4GLLA

Crystal structure of human udp-xylose synthase.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
307
structure length
307
Chain Sequence
RKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human UDP-alpha-d-xylose Synthase and Escherichia coli ArnA Conserve a Conformational Shunt That Controls Whether Xylose or 4-Keto-Xylose Is Produced.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords UDP-glucuronic acid decarboxylase 1
total genus 104
structure length 307
sequence length 307
chains with identical sequence B
ec nomenclature ec 4.1.1.35: UDP-glucuronate decarboxylase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gllA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 4gllA02
1BG6A 2F00A 3DBLA 3WBBA 4IIVA 3RFVA 5T8KA 3GMSA 5T67A 3F46A 4B4OA 4TRRA 3JYNA 1PJSA 4YRDA 4YT5A 2GLXA 2XOXA 3UGKA 2AHRA 2ZTLA 1MG0A 3RKRA 5KVVA 1MUUA 1E7MA 4RVUA 1GYRA 2X9NA 1N7GA 5KNLA 2Q1TA 2X0RA 3ZN2A 3QLJA 3JD1A 1B16A 1GQ2A 4XQ9A 5CP8A 2FPPA 4E12A 3DL2A 4K28A 3UUWA 1F14A 1HTBA 4CV1A 1A4UA 2RHCA 4EJMA 5JMPA 2HU2A 1IB6A 2F1KA 3WGOA 3K96A 3G0OA 1FDVA 5BNIA 1HSZA 3AWDA 2NV6A 4ILKA 4GX2A 1H6CA 2ZCUA 1YOVB 3NKLA 5CDSA 4MOWA 3LT1A 3ZNNA 1R0LA 1M76A 1SOWA 2BFAA 3VVCA 1MXHA 4CQLB 1PTJA 3S8MA 5DCYA 1F8GA 1MP0A 2PZMA 2ZK7A 4BMVA 4BNTA 3E5MA 2DBQA 4RVFA 1B15A 3LF2A 4OKIA 4J4BA 4FFRA 3GZNB 4XR4A 4S1VA 3CUKA 4GL4A 2ZCVA 1EK5A 4ZQFA 5A9SB 4GAEA 3AM4A 3QWHA 5MDHA 2FRDA 3HHPA 3JQ6A 4CR8A 1EEHA 2PNFA 3OICA 3S2GA 4GX0A 2OORA 4NBUA 2WM3A 3DZJA 4INAA 3ZWWA 4ZHSA 5JPIA 5A3JA 4PLPA 1DFHA 2X22A 1QG6A 8LDHA 3ETEA 4B8WA 3PFFA 1IPFA 1ZW1A 1G0NA 4FFMA 1EFLA 5JE8A 1C0IA 1T2CA 1U8XX 3PZRA 5A03A 3NDJA 1X1TA 5FEUA 1W4ZA 4RO0A 3RBXA 2HMVA 1B0AA 5MGBA 1ZCJA 2PH5A 4ND3A 1SAYA 5EJ2A 1C0LA 1P9LA 1W73A 5HS6A 1H2BA 3TOXA 3ZNQA 4BGEA 1BHSA 1Q7CA 2DKNA 3DAGA 1HDXA 1ID1A 1F17A 4YQZA 5K0ZA 1I5RA 1KEPA 2IZ0A 4JNKA 4BNUA 1DAPA 1FDUA 1ZSVA 2X5OA 3GDGA 3JV7A 2P5YA 4IDEA 3BXXA 5JO0A 2Q3EA 2Q2QA 4CL3A 5KOIA 3KEOA 2W2KB 5A02A 1LRKA 3L4BC 4ID9A 4W99A 4DWVA 2E4AA 2EW8A 5TS3A 3LT0A 4YAKA 3GGGA 3BMQB 1DC5A 2WYVA 4WEQA 4EZBA 1E1MA 2IYPA 4XYMA 2X86A 1ZH8A 3GAFA 1XKQA 4KMSA 1WNTA 5HWSA 2PFGA 3JQBC 4Q3AA 4MKXA 1GY8A 2JCXA 1ZK2A 1LRLA 4A7PA 1DOHA 4L8VA 4LGVA 4NZ9A 3OP4A 1G6KA 3I9KA 1B8PA 4RDIA 1Z74A 3JQFC 3SBOA 3WIEA 4AJEA 1SOVA 2NVWA 3JCZA 4BMSA 3V1YA 4FFOA 4B3HA 3VHRA 3RKUA 3F3SA 3MWEB 3LQFA 3WYEA 4AFNA 5JMWA 3SC4A 4B7UA 3ENKA 2B0JA 4IJKA 4PLYA 4DMLA 3BTVA 1DAOA 3PIIA 1UAGA 3JQAA 4QO7A 1Z7BA 3K6JA 3PYLA 5H83A 4YT8A 5JFOA 2UDPA 1T2AA 2AEMA 3H3JA 4OL9A 4OM8A 1TT5A 2FPIA 3CINA 3ANLA 2BGMA 2X5JO 4DPKA 1D3AA 1I8TA 2HCTA 3JQCA 3F5SA 4R54A 1PZGA 3BMNB 3DAFA 1HT0A 1GEEA 3ZCXA 5B4UA 3D3EA 4I5EA 3DBRB 1UXGA 3PP8A 2Y1FA 3NGLA 3ANNA 1SMKA 5IXSA 3M1AA 1ULUA 4E30A 4CUKA 2FR1A 1T2DA 4D3SA 4O63O 5GMOA 4CMEA 1N8KA 2CFCA 5FWNA 3HB4X 1Q7GA 1HSOA 3I4CA 1BDMA 4FGSA 5IDWA 1C1DA 1P1KA 3JQEA 1I2CA 3OFSA 4Q3NA 5G2OA 2O7QA 3ZHBA 3H2SA 1SCUA 2VT3A 1U7TA 2HQ1A 3VZSA 1OZAA 4KUHA 5KJ6A 4PLVA 4ZQHA 4Z3KA 3KYCB 4MVJH 4RL6A 4XRGA 3EHEA 2P5UA 3RWBA 3LYLA 2O3UA 2BKAA 4WE3A 3JQ8B 4WASA 3TL2A 1IZ0A 4M54A 4Y8VA 5A4DA 1TXGA 2YZ7A 3CTMA 2GYYA 4KQWA 3PQFA 2P68A 3JQDA 3SX2A 2Y99A 3QVWA 4ND2A 4Z9XA 1FDSA 3Q9UA 5DULA 4GX5A 4CMBA 2OGUA 1IZ9A 4IMRA 5JY6A 5TLSA 1GV0A 3WGIA 3H65A 3D5TA 5F1PA 3ITKA 4PFJA 4BGVA 4C4OA 4W6ZA 4D46A 1I01A 3OJFA 4RF3A 1E7SA 1JTVA 3PHIA 1P0FA 5IN4A 4BKQA 4J6FA 4RQUA 3FHLA 3MJSA 1NWCA 1EE2A 2GZ2A 2XPCA 4BKRA 2P9EA 3GRPA 3LSYA 3JYOA 4LSWA 1RWBA 1V3UA 4BGUA 4RF5A 1YONA 1UXIA 1EVIA 4YACA 1PGQA 4OXYA 4BNVA 1IE3A 3QA9A 2V6BA 2V6FA 1ZIDA 4A26A 2HMTA 4J91A 2BGLA 2HUNA 2W98A 4R16A 5KCZA 3DOOA 2ZTUA 4QX6A 2J3HA 2WMDA 3RVDA 5JW6A 3QV1A 3VZRA 4KP7A 5EPOA 3BHJA 1NAIA 3C24A 3OQBA 3WQSB 1VE9A 4EEXA 1EVYA 1LSSA 1OAAA 4MVJI 1HDYA 1UDAA 2Y05A 2PD3A 1PGOA 2CZCA 2AQ8A 5L4LA 3TZQA 1YE3A 2EWMA 2NSDA 3R3SA 1N9GB 1UXHA 3UF0A 3EZLA 4OOFA 3RFTA 3HB5X 4PLHA 3KO8A 2P2SA 3EYWA 4CM7A 4LISA 2OMEA 4GWGA 3A1NA 3GZNA 2WYWA 5ADHA 2VTEA 5KJCA 3BZUA 3AI2A 1PJLA 3I52A 1GUFA 2Y93A 3O4RA 2AE1A 3JQFA 4FW8A 1LSOA 1LSUA 3D3WB 3RU9A 4BO5A 3F9IA 3FTPA 2YFHA 3I5MA 1BVRA 1GUZA 1GFSA 3EY4A 1E3WA 1L7EA 4RPJA 3H9EO 1OFGA 5LCXA 4S3MA 1PL6A 1EK6A 2AXQA 3L0DA 4BVAA 4AJHA 3DB2A 5CFZA 2EKLA 3ABIA 4R68A 3TN7A 5JDIA 3IUPA 1H93A 2VYND 1HDOA 3GNTA 1XU7A 3U49A 1F06A 1ZBQA 2LDXA 2JFFA 3VDQA 3HADA 1ZJYA 1NPDA 3I3OA 1ENZA 1VL0A 1E3JA 2J3JA 1DIBA 1CJCA 4JLWA 2VYNA 1PS9A 1V3TA 1K6XA 2V65A 2VUSA 4XX0A 3U4CA 4R01A 4ALJA 2X9VA 4BNIA 5HRUA 4KTVE 3E9NA 1KOLA 1ISFA 2H9IA 2WE7A 1E7RA 2C29D 2O4CA 3EGOA 3UCFA 3ENNA 2DVMA 5JYEA 3MOIA 1UDCA 3PHHA 3D5QA 5IZCC 3ST7A 2WWRA 2HK9A 3BA1A 3IDSA 4HFJA 2JAPA 1RM3A 4JCOA 3DO5A 1T25A 3V5NA 2D3TA 1LEHA 3KOUA 4WEOA 3MJEA 4WPGA 4IMPA 1M67A 1OBFO 4L0QA 1B2LA 3C7DB 1LDMA 3RUEA 5JCJD 3IJRA 1KS9A 2HK7A 4CM4A 2YDYA 3QWFA 1R16A 1SO8A 4MJLA 3JQAB 5DCWA 1ISGA 1LLQA 1YS4A 4Q9NA 3K2BA 3COSA 1NVGA 1X0XA 3ZU4A 2X0IA 3JD2A 4HFNA 2JJYA 2JHGA 1DC6A 3H3FA 3AUTA 1O8CA 4R5MA 5IAAA 3CZRA 3KHUA 3RSHA 1LDYA 2ILTA 5CEEA 3ROQA 1DFGA 1K6IA 3KVOA 3DBHA 3QJ5A 3RC1A 4EBFA 2GNAA 3ZDFA 2WSBA 2PGDA 2FZWA 2J3IA 3ZV5A 4L4SA 3PQDA 3C1AA 2HKIA 3PYMA 2FY8A 3KETA 4NR0A 1HRDA 3TDKA 3W4JA 3SJ7A 5KWEA 3AY7A 3BTUA 2YYYA 4GVXA 2PD6A 1EBUA 1VJ0A 2YHIB 1BTOA 5B37A 3DC2A 3ULKA 4F45A 3PGJA 5EQFA 1W8DA 5C3MA 4BKPA 2Q2WA 2X8LA 3PTZA 4XGKA 2X4GA 4B3IA 1EVJA 2AQIA 1ENOA 3TPCA 4R9RA 3DZBA 2UUPA 3CMCO 4QO8A 3RUHA 3S2FA 1Y6JA 4HKTA 1ZUD1 3UAGA 5DT9A 1Z6ZA 3OSUA 3WR5A 2Y0EA 5AVOA 3MTGA 3VKUA 3FRJA 3IQDB 1BXGA 1JAYA 2B4TO 1HF3A 2GN6A 4LK3A 1JA9A 3NT4A 1T2EA 4NBRA 4CUZA 1SC6A 4AJKA 2DQ4A 4CUJA 4YT2A 3E9MA 1KBZA 4FOSA 2ZTVA 1SB9A 3T4EA 2NACA 1PZHA 1A7KA 1JDJA 5I8WA 1EE9A 2CSUA 3AI1A 3DDNA 8ADHA 4M55A 1DXYA 4DVJA 3ICCA 1AUPA 3IUSA 4D0SA 2X58A 2C2YA 5TRTA 1I24A 4OAQA 2J5QA 4IXTA 4DIBA 1IL0A 5EIOA 3IS3A 3PK0A 1DSSG 3UHAA 1AN9A 5TT1A 4PG8A 4DC1A 1GTMA 2H5LA 4JBHA 4UVEA 3V2UA 1E6UA 1ZK1A 4B3JA 4DLBA 1KIFA 4RLSA 3ZWPA 2AQHA 4H16A 4PZDA 2Y0CA 4I5GA 3JQGB 3HG7A 2J6IA 3ZWNA 4ALKA 1DIAA 1KY5A 3IKVA 1Y9EA 5C7LO 1C14A 4YJHB 3I4FA 4Y67A 3JTMA 1R12A 1ONNA 2EHDA 1NP3A 2B5VA 3NT2A 3ITDA 5T57A 4DIOA 1MV8A 4MVJF 1Q1NA 3PHLA 4OQZA 1N1EA 4NI5A 1Z73A 3GG9A 3QVOA 1N92A 3G17A 4LN1A 5JC1A 1LSJA 1M6WA 3FR7A 1WMAA 1P1FA 4G65A 4U6SA 1R66A 3F5QA 5DDIP 1I30A 4O59O 3G1TA 4PVDA 4FJ1A 2E82A 3VPFA 1UXKA 3KYBA 3WGQA 2WE8A 5JCJA 2ZJ0A 1FJHA 1SZJG 4NK4A 1GPJA 3VDRA 3INGA 2PK3A 3D1LA 4JQCA 4MKRA 4RV9A 4G5HA 4WLUA 4FJ0A 3OIFA 4U7WA 4W9NC 1DFIA 4P8RA 1U3WA 4QXMA 1AXEA 2AA3A 3DAPA 4LMRA 2VHVA 3VTFA 4CLEA 1U4SA 1NWHA 5EL0A 5EN4A 4XCVA 1YBMA 3GDOA 4IUYA 4BL5A 2E48A 4BNHA 3SJUA 1R6DA 3ZI0A 1GAEO 1E92A 1UUFA 2HDHA 1QLHA 4YWJA 2VRBA 1TEHA 3IAHA 4A5OA 3BTSA 3KSUA 5COQA 3DBRA 3W6UA 3D7LA 4U5QA 5DBIA 4MP3A 4XR9A 1VC2A 4WECA 4CV0A 3OQ6A 4PCVA 3A9WA 2XXBA 1Y5MA 3ORFA 2XAAA 1R4MA 1BVUA 3WBFA 1TB4A 2NQTA 2P9CA 3P19A 5BNTA 3NRCA 5T8KC 2ZB8A 5DBFA 1IYZA 1YBVA 2A4KA 2IZ1A 5EERA 2BH9A 3PXXA 1HLPA 3OHSX 4PLZA 3GPDG 1PJ4A 3JQ9C 3AJRA 2RHRA 1JVSA 4JK3A 4CLOA 1X14A 4Z9FA 1DO8A 2CVOA 3L77A 1PJCA 3OJLA 1Y8RB 4FFNA 3P2YA 4WK6A 2CUKA 2D1YA 4CMGA 2TMGA 2CNBA 5AXAA 5IDYA 3QVXA 4HV4A 5IZCA 4TZTA 4XIYA 3W6ZA 1LU9A 1SEVA 4LW8A 1P45A 2O23A 4ESOA 4FD3A 4YAIA 4CM5A 1MG5A 4J2HA 5CEJA 2X1HA 4KWHA 1PL7A 4CR7A 2I3AA 3T7EA 4LRSB 3F47A 3WSWA 4MP8A 3FD8A 1JKIA 1B3BA 1ADGA 4ITUA 4Q3DA 5ER9A 4KUGA 2IXAA 1DLIA 3DZFA 1DIRA 1CEQA 2PH3A 2O2SA 3DMTC 3TF5A 2YJZA 3DZHA 4PN3A 5BSHA 3B20A 5DN9A 4XB1A 4YB8A 2R00C 4EEZA 1OOEA 3JYLA 4BO1A 1LDGA 3M1LA 2DUWA 2ZTMA 5GY7A 3D3WA 1A4IA 5DNAA 4KQXA 2GR9A 4Q3CA 4NG5A 1U28A 2FZEA 1J4AA 3F4BA 1R37A 2IODA 1TA4A 3ADPA 1K89A 4PLGA 1GV1A 3ZHXA 1GZ6A 5I9NA 3AM5A 2JD0A 7ADHA 3KYDB 4UEKA 4B7CA 1MFZA 2ZQZA 4CMAA 4IJVA 4FOOA 4ZU3A 5FF9A 1J49A 4O5OA 1EUZA 1R4NA 4XYGA 3OETA 2W8ZA 9LDBA 3W1VA 1NX6A 5CHEA 4NFYA 1WW8A 3RUAA 4A10A 1MC4A 2DFDA 2ZJ1A 1BXGB 4IJWA 5H81A 4Z0TA 4BGIA 4BO7A 3O03A 4YJHA 4BKUA 1DLJA 2H1SA 1MXFA 3ANMA 4WNCA 2NVUB 1QORA 4XGIA 2HMWA 3FCOA 4BO0A 4ZJUA 3MCVA 4XB2A 3PJFA 1P77A 4AJ4A 2BHLA 4GLOA 5KJEA 1C0KA 1K0UA 2X23A 4HUJA 3PZBA 2BFOA 4J2OA 4ALMA 3MJ4A 5B1YA 1O5IA 3IMFA 2PTGA 1XQ6A 2D5CA 3DOJA 3MJVA 3RQSA 2DBZA 3EMKA 4LVUA 3KLMX 1NFQA 4IGEA 3W4IA 2B4RO 2EP5A 2NNLD 2Z1NA 3JD0A 5F3RA 3GVXA 2EERA 2H6EA 5L7YA 2FP4A 1YDWA 1HE4A 4W7HA 2HSDA 4Y98A 4MDHA 3JQBA 2WTBA 1PJ2A 1EUDA 3Q2KA 3GR6A 1NM5A 3GN2A 1PWZA 4EJ6A 3NTOA 4UVGA 3Q2IA 2VZ9A 4PRLA 3B1KA 5L9AA 1C3VA 1LXCA 2OXIA 2VNSA 4YQYA 2PY6A 5TC4A 3CSDA 3C1OA 4HP8A 3GVCA 1MGOA 1W0CA 1LC3A 3GF4A 1E3IA 2VYVA 1IOLA 2UUOA 5LC1A 1F0YA 1ENYA 1QYVA 3H4VA 2O48X 1NVMB 2Q4BA 3GNQA 4CL8A 2NLOA 3HUDA 1LQUA 3RC9A 4TMFA 1KVSA 2EGGA 1XLTA 3MOGA 3EC7A 3A06A 3ZV3A 2PLAA 4DPMA 3F1LA 3EZYA 4I9UA 3UXYA 4HY3A 1LDBA 3RIHA 1DPGA 1GZ4A 1GADO 3DR3A 1XCBA 3KUXA 1EQ2A 4WLOA 4E5MA 1B8UA 3E18A 3JSAA 3UCXA 1N2SA 4NH4A 1T4DA 4XQGA 4IQ0A 1IULA 1T2FA 3ZHYA 4ZA2A 1FDWA 2O3SA 2Y68A 1E0DA 3JYPA 5A1TA 4R51A 4WNIA 4WCFB 4FJ2A 1P1JA 6LDHA 2CD9A 3CKYA 3TL3A 3UKOA 4BO2A 5H82A 2BLLA 4DIFA 1YRLA 4M1QA 4DC0A 3E9QA 4BNYA 3E6AA 5I7VA 1EZ4A 1I3MA 2VRCA 2XXJA 2VWQA 3JD3A 4R1TA 1NR1A 4IQ8A 4KZPA 1VM6A 5A04A 5ITWA 2VZ0A 1LLDA 1HE5A 3I23A 2ZATA 3GPIA 3NDRA 2C82A 1DHRA 1YL6A 3AU8A 1KVUA 3KRTA 1B7GO 1HDZA 3BMCB 4K1LA 4QQRA 2VHYA 5JDIC 4NIMA 4RZIA 1ADBA 3RBZA 5BT9A 5I9MA 2POQX 4NBVA 5JNLA 4PLWA 4J9UE 3LC1O 4J43A 4FCCA 3BMNA 3NJ8A 4FFPA 1SNYA 1PZEA 4XDZA 4JIGA 2EP7A 4E2ZA 1U5AA 2PV7A 3VOSA 2IDZA 2V7PA 2A9FA 3L07A 4J0FA 1I3NA 1VSUA 1NAHA 1ZSNA 1UZLA 2B36A 4JX8A 1Y8RA 3RAJA 1H9AA 2JFGA 4KDEA 5G0SA 4PVCA 3PWZA 1RYEA 4TZKA 3TRIA 3QY9A 3GGOA 3DZKA 1I3KA 3UCEA 4CM9D 5IFLA 1C1XB 1XG5A 1K6JA 4CMJA 3OJOA 1S6YA 1SEPA 1DIHA 5GZ3A 3GRKA 4PG5A 3LZ6A 1O0SA 3L6OO 4JN6B 5I8ZA 3DHNA 4W82A 2OZPA 2JL1A 4P22A 3S1LA 2DAPA 5AQ1A 5LDHA 4JXKA 1KETA 1Z45A 3WNVA 4GPD1 5FFFA 2QRKA 5A06A 5TIIA 2G5CA 4IDBA 3I6IA 1H6DA 1YH3A 2VUTA 1DJNA 4TRJA 2ZB4A 1ADCA 3PGXA 4J4HA 4EUHA 3UFXA 4J49A 2VYVD 1H94A 2EIHA 4BMNA 5G0WA 3AUAA 4E5KA 5JAIA 5JDCA 2OHXA 3O26A 4IZHA 4XGNA 3E03A 3HN2A 3RROA 3HDQA 4RPLA 4WLFA 1HXHA 4YYZA 2A35A 4I08A 4ONEA 1KEUA 1T24A 4FB5A 5DP2A 1O89A 2Y0DA 2BGKA 3GEGA 4ROSA 4B8ZA 5THQA 1M2WA 4DQUA 4B79A 4D45A 1GQYA 2XF8A 3QWAA 3WGZA 4CLOB 1GPDG 1ORRA 1XA0A 2NU8A 4FC6A 4J1NA 3TZCA 3KZVA 4RQTA 3HJAA 1E6EA 5G0TA 1R0KA 3ZNOA 3QWIA 3WLEA 1MA0A 4DREA 3WOHA 4CM4B 3LLVA 2QQ5A 2FR8A 2GGSA 4E2WA 1A72A 1JWAB 4XQCA 3WMWA 2AEJA 3AFMA 5C37A 5DF1A 5JC8A 3DTYA 3GHHA 2Q1WA 3GVIA 1D1SA 3C85A 1JAXA 1UZMA 3AFNA 3HN7A 1T1SA 5BNFA 3DMYA 1DIGA 2PR2A 4XJSA 3VH1A 4IDFA 1QKIA 1YJ8A 4GMFA 1GDHA 4QFCA 3NTRA 3VVBA 3WTBA 1A27A 1B8VA 3QIVA 1HETA 2CF6A 3EVTA 4QFDA 2O4UX 4RZHA 1HDGO 4IGFA 4M8SA 2JD1A 4ZGWA 4E33A 4GSLA 3GNSA 3HWRA 4CODB 1BSVA 3GEMA 4YPOA 1N7HA 1PS0A 4PRKA 2R6JA 2AEFA 2OFPA 3B70A 3H9UA 3NJ4A 3PJEA 2IE0A 4Y6PA 1YJQA 4NPCA 3RUIA 1M6HA 4EGFA 5HBRA 1U5CA 3EW7A 3JQ8A 3O8QB 5TJ9A 3PWSA 4YA6A 4F46A 1UZNA 4Q39A 2VQ3A 4PLTA 2Y1DA 5ICSA 1B26A 5I9LA 2O2YA 5CG2A 4ZN6A 4NQZA 3GT0A 4AJOA 2PD4A 4BNGA 2C0CA 1MC5A 3PI7A 4HADA 1BDBA 1PJ3A 4RPKA 4RVHA 1RPNA 4M89A 4AJJA 3WXBA 1O94A 2JD2A 4DQXA 5BSGA 5CDUA 5KKCA 3X2EA 5IN5A 1ZVMA 2DPHA 4JP3A 4A0SA 3LK7A 4HNGA 2HRBA 4K26A 4XIJA 3GEDA 4WLEA 3U3XA 1YQDA 4WUVA 2DTDA 1KVTA 3FR8A 1OI7A 2VWHA 4BO8A 3TZKA 4ZVVA 3ADOA 2GASA 3MEQA 3OEWA 3ZWXA 9LDTA 1EVZA 1HLDA 5JAZA 2O3QA 1H6AA 4AG3A 3U09A 2UYYA 3KLPX 1ZZEA 4R3NA 4FIZA 1HL3A 3H9JA 4K9DA 3VPHA 5CAEA 2VCYA 1LDEA 3H5AA 1TT5B 2Q46A 2I6TA 4IQGA 1MB4A 3H9QA 3GG2A 3WGTA 4BNKA 4H3VA 1LNQA 3DZIA 4YT4A 3WWYA 1ISHA 1AHIA 4BV9A 2OBYA 2BF7A 2O7SA 1SBYA 2NU9A 4AVYA 1MLDA 3AY6A 4PZCA 5ILOA 4BQPA 3QSGA 1J6UA 2Y66A 4IS2A 1KC1A 3OM9A 5JYDA 4BB6A 3PWKA 1T1RA 2D59A 4D41A 1GYPA 2EG9A 2X0NA 3BHIA 2NTVA 4CM3A 2G76A 2O50A 2ZIZA 2V6MA 3AK4A 5DOZA 4R1UA 4AJ1A 2CF5A 1A7AA 2C20A 2BELA 5KJFA 3QVTA 1Y9AA 3FF4A 4MVJP 1O9BA 3GHYA 4UULA 2DTEA 1NPYA 2QHXA 2VNAA 4L74A 4GGPA 4NHEA 2EF1A 1ZMOA 2DT5A 4TKMA 1RM4A 3BMQA 1LLCA 3HDYA 4MO2A 3OF2A 2RAFA 4CQMB 5TJHA 4HFRA 3I9NA 2CY0A 3MWDB 4GKBA 4XRRA 4UEJA 3FWZA 3VPXA 5L53A 5JBIA 2BFMA 1VKOA 3W4KA 3RCBA 1WZIA 1D8AA 1E5QA 1WDLA 3KYCA 3NYWA 5A9SA 5G0VA 4QECA 2YHUA 4UVIA 3OA2A 5DBGA 3T7CA 1UR5A 1ONPA 1SPXA 1GEGA 4D3FA 2B69A 4HFMA 4DXHA 4IZIA 4WOJA 4CJXA 2GDZA 3SVTA 1TVEA 3ZWOA 1NFRA 3BMOB 4DYDA 1OMOA 3FNGA 2HMUA 4NDNE 1AE1A 3VZPA 2BMAA 1BMDA 4EI2A 2GN9A 5ENVA 4CLHA 4R9SA 3I1JA 2X0JA 4P4NA 2VZ8A 5A9TA 1DEHA 1HE2A 1QP8A 4CM1A 2CDAA 3PJDA 1FDTA 4D0RA 1QSGA 5KTKA 2NVBA 3LVFO 4CMEC 1LX6A 1JKFA 4YAGA 4J7XA 4R1SA 1EDZA 4XDYA 5K9ZA 3DBLB 2AQKA 1T26A 1NHWA 2G0TA 5EMHA 3BAZA 4DLAA 5KJ1A 1X7GA 4YAEA 3OBBA 4AJLA 4DTIA 4E31A 4O6VA 3WICA 1DJQA 3ETGA 2FMUA 3W8FA 1C1XA 4ZQGA 2NTJA 3WJ7A 4RCVA 2DM6A 4WCFC 1TI7A 1JN0A 1LI4A 1E3LA 3C8MA 1PU2A 3JQ7B 2NU6A 1GQQA 1X7DA 5K6AA 1P33A 1HYGA 2G1UA 3K9QO 4XJTA 3H5RA 2NUAA 4KWIA 3EK2A 2W4QA 3HQ4O 1YL5A 3TZHA 2NQ8A 4Q3EA 1P44A 1WPQA 2EXXA 1CRWG 1YOVA 5BQFA 1NNUA 4MP6A 1KYQA 3R0IA 1ISIA 4ZRNA 3TOZA 2GRAA 2HJRA 4CM8B 4EDFA 3U62A 1KVRA 2GPTA 1ULSA 5IJZA 1RJWA 2FN7A 4E5NA 4NFSA 1VJ1A 1QV7A 2Q4EA 3FBTA 4NBTA 4AJPA 2E37A 3H2ZA 4C7KA 3ZGYA 1L1FA 5JS6A 3HZZA 5CPFA 5IZ4A 1E1LA 3RBVA 4N7RA 2Q1UA 4OO3A 3WG9A 4F6LA 1YQGA 4U6QA 2W2LD 2GN4A 5AXBA 1WWKA 1QYXA 4DUPA 1PJQA 1QMGA 1RM0A 1ZK0A 3WX0A 1PJBA 1MFPA 2AMFA 3C3XA 1PR9A 3TSCA 3DFUA 4U8GA 2E6UX 1DC3A 1Q2XA 4ND4A 2BD0A 3NX4A 3DMTA 3VZQA 3CMMA 4K6CA 5IDXA 5KIAA 3HE3A 5JCXA 3QE3A 5AYVA 5C5IA 1B14A 4FS3A 4ZQEA 1H2HA 2G17A 3FWNA 3ZH2A 3PDUA 5L7WA 4I8XA 4JBGA 2HLPA 2PGLA 4D43A 2O3TA 3U5TA 3NGXA 1M66A 5I7SA 2FWMX 2CMDA 1XU9A 3K31A 4CQMD 3UH1A 3PHJA 3L9WA 5I7FA 3WYCA 1I33A 5HA5A 1NXQA 4N5LA 1PSDA 2ZYDA 1DC4A 2FOIA 3DTTA 4XQEA 3L6EA 3O38A 5I7EA 4NU5A 4E5YA 2GD1O 3ON5A 1H5QA 4OGWA 4RDHA 4FPXA 4Y6RA 2RBEA 1WXDA 1A5ZA 4TROA 5C7OO 4CR6A 5F21A 1N1GA 4D44A 1LJ8A 1PX0A 1RKXA 1V35A 1X0VA 4BKOA 2Q50A 1GCUA 1XDWA 4MVJM 4RLHA 4HWKA 2CVZA 2DBVO 3A28A 1FXSA 1VRWA 2QX7A 3AI3A 3RC7A 3WGGA 1VSVA 1A9ZA 1GU7A 1R15A 2YY7A 3PIDA 4YR9A 1HEUA 1IY8A 1L7DA 2BFPA 1KERA 2GZ1A 2Q99A 3BMCA 1SB8A 4W4TA 1PL8A 2IXBA 4BS9A 2NM0A 1GZ3A 3K5PA 2Y1CA 3INRA 4UUOA 4HXYA 2YHIA 1J5PA 3TFQA 3K2EA 4DL9A 4QUKA 4LMPA 3G3EA 4RJTA 1NR7A 3UVEA 1GCOA 2Y1OA 2CVQA 2VHZA 4CM8A 4N5NA 1JLLA 2YV1A 3GUYA 4BUCA 4CLXA 3AOGA 1P31A 3V8BA 1NYTA 4FQ8A 1GUYA 4U0JA 4RF4A 3D4NA 5EINA 2RCYA 1UH5A 1P1IA 2D2IA 3OEYA 1YB4A 2YQ4A 3UN1A 4BNMA 2CDCA 4MINA 4L73A 3EAGA 4IBOA 4MPDA 2Q2VA 4WCFA 5GZ6A 3WWZA 3ZV6A 4CM6A 2C5EA 2YV3A 4JJIA 2HJSA 3OIDA 2EJVA 4BNNA 5COAA 1ZKMA 1Q0LA 2JKVA 3OJ0A 5DZSA 1WZEA 1ZSYA 4A03A 2WJPA 1EMDA 5EESA 2AG5A 1BGVA 3G79A 4OHUA 2LDBA 4QT0A 3GQVA 3RUFA 5F1OA 3WFIA 2QYSA 1LC0A 3NAQA 1JW9B 5JAMA 5L7TA 3OMLA 3GA0A 1EQUA 2B5WA 1GR0A 4CLDA 3RJ9A 4G81A 2P9GA 1VL8A 4GH5A 3ZNPA 1HYEA 2D5AA 3HNPA 3DWFA 1DRWA 2PZKA 3ZZNA 3L4SO 1XIVA 4AJIA 3V1UA 4IIUA 1YGYA 1MX3A 4M49A 1PWXA 3CZMA 1TLTA 3ZWMA 2Q1SA 5FI3A 4LCEA 1ZEMA 3WGHA 5J23A 4GX1A 4B4VA 1C0PA 3F6YA 4RVDA 3E8XA 1V8BA 3QW2A 4OXNA 3WQQA 2J5RA 4IXWA 3I9MA 3LC7O 3W8DA 5L4NA 2B37A 2GSDA 3ZW9A 1Z82A 1NBOA 1LTHR 2H63A 3WQRA 3ASUA 3HDJA 2EKQA 3U4IA 1K3TA 1XGKA 1LDNA 4PLFA 4U0KA 3CH6A 2Y1GA 5L3ZA 1DBVO 1R0SA 4R5HA 4TQGA 3TZ6A 4CV2A 2YV2A 4J1QA 1E77A 1DRVA 3MTJA 3QRWA 5T64A 1BW9B 1Q0HA 2FSSA 2ZB7A 3QVSA 2G82A 2EV9A 1Y1PA 2W90A 3ONEA 4DPLA 1EBFA 3WLFA 4LVCA 5L51A 2X9GA 1VI2A 2WD8A 5FYDA 4CMHA 3AOEC 4D3DA 4UUPA 4Y6SA 3NTQA 4I1IA 2C5AA 4J1TA 1R4NB 4HX5A 4II2A 3D4PA 4WLVA 2P4HX 3E82A 1U3VA 1R4MB 3IKTA 2BRUA 2EW2A 1WDKA 3SXPA 3ZWVA 3C1TA 2B4QA 3U4DA 4BO3A 1DHTA 2QRJA 4PZEA 3H9GA 2VOJA 2DLDA 4BNWA 2RH8A 4R69A 2ZB3A 1ZEJA 3Q9NA 3V2GA 1ISJA 4ALLA 5G4KA 1Q7BA 5HS4A 1N9GA 3BMOA 4R41A 4Z3DA 4AL4A 2OL4A 4JJFA 3PQEA 1CYDA 4GKVA 4P4GA 4GVLA 3SEFA 3GUCA 1NHGA 4OSPA 4E2XA 4ZICA 1HYHA 4GQAA 3OJEA 4XYLA 4J9VA 4QEDA 4H7PA 2UAGA 4KTTE 1OC2A 4E13A 1NQAO 1KC3A 1U3UA 1ZXBA 3OQ1A 4BQRA 1VPDA 1BWSA 1D1TA 1I2ZA 4G2NA 1CETA 3ZHZA 4YVFA 3FSRA 4RVSA 1E6WA 1AXGA 4CV3A 3PHGA 4Z6KA 1JWBB 4RORA 5JLAA 1U9JA 1WLYA 3ZU3A 5G4KB 4BNXA 4TRNA 3STHA 2QW8A 4UVDA 3I9LA 4CLRA 4JROA 4ND1A 4RPHA 3NDIA 1IUKA 3QP9A 3VPSA 3WGYA 2YFQA 2CDBA 1XSEA 2Q45A 4OH1A 3RUCA 1RM5A 4KDFA 4UAGA 2EGHA 4BOYA 2FPGA 4WOKA 3KSDO 5CEFA 2BI7A 5FI5A 3GY0A 1PZFA 1YL7A 3KSZO 5G4LA 4E5PA 3M6IA 4KUEA 4P4LA 1N5DA 2Z1MA 3R1IA 1KEWA 3FNHA 4J90A 3VTZA 3NEPX 2HMSA 4IS3A 4J7CA 1ZJZA 1U1IA 4X54A 3FTNA 1QV6A 3GC6A 3KEQA 1LQTA 4J4TA 3E5RA 1NASA 4CMIA 1JVBA 3CE6A 5BSFA 1FF9A 4FFLA 3UICA 5CPBA 1NTOA 4B7XA 1YKFA 3NT5A 3IJPA 3FN4A 5L40A 3ZWYA 5A3VA 2Z95A 3OH8A 2QRLA 2P4QA 1WVGA 4YXFA 4GGOA 3MJCA 1V3VA 1KEVA 4XZ3A 4TSKA 4UUNA 5TF4A 4I9HA 5THKA 2DPGA 2Y67A 4NJMB 4OXKA 3G49A 5DP1A 4A2CA 3KB6A 2IRWA 3I9JA 3WTCA 2ZYGA 3ZV4A 1XWFA 4RF2A 4DQVA 3M2PA 3FBGA 2HK8A 3HSKA 3MJTA 3K8ZA 1BXZA 1CF2O 4MVJA 4F6CA 3DHYA 2R2GA 5U1PA 4IINA 5GZ1A 4YCAA 1QYCA 1YDEA 4BO4A 5A9RA 4I5FA 3VH4A 4N54A 1LLUA 4MKZA 4CMIB 4N18A 1G1AA 1YO6A 1ISMA 2PKRA 5ES3A 3DHEA 5LDGA 1LRJA 2DBRA 1E7QA 1V9LA 3ETDA 2QZ9A 3GVPA 4PG7A 4URFA 3TJRA 4WCDA 3WMXA 1GL3A 1QYDA 2OP0A 3ROKA 4XWYA 3VKVA 2EEZA 4HBGA 1ML3A 1CWUA 3L6DA 2VHXA 4CQLA 5HTOA 2UV8A 1DRUA 1ZK3A 1U8FO 5JO9A 3VH3A 5F5NA 4MIOA 1QR6A 4BB5A 4O1MA 1QLJA 3P7MA 3MZ0A 1Q0QA 3G1UA 1IPEA 3SLKA 3WB9A 1WDMA 3P5SA 2OBNA 4L76A 4DRYA 1HKUA 1UP7A 4F3YA 2FR0A 3ONDA 3E48A 4AJNA 1NPTO 4XYEA 4W9NA 4BIIA 4BV8A 4CLRB 1VL6A 3NV9A 1QYWA 2JCVA 2PKQO 4MIEA 4WJZA 3TQHA 5F5LA 1PQWA 3AUSA 1BRMA 1I10A 3OA0A 4A73A 1RYDA 4W7IA 4CQMA 3RI3A 3WNQA 3LF1A 3R3JA 2OUIA 2X7HA 3INTA 4DMMA 1U2GA 2UVDA 1P1RA 4R3WA 1UP4A 5DCUA 2VN8A 3I9OA 3RASA 3D64A 1EDOA 3GFBA 5ITVA 3IC5A 3BHMA 3PJGA 3A14A 3U4HA 1NQTA 1J0XO 1ZMTA 4Q3BA 5U4QA 1FMCA 1WAMA 3D4OA 4DGSA 1JKJA 1I3LA 3H7AA 3KV3O 5JY1A 2QG4A 3B1JA 1AGNA 4N5MA 5AXDA 4ZD6A 1B3RA 1LUAA 3HFGA 3IOYA 2NVUA 3VPGA 1PQUA 2WD7B 4L75A 2J8ZA 4IDGA 5L4SA 3R6DA 2C54A 2OP1A 4E32A 1LA2A 1CQIA 1DDOA 1E3SA 3WYBA 2HRZA 3SC6A 4TVOA 1HZZA 1XELA 3GDFA 3S2EA 2W2LA 3C7CB 4IY1A 2RIRA 3M2TA 1P1HA 4J1SA 1D4FA 5BR7A 2JCYA 5CDGA 4Z0HO 3EDMA 5G0UA 3VC7A 1Y8QB 1CDOA 4RVGA 3N74A 1U7HA 3H6KA 3ONFA 4TWRA 1G0OA 4XYBA 2VHWA 4PIVA 2J3KA 5KVSA 2IEDA 3X2FA 3PDJA 2I65A 4NFHA 1HDRA 4FBGA 3FPLA 2WYUA 2VWGA 1D7OA 1PIWA 2I99A 3K30A 4FR5A 4MVJG 4OIMA 4I5DA 4XD2A 5HM8A 1M75A 3ZU2A 3W8EA 3JQ7A 1Z75A 3BYZA 1U4OA 1X1EA 1YWGO 2BI8A 2WD7A 3RUDA 5A5EA 4EYEA 3KTDA 5BSEA 1NVTA 1OC4A 2PA3A 3BIOA 3UW3A 3TFOA 3K92A 1UP6A 1S7CA 3ZU5A 4GBJA 1E7YA 1F12A 1ZFNA 3Q1LA 4MVJE 2VTDA 3Q0EA 2I66A 5ENDA 4RGBA 3RC2A 4E4YA 2EKPA 2GZ3A 2O3RA 3Q3CA 4J16A 3K73O 3DFZA 4HNHA 1H9BA 4IDCA 2C2XA 4GWKA 1GYQA 1O95A 1I32A 1EUCA 3ZWAA 4M86A 2P91A 1TT7A 1HE3A 1Y8QA 4K6FA 2B35A 1GD1O 3PPIA 1HZJA 4JBIA 4E0BA 1VJTA 2PGJA 1Y5RA 2IZZA 1NFFA 1VKNA 3GVHA 3O8QA 4MIYA 3IL2A 5EQDA 3I83A 4YDRA 3WFJA 2VOEA 2C7VA 4NJMA 4NU6A 4Z9YA 3PRJA 4ZRMA 2E49A 5AXCA 4BNZA 3CIFA 3UOGA 4CMKA 3RD5A 3GZ4A 1ZNQO 4H15A 5KVQA 2QIOA 2VT2A 4IDAA 2O3JA 3ASVA 2VWPA 3V1TC 1H0KA 3B6ZA 4XA8A 3PVZA 1UAYA 4BNLA 4E3ZA 4YJFB 1U2DA 2WDZA 1O6ZA 4IDDA 5TSDA 5KVCA 1Z7EA 1ADFA 3DQPA 4NNJA 4YRAA 2OOSA 1X15A 2C07A 4PG4A 3HFSA 4CPDA 1E7WA 1PR3A 1CERA 3F1KA 3S2IA 2A94A 1VLLA 2DU8A 3GMDA 1T4BA 3B1FA 2V6GA 4CMCA 5CDTA 3EUWA 3BTOA 4WKGA 3RJ5A 4L4XA 1XEAA 1I0ZA 4ND5A 2I76A 1K5HA 4FGWA 4AJ2A 3SLGA 2ZQYA 5IG2A 5JSFA 4JP2A 1E3WB 2X6TA 1U3TA 4NJOA 3AW9A 4GMGA 4E21A 4A27A 3E1KA 3N7UA 3O9ZA 4MVJD 3LLSA 3N58A 2YQ5A 4R1NA 4J0EA 1XHLA 2DUUA 3Q11A 2Z5LA 4R4JA 4IM7A 1NQOA 2C59A 2GO1A 2HAEA 3OIGA 4YJGB 2PZLA 1YQXA 1ZO8A 4PG6A 3ZWCA 1WMBA 4GSKA 1EFKA 1P74A 2HO5A 1E5LA 3DBVO 3GAZA 1HDCA 1LBEA 2NWQA 2J5KA 3KYDA 1PS8A 3GGPA 3GN1A 4RPGA 1I36A 3PLNA 4EUEA 1P0CA 2VRCD 1E3EA 3S55A 3AM3A 4ALNA 1XYGA 3ROPA 5B4TA 3GOHA 3LU1A 2PKQP 4L9RA 4LRTB 2D0IA 1E1NA 1ARZA 2WEKA 4J3FA 4UUMA 3VAZA 1KY4A 4NMHA 1F8FA 4M87A 3LDHA 1CIVA 4O0LA 4KOAA 2Y1EA 4EITA 5IDQA 3FI9A 1PJTA 2TMDA 5A05A 5CDYA 4DYVA 3IIEA 4BNFA 1P3DA 3DEYX 2PWZA 1IHXA 2A92A 4LCJA 2EJWA 3WDSA 3JQGA 4FSHA 3GH3A 2QZZA 3AOEA 1NQ5A 5TQVA 7MDHA 4CM9A 2AE2A 2D8AA 3GK3A 4AICA 5KKAA 2JAHA 4DLLA 4UVHA 5B4VA 1ZXLA 4WLNA 2ZYAA 3CEAA 1DB3A 2OO5A 1UDBA 5CG1A 4XKJA 5U9CA 3TWOA 3GFGA 3PFWO 1V6AA 3ZWBA 4BNJA 2DC1A 5ILGA 1ONOA 5DOVA 2IYOA 5L95A 4BO6A 2RH4A 6ADHA 2YW9A 4PLCA 4OQYA 5JAQA 2ZKLA 4D42A 5TT0A 4IPTA 3I6QA 3H5NA 4YEDA 1K2WA 2D4AA 5F1KA 3GLQA 1JQBA 1XQ1A 2GF2A 1IHYA 4DBZA 3LT2A 1YB5A 1WP4A 1PGPA 1XR3A 1UXJA 4D79A 2YUTA 4OOEA 2I5PO 3KXDA 4BHTA 1PQPA 5L45A 4YJFA 2DTXA 1YBAA 2GN8A 3L4BA 4IJUA 4YAJA 1YB1A 1C1DB 2NADA 3CPSA 2QYTA 4J7UA 2Q49A 1JU9A 3QHAA 3RU7A 2FHSA 3F4LA 1PGJA 5TX7A 3P2OA 4FDAA 2AW5A 4I9NA 2IEBA 2I9PA 5IXYA 5JXWA 2I67A 3DOCA 4FN4A 3EVNA 3PLRA 3JYQA 4GLLA 2C7GA 4NK5A 4JGBA 4OSOA 3AU9A 4QTZA 3VH2A 4OJNA 2R00A 4FC7A 3OECA 3NUGA 3Q6IA 5JDCC 4EUFA 3LC2O 3RFXA 3ICPA 3AY3A 4D7AA 1A9YA 3JQ9A 3KM0A 4TRMA 3WJAA 1YXMA 5K6AC 1E1KA 3ZW8A 4NBWA 1HWYA 4YJGA 3H8VA 1BXKA 4L4RA 3CXRA 4C7JA 3AUUA 3WS7A 2SCUA 5C7IO 1X13A 4ALIA 4OMUA 5TGDA 3DONA 4B4WA 4Z0PA 3LT4A 4TVBA 1W6UA 1PGNA 4YJDA 3V2HA 3ROMA 5COBA 2JHFA 4YTEA 5AOVA 2GCGA 1BW9A 1H6BA 4LSMA 1I2BA 2YDXA 2I3GA 4JJGA 2NTNA 1ZK4A 3IP3A 1FK8A 4OYRA 3DBHB 3PYXA 5B12A 3FNFA 1YVEI 3HDHA 3WIDA 4XEHA 2AG8A 3D0OA 3IP1A 3JQAD 3A4VA 3QWBA 1Y7TA 3FNEA 4ZQBA 5T6BA 2JFHA 3DXFA 3L9XA 1A71A 3U9LA 5ER6A 4DA9A 3FPCA 4UREA 3WSVA 4QSMA 1CQJA 4OKNA 1Y81A 2PZJA 3DZGA 1QRRA 5A5FA 1ENPA 1UJMA 1X7HA 1KVQA 2GUGA 3PEFA 4GI2A 1QXSA 2FSVA 2NU7A 2W2KA 5TNXA 3U0BA 4EJ0A 5IF3A 3JD4A 4YBZA 3C7AA 4YRBA 4Y9DA 2ET6A 4PGFA 4B4UA 4UEOA 4E6PA 4WGGA 4BO9A 5ICMA 1V0JA 2DFVA 4E2YA 3QQPA 4DBVO 3TNLA 3KBOA 4EW6A 4TKLA 2VUUA 1AHHA 4II3A 4P38A 2GERA 5T5QA 2X5KO 2B83A 1PEDA 3T4XA
chains in the Genus database with same CATH superfamily
4FE7A 1UMDB 5FWXB 4PGMA 5I4KA 4IIVA 3RFVA 4ITVA 5T8KA 3GMSA 1JHXA 2ZJ3A 1UBMS 4MUKA 5T67A 3WSTA 3ZQKA 3PQ3A 5C81A 2BONA 2Y92A 1UWCA 2H7XA 4JLKA 4REMA 1PJSA 4YRDA 3IUMA 4ASUA 4KNVA 4D81A 5CCBA 1H4SA 1OTXA 1UPAA 4N82A 1E7MA 1G5RA 4KRYA 1FDRA 2Q1TA 3QBDA 1T1JA 4C6HA 2FUG6 3JD1A 4UBLA 1Y4DE 2QSYA 4OMFG 2IP2A 1VHLA 5FOSA 5D01A 3DL2A 3GQBB 3U3RA 2IYTA 3KVYA 2UYOA 1F14A 5K0NA 2G06A 2ZTHA 1E1YA 1O77A 1N2XA 2ECQA 2HU2A 2GZRA 4DIDA 1GU0A 1U94A 3K96A 4BASA 1VRVA 1NMEA 3LECA 3QMPA 3M3DA 3V4FA 2O57A 3ZWKA 1HSZA 1T8WA 5BNIA 4GX2A 3NB0A 4QG7A 2F3QA 2VNKA 1BHQ1 1V16B 5CDSA 4MOWA 3LT1A 4EJFA 4P86A 2P9HA 1VYTA 3LTNC 2F59A 1R0LA 4MITA 3UGQA 4IYJA 3LLUA 5AVTA 1G2OA 2O0KA 4PICA 2CNWD 2UUAB 2O8CB 1F8GA 1V41E 1OA1A 2XUQA 2ZK7A 4C21A 1XDZA 3RQIA 1KMMA 3Q4GA 3DM5A 4BNTA 1T1IA 1U8EA 2DBQA 3QU4A 2QTGA 4GXRA 2JLXA 4OTZA 1Z2NX 1Z7GA 1TU0A 4I0WB 4ANFA 4J4BA 5IT5A 1JEEA 2IY9A 2DWPA 3CUKA 4GL4A 2ZCVA 2W9XA 1SK8A 4GR4A 4GQBA 4DDHA 1U9CA 3KVNA 1US8A 4BYGA 1XJWA 4FEYA 2W2PA 3JQ6A 1J1IA 3IAS1 4CR8A 1XMPA 5LMUB 2BTQB 2FNAA 5D3KA 1RQXA 4GX0A 3LDUA 3H2KA 4H9GA 4QPCA 4NBUA 2ZUFA 1GTG1 2OO3A 3LMKA 1M8GA 2EW1A 2J9ZB 3DLCA 4FZ5A 2PKXA 3HO8A 3LUAA 1UC5B 1T36A 3OZWA 4PWZA 2DKOA 5JPIA 1Q74A 4L85A 4WOPA 5I7RA 4EYOA 1X39A 1LZKA 3V4RA 3SYTA 2LCIA 3WGGA 4FFMA 4AP9A 3QUAA 3GPLA 2QRNA 1ECPA 2D4HA 3NDJA 2J85A 3BFXA 2M6LA 4UBNA 1WXEA 5FNVA 1W4ZA 1NUPA 1WZ2A 5DHUA 1Q17A 4UFOA 4LXHA 2Q5JA 5ALDA 1N36B 1Y9DA 1U1EA 4OGFA 4K2AA 4YV7A 2QM3A 5ECYA 2A0UA 3M4YA 4GXNA 1BHSA 1UFQA 3D6NB 2JIDA 3DAGA 7YASA 4LF8B 1HDXA 2XHEA 2FEAA 3F8TA 2BBOA 4OQXA 1I5RA 3IDAA 2J6HA 4KH0A 2IZ0A 4JNKA 3GDGA 4IDEA 4LC9A 3BGIA 4F5YA 3D1JA 3UAOA 2Q3EA 4B3FX 2EDCA 3WJ1A 4ISCA 5C1IA 2GNPA 2UZAA 3KEOA 2ZYTX 1KR2A 1XEXB 1WV0A 1LRKA 1AZWA 3HU3A 1YI8A 2I6XA 5KAMA 5TS3A 3D3JA 5KOJB 2ECKA 1MV5A 1VIAA 2IYVA 1QH1A 3GGGA 4K6HA 3BMQB 4IV0A 2WYVA 1KSJA 2X86A 2HEGA 4XYMA 2DULA 3GAFA 3O90A 2ZZNA 1C7ZA 4N8EA 3ZJ5A 4I4NA 3W06A 5IVKA 4FYKA 1BWQA 1WNTA 5DHRA 1F3LA 4IJQA 2PFGA 5KREA 3FB4A 5JXGA 5I51A 4PSKA 1GJRA 2P90A 5FR1A 1MDFA 4O02B 2I1VB 4QGAA 3WKCA 4D6YA 4C0JA 4EEKA 2JFYA 3ZVKA 5LN1A 3OP4A 3NP7A 1G6KA 5F76A 1ZJJA 5CGZA 4ETIA 1USVA 4RDIA 3OG9A 3N2ZB 4WD3A 4ZHSA 2B1GA 2YC4C 4KPEC 2NVWA 5KOJA 1LBTA 2Y1XA 5BXQC 2HWXA 2WPDD 4ZO7A 3V1YA 1K98A 2N1MA 4XOIA 1X87A 5CYPA 2IW3A 3MWEB 1BGWA 2JGKA 2WT8A 3PGKA 4M0PA 4QEKA 3WVNA 5KU1A 3BM5A 5AM2A 5JMWA 4FP9A 5TQ0A 5LU9A 4RY2A 3WLJA 5JZOA 2XYRA 4EA7A 4DMLA 3AR6A 1VCNA 3O8OB 1RLOA 1JALA 3CB2A 3PIIA 2P2CA 4MJ7A 5EP3A 1TVCA 1H2XA 3ETCA 2F64A 1IM2A 3OLWA 1FFWA 1Q77A 4JOSA 4MCJA 2AEMA 3H3JA 2XTAA 4JQSA 4WXRA 1TT5A 3RW9A 4JT4A 2FPIA 1N6NA 3FGOA 4MR7A 5FL7A 3RV3A 2X5JO 3DJFA 1J07A 1I8TA 3Q7RA 4KLNA 4DPKA 1RHJA 3JQCA 4KXVA 4D02A 4BX3A 4RTNA 4XSVA 4C5CA 2CUTA 2EU8A 3QMVA 2IZ7A 1HT0A 2GZMA 2IU6A 2BUCA 3IDFA 4JB8A 4PO9A 3ZCXA 3D3EA 2V9CA 3IDZA 1J0DA 1M34B 1OX6A 3HKCA 2W4MA 1SBNE 2FA9A 3DPIA 2KX7A 4DABA 3QE9Y 3V8MA 1LV7A 2NSLA 3M1AA 5DTMA 3TD9A 1AGPA 2HHAA 4CCSA 1M1NA 4F4HA 3H0CA 4Y2GA 1H2EA 2H5IA 4D3SA 2XWQA 3D2AA 3UOAB 1XEWY 2B2XA 3H4MA 1YNSA 1Z07A 2IUTA 3DMPA 2CJWB 1BDMA 2AN3A 3L6CA 4FGSA 5MN6A 5IDWA 1FX0B 3JQEA 3FVVA 2N1BA 1XQ9A 2O7QA 3LPDA 4EHLA 4JR0A 3H2SA 4NBLA 5EIWA 5HFNA 1ULTA 5LYYA 1U7TA 2HQ1A 2QG9A 3OOSA 1ZIPA 4KUHA 2ZITA 2GEUA 2XITA 3NZEA 2MSLA 1GA4A 4MVJH 4EM6A 5AESA 1WMSA 4DG8A 3FLEA 4XRGA 2P5UA 1P73A 3RWBA 2XNHA 2SICE 4NNOA 2XE7A 3IJ5A 2DCMA 4MI9A 3U61B 3BFVA 1AHNA 4Q1FA 2BKAA 521PA 4KE8A 3RODA 1G20E 3JQ8B 3ZXXA 5B53A 4CIAA 4M54A 4QEZA 4LECA 1TXGA 2O2GA 2YXPX 1GNQA 3CTMA 2XCOA 4M0CA 3NMUF 3KE8A 4AC9A 2QE6A 4RULA 3KSMA 3UAVA 4NENA 2P68A 4RJKA 2ZVQX 2MMCA 2V7EA 5KPJA 1DKUA 3FLMA 3QVWA 1Z8FA 5DU2A 1TOAA 2Q29A 4CMBA 4C4TA 4F2DA 3B1VA 2RAPA 3PQ4A 4CRWB 5K3EA 3LRPA 4P3PA 5BWNA 5ALNA 3KQKA 1KKUA 4L22A 4F4IA 2CLEB 2F4VB 5F1PA 4PFJA 2QN2A 3QXGA 4ARSA 3SS7X 3ETHA 3UXEA 1D2NA 1QHSA 4RF3A 4D46A 2IKSA 5C1BA 5LA6A 2DWQA 4IUDS 1Z4QA 3T1HB 2R3SA 3EF1A 4ZYYA 5F9MA 4TXJA 1TJPB 3BVPA 4OQDA 1C0EA 3RRMA 3DWGA 4AI6A 1EGVB 1YC2A 2QXTA 4BKRA 1AQJA 4QHTA 1FA9A 3GCXA 3F6SA 4CT4B 3JYOA 3PFNA 1UBCA 5TB5A 2FZGA 4EFKA 4IKEA 4YACA 1U8YA 4YMUA 1EM6A 2C4MA 3UMGA 1N6LA 3QA9A 4IWYA 4EX7A 2V6FA 1FJXA 3WL7A 4JLBA 2RGNA 3ZIUA 2DYKA 2GM4A 1E0KA 3TSAA 1IK6A 1A2KC 3AP3A 3LBIA 4FT2A 3WL6A 1GR1A 4ZAXA 1HNZB 5K0BA 2PMFA 3NBYC 1ECJA 4QBTA 1VYUA 3LYHA 4CIVA 1T3SA 4ZVQA 4LMBA 4CW7A 3AVVA 1DT3A 4KP7A 2G5PA 2QJFA 1NAIA 5KI6A 2LPMA 5IKOA 2UVPA 1DO0A 5DIFA 1RTKA 1EVYA 1LSSA 2WBLC 4NZNA 4RKRA 1M2NA 3OKFA 2Y05A 3ROZA 1ORWA 2DE0X 4CIWA 1PGOA 2CZCA 2AQ8A 2IGBA 4HEA1 5L4LA 3JVVA 3T7IA 4D4JA 6ABPA 1IUPA 2W48A 1SC3A 1V39A 3ASZA 4NCKA 1YS6A 2QTFA 4M0DA 3SPXA 1N9GB 1UXHA 2XMDA 2HLDD 3M83A 1GRRA 1N3BA 3RFTA 3W5CA 4AU1A 1QV9A 2XQIA 3FUTA 4LE1A 5CFOA 3EYWA 4G24A 1PNQA 4LISA 4FDLA 1VCOA 2JHAA 2O20A 1Z17A 4DADA 1EX9A 2OMEA 5H3CA 3EXIA 3A1NA 1NN1A 2PL5A 1J09A 3GZNA 4MV4A 4I3HA 5ADHA 4JNCA 3I52A 3O4RA 5AUPB 3QEKA 1GUFA 4I1VA 4BMYA 2AE1A 4FW8A 1JPNA 3I2GA 4ABTA 1LSUA 3RU9A 1CUJA 3LXMA 2PPLA 3F9IA 3FTPA 3DTVA 1PR6A 2CHGA 1VYHA 3P2JA 3S4YA 3SDZA 3V1MA 1EWKA 3I4LA 2X8BA 1JLLB 5KQMA 4AY2A 3F8SA 1IN1A 2A78A 2Q6IA 3OFJA 2EF0A 1HE8B 3L0DA 4W1PA 4NARA 5D6OA 1WXWA 4YJ2A 3C3BA 3IUPA 3LLCA 1NBEA 2I33A 1U6JA 2PXHA 2EFGA 4C2AA 4CEHB 3NRBA 4EHHA 3Q3EA 2ZAYA 3OZSA 1F06A 1VMDA 1YZQA 3NAMA 4H7IA 5BSMA 1PHPA 4RD1A 2P9QA 1ECBA 2V7QD 1UJ6A 2I7VA 3BD9A 7REQB 1E3JA 1ES9A 5CNJA 1CJCA 4BE7B 2NG1A 1K4MA 2WF6A 5CB6A 2E5WA 2V4UA 3P2IA 3FPAA 4KFCA 4UPVA 1NJ8A 1TGVA 3DCJA 4URUR 1PT5A 4BUJA 4NYMQ 1V3TA 3LQYA 3OZEA 2QD1A 2BL4A 4XX0A 4ALJA 3T61A 3OT1A 2LRHA 3PNVA 3VC1A 1QCDA 4KTVE 5HRUA 1ISFA 1UINA 2P6UA 1B8NA 2ZIGA 2WUEA 2O4CA 5FOXA 3UCFA 2DVMA 4FYXA 5IC5A 1UDCA 2W2TA 1Q3KA 2ZS9A 5K0LA 3UYLA 5ITZA 3ZVLA 5LZ9A 5JJIA 2YMQA 1YZFA 2RGGA 3UB3A 5IRCD 3NHPA 2CXTA 4HVTA 4OKSA 3BA1A 3IDSA 2FEOA 4PINA 3SAJA 1AKTA 4BY9E 1RM3A 1E5XA 1T25A 4Z5XA 1G8YA 1LEHA 3KOUA 4WEOA 2GFHA 5CTAA 3R9KA 4Z54A 1M67A 5AVRA 1B2LA 4G84A 2UZ3A 1T4MA 1YZHA 3NBXX 3PPVA 4XVUA 2GUWA 2VJDA 5JCJD 5JLJA 3A2KA 1ZD5A 3RVJA 1OZFA 1LTKA 2YDYA 4KR7A 4F1WA 2YZMA 1IB0A 1U1FA 2FOLA 2FSIA 4TXNA 3JQAB 4WBNB 4YCBA 1YS4A 3N75A 2ZRBA 4II7A 3WLKX 5F23A 1X0XA 2IUEA 4FMBB 2BDEA 1JNYA 1HDEA 3QJGA 4QE3A 3VZBA 1Z29A 1IOWA 3N59A 2WUFA 4ZVKA 3T94A 1T4CB 3EGXA 3RSHA 3KHUA 3PENA 5J40A 3WBKA 4O1HA 4OHFA 1PFYA 3TRJA 4DA7A 3RJZA 4BAGA 3SQWA 3IP9A 3KVOA 2WJWA 1NE2A 3IT1A 3QJ5A 1J33A 1XXHB 2WIFA 4MW4A 3V7NA 3VR4H 4XCQA 4N76A 4FI3F 1DG3A 2IOQA 2H59A 4LY0A 4L4SA 2FFJA 4LXXA 2UZ0A 2QN9A 1XV5A 4GXQA 1XLUA 2XA1A 4MQEB 2VYCA 1HRDA 5TV2A 3TDKA 2NUTB 3W4JA 2YKGA 4JI7B 1JIJA 2HQRA 4WWHA 1XK6A 3AY7A 3EMDA 4V0LA 5DIZA 2YYYA 5KWEA 2Z4SA 4AN4A 1EBUA 1VJ0A 2VDWA 2A88A 3CW9A 3JATA 1BE0A 4OB6A 4UFNA 5DGCA 3D4IA 5TVKA 3EFOB 3THWA 1HC7A 4NE9A 1ZM9A 4ZOEA 1CZHA 2EC5A 4F45A 1OX5A 1RI4A 1S1CA 3KD2A 4V2UA 3EZXA 4BKPA 3ZJUA 3OIYA 1TF5A 3CMCO 3EUAA 3S2SA 2XT6A 2RE8A 1NJ1A 1PBTA 4HKTA 4JBLA 1P81A 1C2TA 3PUIA 5CYOA 1GRCA 3WR5A 1I1QB 4CNQA 3CU5A 5JCZA 3I05A 5AVOA 5K01A 3FRJA 1KZ7B 2REQB 2PXXA 2B4TO 3D0KA 3IQDB 2OD2A 2GN6A 4INJA 1JA9A 1T2EA 1J8MF 1IOZA 4Q1VA 4NBRA 5CHYA 4AJKA 4G0OA 3HA5A 1Y4UA 2UZ1A 2XMGA 3LUHA 3T4EA 1U0HC 2EJUA 3UHOA 2NACA 4H4EA 4ZK2A 3HHEA 4U7PB 4TZ0A 1OBVA 1X8JA 4MUIA 5ULLA 1K2VN 1UBGA 3GJZA 1HI9A 1QU2A 3DDNA 3PFBA 4AZ3B 4D9NA 2ZAMA 3IV7A 1DXYA 4DVJA 3TQRA 4D0SA 2ZLBA 3ZKWB 3AESB 3R0VA 4L02A 2ATIA 2E4VA 5E2IA 4OAQA 4IXTA 1XROA 1ZL0A 4EI9A 3IS3A 3PK0A 4YO8A 2DBYA 5AW7A 3CX7A 1DSSG 3UJNA 4P3OA 1P7CA 1AGXA 2JJ2D 4BTEA 1MIOB 4DC1A 3NHZA 4UVEA 3NDBB 1UZUA 1ZGAA 2XDQA 4XIFA 1SFRA 4GPTA 5BURA 3ZWPA 1FLDA 4EFDA 2AQHA 3WL4A 1RYBA 3Q8KA 2QM0A 1VLZA 2DQSA 4AZ0A 1YACA 3ZTTA 4ALKA 1M54A 4PHGA 2AIRA 3NAGA 3CVVA 1N8TA 1QC5A 2F67A 5D86A 2R6AA 4G9EA 1OKKD 2DPMA 4YJHB 3VR3D 3HUTA 4P2BA 5I3CA 4ZDKA 1N7IA 3I4FA 1QFJA 3OZGA 4FKZA 3VJLA 4P80A 2EQBA 2RGXA 3V55A 4PCUA 4Y0VA 2B5VA 4LTMA 4FNAA 2LP4Y 3ZDRA 1MV8A 1S2LA 2QN7A 1EP1B 3R7BA 2O05A 2L69A 5EJ8A 2P2YA 2FVYA 3KQTA 1K7YA 1N92A 2P1ZA 3G17A 3KEGA 1FP6A 5SY9A 3EOZA 3HJHA 2C58A 1P1FA 1R66A 3F5QA 3NVMB 4KXFB 4HGNA 2V03A 4U2BA 2QR5A 1K88A 1U8CB 2WK1A 3ZX4A 1FS6A 5MN5A 3CTPA 4RENA 4O59O 4B0OA 2X3FA 2GAFA 4KGDA 1PT8A 3LX5A 4FJ1A 2E82A 3D6HA 4MX8A 1RIIA 4Y1EA 5DNCA 5GJVC 3KYBA 1Q95A 4M0LA 5JCJA 1FJHA 2ILVA 4NK4A 4IIYA 3CA8A 3VXKA 2B7CA 3INGA 3BGOS 4Q0MA 2O9JA 3D1LA 2QL6A 3D0QA 4EELA 4EABA 4WLUA 4D0LB 3IEPA 2YJ4A 1ILEA 3AUJB 3EE6A 3C2QA 4YRPA 3OIFA 4IW3B 5H02A 4BX9A 1U3WA 3L3BA 1N2EA 3DAPA 3WV5A 3U37A 4CLEA 2D7DA 3ICOA 1WMEA 1D0IA 2G9QA 1NZJA 2IF2A 5EN4A 2QW1A 3NANA 2E48A 1Y3IA 2FWPA 3NNNA 1BOOA 4DSOA 2QZ4A 1XB2A 3V6LA 3LT5A 5GOZA 5AKIA 2QW0X 4YO7A 1AGYA 1GAEO 3CZQA 3UJCA 4OAPA 4C2BA 3IAHA 1DAEA 3L01A 3RFCA 4MUGA 4TWAA 2B94A 3LGAA 5GP1A 1HT2E 2D13A 4C6SA 1MB9A 3W6UA 1RP7A 2O2ZA 1JSCA 4U5QA 1MA3A 3G7SA 3S3TA 4C6RA 1I4DD 1I7PA 1JZTA 2AFVA 1C7RA 4MP3A 3JU3A 2OWEA 2F8TA 2YTZA 4M60A 3OWXA 1E2QA 1LBIA 3HYTA 3TEJA 4M46A 1Y5MA 1WXHA 2PZBA 2ZP1A 1ACMA 5DEOA 1IU9A 2Z9CA 3WA7A 1DTEA 4RS4A 2I2AA 3P19A 5BNTA 5T8KC 1EK0A 2ZB8A 1YBVA 2A4KA 3CONA 3CY6A 3K1YA 3FOWA 1KI7A 2CFIA 3LC0A 3VNUA 4XM2A 3V8PA 1HLPA 4Q6BA 1TDJA 1PJ4A 4HPJB 2M6KA 3L0OA 1WU7A 2J33A 3FOFC 5LLTA 1FS4A 3L02A 4ER7A 3TMYA 1MB3A 2WZCA 5AM1A 2VNIA 4HAOA 1SXJA 2CVOA 3EMVA 3HXKA 3P2MA 4PZPA 1N4DA 1HUQA 5TF0A 4HDCA 4BAUA 2GXAA 3K53A 2J0UB 3F5FA 4P0TA 4YDHB 3I1FA 4N0DA 1ZPDA 2R48A 2TMGA 4W1QA 5AXAA 3U7IA 5IDYA 4HV4A 3RS4A 4N6GA 1GNPA 3GAMA 3UV6A 4DAOA 2X8WA 3VO8A 1M6YA 4X93A 4HDNB 5ALGA 1Q84A 1ZIXA 2O23A 1H0RA 3DS8A 3A1TA 3BSSA 3L7BA 4FD3A 1MG5A 4YUVA 4J2HA 2HU7A 1KMHB 3DE5X 3QOFA 4G0YA 3UMBA 2GCEA 4W5NA 5KUTA 2GXSA 2X1HA 1HOTA 4KWHA 1DWPA 1HT1E 4CR7A 1M1YA 3AHIA 3T7EA 3TSWA 5AR1A 3WSWA 1CQXA 1MENA 2CXOA 4U7DA 1B3BA 1VPWA 3R5SA 3V8QA 1MF7A 2ATEA 2YH2A 2FUG1 2IU4A 3F49S 4KUGA 3TL6A 2IXAA 1IFXA 1XX6A 4TYWA 1KZGB 1CEQA 3NOVA 4PF1A 3DMTC 3Q6NA 4CYMA 3R0JA 4DG5A 3OPYB 2AFHE 2D2EA 4KX5A 1SIOA 1TM2A 4XB1A 1NBME 1NMQA 1S89A 4E3WA 3PF9A 4QULA 1ZOLA 3RSLA 2DUWA 2OHVA 3D3WA 4G41A 1C9EA 3FFWA 4HDSB 3R8CA 1FP4A 4QNRA 4Q3CA 1OIWA 3DOIA 2XNDD 5FLEX 3U7EB 4NG5A 2RI1A 4JT8A 4BMZA 2FZEA 4BB9A 2PUEA 1J4AA 2ODQA 5HVNA 4IDPA 1RQ2A 3ZHXA 5I9NA 1UBFA 1V48A 1N6PA 2AMLA 3IEUA 3GLIB 1QGUB 3NC1C 4J1JA 1R6VA 3NYRA 1UBRS 2XDWA 1EXWA 3G9TA 1MFZA 1VJCA 3KYDB 4L9WA 4LHSA 3HJTA 4X63A 4F8EA 4EG3A 3PLAE 2OUKA 3PHCA 4ZU3A 2JIMA 2YVAA 1P6UA 2WSMA 4RTOA 5AJUA 2V7UA 4X00A 1R4NA 3GX1A 4W1RA 5MHTA 1U0EA 13PKA 2W8ZA 1C4WA 2H4FA 1NX6A 2QMEA 1SQ6A 5DGXA 1CY4A 3O1LA 1G9XA 3HDGA 2ZJ1A 1BXGB 1EP3B 4R40A 4BFTA 1DADA 5H81A 4O4HF 1Z6AA 1ZR4A 5B7QA 3O03A 3R4CA 4U8HA 3IMCA 5H9WA 1RR6A 4I1UA 1SCUB 4YQEA 1QK4A 1I1NA 4V3BA 1QORA 4DS3A 3RM3A 1XA4A 2QRQA 4C4ZA 3GJYA 2ZSBA 1QDUA 1DDIA 4XB2A 2C61A 1XTZA 4AJ4A 2AFIE 3EZ9A 4B35A 1O1YA 2V3WA 1K0UA 5BYKA 1GUAA 4Y2JA 1YVDA 3C16C 2Z6UA 5HTKA 4N5HX 1U9IC 2PUGA 3TPZA 2NNWB 4J2OA 2QTNA 2W2MA 2WV7A 2PTGA 3EUFA 3TTTA 4ARZB 4IF6A 1CE8B 4FR0A 2E4ZA 1W75A 4FM9A 1NFQA 3BRCA 4L07A 2AJDA 2B4RO 2NUPB 4AMYA 4OH7A 3MBIA 2YICA 3U9SA 3GVXA 1V7QA 4AZ3A 2VCEA 2JNWA 3IO5A 3SKXA 2FP4A 3HXOA 1S3FA 3ZZTA 5HCNA 4IXMA 5EHQA 1M8JA 4MCAA 1FUIA 5K6AC 2MMGA 4ZDIA 3A9RA 3U6KA 2VXYA 3K05A 1XZJA 3N3BC 3Q2KA 4G36A 1T10A 1NM5A 4Z8XA 1AQIA 5TVGA 1BE1A 4FK8A 3FYCA 3NTOA 1JQJC 4UVGA 5BWCA 3Q2IA 3MILA 2BZ0A 2O2DA 1WUHS 4IIXA 4ARIA 4YP1A 5LMCA 2JH8A 1NJ2A 3SNKA 2PLFA 3HBAA 2CNNA 4R2IA 3UM9A 2ASEA 4RFSB 4LFBB 2FJPA 2VNSA 3NNDA 2XUZA 5EWMA 5CA0F 5KWSA 1ISPA 1G291 3HGMA 1RLIA 4HP8A 2B9VA 3ZDEA 5KMGA 3AVWA 1NMYA 3DEHA 5KYXA 1LC3A 4K0RA 1IOLA 1JXMA 1U0FA 3AR8A 3Q15C 1QAOA 4NS4A 5AVJA 3BPSA 2JK0A 1ENYA 1QPGA 2YWRA 4G89A 4L5IA 4QD3A 4U00A 5LC1A 3RTAA 4DSUA 3DXXA 4DMGA 3ZLBA 1PLKA 4CL8A 3GNQA 1HORA 2OCDA 2V7GA 1ODSA 3EIQA 3F7MA 5M7EA 1Y1KE 3FGNA 1KVSA 1XLTA 2WTMA 3EC7A 2DHDA 1P1CA 5CLLA 3ZCVA 3PUYA 3HLKA 1L5RA 2PLAA 5AOBA 3ZV3A 4UNRA 3NHRA 4L7QA 2YY6A 4DJAA 3GLIE 1J24A 4E5MA 1CSEE 1WJGA 2QNRA 4XLLA 3T6KA 4CHGA 3PEVA 1CB0A 5EWMB 3E18A 3ND7A 3QPVA 1LF0A 3UCXA 3RIGA 1N2SA 3DOUA 4TN5A 4EFLA 1ZJWA 3G9QA 4ZA2A 1W85B 2W6MA 4LNUA 1M0TA 1SBTA 2G28A 2O7VA 2Y68A 1E0DA 2AMVA 1Y5IA 4V0RA 3ESRA 3C5HA 3ML1A 3OKPA 4RKEA 3MLEA 1UWLA 4K3VA 1JMKC 3F7TA 1SCKA 3IXLA 2G5TA 3LA6A 5ALZA 6LDHA 4ZMRA 3L41A 2VVTA 5H82A 1DCFA 3T0FA 3RPEA 1SU6A 3BS4A 1Q0PA 4HEA6 4W5OA 4ZVLA 1ZRSA 2PR7A 2XXJA 2IEIA 4MR9A 2V97A 1BHJA 2FGJA 2ZUBA 2HR1A 4IQ8A 1DBSA 4LZJA 4Q7QA 3SHQA 1F1BA 1T2NA 3VYVA 1VM6A 121PA 2ODTX 1JAIA 3ZK7A 3IQFA 1NF2A 4TWJA 4JLNA 1COWA 1DEAA 2VZ0A 4QWWA 3I23A 2VF7A 2ZYSA 1UK9A 4YECA 3CZAA 1GU1A 3SICE 3IHWA 2ZATA 1KSFX 3VU3A 3GPIA 1E62A 2WKQA 4IXNA 1ZG3A 2NOAA 2C82A 2OSBA 2W6IA 1GVHA 2VIIA 3UWSA 1TM4E 1DOZA 5CVTA 1C2YA 4POAA 1B7GO 1N2CA 1TTHA 2GA9A 1SBZA 3BMCB 3OCVA 4HQNA 4K1LA 2VHYA 4F3KA 4V1CI 5JU6A 1ADBA 2Z6VA 1A9PA 4ZJZA 5I9MA 2POQX 3ICQB 5ECGC 4X71A 4CEIA 4FZVA 5FOWA 3DE7X 3O4JA 4B5KA 3L1HA 3TQOA 3TAXA 1CR1A 4HB2A 1JBKA 2PSFA 1SCIA 2F55A 5KNCH 1H1LB 1SNYA 1PZEA 3FI0A 5HQTA 3VHLB 1XLWA 3BCHA 1ZMXA 2REXB 1JVNA 3ADKA 3PPWA 3V8RA 1J39A 3WRYC 4CV1A 3QZUA 4CI9A 1UFRA 3L07A 4YRSA 3LWDA 1I3NA 4TTRA 5EMJA 1QKJA 5DI9A 4MS1B 1ZSNA 3WLOA 2P1RA 2W37A 1CP3A 5EJEA 1UOEA 1TF7A 2OYSA 3I04A 2AJ8A 3SF0A 4AYXA 5ISMA 4KVZA 3R3ZA 3AKYA 4G37A 5G0SA 5KTOA 5FV4A 1OJ7A 4PVCA 3DMRA 4KSCA 3PWZA 1L4BA 3PHBE 4MGKR 4ZWNA 4NLLA 1M1YB 3DZKA 5MF6A 5IFLA 5LD2C 2MYTA 1XG5A 5EY5B 2X8JA 3LIIA 1S6YA 1ODFA 1O7JA 2INGX 1IDOA 4WZBA 1DIHA 3BL8A 2FFAA 5BUSA 3PEWA 4X20B 3V4SA 4EB3A 3ZQUA 4BJHB 3L6OO 4RL4A 3DHNA 4W82A 3SZMA 1QGED 2OZPA 3RT7A 1OD6A 4JXKA 1Z45A 4DV6B 2AKAB 4HWGA 5A06A 2AXPA 2O2JA 1B6RA 3LE8A 3Q10A 1QOQB 3JATB 3GCWA 2ZB4A 1ADCA 4NMWA 2QLJA 4MW5A 1E4VA 3PGXA 4HLQB 2IP4A 3KU1A 4UXIA 5EMMA 4ERXA 2EIHA 1QF6A 2FPOA 4HVAA 2GS9A 3P9SA 5G0WA 1AGRA 3QTBA 4M4SA 3TAHA 4LDJA 5JAIA 5JDCA 2ZXFA 4IZHA 5IVHA 3RVRA 3E03A 2IYFA 4NATA 5ILQA 3RROA 3VYSB 1Z8HA 4RPLA 4Y6GB 5AVZA 2A35A 4EQ6A 3FMPB 1RXEA 4M9UA 2OCBA 4RAQA 3TH5A 5JD6A 2BGKA 3QI7A 5BT8A 3T9DA 3C14C 1YZLA 3MTDA 3SOZA 1GQYA 1UMKA 1XFAA 4HK4A 4P58A 3PR1A 1Y8ZA 2CKMA 1RZRD 1FFBA 4NMMA 2BRUC 4FC6A 1Z5OA 4ZTBA 2G1AA 1O94C 4RQTA 1ZVVA 1R0KA 4FMDB 1WF6A 3WOHA 3JTEA 4CM4B 2FWIA 1JLHA 3CEPB 2FR8A 3CGGA 3E9ZA 4UJ5A 2E87A 4I1PA 4R8KA 2AEJA 1RVDA 2ZIWB 2VJBA 5CJJA 1ULHA 2ZRKA 5BN1A 5E1BA 3UA3A 5JJCA 3DTYA 3H1AA 2Q1WA 3I42A 4F4UA 1D1SA 1WUKS 1JAXA 3AFNA 3C85A 3HN7A 3LBYA 4JC8A 1P17A 1NC1A 2C8VA 4N9WA 4OLFA 2QTCA 1DIGA 3IV9A 5GJWC 3VH1A 5KTPA 2RGDA 4KFUA 1PHRA 1IN5A 2PYDA 3NTRA 1JF8A 1OASA 5JNSA 5E9JA 4HDRA 2XBMA 1A27A 3RRXA 1JLMA 2CF6A 2XD9A 3PCXA 4S1OA 4ITRC 1NBIA 2EHJA 4EYKA 1HDGO 3IUQA 3PQ5A 4IGFA 2JD1A 4ZGWA 4GC5A 4E33A 2F9MA 4MULA 1VP9A 2XYGA 3HWRA 3KZNA 4MI3A 1ZJ4A 4YPOA 4JR1A 4ZAFA 4BQSA 4LJLA 3UXHA 2OFPA 3B70A 1NSYA 5BVHB 1GNTA 1S0UA 1E0JA 1AUQA 2IE0A 1YJQA 4CI0B 5HOQA 1D6JA 5EIXA 1N78A 1JTEA 3WL8A 4RPCA 3LHSA 4EATA 1BZYA 1DX6A 1QZ3A 3ADDA 2CW5A 1K5PA 3A3KA 3O8QB 5TJ9A 4BLSA 4I7EA 3RK1A 5LSAA 2VQ6A 4RE5A 1ZNXA 5K3FB 1U28C 1UZNA 2ZRDA 4Q39A 2VQ3A 2Y1DA 5ICSA 3C3YA 1TQ2A 1B26A 4BYMA 3TIFA 5I9LA 3LPMA 1JQAA 2H1HA 3FYTA 4Q4JB 3VNRA 4LF7B 2XVYA 3OOYA 1LNSA 2FSVC 4I6JA 3BIJA 3F73A 1HZZC 4BNGA 4W8HA 2RIPA 3PI7A 1BDBA 2DH6A 1XOIA 2Q5QA 4LJYA 4MK4A 4RPKA 1W5SA 2Q0XA 1KDOA 3N2IA 1Y5NA 1H1TA 3QFSA 4FKBA 4M89A 4N9QA 5J5AA 3TQIA 3WXBA 3X2EA 1EDBA 1MORA 1XZEA 2DPHA 3E05A 4Q5IA 3PUZA 1EWVA 3COVA 4BFWA 5EQJB 3PNYA 4HNGA 2QUJA 2AJTA 3BN3A 2EFYA 1INLA 4YS6A 4LBVA 3ZD7A 4K26A 3Q8WA 1YQDA 3U3XA 3PDHA 4WUVA 3EXFB 1KVTA 4BO8A 5JH7F 1A77A 1NN5A 4Q82A 1O94D 2AD1A 3PQ2A 2ZANA 3ZEIA 1DPFA 2OCAA 3O0DA 5ED4A 4IX9A 5JAZA 1H6AA 1XQWA 3DLAA 4AG3A 1UKBA 2GPBA 5EUQB 2XVMA 3ITEA 4CKCA 3B7WA 4HYYA 4Q12A 3HCWA 4X1IB 3S2ZA 1RCTE 2VCYA 2D0PB 3H5AA 2EYQA 2FPWA 2JI9A 4DB4A 3R7FA 3UAZA 1LNQA 5IAGA 3QELB 5KC9A 3PVCA 4DLRA 1H4QA 1IY2A 5F7JA 3ZDQA 2YWJA 4I2VA 3CNHA 4NULA 4Q3KA 1RBYA 2QD2A 3WWOA 4DAEA 3WIUA 5DGTA 2AOWA 2YWXA 4LPSA 3AVQA 4HUTA 3QSGA 3ZY2A 5HRAA 2CYCA 3EZNA 1PW7A 2ALJA 4IDHA 3TUZC 3OZAA 3SHWA 4AM8A 1C8KA 2FPMA 4LVOA 1YJAA 2D59A 2IH4A 4D41A 1GYPA 5IM5A 2Z4TA 2JKZA 1WPRA 1TC1A 3CPEA 4CM3A 1FTWA 1QX3A 2FMFA 2HA0A 1QFZA 4X84A 3KXKA 1H2ZA 2ZIZA 2V6MA 3BXPA 5JNTA 1U0TA 3QF4A 4GT1A 5BYJA 4RTSA 1QX4A 3F3KA 1E2EA 3TLKA 3EIFA 1Q0SA 3W9YA 3X44A 4AJ1A 4UTNA 3J7AC 5FT9A 3R9WA 4KRFA 4N40A 5AW4A 2ZAGA 2BELA 1Y9AA 3ZDZB 4LRWA 1P8AA 4MVJP 3BAFA 4OHVA 5FA8A 3GHYA 4HG2A 4CF4A 2BSQA 5CAEB 3GLTA 3KYIB 2EF1A 1ZZGA 3VKFA 2XNSA 1KDYA 3U3KA 3B89A 1RM4A 2O2IA 5FTJA 3GOQA 1FMTA 6GPBA 3OF2A 4Q02A 5IX8A 1ZICA 1XD9A 4I1YA 3GUUA 4CQMB 1TM7E 1T6XA 3I9NA 2R65A 3RGGA 3PU6A 1LCIA 1K08A 1QAMA 4GKBA 2FRXA 4XRRA 5KDOA 2PX0A 3KQWA 1KK2A 2VPYA 4UEJA 2HRQA 3RSFA 5JBIA 4ISBA 1WZIA 1WDLA 1AKUA 2AWOA 1AXRA 1L5FA 3FY4A 3NYWA 3QOXA 3DMDA 1N6KA 1Z5UA 4LHEA 1W48A 4QECA 3W5JA 4E1BA 3OQMA 3OA2A 1Q20A 2EGUA 5IFKA 2V7WA 5JRJA 2YIVX 1F9AA 3HLYA 4KBFA 1PNVA 3G5TA 2VHTA 3SVTA 3ZWOA 2RHDA 4RTRA 2Q3HA 2J67A 4Z2AA 1HBJA 3FNGA 5L3VA 3VZPA 3L0ZA 2FJ0A 2XUHA 4EI2A 2J09A 2JBHA 1FVOA 4CFZA 5M04A 3I1JA 4P4NA 5K8TA 4QT4A 3BE4A 3LCJA 2OVFA 1HH4A 4MSUA 1FBNA 4BJ5A 3BE8A 4U7TB 1TEXA 3LPNA 3PJDA 4K9RA 1BEUB 3O7WA 4NYIR 1FDTA 4JL6A 2PS0A 2YCBA 4D0RA 3KQNA 1QBKC 3MWFA 3K09C 3L0CA 1LX6A 2JB9A 2W6QA 3Q0IA 3OJXA 1EDZA 4YAGA 1L4MA 4BNDB 5CIYA 3O3OB 1R6XA 2G0TA 3BB4A 1L7XA 1OBCA 1X7GA 4UHDA 2XIJA 3EVDA 2R6R1 3FVWA 3FPSA 1A9XA 4IOJA 5BRAA 2PZAA 4HDAA 5JBNA 4Q1BA 5DSZA 4PAGA 3W8FA 1BIFA 2X5NA 5INTA 1L8QA 2GF9A 5H7XA 4WCFC 4KOEC 3QVMA 3A4NA 1AA6A 3L7KA 5CVCA 3SC3A 2DH5A 1LI4A 2H4XA 2BEJA 3C8MA 3I9V1 4RXUA 3BXFA 1ILWA 2C5HA 5AW9A 1U6KA 5E1DA 2R0QC 2QGFA 4O8CA 2GB4A 2W4QA 1A4RA 3C6KA 3B6MA 2JIOA 3H5OA 1KE1A 1A2QA 1YL5A 4C06A 3TZHA 1T8RA 4Q3EA 1XWIA 1MIOA 1PR1A 1E79A 5GOTA 3RSQA 3I53A 3A6ZA 1KYQA 2D7JA 4MP6A 4UBKA 4ZRNA 2O7NA 5CH5A 3ZY4A 4HNAA 1S2IA 1C7EA 1JJAA 4EDFA 1R18A 3U62A 2GPTA 1C3OB 2XCLA 3O75A 2IHJA 3C7TA 2FN7A 3ZQJA 2QMYA 1HV8A 3V00A 1GAQA 3NCTA 4OHBA 1VJ1A 1Z16A 4NBTA 4EUKA 3NHAA 1TIPA 3GRFA 3V34A 5JS6A 4CL2A 3NTVA 5CPFA 1XZHA 3RBVA 4F6LA 2Q1XA 3CLUC 5FH9A 1IEVA 1K0FA 1N7JA 4M7PA 1SHLA 4QJ3A 4ARBA 1YQGA 3G0BA 3UMVA 2GN4A 2WA2A 2F1IA 5DV9A 4ZIRA 1QYXA 2V7QA 4C3UA 5GADl 4Z53A 2GNOA 1DUVG 3M7IA 3OFNA 1PJQA 1QMGA 2H18A 3RARA 3UZUA 5TGZA 1ZK0A 4EUNA 1GRNA 4P0QB 3WX0A 1Z56C 1PJBA 2P9BA 1KFEB 3C3XA 2BFBA 4G1CA 5F64A 3TSCA 5CLIA 1NM5C 2E6UX 2CL7X 5D3ZA 3EFOA 3IBFA 3ZWDA 1F2DA 1OTHA 1YZVA 3W04A 4HXFB 2J3DA 4RLQA 3VZQA 3PUJA 4MAFA 5JCXA 3D9QX 1JXOA 3QE3A 4JYCA 5IUJC 1Y4AE 5C5IA 2C2GA 3TB4A 3GJ6A 3UK7A 1DG9A 4N03A 2NUTA 4GYWA 4MYSA 3CKLA 3PG5A 4FCTA 3T5MA 3U5TA 3NGXA 3A6HA 4IIHA 2GEFA 2R4QA 3QKSB 3EZ6A 2CMDA 5ALPA 5TPZD 2QT0A 3K31A 4CQMD 1MNAA 3V46A 4QGHA 1SHJA 3PHJA 1VB3A 3HZRA 4F1JA 1XQVA 5I7FA 1E63A 4L8LA 2R1VA 3TR6A 2WTUA 1N33B 2HA7A 2ZYDA 1XVAA 4RHEA 2BMEA 2FOIA 2XCIA 2ZWVA 1USUA 4XQEA 5IARA 5K2MA 3W05A 3ZX5A 1JE1A 5DVZA 5E8JA 4A2WA 3VSBA 3EC2A 4EG0A 2J9XB 4LJ5A 3LHDA 3E9EA 4E5YA 1JG4A 2Q6LA 2QTRA 2Y4NA 3QMMA 5K6RA 1CVIA 1E4YA 3DDHA 3ZVNA 4P84A 1GGNA 2UVPB 3EPPA 5C7OO 3M6XA 1PT7A 4G4IA 3DXYA 4J94A 3GJQA 4BLQA 4CIYA 2W11A 4HH4A 4W8GA 4F5ZA 3ZQ4A 1N1GA 4KQCA 2XEDA 3HKDA 1GKIA 2H4HA 1CD5A 1GCUA 4PWYA 4B3SB 3F74A 3FDZB 3KPUA 3KOMA 1VBMA 4PONA 1Z3IX 2CEKA 1W36B 4MVJM 5FTWA 3QMWA 4TL9A 4IJSA 3KWMA 2FQWA 1GCAA 2EL7A