4GLMA

Crystal structure of the sh3 domain of dnmbp protein [homo sapiens]
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
LTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIFPYRFVKLCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dynamin-binding protein
publication title Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 58
sequence length 58
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4glmA00
2P4RA 3QWYA 4AG2C 2CDTA 3VS4A 1FMKA 2SEMA 1PKSA 2KRMA 5FWBA 4J9FA 1PNJA 1X43A 2O88A 1VYUA 1ZLMA 2EQIA 2ECZA 1K1ZA 4JZ4A 2CSIA 1EFNA 1J3TA 1HSQA 2BZ8A 2FRWA 1PHTA 1YWOA 4D8KA 1PKTA 4JJBA 1I07A 3A98A 1B07A 2KE9A 1X27A 3UA6A 1VYVA 4ORZA 5EC7A 1ARKA 3I5SA 1M3BA 2KBTA 2DL8A 1NM7A 1NYGA 1UJ0A 2LQNA 2LQWA 2K9GA 1X6BA 4CC7A 1BB9A 2GTJA 2DLPA 1NEBA 2AK5A 1JEGA 2DBMA 1QLYA 1T3SA 1QCFA 2DVJA 2J6FA 2BZXA 3PVLA 2C0IA 4D8DA 4Z89A 1YNZA 3RBBB 2F2VA 3M0RA 2DL3A 2EGEA 2NWMA 4LUDA 4LUEA 1MUZA 2RMOA 3H0FA 2ED0A 1WIEA 1V1CA 5IHKA 5IHIA 2GNCA 2VVKA 3REAB 3EG1A 2BZYA 2RF0A 2KYMA 1ZUYA 1JXMA 3VS0A 5GJWB 1FYNA 2L2PA 1GCQA 1OPKA 2O9SA 1K9AA 2LP5A 3NMZC 4A63B 2RQRA 2ENMA 1U5SA 1RI9A 3SEMA 3NHNA 2DL5A 2M51A 1UJYA 3H0HA 1ZUUA 1RLPC 2DBKA 4GLMA 2L0AA 1ZSGA 2RQVA 1GFCA 1GCPA 3EHQA 1WDXA 2YUPA 3VS1A 5ECAA 5FWCA 2FPEA 1WI7A 1WYXA 1E6GA 4RTVA 1GBRA 2EKHA 2PTKA 2CUBA 2K6DA 2L3PA 1BU1A 1KFZA 2DA9A 2J6OA 2DX1A 2EYZA 4RUGA 2SRCA 4RTUA 4IIMA 3ZL7C 1AWJA 1WXTA 2ROTA 3U23A 4GBQA 2G6FX 3TSZA 2K79A 5HCKA 1NG2A 2DF6A 2XMFA 1GFDA 1Y0MA 1YWPA 2YUQA 2HDAA 2DYBA 5IH2A 1QWEA 1ABQA 5IXBA 1VA7A 4LNPA 2VWFA 2JW4A 2RQUA 2V1QA 1UUEA 2K7AA 3RNJA 2X3XD 1E7OA 2DE0X 1YP5A 4AG1C 1T0JA 1UGVA 1Z9ZA 4Z8AA 1QKWA 2D0NA 4R0KA 1AZEA 5IXFA 2DM1A 1X2KA 1CSKA 1X69A 2KRNA 2D8HA 1PRLC 3M0UA 4QT7A 4Z88A 2VKNA 3IQLA 3NGPA 2JM9A 1A0NB 2JXBA 1TUDA 2BTTA 4J9DA 3NPFA 2K3BA 2FRYA 2JMAA 2LJ0A 2LX7A 2LNHB 1Y57A 1M3AA 1RLQC 2EPDA 1X6GA 4ZNXA 1B3QA 1HD3A 1M30A 1XOVA 4HVUA 2JTEA 2O9VA 1UECA 2IIMA 1LCKA 1N5ZA 2CUDA 2KXCA 2FO0A 1SHFA 4DEXA 4J9BA 1KJWA 1NEGA 4IIOA 3UF4A 5I22A 1AEYA 2HEQA 1X2QA 2HBWA 1K0XA 1WA7A 1ZUKA 3VS6A 2RNAA 4JJCA 1TUCA 2OJ2A 1NYFA 3VRYA 3M0QA 2LJ1A 1T3LA 4OMLA 4KRTA 3LH5A 3O5ZA 2CH4A 2FPDA 2J6KA 1K0SA 1UDLA 3H0IA 2RPNA 2KGTA 4HVWA 1M27C 2QDLA 4LN2A 2H8HA 2JM8A 3R6NA 2ESWA 1W6XA 2CSQA 2D8JA 1WXBA 2JS0A 1M3CA 1ABOA 4J9CA 1UTIA 1OV3A 1SRMA 2YDLA 2W0ZA 4RTYA 2J7IA 3THKA 4AFUC 2GBQA 1JQQA 4M4ZA 3VS2A 1SSHA 1YCSB 2HCKA 2RQWA 2LJ3A 1OOTA 4OMOA 2DILA 2EYWA 1H92A 1WFWA 5L23A 2LZ6B 4AFSC 1H3HA 3TSWA 1W1FA 2CH4W 3PVQA 2DMOA 2K2MA 3QWXX 2ED1A 4RTWA 2DNUA 1AWXA 4JPBW 2AZVA 1JO8A 2CT4A 1UHFA 2JMCA 4J9EA 1PWTA 2DRMA 1GRIA 2AZSA 1CKBA 3VS5A 2HSPA 2EGCA 2KXDA 3C0CA 2RQTA 4J9IA 3EG0A 1SHGA 1KIKA 1AVZC 3ULRB 2MCNA 1IO6A 1U3OA 2JT4A 1E6HA 2A08A 2YUNA 1GBQA 4K11A 1JU5C 3VRZA 1GCQC 4DEYA 2EYYA 2E5KA 3KFVA 1TG0A 1K4US 2W10A 2M0YA 4J9HA 3SHWA 3FJ5A 1AOJA 2DL7A 5I11A 4CC4B 3M0TA 3UA7A 1WLPB 1G83A 1UG1A 1ZX6A 2EW3A 1S1NA 1SEMA 4F17A 2CREA 1M8MA 2GTOA 2MIOA 1I0CA 1UE9A 3JV3A 4F16A 1SRLA 1H8KA 2C0TA 2KR3A 1BK2A 4J9GA 2ABLA 3TVTA 1HJDA 2ROLA 3GBQA 3H41A 1PRMC 1T0HA 2J06A 2L3SA 3M0PA 4HCKA 1ZBJA 4AFZC 2EYXA 1JXOA 2OAWA 1WX6A 3EG2A 4CC2A 2EBPA 4JZ3A 4WCIA 1NLPC 2O31A 2D1XA 1VYTA 1UFFA 1AZGB 2PNIA 4AFQC 1KSWA 2DL4A 2V1RA 4OMPA 1QKXA 2X3WD 1GL5A 1OEBA 4RTTA 2KROA 1CKAA 2OI3A 3EHRA 2F2WA 4JJDA 1UHCA 2YT6A 4HVVA 4HXJA 1RUWA 1I1JA 3PE0A 2O2OA 2JS2A 2FEIA 2F2XA 1NLOC 2I0NA 2GQIA 2FG0A 2J05A 1AD5A 5GJVB 2CT3A 2GGRA 3EGUA 2EGAA 2FPFA 2KNBB 3M0SA 1G2BA 1OPLA 2C0OA 2EVRA 2KT1A 4Y92A 1MV3A 4F14A 2LCSA 2RN8A 2KYBA 3I35A 4OMQA 3EG3A 3I5RA 2B86A 2PZ1A 1K76A 1AWOA 1MV0B 1QWFA 2KT8A 5FW9A 2DJQA 3REBB 4FSSA 2NUZA 2AKKA 3UATA 1U06A 4RTXA 3VS3A 4EIKA 2YUOA 2KEAA 2MOXA 4CC3A 2A28A 2L3QA 4E6RA 4OMMA 4RTZA 4X1VA 2LMJA 4LE9A 2A36A 4OMNA 1AWWA 2KRSA 3CQTA 3VS7A 3I9QA 1WXUA 1W70A 1YN8A 1SPKA 2A37A 2DRKA 2AKLA 5IHNA 1BBZA 1Z9QA 4ESRA 2YSQA
chains in the Genus database with same CATH superfamily
5GAN8 4AG2C 1YITA 4KULA 2CDTA 4M77G 2CYZB 2SEMA 1PKSA 3RKXA 2HQXA 2EQJA 2DIQA 2KVQG 3CD6Q 3QZ5B 1ZLMA 1K1ZA 4JZ4A 4PJJA 3X24B 3CD6T 3J80E 4XU0A 3JB9H 2FRWA 5A0DA 2K57A 1FXXA 4JJBA 3A1PA 1B07A 3L1AA 2RHYA 4BDZA 2VB6A 3VUZA 1VYVA 4MDXA 5GAMd 3BDLA 4RCCA 1D1CA 2MK5A 2YLBA 3A8MB 4XAXB 3EGXB 2MAMA 1M2VA 4OMFB 2LQWA 2K9GA 3CCUA 3OS5A 5LJ3j 3H6ZA 1WJSA 1FMVA 1T3SA 1JRIA 3PFSA 3PVLA 1BI2A 3OBYA 3PNWC 1YNZA 2OTLQ 2V8KA 2P0KA 2F2VA 3RR6A 3JCMW 3L2QA 2NWMA 4LUDA 1H3ZA 4LUEA 4M77F 1IB8A 3OYHA 1Q82U 1B34B 1I81A 1K73R 3H0FA 1Y71A 1VQ8T 2ED0A 1WIEA 2YRVA 2FB7A 5GAMg 3G7ZA 3OS2A 4M78E 1OZ3A 2XDDA 2VVKA 3EG1A 4BD3A 2X4JA 4DOWA 2HSEB 1G8XA 1WQ7A 2L2PA 5LJ5e 5I2SA 1GCQA 2LCLA 1PD1A 2LP5A 4DBFA 3M54A 3LW5E 2RQRA 2XK0A 4FYVB 1KHIA 3NHNA 2DL5A 1ZUUA 4KH1B 5GANe 4BB7A 1GFCA 1K9MU 1WDXA 2YUPA 3VS1A 3C95A 5FWCA 2HZYA 4L5GA 2CUBA 2K6DA 1BCMA 3JCMb 4LD9K 4WF2A 2DA9A 2J6OA 2XICA 4KUIA 2DZCA 4OGCA 3OYAA 4HCBA 2SRCA 3ZL7C 1K73C 4GBQA 2K2VA 3DB3A 3C94A 2DPPB 5GMKh 1NG2A 4C8QA 4RG2A 2NLUA 2QEXA 1Y0MA 3JCMJ 1YWPA 1RI0A 5IXBA 3LH0A 5KYNA 3L42A 2RQUA 2V1QA 1UUEA 5LJ5d 4C8QD 4XK8E 4HT9A 2DE0X 1YP5A 1FMWA 4A4HA 1NE8A 2DTHA 2DERA 4ZGDB 1Q82R 4Z8AA 2D0NA 3FB9A 2H3JA 2DM1A 5IXFA 1CSKA 1YHQQ 3CMAT 1PRLC 2QAZA 4Z88A 3L2ZA 2VKNA 5A0LA 1A0NB 1YHQT 1I5OB 4C92B 4BE1A 3MPUB 3ZEHA 1EZZB 2LX7A 2O4XA 1HD3A 1MMAA 1XOVA 3S3OA 3CMEA 4GY5A 3MJXA 2O9VA 1N5ZA 2IIMA 1K9MR 4DEXA 4J9BA 1KJWA 2CZ7B 3BY7A 3I55Q 5CO7A 1AEYA 1WA7A 1ZUKA 3VS6A 1YITQ 1BI0A 2OJ2A 2LX9A 1NYFA 3VRYA 1NJIU 4FW2A 3M0QA 2E3IA 1T3LA 1Q82C 4KRTA 3LH5A 3O5ZA 2CH4A 2FPDA 1YITT 5IAYA 4M75C 4E7JA 1W2BA 4JRPA 3H0IA 3NTKA 2RPNA 3OSSC 4HVWA 1M27C 1N9SA 3R6NA 2D8JA 1WXBA 1X01A 4J9CA 4IUPA 1VQLA 1KQ2A 1D0YA 2R5MA 3HFOA 4JS4A 3THKA 4AFUC 4BY6B 2X4XA 1W2BP 1K9MC 2ZPIB 2X4YA 3OYBA 4N4GA 3V8KA 1JBMA 4BDYA 1JJ2S 4J8OA 4X9DA 3SWNB 3CCUT 2CGHA 3GPLA 4XU2A 2R58A 2YLCA 3CXCA 2EYWA 2CP7A 3M4GA 3TSWA 2NUPB 2L3RA 2QQBA 1AWXA 3CCMA 1JO8A 2CT4A 2JMCA 3E2UA 3URGA 1PWTA 2R5AA 3D7SB 3MEWA 3VS5A 2EGCA 4BE0A 2KXDA 3FRNA 2V8JA 3EH1A 2HAXA 4JRQA 5FRNA 3ULRB 1VUBA 4ME7A 3CXCP 4M7AC 2WSEE 1E6HA 4XU3A 2A08A 2YUNA 1GBQA 4ELYC 3M9QA 3CCLA 5GAN7 2A7YA 4J7FA 4DBHA 4DEYA 4QVCA 2EYYA 3KFVA 2IVWA 1R0BG 4J9HA 3EGDB 4F7UA 1G83A 2D6FA 1D3BA 4F04B 4E7SA 2CZ1B 2LCCA 1RL2A 3X28B 1TOVA 3CCQA 5D6WA 2BE9B 2L3SA 2EJGA 3M0PA 4HCKA 4YTLA 2L8DA 4Q5WA 2RHZA 2EYXA 1TTHB 2OAWA 4M77C 2QEXT 4XTWA 3EG2A 4CC2A 4EMKB 2ZPGB 1I4K1 1PSFA 3OYYA 2Y4YA 2LQ8A 4X34A 1UFFA 1AZGB 2PVOB 4E7HA 4R55A 2IPOB 5CCAA 5CQXA 1VQMA 2HKQB 2KROA 1V29B 1CKAA 2MWPA 2OI3A 1QVFA 3EHRA 2F2WA 2COZA 4FCYA 2YT6A 4E7ZA 3M4YA 4HXJA 1MNEA 1RUWA 2PQWA 2QQSA 1C6VX 3PE0A 4ZN3A 3KXTA 4O6JA 3OSVA 5GAN2 3FC3A 1MHNA 5CQYA 1AD5A 5CIUA 4QVZA 3TQ7P 3VJPA 3O8VA 4C92F 2C0OA 5GMKm 2XHCA 2GFUA 5KYUA 3CMET 2LCSA 2EIFA 3DB4A 3I35A 4OB3B 2B86A 3A5ZB 1K76A 3JCMf 3OBWA 4OF1A 1NPPA 5FW9A 2QTXA 1OU8A 1U8RA 3OW2A 2NUZA 1PSEA 2RH2A 2JUFA 3CBMA 1Y07A 3NTHA 5C0MA 2Y4XA 2L3QA 4E6RA 3M59A 5EG2A 4X1VA 5FRMA 1S72Q 4M7DB 1VQNA 4Y28E 5KYYA 4M75E 5A0GA 1AWWA 4EMHA 1VQLQ 3I9QA 4KT0E 2VXEA 3EG9A 4ZGJB 3OYJA 2AKLA 1VQLT 5KCOA 3OW2P 1BBZA 1IGQA 1QCOA 3VS4A 1XJWB 4M75A 3CPWS 4PFPA 4E7LA 2KRMA 4J9FA 4PJOG 5GAOl 1X43A 2YRDA 4PLIA 2EWNA 2X4WA 3UDCA 2HKNA 1HK9A 2EQIA 3JCMV 2RO0A 1WGSA 4IURA 1J3TA 3GF5A 4M75D 3VYGA 9ATCB 2COWA 4D8KA 1PKTA 2DZ9A 3MP6A 4CRIA 3CCMQ 3HSBA 2NUTA 4ORZA 5EC7A 1ARKA 3HL8A 2KI7A 3CCMT 5DLOA 3OQ5A 1NYGA 1QVFS 2DO3A 2F5KA 3GOXA 1X6BA 1BB9A 3VUBA 3H9NA 2AK5A 2DBMA 3CCLQ 1M9SA 4FYWB 2BZXA 1OX9A 2FZGB 1M2VB 2C0IA 5FU7B 2LTOA 3CCLT 4UC4A 2DEUA 3M0RA 4M7AE 4Y91A 1OX8A 4FIBA 1PG5B 1MUZA 5FU6B 4WTOB 4BI8B 1G3YA 1RAFB 1V1CA 1QCNA 2QG9B 4FT2A 3A8LB 3OYCA 5IHKA 2GNCA 3REAB 4M7AA 2BZYA 4A4GA 3ME9A 1Q7YU 1ZUYA 3CCQQ 1JXMA 5GJWB 1BIAA 1NPRA 3R6OA 1M1FA 3N5BB 3CCQT 4FU6A 3A8GB 1U5SA 3HP9A 4GLKA 1RI9A 3C12A 4PKCC 4M7AD 4E7IA 3MO8A 1RLPC 4GLMA 1YIJA 2RQVA 4Z02A 4QQGA 2CP0A 1GCPA 2K5IA 3X26B 2F5TX 4EDUA 2EAYA 4XTVA 1VQMQ 2L3PA 5GAMe 1KFZA 2QGFB 3BE3A 5DM7R 2EYZA 3MEAA 3CCSA 1VQMT 1D09B 4IIMA 3LGFA 1WXTA 1RADB 2VC8A 3U23A 2QA4Q 3TSZA 2K79A 2RI3A 3X20B 4N0AC 2E5QA 1HYOA 2XD0A 2R57A 1WHJA 2DKGA 2F1LA 4M7DG 1QWEA 4OP0A 1ABQA 3DLLA 3DKMA 4LNPA 1UEBA 3QXEB 2VUBA 4XTXA 2JW4A 3GP8A 1KQSS 2RJCA 2K7AA 5KYXA 8AT1B 2JTMA 4C8QB 1E7OA 3HRUA 2K3XA 4AG1C 1Z9ZA 3JB9F 1QKWA 4A54A 2QASA 4R0KA 1WHHA 3V8JA 1X2KA 4MZTA 4BACA 5LJ5f 3LX7A 2BE7D 3QG1A 1WNLA 2JXBA 2BTTA 3QJ6A 4J9DA 1Q7YR 1WHLA 2EKOA 1GXIE 5GANf 2QQAA 5GAN4 1VQ4A 3A8HB 3QYHB 1YCYA 2EPDA 2QYZA 1M90U 4HVUA 1VQNQ 2JTEA 1QW1A 2KMTA 4XTUA 2ZZDA 1RAIB 1UECA 2KXCA 1SHFA 1VQNT 1NEGA 4MDWA 2DEQA 2O4XB 2KQWA 1BI3A 1K0XA 3A8OB 4JUVA 4ZTJA 2RNAA 4JJCA 1TUCA 4M7DF 1VQ8Q 1TS9A 2FHDA 4OMLA 1R77A 4E7KA 1UDLA 3OYFA 4LN2A 4C92C 4OVAA 3CC7A 2CSQA 1Q7YC 2MWOA 4DOVA 3OMGA 1WJQA 1ABOA 3MP8A 1OV3A 2X35A 2P84A 4M78A 5M9OA 2JOYA 1M1KU 4RTYA 2J7IA 3GNFB 2GBQA 3VS2A 2HCKA 1N6AA 4M78D 5CKDA 3OYNA 3CCJA 3QYGB 3ZFJA 2HBPA 2RQWA 5KYWA 4ZTFA 1YFNA 4OMOA 2DILA 2XIDA 1XTDA 2ATCB 1D0XA 4C5HA 1WFWA 2JZ2A 4N4HA 4PLLA 5L23A 1D1AA 3PVQA 2K2MA 3QWXX 1TSFA 1M90R 4RTWA 2DNUA 1JJ2A 2AZVA 3RMQA 4C0DB 3ER0A 2M02A 2AZSA 1JB0E 2HSPA 4FSXA 3EG0A 1SHGA 1IZ6A 5CKBA 3CCVA 1KIKA 1AVZC 1R0CB 2FL7A 4BY6C 1PM3A 4XQ3A 3RMSA 4K11A 3CMAQ 2P0PA 1MMDA 4HCCA 2RB6A 5GAN3 1JJ2P 1G3TA 4XU1A 1YIJQ 1K4US 3SWNC 3SHWA 2MI6A 4C8QG 4KGVB 4ELZC 1AOJA 1XQHA 5I11A 4CC4B 3M0TA 1YIJT 3GIBA 1ZX6A 1WHKA 3EFSA 1SEMA 2HD0A 1I8FA 3M55A 1I0CA 1UE9A 2QGGA 3T9NA 5GAN5 1M90C 1SRLA 1H8KA 2KR3A 3CCSQ 1BK2A 1M1KR 3AHUA 4J9GA 4F7UB 3EGXA 1HJDA 5DY9A 3H41A 3CCST 1PRMC 1T0HA 2J06A 2Z0WA 2E4HA 2P0QA 3CBPA 1ZBJA 2DYIA 2VGNA 3I56Q 1JXOA 3J7AF 3HRSA 5L8RE 5LJ5j 4PJOC 4BI4A 4B9XA 3META 3I56T 1YBYA 2OX7A 3E9FA 2O31A 2E1HA 2MF2A 2YXYA 1B34A 5GANj 4OMPA 1QMCA 2MPXC 2ZPFB 3P8HA 3INZA 3SD4A 1RAEB 1UHCA 3V7SA 1Y96A 4C8QF 2OTJA 1M1KC 4RMOA 1I1JA 2O2OA 1VQ4Q 2FEIA 1KD1U 1NLOC 2GCXA 2J05A 2HQEA 1VQ4T 4J6YA 2GGRA 3EGUA 4HCZA 3CCUQ 1IRXA 1PD0A 3M0SA 1ZQ1A 1MV3A 4EMKC 1ZSZB 2KYBA 4PK4A 4JDSA 3OYIA 5GMKe 7AT1B 2AT1B 1BYMA 2PZ1A 1QWFA 2KY9A 5CR2A 2DJQA 4JLGA 5KYUB 3UATA 2AKKA 2LDMA 3JCMX 1KG1A 1IHWA 5FROA 3BFMA 2YUOA 5KE2A 2KEAA 2MOXA 4CC3A 3E1SA 2OAUA 1UGSB 4LDYA 4OMMA 3CC7Q 4PL6A 4MMKA 4QQDA 5HK0A 4LE9A 3MCAB 2ZPBB 3RUXA 2RHUA 5J26A 2A36A 3CC7T 4FT4A 2A3LA 2EQUA 4TVRA 3VU3C 4OB2B 2JJ9A 5IHNA 1Z9QA 3QWYA 1WJRA 1FMKA 4KUDK 5KYYB 2MMPA 5FWBA 5AT1B 2CZ0B 3CCJQ 3EG9B 4AT1B 2WSFE 4IKFA 2CSIA 3CCJT 4A53A 5HK3A 1ZA1B 4FL6A 3RDVA 1M1GA 2CP6A 4M75B 1PHTA 4C92G 1KD1R 3CPWA 1YWOA 2XKOC 3M58A 1I07A 3A98A 3CC4A 3UA6A 2QEXQ 2G3RA 2FZKB 4M7DC 3EFRA 4F7UG 3RKWA 3I5SA 1M3BA 3LYIA 3JB9J 3CCVQ 3JCMP 2LQNA 2X9HA 2CP3A 2NUTB 2DLPA 3CCVT 1JEGA 1QLYA 2QQRA 3PT9A 1QCFA 4ANJA 3CPWP 2J6FA 3QUIA 3HFNA 3SB2A 2HL5C 1QVGS 2BIVA 1LJOA 1YJNA 3CCEA 1SKUB 2COYA 4IUUA 4PFZA 5GAOn 4J83A 2RMOA 1KD1C 4BI3A 4FYYB 1N27A 2K5LA 3G4SA 5IHIA 1Q81U 1SSFA 1G3WA 4BE2A 2PUOB 2RF0A 3CMEQ 3VS0A 1VQ9A 1K9AA 3VKIA 2ENMA 4LDWA 2E70A 3C4SA 1QVFP 4NL2A 5AYFA 3SWNA 2E65A 3SEMA 2DBKA 5LJ3h 4A4FA 1ZSGA 4F7UF 2LVMA 1MGQA 5ECAA 1KK7A 5FU7C 1WI7A 4KGZB 1WYXA 3AT1B 4KBMB 1GBRA 2EKHA 2PTKA 4DQ2A 2LQKA 3KBGA 1BU1A 4C0ZA 5FU6C 4RUGA 3DLMA 4HT8A 4PJOE 4RTUA 1AWJA 2ROTA 2M9UA 2QK0A 3CBOA 2DF6A 3OYEA 1GFDA 3OB9A 1NBEB 2OTJT 2YUQA 4PJOA 2DYBA 5IH2A 4O5VA 3QSUA 1VA7A 2E12A 2RK2A 2VWFA 2HQHA 2CP2A 5KE3A 1T0JA 4PJOD 1QVPA 3HRTA 4XTZA 1AZEA 3HPWA 4OB0B 1X69A 2KRNA 2OTLA 4QT7A 3IQLA 3EAEA 3NGPA 2JM9A 3ZBDA 1Q81R 1KQSA 1UGPB 3NPFA 4C5GA 1Q86U 3V7CA 2JMAA 2LNHB 4RG8A 2LRQA 4L6V5 2D0QB 5IT9E 2YRCA 2EJ9A 3JSCA 5GAMf 2FO0A 2AIRB 4IIOA 3UF4A 3WVDB 5KH6A 2CP5A 5I22A 1RACB 1KQSP 1X2QA 2HBWA 1QQJA 4C8QC 1YJ9A 2LT4A 4QQ6A 2P4TA 5HY6A 2LJ1A 2LNVA 2H3EB 1K0SA 3OYKA 3L2VA 3JCMQ 2KGTA 4ZGEB 4JJNK 2O01E 1Q81C 2QDLA 2H8HA 3S6WA 2ESWA 1EIFA 1M3CA 2PU9B 2KDSA 2LC4A 3CC4Q 1O9SA 3L2WA 4A4KA 2EQMA 3PIPA 3JB9G 3WXMB 1K8AU 2YDLA 4NS5A 2GF7A 3CC4T 4IUVA 5KCHA 1JQQA 4M4ZA 3UPUA 4M75F 1YI2A 1SSHA 3EFOA 4R56A 3F70A 2GFAA 4CI0C 4M78B 3BW1A 3JCMd 4D6WA 4M7DE 1Q86R 4M77E 1H92A 1I5LA 1SG5A 2LZ6B 4AFSC 4ATOA 1ZA2B 2CH4W 2DMOA 5FLXE 2BUDA 1YJNQ 1IGUA 2YHTA 1VQOA 1VIEA 5GAOm 5GANh 4M7DA 1MMGA 5GAN6 1YJNT 3CCET 3KUFA 3QKJA 4M77A 3V8LA 4J9EA 1N9RA 4C0GA 3OYDA 4J7IA 1BI1A 1OYXA 3FDRA 4J9IA 2VGMA 1ACMB 4M7DD 1VQ9Q 3G4ST 2MCNA 1IO6A 3L2RA 1U3OA 2JT4A 2DD4A 4M77D 3JCMg 2ZPEB 5D6YA 5LJ3d 1VQ9T 2A0FB 3I55A 1WQWA 2E5KA 3OMCA 1TG0A 4PFOA 3CC2A 2ZCFB 3FJ5A 2I2LA 2DL7A 3JCMc 1Q86C 2VV5A 1HXDA 1WLPB 4X9CA 1IREB 3EH2A 3NTIA 2FYKA 4F17A 2CREA 2HL3A 2GTOA 2MIOA 3OYMA 1EX4A 1K8AR 1MNDA 4M7AF 4C0DC 2ABLA 3CCRA 4E47A 1BCOA 1VQKA 5LJ3g 1WZOA 4OB1B 3JRZA 5A2QE 1WX6A 2V26A 2EBPA 4JZ3A 1M4ZA 3FJPA 2M0OA 3MEVA 2PNIA 1OZ2A 3PTAA 2ZAEA 4AFQC 4J6WA 1D1BA 2DL4A 2RHIA 2V1RA 2E64A 3V7RA 2X3WD 1GL5A 3RIRA 1UGRB 3UWNA 2VYTA 1R8OB 4HA8A 3MEUA 1AT1B 4JJDA 2OTLT 1K8AC 2VASA 5GAMj 3OS0A 1B7TA 2F2XA 4QVDA 2I0NA 1OQKA 2GQIA 1C0MA 4OGEA 5CKEA 1QP2A 5I21A 4VUBA 3OY9A 1Y96B 2FPFA 2JNGA 2KNBB 3LWHA 4Y92A 2RN8A 5GAOq 5GAOr 2F69A 3EG3A 3I5RA 2DETA 3ASKA 1TXQA 1H641 3HHTB 1YJ9Q 1KHCA 1MV0B 3FEOA 2KT8A 4M78G 4PJMA 4QW2A 1FWZA 3QJYA 3REBB 1YJ9T 1U06A 1VOMA 4C8QE 4RTZA 3GLXA 3G6EA 2LMJA 2K3YA 3CEYA 1VQ5A 3HKSA 4OMNA 2KRSA 3CQTA 3VS7A 2K4YA 1WXUA 2CKKA 2JTFA 1W70A 1YN8A 2XU8A 3RERA 4ESRA 2YSQA 2P4RA 1YI2Q 4EMGA 1ZSZC 2XDPA 5GMKi 4NOYA 1YI2T 1PNJA 2O88A 1VYUA 2ECZA 2JVVA 4B9WA 1EFNA 3OS1A 1HSQA 2DJZA 3P8BB 2BZ8A 1AHJB 2EQKA 5GANd 5J3BA 1VQPA 3S3NA 1VQOQ 1D3BB 5DLQE 1WHMA 2KE9A 4M78F 1OU9A 1X27A 1BIBA 1VQOT 4PJLA 3P8DA 5CAIA 1QP3A 2KBTA 3G71A 2RA2A 4HKEA 3HTRA 2MYSA 2DL8A 1NM7A 1UJ0A 3M57A 1VQ7A 4CC7A 5LJ5g 2GTJA 1NEBA 4PJNA 2DVJA 3VV0A 1W4SA 2WACA 2IG0A 4D8DA 4Z89A 4IUQA 3RBBB 5GANg 4C5IA 3M56A 3I55T 2EJFA 3E9GA 3CC2Q 2E41A 4N0AA 2ZPHB 1X75C 2DL3A 2EGEA 1V76A 1G5VA 3CC2T 2XDBA 1IHVA 5I2MA 1QVGA 3CCRQ 2KYMA 1RAHB 2Y90A 1S72A 1FYNA 3GNGA 3CCRT 1VQKQ 1OPKA 2M16A 2O9SA 5IN1A 1TWBA 3NMZC 4A63B 1VQKT 4MMLA 2GQVA 1UJYA 2M51A 2KK4A 3H0HA 2L0AA 2QDYB 5HKCA 1YJWA 3EHQA 3SFMA 1XNIA 2FPEA 3JB9I 1QVGP 1SF9A 1E6GA 4RTVA 1LVKA 1NZ9A 3NFCA 2DX1A 4DBRA 1LPLA 4L59A 4V2SA 3RESA 2RK1A 2G6FX 2B8AA 1PC0A 5HCKA 4LD6A 3TEEA 1MMNA 5GMKl 2L5QA 3X25B 2XMFA 3E19A 1ZHIA 4C92E 4QKUA 4JLIA 2DXUA 2HDAA 2QTVA 2DVEA 2PVDB 3RNJA 2DTOA 2X3XD 1P92A 2DAQA 4F7UE 4C92A 1NJIR 1UGVA 3S3MA 4PJOB 2D8HA 3M0UA 1RAAB 4C92D 1TUDA 2FZCB 2K3BA 2M1HA 2FRYA 5LL6S 2LJ0A 3TCJA 1Y57A 2E3HA 1M3AA 1RLQC 1X6GA 3G6EQ 2EFIA 4ZNXA 1B3QA 1M30A 3Q1JA 1IXDA 1VQ5Q 2XG8D 3M53A 3BDUA 3G6ET 2QXFA 4LDXA 1LCKA 2CUDA 3TU4K 1W2BS 3H8ZA 1VQ5T 1Y7XA 1KC8U 1DJ7B 2HEQA 3JCMh 2ZGWA 5CKHA 1G3SA 1NJIC 3RKYA 3MP1A 2J6KA 2RM4A 1KQ1A 5GMKj 3QPHA 2JM8A 1W6XA 5CVIA 1VQ6A 3LWIA 1VQPQ 2DXCA 2JS0A 4J5YA 3PMTA 5D6XA 4BUGA 2C06A 2QA4A 1UTIA 1VQPT 1SRMA 1X6OA 2NYSA 1N8RU 3LGLA 3CXCS 2W0ZA 1ZSZA 4M7AB 3G71Q 4C0FA 2HNIA 3QDFA 1VQ7Q 1YCSB 2NUPA 3G71T 4PNOA 1D0ZA 2HMAA 4DBQA 2CZ6B 3QDRB 4MZPA 3CD6A 2LJ3A 1VQ7T 1OOTA 8ATCB 1TH7A 2DK3A 2WSCE 1H3HA 1BKBA 3EFOB 1W1FA 1M8VA 1LOJA 2PUKB 2ED1A 2OTJQ 4JPBW 3L2UA 2DFUA 1UHFA 2CS7A 2KAFA 2DRMA 1GRIA 2QI2A 3QZ9B 1CKBA 4LXCA 3QO3A 3PMIA 1KC8R 4LDVA 3QIIA 6AT1B 2RJFA 3C0CA 2RQTA 1ZBXA 2X51A 4A4EA 5GAMh 3EGDA 2DTIA 2V8IA 3FIFA 4IUTA 3M5AA 4M77B 4KH0B 3WVEB 1S72T 1JU5C 3VRZA 1RABB 4KGXB 2LT1A 1GCQC 3SDZA 2RD1A 1OI1A 4M78C 2W10A 2M0YA 2RJEA 4MZMA 5KYXB 1YJWQ 2E6ZA 4ZN1A 1U1TA 2RI5A 2DXBA 5LJ3f 1VQ8A 1VIFA 3UA7A 1UG1A 2EW3A 1YJWT 1OULA 2D9TA 2PVGB 1S1NA 2E10A 3MHXA 2VXFA 4M75G 1M8MA 1O75A 3JAME 3JV3A 4F16A 1N8RR 2C0TA 5CK9A 3TVTA 4EMKA 2ROLA 3GBQA 2DXTA 2DD5A 4AMCA 3JCMe 3PGGA 1FX7A 4NL3A 1KC8C 1LNXA 4AFZC 5C6SA 3UT1A 3CPFA 1M5Q1 2E6NA 3LLRA 4WCIA 1NLPC 1UB4A 4J6XA 2D1XA 1VYTA 3FLGA 1F1BB 4N4IA 3TREA 3PIOA 4DA4A 1TU0B 1KSWA 2EYQA 2XI9A 1QKXA 2JN0A 2FVUA 1OEBA 3VYHB 4RTTA 2QQ9A 4JRIA 1N8RC 4HVVA 5LJ3e 2YWWA 4FW1A 3JB9D 2K5FA 4PJOF 3QHSA 2JS2A 2RHXA 1Q95G 3QBYA 2FG0A 4RKUE 5GJVB 1RAGB 2CT3A 4RCBA 2EGAA 2AHJB 3OYLA 3OA6A 3OW2S 1G2BA 1OPLA 2EVRA 2KT1A 4F14A 4M7AG 5GAOp 4E2FB 1UGQB 4P5NA 3CMAA 4OMQA 4EPCA 4FYXB 5LJ5h 4JRKA 4II1A 1WPYA 1YHQA 4LDUA 2RI2A 1TUGB 1AWOA 3G1JA 3CCEQ 1PCXA 2BKDN 2DIGA 4FSSA 5KYWB 4FM4B 4RTXA 3MKDA 3VS3A 3J81E 1M2OA 4EIKA 2RJDA 5D7UA 4XTYA 2KSSA 4B6MA 2A28A 3G4SQ 5CKFA 1VQ6Q 5J39A 1C1AA 1U1SA 1VQ6T 1K73U 2L89A 4C5EA 3OYGA 2QA4T 1SPKA 2A37A 1WHGA 2DRKA 3I56A 4JS5A
chains in the Genus database with same CATH topology
2P4RA 3QWYA 4AG2C 2CDTA 3VS4A 1FMKA 2SEMA 1PKSA 2KRMA 5FWBA 4J9FA 1PNJA 1X43A 2O88A 1VYUA 1ZLMA 2EQIA 2ECZA 1K1ZA 4JZ4A 2CSIA 1EFNA 1J3TA 1HSQA 2BZ8A 2FRWA 1PHTA 1YWOA 4D8KA 1PKTA 4JJBA 1I07A 3A98A 1B07A 2KE9A 1X27A 3UA6A 1VYVA 4ORZA 5EC7A 1ARKA 3I5SA 1M3BA 2KBTA 2DL8A 1NM7A 1NYGA 1UJ0A 2LQNA 2LQWA 2K9GA 1X6BA 4CC7A 1BB9A 2GTJA 2DLPA 1NEBA 2AK5A 1JEGA 2DBMA 1QLYA 1T3SA 1QCFA 2DVJA 2J6FA 2BZXA 3PVLA 2C0IA 4D8DA 4Z89A 1YNZA 3RBBB 2F2VA 3M0RA 2DL3A 2EGEA 2NWMA 4LUDA 4LUEA 1MUZA 2RMOA 3H0FA 2ED0A 1WIEA 1V1CA 5IHKA 5IHIA 2GNCA 2VVKA 3REAB 3EG1A 2BZYA 2RF0A 2KYMA 1ZUYA 1JXMA 3VS0A 5GJWB 1FYNA 2L2PA 1GCQA 1OPKA 2O9SA 1K9AA 2LP5A 3NMZC 4A63B 2RQRA 2ENMA 1U5SA 1RI9A 3SEMA 3NHNA 2DL5A 2M51A 1UJYA 3H0HA 1ZUUA 1RLPC 2DBKA 4GLMA 2L0AA 1ZSGA 2RQVA 1GFCA 1GCPA 3EHQA 1WDXA 2YUPA 3VS1A 5ECAA 5FWCA 2FPEA 1WI7A 1WYXA 1E6GA 4RTVA 1GBRA 2EKHA 2PTKA 2CUBA 2K6DA 2L3PA 1BU1A 1KFZA 2DA9A 2J6OA 2DX1A 2EYZA 4RUGA 2SRCA 4RTUA 4IIMA 3ZL7C 1AWJA 1WXTA 2ROTA 3U23A 4GBQA 2G6FX 3TSZA 2K79A 5HCKA 1NG2A 2DF6A 2XMFA 1GFDA 1Y0MA 1YWPA 2YUQA 2HDAA 2DYBA 5IH2A 1QWEA 1ABQA 5IXBA 1VA7A 4LNPA 2VWFA 2JW4A 2RQUA 2V1QA 1UUEA 2K7AA 3RNJA 2X3XD 1E7OA 2DE0X 1YP5A 4AG1C 1T0JA 1UGVA 1Z9ZA 4Z8AA 1QKWA 2D0NA 4R0KA 1AZEA 5IXFA 2DM1A 1X2KA 1CSKA 1X69A 2KRNA 2D8HA 1PRLC 3M0UA 4QT7A 4Z88A 2VKNA 3IQLA 3NGPA 2JM9A 1A0NB 2JXBA 1TUDA 2BTTA 4J9DA 3NPFA 2K3BA 2FRYA 2JMAA 2LJ0A 2LX7A 2LNHB 1Y57A 1M3AA 1RLQC 2EPDA 1X6GA 4ZNXA 1B3QA 1HD3A 1M30A 1XOVA 4HVUA 2JTEA 2O9VA 1UECA 2IIMA 1LCKA 1N5ZA 2CUDA 2KXCA 2FO0A 1SHFA 4DEXA 4J9BA 1KJWA 1NEGA 4IIOA 3UF4A 5I22A 1AEYA 2HEQA 1X2QA 2HBWA 1K0XA 1WA7A 1ZUKA 3VS6A 2RNAA 4JJCA 1TUCA 2OJ2A 1NYFA 3VRYA 3M0QA 2LJ1A 1T3LA 4OMLA 4KRTA 3LH5A 3O5ZA 2CH4A 2FPDA 2J6KA 1K0SA 1UDLA 3H0IA 2RPNA 2KGTA 4HVWA 1M27C 2QDLA 4LN2A 2H8HA 2JM8A 3R6NA 2ESWA 1W6XA 2CSQA 2D8JA 1WXBA 2JS0A 1M3CA 1ABOA 4J9CA 1UTIA 1OV3A 1SRMA 2YDLA 2W0ZA 4RTYA 2J7IA 3THKA 4AFUC 2GBQA 1JQQA 4M4ZA 3VS2A 1SSHA 1YCSB 2HCKA 2RQWA 2LJ3A 1OOTA 4OMOA 2DILA 2EYWA 1H92A 1WFWA 5L23A 2LZ6B 4AFSC 1H3HA 3TSWA 1W1FA 2CH4W 3PVQA 2DMOA 2K2MA 3QWXX 2ED1A 4RTWA 2DNUA 1AWXA 4JPBW 2AZVA 1JO8A 2CT4A 1UHFA 2JMCA 4J9EA 1PWTA 2DRMA 1GRIA 2AZSA 1CKBA 3VS5A 2HSPA 2EGCA 2KXDA 3C0CA 2RQTA 4J9IA 3EG0A 1SHGA 1KIKA 1AVZC 3ULRB 2MCNA 1IO6A 1U3OA 2JT4A 1E6HA 2A08A 2YUNA 1GBQA 4K11A 1JU5C 3VRZA 1GCQC 4DEYA 2EYYA 2E5KA 3KFVA 1TG0A 1K4US 2W10A 2M0YA 4J9HA 3SHWA 3FJ5A 1AOJA 2DL7A 5I11A 4CC4B 3M0TA 3UA7A 1WLPB 1G83A 1UG1A 1ZX6A 2EW3A 1S1NA 1SEMA 4F17A 2CREA 1M8MA 2GTOA 2MIOA 1I0CA 1UE9A 3JV3A 4F16A 1SRLA 1H8KA 2C0TA 2KR3A 1BK2A 4J9GA 2ABLA 3TVTA 1HJDA 2ROLA 3GBQA 3H41A 1PRMC 1T0HA 2J06A 2L3SA 3M0PA 4HCKA 1ZBJA 4AFZC 2EYXA 1JXOA 2OAWA 1WX6A 3EG2A 4CC2A 2EBPA 4JZ3A 4WCIA 1NLPC 2O31A 2D1XA 1VYTA 1UFFA 1AZGB 2PNIA 4AFQC 1KSWA 2DL4A 2V1RA 4OMPA 1QKXA 2X3WD 1GL5A 1OEBA 4RTTA 2KROA 1CKAA 2OI3A 3EHRA 2F2WA 4JJDA 1UHCA 2YT6A 4HVVA 4HXJA 1RUWA 1I1JA 3PE0A 2O2OA 2JS2A 2FEIA 2F2XA 1NLOC 2I0NA 2GQIA 2FG0A 2J05A 1AD5A 5GJVB 2CT3A 2GGRA 3EGUA 2EGAA 2FPFA 2KNBB 3M0SA 1G2BA 1OPLA 2C0OA 2EVRA 2KT1A 4Y92A 1MV3A 4F14A 2LCSA 2RN8A 2KYBA 3I35A 4OMQA 3EG3A 3I5RA 2B86A 2PZ1A 1K76A 1AWOA 1MV0B 1QWFA 2KT8A 5FW9A 2DJQA 3REBB 4FSSA 2NUZA 2AKKA 3UATA 1U06A 4RTXA 3VS3A 4EIKA 2YUOA 2KEAA 2MOXA 4CC3A 2A28A 2L3QA 4E6RA 4OMMA 4RTZA 4X1VA 2LMJA 4LE9A 2A36A 4OMNA 1AWWA 2KRSA 3CQTA 3VS7A 3I9QA 1WXUA 1W70A 1YN8A 1SPKA 2A37A 2DRKA 2AKLA 5IHNA 1BBZA 1Z9QA 4ESRA 2YSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4R A;  3QWY A;  4AG2 C;  2CDT A;  3VS4 A;  1FMK A;  2SEM A;  1PKS A;  2KRM A;  5FWB A;  4J9F A;  1PNJ A;  1X43 A;  2O88 A;  1VYU A;  1ZLM A;  2EQI A;  2ECZ A;  1K1Z A;  4JZ4 A;  2CSI A;  1EFN A;  1J3T A;  1HSQ A;  2BZ8 A;  2FRW A;  1PHT A;  1YWO A;  4D8K A;  1PKT A;  4JJB A;  1I07 A;  3A98 A;  1B07 A;  2KE9 A;  1X27 A;  3UA6 A;  1VYV A;  4ORZ A;  5EC7 A;  1ARK A;  3I5S A;  1M3B A;  2KBT A;  2DL8 A;  1NM7 A;  1NYG A;  1UJ0 A;  2LQN A;  2LQW A;  2K9G A;  1X6B A;  4CC7 A;  1BB9 A;  2GTJ A;  2DLP A;  1NEB A;  2AK5 A;  1JEG A;  2DBM A;  1QLY A;  1T3S A;  1QCF A;  2DVJ A;  2J6F A;  2BZX A;  3PVL A;  2C0I A;  4D8D A;  4Z89 A;  1YNZ A;  3RBB B;  2F2V A;  3M0R A;  2DL3 A;  2EGE A;  2NWM A;  4LUD A;  4LUE A;  1MUZ A;  2RMO A;  3H0F A;  2ED0 A;  1WIE A;  1V1C A;  5IHK A;  5IHI A;  2GNC A;  2VVK A;  3REA B;  3EG1 A;  2BZY A;  2RF0 A;  2KYM A;  1ZUY A;  1JXM A;  3VS0 A;  5GJW B;  1FYN A;  2L2P A;  1GCQ A;  1OPK A;  2O9S A;  1K9A A;  2LP5 A;  3NMZ C;  4A63 B;  2RQR A;  2ENM A;  1U5S A;  1RI9 A;  3SEM A;  3NHN A;  2DL5 A;  2M51 A;  1UJY A;  3H0H A;  1ZUU A;  1RLP C;  2DBK A;  4GLM A;  2L0A A;  1ZSG A;  2RQV A;  1GFC A;  1GCP A;  3EHQ A;  1WDX A;  2YUP A;  3VS1 A;  5ECA A;  5FWC A;  2FPE A;  1WI7 A;  1WYX A;  1E6G A;  4RTV A;  1GBR A;  2EKH A;  2PTK A;  2CUB A;  2K6D A;  2L3P A;  1BU1 A;  1KFZ A;  2DA9 A;  2J6O A;  2DX1 A;  2EYZ A;  4RUG A;  2SRC A;  4RTU A;  4IIM A;  3ZL7 C;  1AWJ A;  1WXT A;  2ROT A;  3U23 A;  4GBQ A;  2G6F X;  3TSZ A;  2K79 A;  5HCK A;  1NG2 A;  2DF6 A;  2XMF A;  1GFD A;  1Y0M A;  1YWP A;  2YUQ A;  2HDA A;  2DYB A;  5IH2 A;  1QWE A;  1ABQ A;  5IXB A;  1VA7 A;  4LNP A;  2VWF A;  2JW4 A;  2RQU A;  2V1Q A;  1UUE A;  2K7A A;  3RNJ A;  2X3X D;  1E7O A;  2DE0 X;  1YP5 A;  4AG1 C;  1T0J A;  1UGV A;  1Z9Z A;  4Z8A A;  1QKW A;  2D0N A;  4R0K A;  1AZE A;  5IXF A;  2DM1 A;  1X2K A;  1CSK A;  1X69 A;  2KRN A;  2D8H A;  1PRL C;  3M0U A;  4QT7 A;  4Z88 A;  2VKN A;  3IQL A;  3NGP A;  2JM9 A;  1A0N B;  2JXB A;  1TUD A;  2BTT A;  4J9D A;  3NPF A;  2K3B A;  2FRY A;  2JMA A;  2LJ0 A;  2LX7 A;  2LNH B;  1Y57 A;  1M3A A;  1RLQ C;  2EPD A;  1X6G A;  4ZNX A;  1B3Q A;  1HD3 A;  1M30 A;  1XOV A;  4HVU A;  2JTE A;  2O9V A;  1UEC A;  2IIM A;  1LCK A;  1N5Z A;  2CUD A;  2KXC A;  2FO0 A;  1SHF A;  4DEX A;  4J9B A;  1KJW A;  1NEG A;  4IIO A;  3UF4 A;  5I22 A;  1AEY A;  2HEQ A;  1X2Q A;  2HBW A;  1K0X A;  1WA7 A;  1ZUK A;  3VS6 A;  2RNA A;  4JJC A;  1TUC A;  2OJ2 A;  1NYF A;  3VRY A;  3M0Q A;  2LJ1 A;  1T3L A;  4OML A;  4KRT A;  3LH5 A;  3O5Z A;  2CH4 A;  2FPD A;  2J6K A;  1K0S A;  1UDL A;  3H0I A;  2RPN A;  2KGT A;  4HVW A;  1M27 C;  2QDL A;  4LN2 A;  2H8H A;  2JM8 A;  3R6N A;  2ESW A;  1W6X A;  2CSQ A;  2D8J A;  1WXB A;  2JS0 A;  1M3C A;  1ABO A;  4J9C A;  1UTI A;  1OV3 A;  1SRM A;  2YDL A;  2W0Z A;  4RTY A;  2J7I A;  3THK A;  4AFU C;  2GBQ A;  1JQQ A;  4M4Z A;  3VS2 A;  1SSH A;  1YCS B;  2HCK A;  2RQW A;  2LJ3 A;  1OOT A;  4OMO A;  2DIL A;  2EYW A;  1H92 A;  1WFW A;  5L23 A;  2LZ6 B;  4AFS C;  1H3H A;  3TSW A;  1W1F A;  2CH4 W;  3PVQ A;  2DMO A;  2K2M A;  3QWX X;  2ED1 A;  4RTW A;  2DNU A;  1AWX A;  4JPB W;  2AZV A;  1JO8 A;  2CT4 A;  1UHF A;  2JMC A;  4J9E A;  1PWT A;  2DRM A;  1GRI A;  2AZS A;  1CKB A;  3VS5 A;  2HSP A;  2EGC A;  2KXD A;  3C0C A;  2RQT A;  4J9I A;  3EG0 A;  1SHG A;  1KIK A;  1AVZ C;  3ULR B;  2MCN A;  1IO6 A;  1U3O A;  2JT4 A;  1E6H A;  2A08 A;  2YUN A;  1GBQ A;  4K11 A;  1JU5 C;  3VRZ A;  1GCQ C;  4DEY A;  2EYY A;  2E5K A;  3KFV A;  1TG0 A;  1K4U S;  2W10 A;  2M0Y A;  4J9H A;  3SHW A;  3FJ5 A;  1AOJ A;  2DL7 A;  5I11 A;  4CC4 B;  3M0T A;  3UA7 A;  1WLP B;  1G83 A;  1UG1 A;  1ZX6 A;  2EW3 A;  1S1N A;  1SEM A;  4F17 A;  2CRE A;  1M8M A;  2GTO A;  2MIO A;  1I0C A;  1UE9 A;  3JV3 A;  4F16 A;  1SRL A;  1H8K A;  2C0T A;  2KR3 A;  1BK2 A;  4J9G A;  2ABL A;  3TVT A;  1HJD A;  2ROL A;  3GBQ A;  3H41 A;  1PRM C;  1T0H A;  2J06 A;  2L3S A;  3M0P A;  4HCK A;  1ZBJ A;  4AFZ C;  2EYX A;  1JXO A;  2OAW A;  1WX6 A;  3EG2 A;  4CC2 A;  2EBP A;  4JZ3 A;  4WCI A;  1NLP C;  2O31 A;  2D1X A;  1VYT A;  1UFF A;  1AZG B;  2PNI A;  4AFQ C;  1KSW A;  2DL4 A;  2V1R A;  4OMP A;  1QKX A;  2X3W D;  1GL5 A;  1OEB A;  4RTT A;  2KRO A;  1CKA A;  2OI3 A;  3EHR A;  2F2W A;  4JJD A;  1UHC A;  2YT6 A;  4HVV A;  4HXJ A;  1RUW A;  1I1J A;  3PE0 A;  2O2O A;  2JS2 A;  2FEI A;  2F2X A;  1NLO C;  2I0N A;  2GQI A;  2FG0 A;  2J05 A;  1AD5 A;  5GJV B;  2CT3 A;  2GGR A;  3EGU A;  2EGA A;  2FPF A;  2KNB B;  3M0S A;  1G2B A;  1OPL A;  2C0O A;  2EVR A;  2KT1 A;  4Y92 A;  1MV3 A;  4F14 A;  2LCS A;  2RN8 A;  2KYB A;  3I35 A;  4OMQ A;  3EG3 A;  3I5R A;  2B86 A;  2PZ1 A;  1K76 A;  1AWO A;  1MV0 B;  1QWF A;  2KT8 A;  5FW9 A;  2DJQ A;  3REB B;  4FSS A;  2NUZ A;  2AKK A;  3UAT A;  1U06 A;  4RTX A;  3VS3 A;  4EIK A;  2YUO A;  2KEA A;  2MOX A;  4CC3 A;  2A28 A;  2L3Q A;  4E6R A;  4OMM A;  4RTZ A;  4X1V A;  2LMJ A;  4LE9 A;  2A36 A;  4OMN A;  1AWW A;  2KRS A;  3CQT A;  3VS7 A;  3I9Q A;  1WXU A;  1W70 A;  1YN8 A;  1SPK A;  2A37 A;  2DRK A;  2AKL A;  5IHN A;  1BBZ A;  1Z9Q A;  4ESR A;  2YSQ A; 
#chains in the Genus database with same CATH topology
 5GAN 8;  4AG2 C;  1YIT A;  4KUL A;  2CDT A;  4M77 G;  2CYZ B;  2SEM A;  1PKS A;  3RKX A;  2HQX A;  2EQJ A;  2DIQ A;  2KVQ G;  3CD6 Q;  3QZ5 B;  1ZLM A;  1K1Z A;  4JZ4 A;  4PJJ A;  3X24 B;  3CD6 T;  3J80 E;  4XU0 A;  3JB9 H;  2FRW A;  5A0D A;  2K57 A;  1FXX A;  4JJB A;  3A1P A;  1B07 A;  3L1A A;  2RHY A;  4BDZ A;  2VB6 A;  3VUZ A;  1VYV A;  4MDX A;  5GAM d;  3BDL A;  4RCC A;  1D1C A;  2MK5 A;  2YLB A;  3A8M B;  4XAX B;  3EGX B;  2MAM A;  1M2V A;  4OMF B;  2LQW A;  2K9G A;  3CCU A;  3OS5 A;  5LJ3 j;  3H6Z A;  1WJS A;  1FMV A;  1T3S A;  1JRI A;  3PFS A;  3PVL A;  1BI2 A;  3OBY A;  3PNW C;  1YNZ A;  2OTL Q;  2V8K A;  2P0K A;  2F2V A;  3RR6 A;  3JCM W;  3L2Q A;  2NWM A;  4LUD A;  1H3Z A;  4LUE A;  4M77 F;  1IB8 A;  3OYH A;  1Q82 U;  1B34 B;  1I81 A;  1K73 R;  3H0F A;  1Y71 A;  1VQ8 T;  2ED0 A;  1WIE A;  2YRV A;  2FB7 A;  5GAM g;  3G7Z A;  3OS2 A;  4M78 E;  1OZ3 A;  2XDD A;  2VVK A;  3EG1 A;  4BD3 A;  2X4J A;  4DOW A;  2HSE B;  1G8X A;  1WQ7 A;  2L2P A;  5LJ5 e;  5I2S A;  1GCQ A;  2LCL A;  1PD1 A;  2LP5 A;  4DBF A;  3M54 A;  3LW5 E;  2RQR A;  2XK0 A;  4FYV B;  1KHI A;  3NHN A;  2DL5 A;  1ZUU A;  4KH1 B;  5GAN e;  4BB7 A;  1GFC A;  1K9M U;  1WDX A;  2YUP A;  3VS1 A;  3C95 A;  5FWC A;  2HZY A;  4L5G A;  2CUB A;  2K6D A;  1BCM A;  3JCM b;  4LD9 K;  4WF2 A;  2DA9 A;  2J6O A;  2XIC A;  4KUI A;  2DZC A;  4OGC A;  3OYA A;  4HCB A;  2SRC A;  3ZL7 C;  1K73 C;  4GBQ A;  2K2V A;  3DB3 A;  3C94 A;  2DPP B;  5GMK h;  1NG2 A;  4C8Q A;  4RG2 A;  2NLU A;  2QEX A;  1Y0M A;  3JCM J;  1YWP A;  1RI0 A;  5IXB A;  3LH0 A;  5KYN A;  3L42 A;  2RQU A;  2V1Q A;  1UUE A;  5LJ5 d;  4C8Q D;  4XK8 E;  4HT9 A;  2DE0 X;  1YP5 A;  1FMW A;  4A4H A;  1NE8 A;  2DTH A;  2DER A;  4ZGD B;  1Q82 R;  4Z8A A;  2D0N A;  3FB9 A;  2H3J A;  2DM1 A;  5IXF A;  1CSK A;  1YHQ Q;  3CMA T;  1PRL C;  2QAZ A;  4Z88 A;  3L2Z A;  2VKN A;  5A0L A;  1A0N B;  1YHQ T;  1I5O B;  4C92 B;  4BE1 A;  3MPU B;  3ZEH A;  1EZZ B;  2LX7 A;  2O4X A;  1HD3 A;  1MMA A;  1XOV A;  3S3O A;  3CME A;  4GY5 A;  3MJX A;  2O9V A;  1N5Z A;  2IIM A;  1K9M R;  4DEX A;  4J9B A;  1KJW A;  2CZ7 B;  3BY7 A;  3I55 Q;  5CO7 A;  1AEY A;  1WA7 A;  1ZUK A;  3VS6 A;  1YIT Q;  1BI0 A;  2OJ2 A;  2LX9 A;  1NYF A;  3VRY A;  1NJI U;  4FW2 A;  3M0Q A;  2E3I A;  1T3L A;  1Q82 C;  4KRT A;  3LH5 A;  3O5Z A;  2CH4 A;  2FPD A;  1YIT T;  5IAY A;  4M75 C;  4E7J A;  1W2B A;  4JRP A;  3H0I A;  3NTK A;  2RPN A;  3OSS C;  4HVW A;  1M27 C;  1N9S A;  3R6N A;  2D8J A;  1WXB A;  1X01 A;  4J9C A;  4IUP A;  1VQL A;  1KQ2 A;  1D0Y A;  2R5M A;  3HFO A;  4JS4 A;  3THK A;  4AFU C;  4BY6 B;  2X4X A;  1W2B P;  1K9M C;  2ZPI B;  2X4Y A;  3OYB A;  4N4G A;  3V8K A;  1JBM A;  4BDY A;  1JJ2 S;  4J8O A;  4X9D A;  3SWN B;  3CCU T;  2CGH A;  3GPL A;  4XU2 A;  2R58 A;  2YLC A;  3CXC A;  2EYW A;  2CP7 A;  3M4G A;  3TSW A;  2NUP B;  2L3R A;  2QQB A;  1AWX A;  3CCM A;  1JO8 A;  2CT4 A;  2JMC A;  3E2U A;  3URG A;  1PWT A;  2R5A A;  3D7S B;  3MEW A;  3VS5 A;  2EGC A;  4BE0 A;  2KXD A;  3FRN A;  2V8J A;  3EH1 A;  2HAX A;  4JRQ A;  5FRN A;  3ULR B;  1VUB A;  4ME7 A;  3CXC P;  4M7A C;  2WSE E;  1E6H A;  4XU3 A;  2A08 A;  2YUN A;  1GBQ A;  4ELY C;  3M9Q A;  3CCL A;  5GAN 7;  2A7Y A;  4J7F A;  4DBH A;  4DEY A;  4QVC A;  2EYY A;  3KFV A;  2IVW A;  1R0B G;  4J9H A;  3EGD B;  4F7U A;  1G83 A;  2D6F A;  1D3B A;  4F04 B;  4E7S A;  2CZ1 B;  2LCC A;  1RL2 A;  3X28 B;  1TOV A;  3CCQ A;  5D6W A;  2BE9 B;  2L3S A;  2EJG A;  3M0P A;  4HCK A;  4YTL A;  2L8D A;  4Q5W A;  2RHZ A;  2EYX A;  1TTH B;  2OAW A;  4M77 C;  2QEX T;  4XTW A;  3EG2 A;  4CC2 A;  4EMK B;  2ZPG B;  1I4K 1;  1PSF A;  3OYY A;  2Y4Y A;  2LQ8 A;  4X34 A;  1UFF A;  1AZG B;  2PVO B;  4E7H A;  4R55 A;  2IPO B;  5CCA A;  5CQX A;  1VQM A;  2HKQ B;  2KRO A;  1V29 B;  1CKA A;  2MWP A;  2OI3 A;  1QVF A;  3EHR A;  2F2W A;  2COZ A;  4FCY A;  2YT6 A;  4E7Z A;  3M4Y A;  4HXJ A;  1MNE A;  1RUW A;  2PQW A;  2QQS A;  1C6V X;  3PE0 A;  4ZN3 A;  3KXT A;  4O6J A;  3OSV A;  5GAN 2;  3FC3 A;  1MHN A;  5CQY A;  1AD5 A;  5CIU A;  4QVZ A;  3TQ7 P;  3VJP A;  3O8V A;  4C92 F;  2C0O A;  5GMK m;  2XHC A;  2GFU A;  5KYU A;  3CME T;  2LCS A;  2EIF A;  3DB4 A;  3I35 A;  4OB3 B;  2B86 A;  3A5Z B;  1K76 A;  3JCM f;  3OBW A;  4OF1 A;  1NPP A;  5FW9 A;  2QTX A;  1OU8 A;  1U8R A;  3OW2 A;  2NUZ A;  1PSE A;  2RH2 A;  2JUF A;  3CBM A;  1Y07 A;  3NTH A;  5C0M A;  2Y4X A;  2L3Q A;  4E6R A;  3M59 A;  5EG2 A;  4X1V A;  5FRM A;  1S72 Q;  4M7D B;  1VQN A;  4Y28 E;  5KYY A;  4M75 E;  5A0G A;  1AWW A;  4EMH A;  1VQL Q;  3I9Q A;  4KT0 E;  2VXE A;  3EG9 A;  4ZGJ B;  3OYJ A;  2AKL A;  1VQL T;  5KCO A;  3OW2 P;  1BBZ A;  1IGQ A;  1QCO A;  3VS4 A;  1XJW B;  4M75 A;  3CPW S;  4PFP A;  4E7L A;  2KRM A;  4J9F A;  4PJO G;  5GAO l;  1X43 A;  2YRD A;  4PLI A;  2EWN A;  2X4W A;  3UDC A;  2HKN A;  1HK9 A;  2EQI A;  3JCM V;  2RO0 A;  1WGS A;  4IUR A;  1J3T A;  3GF5 A;  4M75 D;  3VYG A;  9ATC B;  2COW A;  4D8K A;  1PKT A;  2DZ9 A;  3MP6 A;  4CRI A;  3CCM Q;  3HSB A;  2NUT A;  4ORZ A;  5EC7 A;  1ARK A;  3HL8 A;  2KI7 A;  3CCM T;  5DLO A;  3OQ5 A;  1NYG A;  1QVF S;  2DO3 A;  2F5K A;  3GOX A;  1X6B A;  1BB9 A;  3VUB A;  3H9N A;  2AK5 A;  2DBM A;  3CCL Q;  1M9S A;  4FYW B;  2BZX A;  1OX9 A;  2FZG B;  1M2V B;  2C0I A;  5FU7 B;  2LTO A;  3CCL T;  4UC4 A;  2DEU A;  3M0R A;  4M7A E;  4Y91 A;  1OX8 A;  4FIB A;  1PG5 B;  1MUZ A;  5FU6 B;  4WTO B;  4BI8 B;  1G3Y A;  1RAF B;  1V1C A;  1QCN A;  2QG9 B;  4FT2 A;  3A8L B;  3OYC A;  5IHK A;  2GNC A;  3REA B;  4M7A A;  2BZY A;  4A4G A;  3ME9 A;  1Q7Y U;  1ZUY A;  3CCQ Q;  1JXM A;  5GJW B;  1BIA A;  1NPR A;  3R6O A;  1M1F A;  3N5B B;  3CCQ T;  4FU6 A;  3A8G B;  1U5S A;  3HP9 A;  4GLK A;  1RI9 A;  3C12 A;  4PKC C;  4M7A D;  4E7I A;  3MO8 A;  1RLP C;  4GLM A;  1YIJ A;  2RQV A;  4Z02 A;  4QQG A;  2CP0 A;  1GCP A;  2K5I A;  3X26 B;  2F5T X;  4EDU A;  2EAY A;  4XTV A;  1VQM Q;  2L3P A;  5GAM e;  1KFZ A;  2QGF B;  3BE3 A;  5DM7 R;  2EYZ A;  3MEA A;  3CCS A;  1VQM T;  1D09 B;  4IIM A;  3LGF A;  1WXT A;  1RAD B;  2VC8 A;  3U23 A;  2QA4 Q;  3TSZ A;  2K79 A;  2RI3 A;  3X20 B;  4N0A C;  2E5Q A;  1HYO A;  2XD0 A;  2R57 A;  1WHJ A;  2DKG A;  2F1L A;  4M7D G;  1QWE A;  4OP0 A;  1ABQ A;  3DLL A;  3DKM A;  4LNP A;  1UEB A;  3QXE B;  2VUB A;  4XTX A;  2JW4 A;  3GP8 A;  1KQS S;  2RJC A;  2K7A A;  5KYX A;  8AT1 B;  2JTM A;  4C8Q B;  1E7O A;  3HRU A;  2K3X A;  4AG1 C;  1Z9Z A;  3JB9 F;  1QKW A;  4A54 A;  2QAS A;  4R0K A;  1WHH A;  3V8J A;  1X2K A;  4MZT A;  4BAC A;  5LJ5 f;  3LX7 A;  2BE7 D;  3QG1 A;  1WNL A;  2JXB A;  2BTT A;  3QJ6 A;  4J9D A;  1Q7Y R;  1WHL A;  2EKO A;  1GXI E;  5GAN f;  2QQA A;  5GAN 4;  1VQ4 A;  3A8H B;  3QYH B;  1YCY A;  2EPD A;  2QYZ A;  1M90 U;  4HVU A;  1VQN Q;  2JTE A;  1QW1 A;  2KMT A;  4XTU A;  2ZZD A;  1RAI B;  1UEC A;  2KXC A;  1SHF A;  1VQN T;  1NEG A;  4MDW A;  2DEQ A;  2O4X B;  2KQW A;  1BI3 A;  1K0X A;  3A8O B;  4JUV A;  4ZTJ A;  2RNA A;  4JJC A;  1TUC A;  4M7D F;  1VQ8 Q;  1TS9 A;  2FHD A;  4OML A;  1R77 A;  4E7K A;  1UDL A;  3OYF A;  4LN2 A;  4C92 C;  4OVA A;  3CC7 A;  2CSQ A;  1Q7Y C;  2MWO A;  4DOV A;  3OMG A;  1WJQ A;  1ABO A;  3MP8 A;  1OV3 A;  2X35 A;  2P84 A;  4M78 A;  5M9O A;  2JOY A;  1M1K U;  4RTY A;  2J7I A;  3GNF B;  2GBQ A;  3VS2 A;  2HCK A;  1N6A A;  4M78 D;  5CKD A;  3OYN A;  3CCJ A;  3QYG B;  3ZFJ A;  2HBP A;  2RQW A;  5KYW A;  4ZTF A;  1YFN A;  4OMO A;  2DIL A;  2XID A;  1XTD A;  2ATC B;  1D0X A;  4C5H A;  1WFW A;  2JZ2 A;  4N4H A;  4PLL A;  5L23 A;  1D1A A;  3PVQ A;  2K2M A;  3QWX X;  1TSF A;  1M90 R;  4RTW A;  2DNU A;  1JJ2 A;  2AZV A;  3RMQ A;  4C0D B;  3ER0 A;  2M02 A;  2AZS A;  1JB0 E;  2HSP A;  4FSX A;  3EG0 A;  1SHG A;  1IZ6 A;  5CKB A;  3CCV A;  1KIK A;  1AVZ C;  1R0C B;  2FL7 A;  4BY6 C;  1PM3 A;  4XQ3 A;  3RMS A;  4K11 A;  3CMA Q;  2P0P A;  1MMD A;  4HCC A;  2RB6 A;  5GAN 3;  1JJ2 P;  1G3T A;  4XU1 A;  1YIJ Q;  1K4U S;  3SWN C;  3SHW A;  2MI6 A;  4C8Q G;  4KGV B;  4ELZ C;  1AOJ A;  1XQH A;  5I11 A;  4CC4 B;  3M0T A;  1YIJ T;  3GIB A;  1ZX6 A;  1WHK A;  3EFS A;  1SEM A;  2HD0 A;  1I8F A;  3M55 A;  1I0C A;  1UE9 A;  2QGG A;  3T9N A;  5GAN 5;  1M90 C;  1SRL A;  1H8K A;  2KR3 A;  3CCS Q;  1BK2 A;  1M1K R;  3AHU A;  4J9G A;  4F7U B;  3EGX A;  1HJD A;  5DY9 A;  3H41 A;  3CCS T;  1PRM C;  1T0H A;  2J06 A;  2Z0W A;  2E4H A;  2P0Q A;  3CBP A;  1ZBJ A;  2DYI A;  2VGN A;  3I56 Q;  1JXO A;  3J7A F;  3HRS A;  5L8R E;  5LJ5 j;  4PJO C;  4BI4 A;  4B9X A;  3MET A;  3I56 T;  1YBY A;  2OX7 A;  3E9F A;  2O31 A;  2E1H A;  2MF2 A;  2YXY A;  1B34 A;  5GAN j;  4OMP A;  1QMC A;  2MPX C;  2ZPF B;  3P8H A;  3INZ A;  3SD4 A;  1RAE B;  1UHC A;  3V7S A;  1Y96 A;  4C8Q F;  2OTJ A;  1M1K C;  4RMO A;  1I1J A;  2O2O A;  1VQ4 Q;  2FEI A;  1KD1 U;  1NLO C;  2GCX A;  2J05 A;  2HQE A;  1VQ4 T;  4J6Y A;  2GGR A;  3EGU A;  4HCZ A;  3CCU Q;  1IRX A;  1PD0 A;  3M0S A;  1ZQ1 A;  1MV3 A;  4EMK C;  1ZSZ B;  2KYB A;  4PK4 A;  4JDS A;  3OYI A;  5GMK e;  7AT1 B;  2AT1 B;  1BYM A;  2PZ1 A;  1QWF A;  2KY9 A;  5CR2 A;  2DJQ A;  4JLG A;  5KYU B;  3UAT A;  2AKK A;  2LDM A;  3JCM X;  1KG1 A;  1IHW A;  5FRO A;  3BFM A;  2YUO A;  5KE2 A;  2KEA A;  2MOX A;  4CC3 A;  3E1S A;  2OAU A;  1UGS B;  4LDY A;  4OMM A;  3CC7 Q;  4PL6 A;  4MMK A;  4QQD A;  5HK0 A;  4LE9 A;  3MCA B;  2ZPB B;  3RUX A;  2RHU A;  5J26 A;  2A36 A;  3CC7 T;  4FT4 A;  2A3L A;  2EQU A;  4TVR A;  3VU3 C;  4OB2 B;  2JJ9 A;  5IHN A;  1Z9Q A;  3QWY A;  1WJR A;  1FMK A;  4KUD K;  5KYY B;  2MMP A;  5FWB A;  5AT1 B;  2CZ0 B;  3CCJ Q;  3EG9 B;  4AT1 B;  2WSF E;  4IKF A;  2CSI A;  3CCJ T;  4A53 A;  5HK3 A;  1ZA1 B;  4FL6 A;  3RDV A;  1M1G A;  2CP6 A;  4M75 B;  1PHT A;  4C92 G;  1KD1 R;  3CPW A;  1YWO A;  2XKO C;  3M58 A;  1I07 A;  3A98 A;  3CC4 A;  3UA6 A;  2QEX Q;  2G3R A;  2FZK B;  4M7D C;  3EFR A;  4F7U G;  3RKW A;  3I5S A;  1M3B A;  3LYI A;  3JB9 J;  3CCV Q;  3JCM P;  2LQN A;  2X9H A;  2CP3 A;  2NUT B;  2DLP A;  3CCV T;  1JEG A;  1QLY A;  2QQR A;  3PT9 A;  1QCF A;  4ANJ A;  3CPW P;  2J6F A;  3QUI A;  3HFN A;  3SB2 A;  2HL5 C;  1QVG S;  2BIV A;  1LJO A;  1YJN A;  3CCE A;  1SKU B;  2COY A;  4IUU A;  4PFZ A;  5GAO n;  4J83 A;  2RMO A;  1KD1 C;  4BI3 A;  4FYY B;  1N27 A;  2K5L A;  3G4S A;  5IHI A;  1Q81 U;  1SSF A;  1G3W A;  4BE2 A;  2PUO B;  2RF0 A;  3CME Q;  3VS0 A;  1VQ9 A;  1K9A A;  3VKI A;  2ENM A;  4LDW A;  2E70 A;  3C4S A;  1QVF P;  4NL2 A;  5AYF A;  3SWN A;  2E65 A;  3SEM A;  2DBK A;  5LJ3 h;  4A4F A;  1ZSG A;  4F7U F;  2LVM A;  1MGQ A;  5ECA A;  1KK7 A;  5FU7 C;  1WI7 A;  4KGZ B;  1WYX A;  3AT1 B;  4KBM B;  1GBR A;  2EKH A;  2PTK A;  4DQ2 A;  2LQK A;  3KBG A;  1BU1 A;  4C0Z A;  5FU6 C;  4RUG A;  3DLM A;  4HT8 A;  4PJO E;  4RTU A;  1AWJ A;  2ROT A;  2M9U A;  2QK0 A;  3CBO A;  2DF6 A;  3OYE A;  1GFD A;  3OB9 A;  1NBE B;  2OTJ T;  2YUQ A;  4PJO A;  2DYB A;  5IH2 A;  4O5V A;  3QSU A;  1VA7 A;  2E12 A;  2RK2 A;  2VWF A;  2HQH A;  2CP2 A;  5KE3 A;  1T0J A;  4PJO D;  1QVP A;  3HRT A;  4XTZ A;  1AZE A;  3HPW A;  4OB0 B;  1X69 A;  2KRN A;  2OTL A;  4QT7 A;  3IQL A;  3EAE A;  3NGP A;  2JM9 A;  3ZBD A;  1Q81 R;  1KQS A;  1UGP B;  3NPF A;  4C5G A;  1Q86 U;  3V7C A;  2JMA A;  2LNH B;  4RG8 A;  2LRQ A;  4L6V 5;  2D0Q B;  5IT9 E;  2YRC A;  2EJ9 A;  3JSC A;  5GAM f;  2FO0 A;  2AIR B;  4IIO A;  3UF4 A;  3WVD B;  5KH6 A;  2CP5 A;  5I22 A;  1RAC B;  1KQS P;  1X2Q A;  2HBW A;  1QQJ A;  4C8Q C;  1YJ9 A;  2LT4 A;  4QQ6 A;  2P4T A;  5HY6 A;  2LJ1 A;  2LNV A;  2H3E B;  1K0S A;  3OYK A;  3L2V A;  3JCM Q;  2KGT A;  4ZGE B;  4JJN K;  2O01 E;  1Q81 C;  2QDL A;  2H8H A;  3S6W A;  2ESW A;  1EIF A;  1M3C A;  2PU9 B;  2KDS A;  2LC4 A;  3CC4 Q;  1O9S A;  3L2W A;  4A4K A;  2EQM A;  3PIP A;  3JB9 G;  3WXM B;  1K8A U;  2YDL A;  4NS5 A;  2GF7 A;  3CC4 T;  4IUV A;  5KCH A;  1JQQ A;  4M4Z A;  3UPU A;  4M75 F;  1YI2 A;  1SSH A;  3EFO A;  4R56 A;  3F70 A;  2GFA A;  4CI0 C;  4M78 B;  3BW1 A;  3JCM d;  4D6W A;  4M7D E;  1Q86 R;  4M77 E;  1H92 A;  1I5L A;  1SG5 A;  2LZ6 B;  4AFS C;  4ATO A;  1ZA2 B;  2CH4 W;  2DMO A;  5FLX E;  2BUD A;  1YJN Q;  1IGU A;  2YHT A;  1VQO A;  1VIE A;  5GAO m;  5GAN h;  4M7D A;  1MMG A;  5GAN 6;  1YJN T;  3CCE T;  3KUF A;  3QKJ A;  4M77 A;  3V8L A;  4J9E A;  1N9R A;  4C0G A;  3OYD A;  4J7I A;  1BI1 A;  1OYX A;  3FDR A;  4J9I A;  2VGM A;  1ACM B;  4M7D D;  1VQ9 Q;  3G4S T;  2MCN A;  1IO6 A;  3L2R A;  1U3O A;  2JT4 A;  2DD4 A;  4M77 D;  3JCM g;  2ZPE B;  5D6Y A;  5LJ3 d;  1VQ9 T;  2A0F B;  3I55 A;  1WQW A;  2E5K A;  3OMC A;  1TG0 A;  4PFO A;  3CC2 A;  2ZCF B;  3FJ5 A;  2I2L A;  2DL7 A;  3JCM c;  1Q86 C;  2VV5 A;  1HXD A;  1WLP B;  4X9C A;  1IRE B;  3EH2 A;  3NTI A;  2FYK A;  4F17 A;  2CRE A;  2HL3 A;  2GTO A;  2MIO A;  3OYM A;  1EX4 A;  1K8A R;  1MND A;  4M7A F;  4C0D C;  2ABL A;  3CCR A;  4E47 A;  1BCO A;  1VQK A;  5LJ3 g;  1WZO A;  4OB1 B;  3JRZ A;  5A2Q E;  1WX6 A;  2V26 A;  2EBP A;  4JZ3 A;  1M4Z A;  3FJP A;  2M0O A;  3MEV A;  2PNI A;  1OZ2 A;  3PTA A;  2ZAE A;  4AFQ C;  4J6W A;  1D1B A;  2DL4 A;  2RHI A;  2V1R A;  2E64 A;  3V7R A;  2X3W D;  1GL5 A;  3RIR A;  1UGR B;  3UWN A;  2VYT A;  1R8O B;  4HA8 A;  3MEU A;  1AT1 B;  4JJD A;  2OTL T;  1K8A C;  2VAS A;  5GAM j;  3OS0 A;  1B7T A;  2F2X A;  4QVD A;  2I0N A;  1OQK A;  2GQI A;  1C0M A;  4OGE A;  5CKE A;  1QP2 A;  5I21 A;  4VUB A;  3OY9 A;  1Y96 B;  2FPF A;  2JNG A;  2KNB B;  3LWH A;  4Y92 A;  2RN8 A;  5GAO q;  5GAO r;  2F69 A;  3EG3 A;  3I5R A;  2DET A;  3ASK A;  1TXQ A;  1H64 1;  3HHT B;  1YJ9 Q;  1KHC A;  1MV0 B;  3FEO A;  2KT8 A;  4M78 G;  4PJM A;  4QW2 A;  1FWZ A;  3QJY A;  3REB B;  1YJ9 T;  1U06 A;  1VOM A;  4C8Q E;  4RTZ A;  3GLX A;  3G6E A;  2LMJ A;  2K3Y A;  3CEY A;  1VQ5 A;  3HKS A;  4OMN A;  2KRS A;  3CQT A;  3VS7 A;  2K4Y A;  1WXU A;  2CKK A;  2JTF A;  1W70 A;  1YN8 A;  2XU8 A;  3RER A;  4ESR A;  2YSQ A;  2P4R A;  1YI2 Q;  4EMG A;  1ZSZ C;  2XDP A;  5GMK i;  4NOY A;  1YI2 T;  1PNJ A;  2O88 A;  1VYU A;  2ECZ A;  2JVV A;  4B9W A;  1EFN A;  3OS1 A;  1HSQ A;  2DJZ A;  3P8B B;  2BZ8 A;  1AHJ B;  2EQK A;  5GAN d;  5J3B A;  1VQP A;  3S3N A;  1VQO Q;  1D3B B;  5DLQ E;  1WHM A;  2KE9 A;  4M78 F;  1OU9 A;  1X27 A;  1BIB A;  1VQO T;  4PJL A;  3P8D A;  5CAI A;  1QP3 A;  2KBT A;  3G71 A;  2RA2 A;  4HKE A;  3HTR A;  2MYS A;  2DL8 A;  1NM7 A;  1UJ0 A;  3M57 A;  1VQ7 A;  4CC7 A;  5LJ5 g;  2GTJ A;  1NEB A;  4PJN A;  2DVJ A;  3VV0 A;  1W4S A;  2WAC A;  2IG0 A;  4D8D A;  4Z89 A;  4IUQ A;  3RBB B;  5GAN g;  4C5I A;  3M56 A;  3I55 T;  2EJF A;  3E9G A;  3CC2 Q;  2E41 A;  4N0A A;  2ZPH B;  1X75 C;  2DL3 A;  2EGE A;  1V76 A;  1G5V A;  3CC2 T;  2XDB A;  1IHV A;  5I2M A;  1QVG A;  3CCR Q;  2KYM A;  1RAH B;  2Y90 A;  1S72 A;  1FYN A;  3GNG A;  3CCR T;  1VQK Q;  1OPK A;  2M16 A;  2O9S A;  5IN1 A;  1TWB A;  3NMZ C;  4A63 B;  1VQK T;  4MML A;  2GQV A;  1UJY A;  2M51 A;  2KK4 A;  3H0H A;  2L0A A;  2QDY B;  5HKC A;  1YJW A;  3EHQ A;  3SFM A;  1XNI A;  2FPE A;  3JB9 I;  1QVG P;  1SF9 A;  1E6G A;  4RTV A;  1LVK A;  1NZ9 A;  3NFC A;  2DX1 A;  4DBR A;  1LPL A;  4L59 A;  4V2S A;  3RES A;  2RK1 A;  2G6F X;  2B8A A;  1PC0 A;  5HCK A;  4LD6 A;  3TEE A;  1MMN A;  5GMK l;  2L5Q A;  3X25 B;  2XMF A;  3E19 A;  1ZHI A;  4C92 E;  4QKU A;  4JLI A;  2DXU A;  2HDA A;  2QTV A;  2DVE A;  2PVD B;  3RNJ A;  2DTO A;  2X3X D;  1P92 A;  2DAQ A;  4F7U E;  4C92 A;  1NJI R;  1UGV A;  3S3M A;  4PJO B;  2D8H A;  3M0U A;  1RAA B;  4C92 D;  1TUD A;  2FZC B;  2K3B A;  2M1H A;  2FRY A;  5LL6 S;  2LJ0 A;  3TCJ A;  1Y57 A;  2E3H A;  1M3A A;  1RLQ C;  1X6G A;  3G6E Q;  2EFI A;  4ZNX A;  1B3Q A;  1M30 A;  3Q1J A;  1IXD A;  1VQ5 Q;  2XG8 D;  3M53 A;  3BDU A;  3G6E T;  2QXF A;  4LDX A;  1LCK A;  2CUD A;  3TU4 K;  1W2B S;  3H8Z A;  1VQ5 T;  1Y7X A;  1KC8 U;  1DJ7 B;  2HEQ A;  3JCM h;  2ZGW A;  5CKH A;  1G3S A;  1NJI C;  3RKY A;  3MP1 A;  2J6K A;  2RM4 A;  1KQ1 A;  5GMK j;  3QPH A;  2JM8 A;  1W6X A;  5CVI A;  1VQ6 A;  3LWI A;  1VQP Q;  2DXC A;  2JS0 A;  4J5Y A;  3PMT A;  5D6X A;  4BUG A;  2C06 A;  2QA4 A;  1UTI A;  1VQP T;  1SRM A;  1X6O A;  2NYS A;  1N8R U;  3LGL A;  3CXC S;  2W0Z A;  1ZSZ A;  4M7A B;  3G71 Q;  4C0F A;  2HNI A;  3QDF A;  1VQ7 Q;  1YCS B;  2NUP A;  3G71 T;  4PNO A;  1D0Z A;  2HMA A;  4DBQ A;  2CZ6 B;  3QDR B;  4MZP A;  3CD6 A;  2LJ3 A;  1VQ7 T;  1OOT A;  8ATC B;  1TH7 A;  2DK3 A;  2WSC E;  1H3H A;  1BKB A;  3EFO B;  1W1F A;  1M8V A;  1LOJ A;  2PUK B;  2ED1 A;  2OTJ Q;  4JPB W;  3L2U A;  2DFU A;  1UHF A;  2CS7 A;  2KAF A;  2DRM A;  1GRI A;  2QI2 A;  3QZ9 B;  1CKB A;  4LXC A;  3QO3 A;  3PMI A;  1KC8 R;  4LDV A;  3QII A;  6AT1 B;  2RJF A;  3C0C A;  2RQT A;  1ZBX A;  2X51 A;  4A4E A;  5GAM h;  3EGD A;  2DTI A;  2V8I A;  3FIF A;  4IUT A;  3M5A A;  4M77 B;  4KH0 B;  3WVE B;  1S72 T;  1JU5 C;  3VRZ A;  1RAB B;  4KGX B;  2LT1 A;  1GCQ C;  3SDZ A;  2RD1 A;  1OI1 A;  4M78 C;  2W10 A;  2M0Y A;  2RJE A;  4MZM A;  5KYX B;  1YJW Q;  2E6Z A;  4ZN1 A;  1U1T A;  2RI5 A;  2DXB A;  5LJ3 f;  1VQ8 A;  1VIF A;  3UA7 A;  1UG1 A;  2EW3 A;  1YJW T;  1OUL A;  2D9T A;  2PVG B;  1S1N A;  2E10 A;  3MHX A;  2VXF A;  4M75 G;  1M8M A;  1O75 A;  3JAM E;  3JV3 A;  4F16 A;  1N8R R;  2C0T A;  5CK9 A;  3TVT A;  4EMK A;  2ROL A;  3GBQ A;  2DXT A;  2DD5 A;  4AMC A;  3JCM e;  3PGG A;  1FX7 A;  4NL3 A;  1KC8 C;  1LNX A;  4AFZ C;  5C6S A;  3UT1 A;  3CPF A;  1M5Q 1;  2E6N A;  3LLR A;  4WCI A;  1NLP C;  1UB4 A;  4J6X A;  2D1X A;  1VYT A;  3FLG A;  1F1B B;  4N4I A;  3TRE A;  3PIO A;  4DA4 A;  1TU0 B;  1KSW A;  2EYQ A;  2XI9 A;  1QKX A;  2JN0 A;  2FVU A;  1OEB A;  3VYH B;  4RTT A;  2QQ9 A;  4JRI A;  1N8R C;  4HVV A;  5LJ3 e;  2YWW A;  4FW1 A;  3JB9 D;  2K5F A;  4PJO F;  3QHS A;  2JS2 A;  2RHX A;  1Q95 G;  3QBY A;  2FG0 A;  4RKU E;  5GJV B;  1RAG B;  2CT3 A;  4RCB A;  2EGA A;  2AHJ B;  3OYL A;  3OA6 A;  3OW2 S;  1G2B A;  1OPL A;  2EVR A;  2KT1 A;  4F14 A;  4M7A G;  5GAO p;  4E2F B;  1UGQ B;  4P5N A;  3CMA A;  4OMQ A;  4EPC A;  4FYX B;  5LJ5 h;  4JRK A;  4II1 A;  1WPY A;  1YHQ A;  4LDU A;  2RI2 A;  1TUG B;  1AWO A;  3G1J A;  3CCE Q;  1PCX A;  2BKD N;  2DIG A;  4FSS A;  5KYW B;  4FM4 B;  4RTX A;  3MKD A;  3VS3 A;  3J81 E;  1M2O A;  4EIK A;  2RJD A;  5D7U A;  4XTY A;  2KSS A;  4B6M A;  2A28 A;  3G4S Q;  5CKF A;  1VQ6 Q;  5J39 A;  1C1A A;  1U1S A;  1VQ6 T;  1K73 U;  2L89 A;  4C5E A;  3OYG A;  2QA4 T;  1SPK A;  2A37 A;  1WHG A;  2DRK A;  3I56 A;  4JS5 A; 
#chains in the Genus database with same CATH homology
 2P4R A;  3QWY A;  4AG2 C;  2CDT A;  3VS4 A;  1FMK A;  2SEM A;  1PKS A;  2KRM A;  5FWB A;  4J9F A;  1PNJ A;  1X43 A;  2O88 A;  1VYU A;  1ZLM A;  2EQI A;  2ECZ A;  1K1Z A;  4JZ4 A;  2CSI A;  1EFN A;  1J3T A;  1HSQ A;  2BZ8 A;  2FRW A;  1PHT A;  1YWO A;  4D8K A;  1PKT A;  4JJB A;  1I07 A;  3A98 A;  1B07 A;  2KE9 A;  1X27 A;  3UA6 A;  1VYV A;  4ORZ A;  5EC7 A;  1ARK A;  3I5S A;  1M3B A;  2KBT A;  2DL8 A;  1NM7 A;  1NYG A;  1UJ0 A;  2LQN A;  2LQW A;  2K9G A;  1X6B A;  4CC7 A;  1BB9 A;  2GTJ A;  2DLP A;  1NEB A;  2AK5 A;  1JEG A;  2DBM A;  1QLY A;  1T3S A;  1QCF A;  2DVJ A;  2J6F A;  2BZX A;  3PVL A;  2C0I A;  4D8D A;  4Z89 A;  1YNZ A;  3RBB B;  2F2V A;  3M0R A;  2DL3 A;  2EGE A;  2NWM A;  4LUD A;  4LUE A;  1MUZ A;  2RMO A;  3H0F A;  2ED0 A;  1WIE A;  1V1C A;  5IHK A;  5IHI A;  2GNC A;  2VVK A;  3REA B;  3EG1 A;  2BZY A;  2RF0 A;  2KYM A;  1ZUY A;  1JXM A;  3VS0 A;  5GJW B;  1FYN A;  2L2P A;  1GCQ A;  1OPK A;  2O9S A;  1K9A A;  2LP5 A;  3NMZ C;  4A63 B;  2RQR A;  2ENM A;  1U5S A;  1RI9 A;  3SEM A;  3NHN A;  2DL5 A;  2M51 A;  1UJY A;  3H0H A;  1ZUU A;  1RLP C;  2DBK A;  4GLM A;  2L0A A;  1ZSG A;  2RQV A;  1GFC A;  1GCP A;  3EHQ A;  1WDX A;  2YUP A;  3VS1 A;  5ECA A;  5FWC A;  2FPE A;  1WI7 A;  1WYX A;  1E6G A;  4RTV A;  1GBR A;  2EKH A;  2PTK A;  2CUB A;  2K6D A;  2L3P A;  1BU1 A;  1KFZ A;  2DA9 A;  2J6O A;  2DX1 A;  2EYZ A;  4RUG A;  2SRC A;  4RTU A;  4IIM A;  3ZL7 C;  1AWJ A;  1WXT A;  2ROT A;  3U23 A;  4GBQ A;  2G6F X;  3TSZ A;  2K79 A;  5HCK A;  1NG2 A;  2DF6 A;  2XMF A;  1GFD A;  1Y0M A;  1YWP A;  2YUQ A;  2HDA A;  2DYB A;  5IH2 A;  1QWE A;  1ABQ A;  5IXB A;  1VA7 A;  4LNP A;  2VWF A;  2JW4 A;  2RQU A;  2V1Q A;  1UUE A;  2K7A A;  3RNJ A;  2X3X D;  1E7O A;  2DE0 X;  1YP5 A;  4AG1 C;  1T0J A;  1UGV A;  1Z9Z A;  4Z8A A;  1QKW A;  2D0N A;  4R0K A;  1AZE A;  5IXF A;  2DM1 A;  1X2K A;  1CSK A;  1X69 A;  2KRN A;  2D8H A;  1PRL C;  3M0U A;  4QT7 A;  4Z88 A;  2VKN A;  3IQL A;  3NGP A;  2JM9 A;  1A0N B;  2JXB A;  1TUD A;  2BTT A;  4J9D A;  3NPF A;  2K3B A;  2FRY A;  2JMA A;  2LJ0 A;  2LX7 A;  2LNH B;  1Y57 A;  1M3A A;  1RLQ C;  2EPD A;  1X6G A;  4ZNX A;  1B3Q A;  1HD3 A;  1M30 A;  1XOV A;  4HVU A;  2JTE A;  2O9V A;  1UEC A;  2IIM A;  1LCK A;  1N5Z A;  2CUD A;  2KXC A;  2FO0 A;  1SHF A;  4DEX A;  4J9B A;  1KJW A;  1NEG A;  4IIO A;  3UF4 A;  5I22 A;  1AEY A;  2HEQ A;  1X2Q A;  2HBW A;  1K0X A;  1WA7 A;  1ZUK A;  3VS6 A;  2RNA A;  4JJC A;  1TUC A;  2OJ2 A;  1NYF A;  3VRY A;  3M0Q A;  2LJ1 A;  1T3L A;  4OML A;  4KRT A;  3LH5 A;  3O5Z A;  2CH4 A;  2FPD A;  2J6K A;  1K0S A;  1UDL A;  3H0I A;  2RPN A;  2KGT A;  4HVW A;  1M27 C;  2QDL A;  4LN2 A;  2H8H A;  2JM8 A;  3R6N A;  2ESW A;  1W6X A;  2CSQ A;  2D8J A;  1WXB A;  2JS0 A;  1M3C A;  1ABO A;  4J9C A;  1UTI A;  1OV3 A;  1SRM A;  2YDL A;  2W0Z A;  4RTY A;  2J7I A;  3THK A;  4AFU C;  2GBQ A;  1JQQ A;  4M4Z A;  3VS2 A;  1SSH A;  1YCS B;  2HCK A;  2RQW A;  2LJ3 A;  1OOT A;  4OMO A;  2DIL A;  2EYW A;  1H92 A;  1WFW A;  5L23 A;  2LZ6 B;  4AFS C;  1H3H A;  3TSW A;  1W1F A;  2CH4 W;  3PVQ A;  2DMO A;  2K2M A;  3QWX X;  2ED1 A;  4RTW A;  2DNU A;  1AWX A;  4JPB W;  2AZV A;  1JO8 A;  2CT4 A;  1UHF A;  2JMC A;  4J9E A;  1PWT A;  2DRM A;  1GRI A;  2AZS A;  1CKB A;  3VS5 A;  2HSP A;  2EGC A;  2KXD A;  3C0C A;  2RQT A;  4J9I A;  3EG0 A;  1SHG A;  1KIK A;  1AVZ C;  3ULR B;  2MCN A;  1IO6 A;  1U3O A;  2JT4 A;  1E6H A;  2A08 A;  2YUN A;  1GBQ A;  4K11 A;  1JU5 C;  3VRZ A;  1GCQ C;  4DEY A;  2EYY A;  2E5K A;  3KFV A;  1TG0 A;  1K4U S;  2W10 A;  2M0Y A;  4J9H A;  3SHW A;  3FJ5 A;  1AOJ A;  2DL7 A;  5I11 A;  4CC4 B;  3M0T A;  3UA7 A;  1WLP B;  1G83 A;  1UG1 A;  1ZX6 A;  2EW3 A;  1S1N A;  1SEM A;  4F17 A;  2CRE A;  1M8M A;  2GTO A;  2MIO A;  1I0C A;  1UE9 A;  3JV3 A;  4F16 A;  1SRL A;  1H8K A;  2C0T A;  2KR3 A;  1BK2 A;  4J9G A;  2ABL A;  3TVT A;  1HJD A;  2ROL A;  3GBQ A;  3H41 A;  1PRM C;  1T0H A;  2J06 A;  2L3S A;  3M0P A;  4HCK A;  1ZBJ A;  4AFZ C;  2EYX A;  1JXO A;  2OAW A;  1WX6 A;  3EG2 A;  4CC2 A;  2EBP A;  4JZ3 A;  4WCI A;  1NLP C;  2O31 A;  2D1X A;  1VYT A;  1UFF A;  1AZG B;  2PNI A;  4AFQ C;  1KSW A;  2DL4 A;  2V1R A;  4OMP A;  1QKX A;  2X3W D;  1GL5 A;  1OEB A;  4RTT A;  2KRO A;  1CKA A;  2OI3 A;  3EHR A;  2F2W A;  4JJD A;  1UHC A;  2YT6 A;  4HVV A;  4HXJ A;  1RUW A;  1I1J A;  3PE0 A;  2O2O A;  2JS2 A;  2FEI A;  2F2X A;  1NLO C;  2I0N A;  2GQI A;  2FG0 A;  2J05 A;  1AD5 A;  5GJV B;  2CT3 A;  2GGR A;  3EGU A;  2EGA A;  2FPF A;  2KNB B;  3M0S A;  1G2B A;  1OPL A;  2C0O A;  2EVR A;  2KT1 A;  4Y92 A;  1MV3 A;  4F14 A;  2LCS A;  2RN8 A;  2KYB A;  3I35 A;  4OMQ A;  3EG3 A;  3I5R A;  2B86 A;  2PZ1 A;  1K76 A;  1AWO A;  1MV0 B;  1QWF A;  2KT8 A;  5FW9 A;  2DJQ A;  3REB B;  4FSS A;  2NUZ A;  2AKK A;  3UAT A;  1U06 A;  4RTX A;  3VS3 A;  4EIK A;  2YUO A;  2KEA A;  2MOX A;  4CC3 A;  2A28 A;  2L3Q A;  4E6R A;  4OMM A;  4RTZ A;  4X1V A;  2LMJ A;  4LE9 A;  2A36 A;  4OMN A;  1AWW A;  2KRS A;  3CQT A;  3VS7 A;  3I9Q A;  1WXU A;  1W70 A;  1YN8 A;  1SPK A;  2A37 A;  2DRK A;  2AKL A;  5IHN A;  1BBZ A;  1Z9Q A;  4ESR A;  2YSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...