  2QA4 Q;  1YJ9 Q;  1Y96 A;  2D0N A;  3HFO A;  3N5B B;  1FXX A;  2E6N A;  1HYO A;  1M90 U;  2GGR A;  1F1B B;  5EG2 A;  3PT9 A;  3G71 Q;  2DAQ A;  1AT1 B;  2PTK A;  3V8J A;  2KQW A;  1MMD A;  3SDZ A;  1PSE A;  5KYW A;  2ROL A;  1VQK A;  2A36 A;  3P8D A;  1Q86 R;  1VYV A;  1W2B A;  3SEM A;  1YFN A;  4E7K A;  1GCP A;  4A63 B;  3G6E T;  2EQK A;  2B86 A;  1YI2 A;  2D8J A;  2DJQ A;  5KYY B;  2V8I A;  4M7D F;  5D6W A;  1W6X A;  1VQ7 T;  4QT7 A;  4RTU A;  2OI3 A;  5M9O A;  2EGA A;  3OA6 A;  5GAO r;  4RG8 A;  2H8H A;  1YNZ A;  4PJO A;  1UEC A;  2FEI A;  2WSF E;  3TQ7 P;  4FYY B;  1KQ1 A;  4EMK A;  3VS1 A;  1MND A;  2VC8 A;  4X1V A;  2EW3 A;  1RLQ C;  2MWO A;  3E9F A;  3RNJ A;  4BE1 A;  1W70 A;  1QP2 A;  1M5Q 1;  2AIR B;  4DQ2 A;  4O6J A;  5IXF A;  8ATC B;  4ZTF A;  2ESW A;  2KY9 A;  3QZ9 B;  1C0M A;  3I56 A;  3NFC A;  3PE0 A;  4C5E A;  2DYB A;  2Z0W A;  3OYA A;  2MI6 A;  2KNB B;  4OMM A;  3V7S A;  1QCN A; 
#chains in the Genus database with same CATH homology
 3OYC A;  5FLX E;  4ZGE B;  1KHI A;  1M1K U;  2XKO C;  1I81 A;  2AHJ B;  4II1 A;  3RIR A;  4XTW A;  3TEE A;  3INZ A;  4GLK A;  4C8Q A;  2OTL A;  3DB3 A;  2XU8 A;  2EAY A;  3CEY A;  1BIA A;  2F5T X;  2HQX A;  2E12 A;  2M0O A;  2I2L A;  3PMT A;  4PL6 A;  5FU6 C;  2L89 A;  3ER0 A;  3CPW S;  2D6F A;  5GAN h;  5CQY A;  3L2W A;  3SWN B;  3OS2 A;  4X9D A;  1Q7Y C;  1Y71 A;  2WSE E;  3P8H A;  4IUQ A;  3OW2 S;  3S6W A;  2RB6 A;  4C0D C;  2F5K A;  1VQ5 T;  4F7U B;  1VQ8 A;  3OSV A;  1YI2 T;  4QW2 A;  3OS5 A;  5C0M A;  3PIO A;  2DZC A;  3GNG A;  4M78 E;  3HHT B;  2HAX A;  3HL8 A;  4OB0 B;  4R56 A;  5J26 A;  3M4Y A;  1RL2 A;  3M4G A;  1WJQ A;  3E19 A;  3CC7 A;  3ZBD A;  1X01 A;  1K73 U;  3QYG B;  1Q81 C;  3OYJ A;  1UEB A;  2K4Y A;  3CCS T;  3CD6 A;  4DA4 A;  3CC4 T;  3CCQ A;  5L8R E;  5GAN e;  4L5G A;  3QZ5 B;  5I2S A;  3BDU A;  3S3O A;  2R5A A;  3QO3 A;  4M77 E;  2VYT A;  3A5Z B;  4QVC A;  3JB9 H;  2XIC A;  3OBY A;  3VUB A;  3A8L B;  3M54 A;  4EDU A;  3RMS A;  4BDY A;  3Q1J A;  2WSC E;  4M7A G;  3CCL A;  4IUP A;  1ZHI A;  2MAM A;  3VV0 A;  1SSF A;  2RO0 A;  3WVD B;  1U1T A;  4NOY A;  4Q5W A;  2M9U A;  4XU3 A;  3ASK A;  2P4T A;  2PUK B;  2GFA A;  4JRK A;  3X20 B;  3FJP A;  1G3S A;  3JCM f;  3OYN A;  4Z02 A;  3EAE A;  3CC2 T;  2LTO A;  2FVU A;  3C94 A;  2RD1 A;  1Q82 C;  2QA4 T;  3M59 A;  3FDR A;  1M1F A;  4QVZ A;  1JBM A;  4M75 C;  5GAN 2;  1VQP A;  1YJN T;  4C92 E;  3JCM P;  3G7Z A;  2LQ8 A;  1I4K 1;  4JLG A;  2LRQ A;  4E7I A;  3JRZ A;  4C0F A;  5A0D A;  4M77 G;  3VKI A;  4LDU A;  3MET A;  1B34 A;  3KUF A;  3WVE B;  4EMK C;  3CCE A;  4M78 F;  3TRE A;  1S72 A;  3LGF A;  3GPL A;  4ZGJ B;  5KCH A;  3JCM X;  5GAN g;  3CCR T;  3HSB A;  2KSS A;  4J7I A;  1Y07 A;  2M16 A;  2QXF A;  3NTI A;  1P92 A;  4M7A C;  1VQL A;  4OP0 A;  4KT0 E;  1N9S A;  3BDL A;  4JS5 A;  5CAI A;  3J80 E;  2DD5 A;  3S3N A;  1BI2 A;  1O9S A;  4HCZ A;  3V7C A;  4M77 F;  1NZ9 A;  3M9Q A;  3EFS A;  3M56 A;  2VGM A;  2LCL A;  5GAO n;  2DXC A;  2RHU A;  2E6Z A;  2E64 A;  3FEO A;  2E65 A;  3OBW A;  4C8Q G;  3MCA B;  2CZ7 B;  4XTV A;  1XNI A;  3I55 A;  5GAO m;  4XU1 A;  1BKB A;  3V8K A;  4BE0 A;  1W2B S;  1UGR B;  4E7J A;  4C92 G;  4C0G A;  4EMH A;  5CR2 A;  2LQK A;  4HKE A;  3OYB A;  4CI0 C;  3OQ5 A;  3CCU A;  1PSF A;  5DY9 A;  4JUV A;  2NLU A;  2EKO A;  1JB0 E;  4J5Y A;  4C5G A;  2DIQ A;  4XTZ A;  2XG8 D;  3A8M B;  4MDW A;  3JB9 I;  4JJN K;  1UB4 A;  1BI0 A;  2CZ6 B;  1G3Y A;  2Y90 A;  4M78 D;  2DKG A;  3HP9 A;  2XDD A;  1YIJ T;  1KQS A;  2K3X A;  4C92 F;  5GAN 6;  5GAM j;  2DO3 A;  2FB7 A;  3J7A F;  2XHC A;  1N27 A;  3PNW C;  1VQM T;  4L59 A;  4Y91 A;  3QPH A;  3CCM A;  4N0A A;  1VQO A;  3TU4 K;  4BY6 B;  1FX7 A;  3BW1 A;  3JCM V;  4XTX A;  3JB9 J;  4E47 A;  1YHQ T;  3JCM W;  1QVF S;  1Y7X A;  4OGC A;  2RHZ A;  4M77 D;  4OVA A;  4C8Q C;  2K57 A;  2LVM A;  4F7U A;  3RKX A;  3CCV A;  2JOY A;  1UGS B;  3QDR B;  3QXE B;  5I2M A;  4NS5 A;  3P8B B;  3CC7 T;  1M8V A;  3QJ6 A;  2O4X A;  3MEW A;  3VYG A;  2YHT A;  3CD6 T;  2JNG A;  4JRI A;  3G6E A;  4XU0 A;  3CME T;  2X4Y A;  4ZN3 A;  4A4G A;  3LH0 A;  5GAN f;  3RMQ A;  3CXC A;  1OZ3 A;  3QII A;  4WF2 A;  4XTU A;  4M7D A;  5CKE A;  2DXU A;  2EFI A;  4PNO A;  3MEA A;  3OYD A;  4KUD K;  1KG1 A;  5LJ5 j;  4M75 E;  4ZN1 A;  3G71 A;  1VQ7 A;  4PJO E;  2QQ9 A;  1KQS S;  2QQR A;  3GNF B;  2R57 A;  3OS1 A;  2DPP B;  4LDW A;  3M58 A;  1M1G A;  2M1H A;  4QQ6 A;  2KMT A;  4C92 D;  2QQB A;  3MEV A;  1EIF A;  4RCC A;  3X25 B;  1Q7Y U;  2LT4 A;  3QYH B;  4PLL A;  3CBP A;  4JDS A;  3ZEH A;  4BB7 A;  4ELY C;  1VQK T;  5GAO l;  3QUI A;  4M7A E;  4EPC A;  4J6Y A;  2BKD N;  5A0G A;  1BIB A;  3JCM d;  1WPY A;  2YRV A;  1JJ2 A;  4ATO A;  2L3R A;  5LJ3 j;  2JN0 A;  3M5A A;  3CMA T;  5GAM d;  3JB9 G;  5CQX A;  3LGL A;  2CGH A;  3OYE A;  1HK9 A;  2O4X B;  5DM7 R;  1WGS A;  3FLG A;  3E1S A;  3UDC A;  3UT1 A;  3DKM A;  1YCY A;  1VQ4 T;  1MGQ A;  3DB4 A;  1YJW A;  2FYK A;  5I21 A;  3JCM b;  1S72 T;  2HBP A;  3HFN A;  2EYQ A;  4MZM A;  2ZCF B;  3L42 A;  4M75 G;  5CKD A;  4PJO G;  4RMO A;  2K5I A;  4M78 B;  1KC8 C;  4YTL A;  2C06 A;  4E7L A;  1I5L A;  4M7D B;  2KVQ G;  2DK3 A;  4BAC A;  4F7U E;  1KD1 C;  3JB9 F;  4MZT A;  4X34 A;  3MO8 A;  3G4S T;  2OTJ T;  4A4E A;  1R8O B;  1WQW A;  2R5M A;  4C5H A;  5FRO A;  1LNX A;  3MP6 A;  5IAY A;  1LJO A;  3L1A A;  3VU3 C;  3PIP A;  5HKC A;  5GAN j;  1NPP A;  2QQS A;  4M77 B;  4M75 F;  4KUL A;  4PJO F;  2RHI A;  4R55 A;  4LDX A;  1K9M C;  4P5N A;  4LD6 A;  4ELZ C;  2H3J A;  2JTM A;  5LJ5 d;  1Q82 U;  4J6W A;  3MHX A;  4D6W A;  5FU7 B;  2RI2 A;  5CIU A;  1N8R C;  4KBM B;  3QKJ A;  3CCU T;  4C8Q E;  1K8A C;  5J3B A;  2P0P A;  2RI3 A;  4FU6 A;  4M7A F;  1GXI E;  2HQE A;  3AHU A;  1DJ7 B;  1H64 1;  5A0L A;  2RJD A;  3L2U A;  4PJO C;  4IKF A;  3UWN A;  4L6V 5;  4F7U G;  5IT9 E;  1M90 C;  4EMG A;  4XTY A;  2K5F A;  5LJ3 d;  3C4S A;  2GFU A;  3OYI A;  2PVG B;  3PTA A;  3JB9 D;  2MMP A;  2PUO B;  2E1H A;  2ZZD A;  3I56 T;  4BDZ A;  3QHS A;  2L8D A;  3WXM B;  1VQ6 T;  1U8R A;  4F7U F;  1OYX A;  2DJZ A;  4M75 D;  2P0Q A;  4PJO D;  3SD4 A;  3X28 B;  2B8A A;  1VQ9 T;  4NL2 A;  1VQ5 A;  2XDB A;  4BUG A;  2V8K A;  4A4F A;  4MDX A;  5GMK j;  4MMK A;  4OB3 B;  3FB9 A;  1VQN A;  4BD3 A;  1Y96 B;  3SWN C;  2D9T A;  2X4J A;  4HA8 A;  4C0Z A;  2WAC A;  4X9C A;  1YIT T;  5GAN d;  5FRN A;  3LWH A;  4RCB A;  1Q86 C;  4HT8 A;  1XQH A;  1BI1 A;  3BFM A;  2E41 A;  5FU6 B;  2RJC A;  4M7A D;  3JCM c;  4MZP A;  1MHN A;  5KH6 A;  3CCS A;  3SFM A;  1NJI C;  2OTL T;  4NL3 A;  2X4X A;  5GAM h;  3GOX A;  2JUF A;  2BIV A;  3URG A;  4C8Q F;  3O8V A;  4QVD A;  4C0D B;  5GMK m;  3CBM A;  1QVG A;  2EWN A;  1N9R A;  2RK2 A;  3MEU A;  4XAX B;  3A8H B;  1W4S A;  5HK3 A;  2LDM A;  4N4G A;  3DLM A;  3VYH B;  3OYM A;  4M7D C;  5GAN 3;  5IN1 A;  5GAO p;  2LX9 A;  2GF7 A;  3PGG A;  4DOW A;  3J81 E;  3HPW A;  1VQ8 T;  1KQ2 A;  3OYG A;  4GY5 A;  1WQ7 A;  3LLR A;  1XOV A;  4V2S A;  2BUD A;  4XQ3 A;  2Y4X A;  5LL6 S;  3QG1 A;  3M57 A;  2CYZ B;  3OMC A;  5HK0 A;  5A2Q E;  3CC2 A;  2RM4 A;  2LNV A;  3CPF A;  1UGP B;  4ZTJ A;  2RH2 A;  2A3L A;  2EIF A;  3X26 B;  5J39 A;  2QA4 A;  3JCM J;  1YJ9 A;  4A53 A;  3FIF A;  1WJR A;  2PVO B;  3CCQ T;  1YJN A;  5FU7 C;  5LJ5 h;  5KCO A;  3DLL A;  2ZPB B;  2MWP A;  3LW5 E;  2MF2 A;  1TH7 A;  3GIB A;  4M78 A;  5CVI A;  3C95 A;  4J8O A;  3H8Z A;  1V29 B;  2FHD A;  2X35 A;  2XDP A;  4TVR A;  2YLC A;  3PMI A;  2V8J A;  2DTI A;  2VV5 A;  4C8Q D;  4CRI A;  3CCR A;  2RJE A;  2X4W A;  3CPW A;  3CCL T;  1H3Z A;  3LX7 A;  1O75 A;  1X6O A;  4N4I A;  3VJP A;  4ZGD B;  5FRM A;  2VXE A;  2ZPF B;  4Y28 E;  2HD0 A;  5D6Y A;  1KHC A;  4M77 A;  3OW2 A;  3CCJ A;  4N4H A;  4HCB A;  3R6O A;  2XI9 A;  2ZPI B;  5LJ3 h;  2QDY B;  4OMF B;  3NTH A;  3TCJ A;  1ZQ1 A;  5LJ5 e;  3JCM Q;  3CBO A;  3FRN A;  4HT9 A;  4EMK B;  4C5I A;  4O5V A;  3T9N A;  2LCC A;  2P0K A;  2E70 A;  5CKH A;  1G5V A;  4FM4 B;  1VQP T;  1XTD A;  4A4H A;  2E10 A;  1U1S A;  2EQJ A;  5GMK i;  2F69 A;  3KXT A;  2RHY A;  2XK0 A;  3PFS A;  4M7A B;  5GAM g;  1Q81 U;  2PQW A;  4JRQ A;  1NE8 A;  2DVE A;  5GMK l;  3CCE T;  1IZ6 A;  1KC8 U;  5CK9 A;  2DXB A;  2JZ2 A;  5GAN 8;  2PU9 B;  4IUT A;  3CXC S;  3JSC A;  1KD1 U;  3GLX A;  1YBY A;  2KAF A;  1X75 C;  1M1K C;  5KE3 A;  4VUB A;  2XD0 A;  5CKF A;  5DLQ E;  3RKW A;  5LJ3 e;  1VIF A;  4OGE A;  1FWZ A;  4C92 A;  1VQL T;  4IUU A;  5KE2 A;  5DLO A;  4E7H A;  1YIJ A;  2CZ0 B;  2RHX A;  3GP8 A;  1D3B A;  4XU2 A;  4BI3 A;  3H6Z A;  1VQM A;  1K9M U;  2DZ9 A;  1VIE A;  4FIB A;  3L2V A;  1BYM A;  2DTO A;  2QEX A;  3SB2 A;  2E5Q A;  5C6S A;  4PKC C;  5GAO q;  2EJ9 A;  1YHQ A;  2GCX A;  2JVV A;  2VUB A;  3I55 T;  1N8R U;  1VQN T;  2VXF A;  4OF1 A;  4M7D E;  4JLI A;  1AHJ B;  1K8A U;  4QQD A;  5HY6 A;  3V7R A;  1JJ2 S;  1I8F A;  3M53 A;  5LJ5 g;  4RKU E;  1QVP A;  2FL7 A;  4A4K A;  1Y96 A;  2LT1 A;  4BY6 C;  3UPU A;  4J7F A;  2OAU A;  2YLB A;  3HFO A;  3M55 A;  3N5B B;  5AYF A;  3LYI A;  3FC3 A;  3CME A;  1FXX A;  2E6N A;  1K73 C;  1M90 U;  3A8O B;  4A54 A;  2LC4 A;  4BE2 A;  1M9S A;  2K5L A;  4C8Q B;  3OSS C;  5EG2 A;  3S3M A;  3PT9 A;  2DXT A;  2DAQ A;  2EJG A;  2XID A;  4FT4 A;  3CCM T;  3RKY A;  3KBG A;  2EJF A;  4C92 B;  5LJ3 g;  4BI8 B;  3HRS A;  1VQO T;  3V8J A;  3V8L A;  3HRT A;  2KQW A;  3SDZ A;  3E9G A;  2DTH A;  1PSE A;  1G3T A;  1D3B B;  1N6A A;  3ZFJ A;  3OS0 A;  1ZBX A;  1VQK A;  4M78 G;  3CCV T;  2EQM A;  4M7D G;  4FSX A;  3P8D A;  4QQG A;  3F70 A;  5GAM f;  3JAM E;  4LD9 K;  5GMK h;  3OYK A;  1YJ9 T;  1IRE B;  1W2B A;  2PVD B;  4XK8 E;  4E7K A;  3HKS A;  3G6E T;  3CMA A;  2EQK A;  2Y4Y A;  2KK4 A;  3L2Z A;  4J83 A;  1Q86 U;  2KDS A;  1YI2 A;  4N0A C;  2CKK A;  1NJI U;  3VUZ A;  2CS7 A;  3MP1 A;  2D0Q B;  1VQ4 A;  4UC4 A;  2V8I A;  2A7Y A;  4FT2 A;  2IVW A;  5D6W A;  4PLI A;  4M7D F;  4OB2 B;  3QSU A;  2O01 E;  4IUR A;  3G71 T;  3L2Q A;  1VQ7 T;  3OYL A;  3JCM h;  5CO7 A;  3C12 A;  3LWI A;  3CC4 A;  5M9O A;  2GQV A;  3A8G B;  1NPR A;  2ZPG B;  5GMK e;  3X24 B;  4HCC A;  1LOJ A;  1UGQ B;  4BI4 A;  1RI0 A;  4OB1 B;  3G4S A;  3CCJ T;  5GAN 4;  3OMG A;  3MP8 A;  3OA6 A;  5GAO r;  3BY7 A;  4RG8 A;  2OTJ A;  2QTX A;  3ME9 A;  4IUV A;  1QVF A;  2K3Y A;  1WNL A;  4M75 A;  1OZ2 A;  1BI3 A;  4LDV A;  4M78 C;  5LJ5 f;  5GAN 5;  4PJO A;  2EQU A;  2WSF E;  4FL6 A;  3OYH A;  3OYY A;  2DD4 A;  4B9W A;  1VUB A;  1KQ1 A;  2ZPH B;  4EMK A;  4ME7 A;  1JRI A;  4J6X A;  2VC8 A;  3JCM e;  3RUX A;  2MWO A;  3RER A;  1WJS A;  3E9F A;  5GAM e;  4M77 C;  5CKB A;  3QJY A;  1YJW T;  4BE1 A;  4M7A A;  1QP2 A;  2G3R A;  4RG2 A;  2DIG A;  1M5Q 1;  5D6X A;  1B34 B;  5LJ3 f;  4DQ2 A;  4B9X A;  4JRP A;  1QW1 A;  4M7D D;  2RI5 A;  1G3W A;  1OI1 A;  1M4Z A;  2R58 A;  2JTF A;  4O6J A;  2RJF A;  5GAN 7;  2RA2 A;  4JS4 A;  2VGN A;  2IG0 A;  3EFR A;  2HNI A;  2CZ1 B;  4KUI A;  4MML A;  2QEX T;  3SWN A;  1QP3 A;  4ZTF A;  1QVG S;  2QI2 A;  2K2V A;  2DEQ A;  4LDY A;  2KY9 A;  3OB9 A;  3QZ9 B;  1HXD A;  3I56 A;  5CCA A;  3QBY A;  3NFC A;  3OYF A;  1VQ6 A;  4M75 B;  4C5E A;  4PJO B;  2L5Q A;  4C92 C;  3GF5 A;  2ZGW A;  4DOV A;  3OYA A;  1VQ9 A;  3L2R A;  2MI6 A;  2QQA A;  3NTK A;  2ZPE B;  2RK1 A;  3OY9 A;  3HRU A;  3RES A;  3V7S A;  3JCM g;  1YIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...