4GLMA

Crystal structure of the sh3 domain of dnmbp protein [homo sapiens]
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
LTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIFPYRFVKLCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Dynamin-binding protein
total genus 11
structure length 58
sequence length 58
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4glmA00
5I11A 1T0HA 1NLOC 1UE9A 1YNZA 1YWOA 1LCKA 5GJWB 1JU5C 3REBB 1UTIA 2NUZA 2W10A 4RTYA 3EHQA 1YCSB 1AWWA 1K1ZA 4Y92A 2PTKA 3SHWA 2BZ8A 2VKNA 1QKXA 1TUCA 1RI9A 1WI7A 1AWXA 2RNAA 5IXBA 2JM8A 3M0TA 3ULRB 2CDTA 2O88A 2JS0A 2KXCA 1VYTA 2A37A 2JTEA 1SEMA 2J6OA 4RTXA 4CC4B 2LP5A 1OPKA 2RQTA 1QWEA 1FYNA 1OOTA 4AFUC 2RQUA 3EG2A 3VRZA 1OV3A 5L23A 2DILA 4ZNXA 1GCPA 4OMPA 2KRNA 2O9VA 3VS3A 1K0SA 2DL3A 2V1RA 2KEAA 3C0CA 1CKBA 4DEYA 2LQWA 3SEMA 4HCKA 1MV0B 2YUPA 2DX1A 1QCFA 3I5RA 1K4US 2DLPA 1NYFA 1PNJA 2KXDA 1ZBJA 2KT8A 2DL7A 1Y57A 2DRKA 1UG1A 1NYGA 1WLPB 1J3TA 2O9SA 3EGUA 1E6GA 1U5SA 2ROLA 2DBKA 5IHKA 1M3BA 2DYBA 2J6FA 2FG0A 2DL5A 3H0IA 1ZUUA 3I5SA 4IIOA 3UA6A 3UATA 2G6FX 1PWTA 2BTTA 3EG1A 5ECAA 1GBQA 3PE0A 4JPBW 2QDLA 3M0UA 3LH5A 4F14A 1X27A 4LNPA 1HSQA 4J9DA 1W70A 3M0SA 5FWCA 2F2WA 1SHGA 1M8MA 2DJQA 2KRSA 1N5ZA 1ZUKA 4CC2A 1W6XA 5I22A 3REAB 2ENMA 4M4ZA 2JMAA 2MCNA 4OMNA 4JZ4A 3VS5A 4A63B 1EFNA 1SSHA 2DL4A 2W0ZA 1MUZA 1SPKA 3ZL7C 1OEBA 2O2OA 2MIOA 1S1NA 2KGTA 5IH2A 2J05A 2C0OA 2K9GA 1HD3A 4EIKA 2C0IA 2GTJA 4OMOA 1X2KA 1TUDA 2K2MA 2RPNA 4CC7A 2VVKA 3PVQA 3M0QA 2JXBA 1G2BA 4F17A 2LNHB 1WIEA 5IHNA 1KIKA 2IIMA 2DM1A 3FJ5A 2EYWA 2LZ6B 1SHFA 2DRMA 4FSSA 3H0FA 2NWMA 2EQIA 2X3XD 1M30A 4Z88A 1X69A 1Z9ZA 3H41A 1ABOA 2FO0A 3THKA 4AFQC 3JV3A 2DNUA 1IO6A 2YSQA 2I0NA 3GBQA 2KE9A 1H92A 4J9IA 1PKTA 4D8KA 1BK2A 2EGEA 3UA7A 1NLPC 3TSWA 4GLMA 2YUOA 2EKHA 1WYXA 4JJBA 3QWYA 2BZXA 2KT1A 2AK5A 1MV3A 1KJWA 1UUEA 2HBWA 1I1JA 1E6HA 2SRCA 2J6KA 2RN8A 2RQVA 4Z8AA 2KYMA 4ORZA 4JZ3A 2GTOA 4RTWA 4J9BA 4RTVA 2J06A 3EHRA 3QWXX 2L3PA 2X3WD 1M27C 2HDAA 2OI3A 1H8KA 2ED1A 2JMCA 1WFWA 1PRLC 2BZYA 1WXUA 4QT7A 2XMFA 3H0HA 4GBQA 1WXBA 2OAWA 1UHCA 2M51A 4OMLA 2HCKA 1JQQA 2EW3A 2A36A 3UF4A 2CUDA 1AWOA 1W1FA 1NEGA 2FEIA 1K9AA 2EVRA 2HSPA 3M0PA 2JM9A 1UECA 4J9CA 1NM7A 1Y0MA 1B3QA 1I07A 4RTZA 1ZSGA 2L3QA 1TG0A 2DF6A 5GJVB 2RF0A 3VS0A 4J9GA 4LUEA 2K7AA 2LJ0A 2A08A 1NG2A 2A28A 3VS7A 1GBRA 4KRTA 2EGAA 2JS2A 3I9QA 2LQNA 4AFSC 4IIMA 5EC7A 1X2QA 3O5ZA 4HVUA 1GCQC 1JO8A 2D8JA 2KR3A 2LJ1A 1U3OA 2FPDA 4E6RA 2CH4W 2L2PA 1AZGB 1SRLA 4JJCA 2CT3A 2L0AA 2ESWA 1JXMA 2YDLA 1RLQC 2P4RA 2DL8A 2CH4A 2GNCA 4JJDA 1RLPC 2AZVA 1CKAA 4WCIA 1T3LA 1K0XA 2K79A 3M0RA 3VS2A 3RNJA 1X43A 3I35A 2ECZA 1YN8A 4RUGA 3VRYA 1AZEA 2CSQA 1WX6A 2PNIA 1X6GA 2CSIA 2FPEA 4RTTA 2JT4A 2AZSA 1PRMC 2KBTA 2H8HA 2RQWA 2FPFA 2GBQA 2J7IA 1PKSA 4X1VA 1QWFA 4F16A 2MOXA 2RMOA 2KNBB 2LJ3A 4LUDA 2V1QA 3NGPA 2EYZA 4J9HA 1ZLMA 2LCSA 1HJDA 2JW4A 2YUNA 4J9EA 2RQRA 2K6DA 1PHTA 1AOJA 1QLYA 4ESRA 1UFFA 1WDXA 1KFZA 2KYBA 2CREA 2EBPA 1VYVA 2K3BA 1UGVA 2OJ2A 3KFVA 1K76A 1GFDA 1AWJA 1H3HA 1JEGA 1AD5A 2EYYA 5IHIA 2CT4A 1UDLA 4R0KA 4K11A 3NMZC 5FWBA 3RBBB 1U06A 2HEQA 1E7OA 1WXTA 4Z89A 2AKKA 1BU1A 2ROTA 1GFCA 3R6NA 1ABQA 4AG1C 2CUBA 3CQTA 4AFZC 2AKLA 1BB9A 3TVTA 1B07A 1T0JA 2VWFA 2O31A 2GQIA 4HVWA 2E5KA 1QKWA 2F2XA 2YUQA 4D8DA 3NPFA 1VYUA 4OMMA 3VS4A 5IXFA 4J9FA 1ZX6A 4CC3A 1UJ0A 2DVJA 2ED0A 1WA7A 2B86A 2D0NA 3EG0A 3VS6A 3U23A 2YT6A 2L3SA 2EGCA 1Z9QA 1RUWA 3NHNA 4OMQA 1UJYA 1YP5A 1VA7A 1X6BA 4LE9A 1A0NB 2F2VA 4LN2A 2KROA 1JXOA 1GRIA 1M3AA 1ZUYA 1AEYA 1BBZA 2LX7A 4HVVA 5HCKA 2DBMA 2ABLA 1FMKA 1GCQA 2D1XA 3EG3A 1KSWA 4AG2C 3TSZA 1G83A 1GL5A 1CSKA 1XOVA 4RTUA 2C0TA 2FRYA 2DMOA 2D8HA 2LMJA 3PVLA 1UHFA 3A98A 1NEBA 1T3SA 2EPDA 1V1CA 2EYXA 4DEXA 2PZ1A 2KRMA 1M3CA 5FW9A 3VS1A 2DA9A 1SRMA 1OPLA 1YWPA 1I0CA 2DE0X 3IQLA 1ARKA 2FRWA 4HXJA 2GGRA 2M0YA 1AVZC 2SEMA
chains in the Genus database with same CATH superfamily
3ZEHA 3FEOA 1PSFA 3REBB 2W10A 4M75D 1IXDA 4RTYA 3EHQA 2RI2A 3MJXA 1D09B 3GPLA 2EQUA 3SHWA 3FC3A 2BZ8A 2YHTA 2JVVA 4CI0C 1WI7A 4EPCA 1EZZB 4FT2A 2JM8A 2RM4A 3CC4A 3H9NA 2O88A 4RTXA 4CC4B 1RABB 2OAUA 2PVGB 1NBEB 3OYCA 5D6WA 3T9NA 4ELYC 5GAOl 1FYNA 5HK3A 3RERA 4AFUC 1QQJA 3GP8A 1MMDA 2DILA 2CS7A 5GMKl 3CCSA 5KE2A 4C5IA 2O9VA 2ZCFB 1LOJA 2QEXT 2E70A 2DXUA 1RAEB 3M55A 1K4US 2FVUA 2DLPA 3OS1A 3QHSA 4CRIA 2RJEA 3UT1A 2RJFA 2DL7A 1VQ5Q 4P5NA 3A1PA 4JLGA 3OMGA 3TQ7P 1B7TA 4XU2A 1RACB 3G71T 1Q82R 1QVGA 3QXEB 2O9SA 5A0LA 3EGUA 4ZTJA 1U5SA 4M7AB 2DBKA 2DD5A 5IHKA 2DL5A 1ZUUA 3UA6A 4LXCA 2NLUA 2QYZA 1UGQB 2G6FX 2BTTA 3EG1A 3M4YA 3V8KA 4GY5A 4F14A 1YHQA 4DOVA 4M7DC 3CC4T 3OYDA 5DLQE 1Q82C 2ZZDA 2FHDA 3OYEA 5FU6C 3AHUA 2ZPEB 2AT1B 5KYUA 4MZPA 5HY6A 2F2WA 4BY6B 2JOYA 1M8MA 2KRSA 3MEWA 1ACMB 4J6WA 4CC2A 5I22A 1D1BA 3CCVQ 2ENMA 4M4ZA 4PFOA 4B9XA 4OMNA 3VS5A 3CCUQ 4A63B 4F7UF 1Q86R 2DL4A 2QG9B 2NYSA 2QQ9A 1SPKA 3ZL7C 2A0FB 2MIOA 1KHCA 4BACA 3M58A 3CCVA 3MEAA 1JBMA 4A54A 1EX4A 3CD6A 1AHJB 3E19A 4ANJA 1WJRA 3MCAB 2NUPA 2CP6A 3SFMA 2X4JA 1IGUA 2JXBA 1RAAB 4MMKA 3JCMf 1KIKA 2IIMA 4M75F 3EGDA 3L1AA 2EYWA 2LZ6B 1SG5A 4C92G 4UC4A 1YCYA 1X69A 3FJPA 2CGHA 3A8MB 2DNUA 4M77C 2HSEB 4ME7A 4BI3A 4J9IA 1PKTA 2DK3A 5LJ5e 2EGEA 3HKSA 5LJ5f 5M9OA 1YJ9Q 4PJMA 5CCAA 4M7AA 2YUOA 4JJBA 1WYXA 4BI8B 3DKMA 3A8LB 1VQ8A 5CQXA 3G6EQ 1BCMA 1Y71A 1Q81U 1MMAA 1KC8U 3QDFA 3CCRT 2FZCB 4M7DG 1G8XA 1K73R 5CVIA 4Z8AA 2KYMA 1VQ6Q 3GNGA 3LW5E 3PIPA 3CD6Q 4J9BA 2J06A 3QWXX 2EFIA 2OI3A 2LVMA 4RCCA 1IGQA 1WXUA 3H0HA 3CCMQ 2DXCA 1H3ZA 3CCLQ 4MZMA 1UHCA 4OMLA 2LNVA 2DXTA 3RMQA 4LD9K 4NL3A 3BW1A 4BDYA 5GAN8 5GAMg 2FEIA 3CC7Q 2GCXA 4J9CA 4AT1B 1QVGS 1Y0MA 2HBPA 3URGA 3KUFA 1V29B 2K5FA 3FIFA 3V7SA 1TG0A 2VC8A 3V7RA 2RB6A 2DF6A 5GJVB 4C8QA 4QW2A 3VS0A 4LUEA 2K7AA 1NG2A 3VS7A 4KRTA 5KCOA 2LQNA 4AFSC 4IIMA 4FSXA 4M7DA 4DBHA 3OYHA 3O5ZA 1VQOQ 1WJSA 2MAMA 4N0AA 1C0MA 1U3OA 4PJNA 1UB4A 2FPDA 2VXEA 1QVFS 4JJCA 2CT3A 2ESWA 2ZPBB 2P4RA 3PFSA 2CH4A 2GNCA 4FL6A 1RLPC 2AZVA 4HCZA 3PMTA 1QVPA 1IHWA 2K79A 3CCJA 1MHNA 4BE0A 4PJLA 3VS2A 4PKCC 5GAN6 5FU7B 1WX6A 4PLLA 4PJOF 2CSIA 2FPEA 1YITA 1KC8C 1N27A 1PRMC 2KQWA 2RQWA 3L42A 3CCMT 2FB7A 4XU0A 5GAOn 4N4HA 2VYTA 3LYIA 2EJFA 3NGPA 2RA2A 2HL3A 1HJDA 3CMAQ 2YUNA 4J9EA 4HCCA 1PHTA 1AOJA 2RO0A 4IUUA 3GIBA 1JJ2S 3EFOB 1YJNT 2EBPA 1VQ9A 2RHIA 1R8OB 1VYVA 1QMCA 3CCQA 4M77B 3KFVA 1TS9A 1H3HA 5IHIA 1UDLA 4K11A 4B6MA 2CP5A 5FWBA 3RBBB 1U06A 4PFPA 1E7OA 2AKKA 2ROTA 3TU4K 4AG1C 2KSSA 4AFZC 9ATCB 1BB9A 5GMKh 3TVTA 3JCMe 3CPWP 2DTOA 2VWFA 3C12A 2GQIA 2E5KA 1QKWA 2BIVA 2FL7A 4J5YA 2L8DA 4D8DA 3EH1A 3VS4A 3M54A 3L2UA 4J9FA 3CCQT 2F5TX 2L3RA 2DVJA 1N9SA 3P8DA 5CK9A 3WVEB 1YP5A 4XTZA 1X6BA 4LE9A 3M9QA 4F7UB 1JXOA 2DAQA 4HVVA 3SB2A 3SWNA 2V26A 5KYXB 3HP9A 3EG3A 1KSWA 3TSZA 3S6WA 1BIBA 2M16A 1GL5A 1CSKA 2HZYA 4J6YA 4RTUA 2EJ9A 3OYFA 2C0TA 2DMOA 4C5GA 2LMJA 1MMGA 1UHFA 2QEXQ 2QI2A 1VQ4T 5HK0A 2RK2A 1NEBA 2EPDA 3HHTB 4N4GA 1V1CA 3RDVA 3EFSA 2EKOA 2M0OA 1M90U 1QW1A 1YWPA 4XAXB 2DE0X 4QQ6A 1KD1R 2QGFB 2WSFE 2EQMA 1VIEA 3M56A 3M4GA 1WNLA 1AVZC 2SEMA 2YRVA 4C8QD 4JS5A 4C92E 3EAEA 4PNOA 5GAOp 1UE9A 1YNZA 3CXCP 3M57A 1LCKA 2NUZA 1YCSB 2DEQA 1MNDA 1ZSZB 1OULA 2E64A 2VKNA 3SDZA 4C92C 3FB9A 4PJOA 2RNAA 4J83A 5IXBA 5LJ5d 4DQ2A 3M0TA 1BI0A 3QZ5B 2JS0A 2KXCA 4E7KA 1VYTA 1VOMA 4XTUA 3RKYA 3P8HA 3CCVT 4ZTFA 4X34A 1QWEA 4OGEA 3MKDA 1OOTA 2RQUA 3JCMd 1M90C 4OB1B 2I2LA 1OV3A 5GAOr 1SF9A 4C0FA 4ZNXA 4OMPA 2KRNA 4JS4A 1K0SA 1QVGP 2LQWA 2VUBA 2GQVA 2YUPA 4NS5A 1VQLQ 1QCFA 5GAN2 3I5RA 1OYXA 3OYAA 1NYFA 1PNJA 2WSEE 2KT8A 1FMWA 4XTYA 1RAFB 2MF2A 1UG1A 4KBMB 1NYGA 4M77G 1VQKT 2V8KA 1E6GA 3CPWS 5GAOq 3OYIA 1M3BA 2DYBA 2J6FA 3H0IA 4QKUA 1XJWB 1FWZA 2YRDA 4IIOA 2DYIA 3UATA 1GBQA 3PE0A 4JPBW 4MMLA 2QDLA 4Z02A 1U1TA 4M7AD 3M0UA 2E3HA 3V8LA 1VQ8T 4LNPA 3NFCA 2MK5A 3LLRA 2OTLT 1MMNA 1VQPQ 1Q82U 4OVAA 3UDCA 1I5LA 3CCRQ 4M77F 3DB3A 1SHGA 1Q86U 2DJQA 5CKBA 4HKEA 1OZ3A 1N5ZA 1VQ6T 5IT9E 3CCEA 2JMAA 4DOWA 5EG2A 1VQ7A 1OEBA 2P84A 2O2OA 3S3MA 1C6VX 2J05A 3QJYA 1JJ2P 2C0OA 4C5HA 3CC7A 2DZ9A 3JCMb 3RKXA 4EIKA 4FT4A 3CCLT 1DJ7B 1X2KA 4GLKA 2XU8A 1VQLT 2O4XA 4FYWB 4C8QB 2K2MA 2RPNA 2VVKA 3EG9B 1M5Q1 3RESA 2F69A 4IUQA 4A4FA 4OB3B 1G2BA 1WIEA 2XICA 2P0PA 4M78F 3X26B 3I55A 2VXFA 3RUXA 2DRMA 4FSSA 2X3XD 2EWNA 2PUKB 3UWNA 2DKGA 3JB9J 1IO6A 4C92F 2YSQA 1S72Q 1O9SA 3OY9A 4BD3A 2RHZA 3LGLA 4TVRA 3OYMA 1WQ7A 5FU6B 2PU9B 1VQOT 3L2ZA 4KGVB 5J39A 5FROA 5KE3A 1RI0A 1JB0E 3CC4Q 2LT4A 1KHIA 2MYSA 2OTLQ 1RADB 1YJ9A 1I1JA 1E6HA 2MPXC 3MHXA 4QVDA 2RQVA 2Y4XA 2YXYA 4JZ3A 2GTOA 4RTWA 1VQ9T 1YJNA 3EHRA 1RAGB 3OYLA 1I4K1 5IN1A 1TWBA 4M78C 3O8VA 2K2VA 2XMFA 1WXBA 1K8AU 3OYYA 2O01E 2M51A 3QYHB 3CMET 2QASA 2HCKA 4IUPA 1X6OA 2EW3A 8ATCB 2A36A 4KULA 1W1FA 1R77A 2QEXA 1K9MR 2KDSA 1K9AA 2EVRA 4BE2A 5AT1B 1VQMQ 4FYVB 1B3QA 4RTZA 1ZSGA 2H3JA 4RG8A 5L8RE 5A2QE 2IVWA 2NUPB 2DJZA 5GAOm 1BKBA 1JJ2A 4J9GA 1KQSA 3VYHB 3I55T 4NOYA 3I9QA 3A5ZB 4WF2A 1X2QA 4HVUA 1JO8A 4M77A 2DIQA 2CH4W 1VQNA 3RKWA 1VQPA 1NPRA 2L0AA 3OW2S 3X20B 1RLQC 2VV5A 4M77E 4JJDA 5LJ3e 5IAYA 3E2UA 1C1AA 5GAMj 4WCIA 4M75E 2K4YA 1K0XA 1TUGB 2DEUA 1BYMA 4B9WA 3BDLA 3VRYA 1AZEA 2PNIA 4C8QE 2QA4Q 4PJOE 2RJDA 2AZSA 4OP0A 4PJJA 5KYNA 2H8HA 2FPFA 2GBQA 2J7IA 3NTHA 4X1VA 4F16A 3CMEA 3X24B 1VQMA 2RMOA 5GAMf 2RK1A 1VQLA 2KNBB 4LUDA 3A8OB 5LJ3j 2JW4A 2KVQG 2K6DA 4C0DB 2LQKA 1QLYA 1BIAA 2XDDA 1WDXA 4OB0B 5GANh 1K8AC 4DA4A 1KQ1A 2OJ2A 3PT9A 3GLXA 1AWJA 4XTVA 2EYYA 4PLIA 4R0KA 2RD1A 4RMOA 3CC2A 1BU1A 2BUDA 1ABQA 1Y96B 1B34B 1ZHIA 2HKNA 1T0JA 5HKCA 4HVWA 4PL6A 1M2VA 3EFOA 4HA8A 4KUIA 3JRZA 1O75A 2F2XA 2YUQA 3ME9A 1R0BG 4OMMA 5CAIA 1ZX6A 1RL2A 5FU7C 1Y07A 1UJ0A 5GAN5 1OQKA 1WA7A 5DY9A 2B86A 3NTIA 3VS6A 3U23A 4M78D 2L3SA 1XTDA 1ZSZC 1Z9QA 2QTVA 4FU6A 1UJYA 3CCRA 1VA7A 1VQNQ 1NZ9A 2F2VA 4A4GA 2KROA 4O5VA 1GRIA 1M3AA 1AEYA 3GOXA 2LX7A 3OSVA 1GCQA 4EMKC 3G1JA 5GMKe 2QK0A 1G83A 3HFNA 3I56A 2D8HA 3GF5A 2E5QA 3MP1A 4OMFB 4X9CA 1YJNQ 2OTJQ 5GANd 5GAMe 3VYGA 3HRTA 1M3CA 3VS1A 2DA9A 3VV0A 3AT1B 3G4SQ 1OPLA 1NE8A 4R55A 3IQLA 1ARKA 1I81A 3G71Q 3JCMh 2KK4A 1TH7A 3PMIA 3JCMQ 5C0MA 3LH0A 5I11A 1T0HA 2HMAA 3JCMV 1N9RA 1NLOC 1UTIA 1IZ6A 1S72A 4PJOB 1AWWA 1M4ZA 1K1ZA 4II1A 5KYYB 3CPWA 1RI9A 2QGGA 2P4TA 1VQ8Q 4BI4A 2RHXA 1VQ6A 1HXDA 4KGZB 2CDTA 2EYQA 5LJ3h 1VQPT 2A37A 2BE9B 2JTEA 1SEMA 2QDYB 2LP5A 3CCET 1OPKA 2B8AA 3VU3C 4L6V5 4E7ZA 3EG2A 5L23A 5LJ5j 2FYKA 3I56Q 3CCST 2PUOB 1GCPA 3J80E 3VS3A 4LDYA 1CKBA 2BE7D 5GMKi 1D0XA 1MV0B 1RAHB 2DETA 2PQWA 4F7UG 3LGFA 3JB9G 5I2MA 2KXDA 3VUBA 2XKOC 3VKIA 1YI2Q 1Y57A 2HAXA 3OYNA 3QSUA 4JLIA 3JB9F 4LDXA 2JUFA 2PVOB 4JUVA 2RH2A 2XD0A 3OYGA 3OW2P 1QCOA 2WSCE 4FIBA 4EMKA 5GMKj 1S72T 2CZ1B 3I5SA 3M5AA 1Q7YC 1BI2A 3WXMB 1G5VA 1KC8R 1SKUB 5ECAA 1YJ9T 4DBRA 1PCXA 3MO8A 3TREA 4ZN1A 4C8QF 1QP3A 5CKFA 3LH5A 1X27A 3A8GB 4MDXA 2MI6A 4M78B 2LTOA 2CZ7B 2DERA 5J3BA 4M7DD 5J26A 4KGXB 3L2WA 1ZUKA 1W6XA 2MCNA 4JZ4A 1EFNA 2LCCA 2W0ZA 1YIJA 1MUZA 3OYKA 1IB8A 2JTFA 4HCBA 1S1NA 2A7YA 2OTJA 4F04B 2KGTA 1K8AR 5IH2A 5KYWB 1M1GA 5KYWA 2ZAEA 3H6ZA 2H3EB 2QQSA 2WACA 4OB2B 2K9GA 2DPPB 1XQHA 3RMSA 2E1HA 3CMEQ 1TUDA 5GMKm 3HRSA 1D3BB 3HPWA 3PVQA 3J7AF 5KYUB 1VQ4A 3JB9H 3OB9A 2QQAA 4C8QC 1YI2T 4LDUA 2DM1A 4VUBA 1K73C 3FJ5A 3H8ZA 1NJIC 1SHFA 1M1KC 3H0FA 2NWMA 2EQIA 1OX9A 1M30A 3BE3A 1MNEA 1ABOA 3JV3A 2X51A 1M1KR 5GAMh 3GBQA 2E6NA 2KE9A 1H92A 3ZBDA 1PD0A 1BK2A 4R56A 3UA7A 1NLPC 4RCBA 4QVCA 1IHVA 4NL2A 1WHMA 2BZXA 2Y90A 2E10A 3R6OA 3MP8A 3PGGA 2KT1A 2MMPA 4N4IA 2AK5A 1EIFA 4JRQA 2EIFA 1UUEA 3JCMc 2J6KA 3A8HB 3BY7A 1ZQ1A 3L2QA 1W2BA 4ORZA 3CBMA 1YIJT 2AIRB 3PIOA 2L3PA 2X3WD 2HDAA 2E65A 1YJWQ 2RHYA 4XQ3A 4ATOA 1BI3A 1WFWA 2BZYA 3QKJA 1WHKA 4QT7A 4X9DA 2R5MA 4A53A 1Q81C 3JSCA 2OAWA 4J8OA 2HL5C 4XK8E 1WHGA 2M1HA 1JQQA 4IUVA 2CUDA 1AWOA 3LX7A 1NEGA 4Y28E 2X4YA 3OA6A 2LRQA 3M0PA 3TCJA 2JM9A 3F70A 1D0ZA 1VIFA 2QA4A 2G3RA 3G7ZA 4IURA 4ZN3A 2IG0A 1WHLA 3TEEA 4M7DE 4C92D 3M53A 4ZGJB 1M90R 1F1BB 5GAN3 4XTXA 5GAMd 1M9SA 1VUBA 2K3XA 3X28B 1GBRA 3ZFJA 2EGAA 2JS2A 2JNGA 2D9TA 5EC7A 1YHQQ 1GCQC 2E12A 1B34A 1MGQA 1UGRB 1Y96A 4E6RA 5GAN7 1AZGB 3G6ET 3KBGA 1RAIB 3VJPA 1YBYA 4IUTA 2DO3A 1CKAA 2BKDN 1T3LA 5A0DA 1QCNA 4C92A 2GFAA 3CD6T 5LJ3d 4M78E 5GAN4 1YIJQ 5KCHA 1FMVA 2R58A 3I35A 4RUGA 2X4WA 2CSQA 3Q1JA 3E1SA 1X6GA 4RTTA 2JT4A 1NJIU 2CP7A 4ELZC 1U8RA 1VQ7T 2COWA 1PKSA 2MOXA 2R5AA 4FCYA 3QUIA 3OMCA 2V1QA 2EYZA 4J9HA 4BY6C 7AT1B 4FW1A 1JRIA 1TTHB 1G3YA 4ESRA 2LDMA 1TU0B 3DB4A 2CREA 1Q95G 2K3BA 3EH2A 2COZA 1FX7A 1M1KU 1LVKA 2QQRA 1JEGA 3PTAA 2CT4A 4E7IA 3G4ST 1PG5B 2C06A 2GFUA 2HEQA 3PNWC 4JRKA 1WXTA 4ZGDB 4E7HA 4M7AC 3G71A 3CQTA 2DTHA 5DLOA 3I55Q 1ZA1B 1VQOA 1Q7YR 1B07A 1NPPA 4E7JA 4E7SA 3J81E 4OF1A 4FM4B 3HSBA 3NPFA 1VYUA 4PFZA 3EGXB 5FRMA 2YLBA 2HNIA 3JCMg 1KQSP 2JTMA 4PJOC 3EG0A 3OW2A 2EGCA 3NHNA 4E2FB 1N8RR 4D6WA 5A0GA 2ZPHB 2ATCB 1ZUYA 4C5EA 1BBZA 1V76A 4BUGA 4E7LA 5HCKA 1VQ7Q 2DBMA 6AT1B 4FYYB 2D1XA 3S3NA 2DFUA 4LDVA 4M7AE 5LJ3g 3E9FA 3HRUA 2DXBA 3CMAT 5CKDA 2FRYA 1WQWA 3DLLA 1UEBA 4BDZA 5D7UA 3A98A 4M75B 4HT9A 4N0AC 2DTIA 3JCMJ 1LJOA 3EG9A 2PZ1A 1R0CB 2HQHA 4M77D 1WJQA 1I0CA 3HFOA 3OQ5A 1M2OA 4YTLA 1VQKQ 2GGRA 2LX9A 2M0YA 3NTKA 1W2BP 1LPLA 2CYZB 4M78A 2CP0A 4RKUE 2Z0WA 1YWOA 2M02A 5GJWB 1JU5C 1IREB 4M7AG 4Y92A 2PTKA 2X4XA 4BB7A 2PVDB 1QKXA 1TUCA 5CR2A 1AWXA 3ULRB 2QXFA 1M2VB 4BE1A 2KI7A 3G6EA 2J6OA 1ZBXA 1VQNT 4PK4A 3QZ9B 1K9MC 3MEVA 3EGDB 3SWNC 1YFNA 2LT1A 1KD1C 2RQTA 2ZPFB 3CCUT 2NUTA 4C0GA 3VRZA 1YITQ 5CO7A 3E9GA 3FRNA 2ZPGB 2DL3A 2V1RA 5KH6A 2KEAA 2DZCA 3C0CA 4DEYA 1G3TA 1SSFA 3CCJQ 3SEMA 5AYFA 4HCKA 1N8RU 2KAFA 2DX1A 3C94A 3HTRA 4V2SA 2XG8D 2OTJT 1GXIE 3V8JA 3CPFA 5C6SA 3CMAA 2VGNA 4M7AF 2K57A 4WTOB 2COYA 4M78G 2CZ0B 1ZBJA 3JCMW 3OBWA 2DRKA 1WGSA 2DIGA 3OS2A 2CKKA 2YWWA 1WLPB 4A4HA 1TOVA 1J3TA 1OI1A 2ROLA 4L59A 5GANj 2R57A 1U1SA 2FG0A 2YLCA 1H641 1I5OB 3FDRA 4C8QG 2CP2A 1KD1U 2FZKB 1PWTA 1KQSS 2LCLA 2QQBA 3ASKA 1HSQA 3M59A 3KXTA 5LJ5g 4JDSA 4J9DA 1W70A 3M0SA 3MEUA 5GANf 5FWCA 3QG1A 3JAME 3OYBA 2HQXA 2M9UA 2P0KA 1N6AA 3OYJA 3REAB 3CCLA 1OU8A 4LD6A 4XTWA 4F7UE 1VQ9Q 3QDRB 1SSHA 4EMHA 4QQGA 3RR6A 3I56T 2ZGWA 2XDPA 1HD3A 2C0IA 2GTJA 4OMOA 1KQ2A 3QBYA 1Q86C 2GF7A 2LC4A 2VB6A 4CC7A 5FLXE 4L5GA 3M0QA 2EAYA 4F17A 3CC7T 2LNHB 1OU9A 5IHNA 1VQMT 1VQ5T 3WVDB 2X35A 4E47A 3C95A 5CKHA 4Z88A 1WZOA 1Z9ZA 3H41A 2VASA 3GNFB 2FO0A 3THKA 4AFQC 1UGSB 2NUTB 3BFMA 2RJCA 2HKQB 2I0NA 2LQ8A 1PSEA 2ZPIB 1QVFA 4D8KA 3TSWA 1X75C 4GLMA 2RHUA 4DBQA 2O4XB 2XDBA 2V8JA 2EKHA 4XU1A 3QWYA 4IKFA 1KG1A 3L2VA 2E6ZA 4Q5WA 1MV3A 3MP6A 1KJWA 4C92B 2HBWA 1PD1A 1X01A 2SRCA 2QAZA 2RN8A 3QJ6A 4J6XA 2HD0A 4KT0E 3RIRA 3OS5A 5CIUA 1W4SA 4RTVA 4A4EA 1TSFA 4LDWA 1AT1B 1M27C 1Q81R 1H8KA 2JJ9A 2KMTA 4ZGEB 5CQYA 3META 4RG2A 2ED1A 3FLGA 2JMCA 1PRLC 5GANe 5FRNA 2IPOB 2L5QA 4GBQA 3QYGB 4M75G 5D6YA 3CC2T 2OTLA 3HL8A 1Q7YU 2E41A 4QQDA 1M8VA 3JB9I 3MPUB 1XNIA 3UF4A 1QP2A 4M75C 2OX7A 2HQEA 2HSPA 4PJOD 4AMCA 4F7UA 4HT8A 4EDUA 4J7FA 1UECA 1NM7A 3X25B 3LWHA 1I07A 3ER0A 2L3QA 2XHCA 2D6FA 2E4HA 1G3SA 2EJGA 1ZSZA 8AT1B 2RF0A 3EGXA 3D7SB 4KUDK 2LJ0A 5KYXA 2A08A 1P92A 2A28A 1YJWA 1WPYA 4MZTA 2D8JA 2F5KA 2MWPA 3BDUA 2KR3A 2LJ1A 1FXXA 2L2PA 4M75A 1SRLA 2FZGB 3V7CA 1JXMA 2YDLA 1HK9A 2DL8A 1OX8A 3CCQQ 1D0YA 3OBYA 3CEYA 4Y91A 1WHHA 3M0RA 4FYXB 3SD4A 2RI5A 3RNJA 1X43A 2ECZA 1K73U 1YN8A 2A3LA 4JRIA 2K3YA 1I8FA 1W2BS 4M7DB 3OS0A 1YJWT 2KBTA 4KH1B 3JCMP 1PC0A 5LJ3f 5DM7R 1TXQA 1QWFA 3EFRA 2D0QB 3CC2Q 2DVEA 3UPUA 3L2RA 2LJ3A 1ZLMA 2KY9A 4EMKB 1IRXA 2XI9A 2LCSA 2RQRA 4FW2A 4JJNK 3QO3A 4QVZA 2K5IA 4OGCA 1UFFA 5I2SA 1VQ4Q 2E3IA 1KFZA 2KYBA 2K5LA 1UGVA 2EQJA 1K76A 2JN0A 1GFDA 2JZ2A 1AD5A 2EQKA 1YI2A 3NMZC 2AHJB 1BCOA 4Z89A 1GFCA 3R6NA 2CUBA 2AKLA 2YRCA 1YHQT 1G3WA 3C4SA 2O31A 1N8RC 4A4KA 3QPHA 2RI3A 3OSSC 1D1AA 2L89A 4KH0B 5IXFA 1UGPB 4MDWA 3QIIA 4CC3A 1KK7A 2XIDA 3INZA 3CBOA 5CKEA 2ED0A 1WHJA 3P8BB 1Y7XA 3CBPA 2F1LA 2D0NA 2YT6A 1VQ5A 5D6XA 1RUWA 4OMQA 1VQKA 3LWIA 1LNXA 1A0NB 4LN2A 4M7DF 2QA4T 3CCEQ 1HYOA 3CXCS 4DBFA 5KYYA 3CXCA 3DLMA 3CCUA 2ABLA 2V8IA 3G4SA 4O6JA 1FMKA 1OZ2A 4AG2C 3CCMA 1NJIR 5GANg 2XK0A 1PM3A 3S3OA 2MWOA 2CP3A 3SWNB 1ZA2B 1YITT 1M1FA 1XOVA 3CCSQ 1D1CA 4C0ZA 5LL6S 4JRPA 3PVLA 4C0DC 3N5BB 3CCJT 5I21A 4PJOG 5LJ5h 1T3SA 1QVFP 2VGMA 3JB9D 2EYXA 2CZ6B 4DEXA 1D3BA 2Y4YA 2KRMA 3JCMX 2X9HA 5FW9A 1SRMA 4EMGA 1BI1A 4J7IA 2FRWA 4HXJA 3VUZA 2P0QA 4XU3A 2QTXA 2DD4A 1K9MU
chains in the Genus database with same CATH topology
5I11A 1T0HA 1NLOC 1UE9A 1YNZA 1YWOA 1LCKA 5GJWB 1JU5C 3REBB 1UTIA 2NUZA 2W10A 4RTYA 3EHQA 1YCSB 1AWWA 1K1ZA 4Y92A 2PTKA 3SHWA 2BZ8A 2VKNA 1QKXA 1TUCA 1RI9A 1WI7A 1AWXA 2RNAA 5IXBA 2JM8A 3M0TA 3ULRB 2CDTA 2O88A 2JS0A 2KXCA 1VYTA 2A37A 2JTEA 1SEMA 2J6OA 4RTXA 4CC4B 2LP5A 1OPKA 2RQTA 1QWEA 1FYNA 1OOTA 4AFUC 2RQUA 3EG2A 3VRZA 1OV3A 5L23A 2DILA 4ZNXA 1GCPA 4OMPA 2KRNA 2O9VA 3VS3A 1K0SA 2DL3A 2V1RA 2KEAA 3C0CA 1CKBA 4DEYA 2LQWA 3SEMA 4HCKA 1MV0B 2YUPA 2DX1A 1QCFA 3I5RA 1K4US 2DLPA 1NYFA 1PNJA 2KXDA 1ZBJA 2KT8A 2DL7A 1Y57A 2DRKA 1UG1A 1NYGA 1WLPB 1J3TA 2O9SA 3EGUA 1E6GA 1U5SA 2ROLA 2DBKA 5IHKA 1M3BA 2DYBA 2J6FA 2FG0A 2DL5A 3H0IA 1ZUUA 3I5SA 4IIOA 3UA6A 3UATA 2G6FX 1PWTA 2BTTA 3EG1A 5ECAA 1GBQA 3PE0A 4JPBW 2QDLA 3M0UA 3LH5A 4F14A 1X27A 4LNPA 1HSQA 4J9DA 1W70A 3M0SA 5FWCA 2F2WA 1SHGA 1M8MA 2DJQA 2KRSA 1N5ZA 1ZUKA 4CC2A 1W6XA 5I22A 3REAB 2ENMA 4M4ZA 2JMAA 2MCNA 4OMNA 4JZ4A 3VS5A 4A63B 1EFNA 1SSHA 2DL4A 2W0ZA 1MUZA 1SPKA 3ZL7C 1OEBA 2O2OA 2MIOA 1S1NA 2KGTA 5IH2A 2J05A 2C0OA 2K9GA 1HD3A 4EIKA 2C0IA 2GTJA 4OMOA 1X2KA 1TUDA 2K2MA 2RPNA 4CC7A 2VVKA 3PVQA 3M0QA 2JXBA 1G2BA 4F17A 2LNHB 1WIEA 5IHNA 1KIKA 2IIMA 2DM1A 3FJ5A 2EYWA 2LZ6B 1SHFA 2DRMA 4FSSA 3H0FA 2NWMA 2EQIA 2X3XD 1M30A 4Z88A 1X69A 1Z9ZA 3H41A 1ABOA 2FO0A 3THKA 4AFQC 3JV3A 2DNUA 1IO6A 2YSQA 2I0NA 3GBQA 2KE9A 1H92A 4J9IA 1PKTA 4D8KA 1BK2A 2EGEA 3UA7A 1NLPC 3TSWA 4GLMA 2YUOA 2EKHA 1WYXA 4JJBA 3QWYA 2BZXA 2KT1A 2AK5A 1MV3A 1KJWA 1UUEA 2HBWA 1I1JA 1E6HA 2SRCA 2J6KA 2RN8A 2RQVA 4Z8AA 2KYMA 4ORZA 4JZ3A 2GTOA 4RTWA 4J9BA 4RTVA 2J06A 3EHRA 3QWXX 2L3PA 2X3WD 1M27C 2HDAA 2OI3A 1H8KA 2ED1A 2JMCA 1WFWA 1PRLC 2BZYA 1WXUA 4QT7A 2XMFA 3H0HA 4GBQA 1WXBA 2OAWA 1UHCA 2M51A 4OMLA 2HCKA 1JQQA 2EW3A 2A36A 3UF4A 2CUDA 1AWOA 1W1FA 1NEGA 2FEIA 1K9AA 2EVRA 2HSPA 3M0PA 2JM9A 1UECA 4J9CA 1NM7A 1Y0MA 1B3QA 1I07A 4RTZA 1ZSGA 2L3QA 1TG0A 2DF6A 5GJVB 2RF0A 3VS0A 4J9GA 4LUEA 2K7AA 2LJ0A 2A08A 1NG2A 2A28A 3VS7A 1GBRA 4KRTA 2EGAA 2JS2A 3I9QA 2LQNA 4AFSC 4IIMA 5EC7A 1X2QA 3O5ZA 4HVUA 1GCQC 1JO8A 2D8JA 2KR3A 2LJ1A 1U3OA 2FPDA 4E6RA 2CH4W 2L2PA 1AZGB 1SRLA 4JJCA 2CT3A 2L0AA 2ESWA 1JXMA 2YDLA 1RLQC 2P4RA 2DL8A 2CH4A 2GNCA 4JJDA 1RLPC 2AZVA 1CKAA 4WCIA 1T3LA 1K0XA 2K79A 3M0RA 3VS2A 3RNJA 1X43A 3I35A 2ECZA 1YN8A 4RUGA 3VRYA 1AZEA 2CSQA 1WX6A 2PNIA 1X6GA 2CSIA 2FPEA 4RTTA 2JT4A 2AZSA 1PRMC 2KBTA 2H8HA 2RQWA 2FPFA 2GBQA 2J7IA 1PKSA 4X1VA 1QWFA 4F16A 2MOXA 2RMOA 2KNBB 2LJ3A 4LUDA 2V1QA 3NGPA 2EYZA 4J9HA 1ZLMA 2LCSA 1HJDA 2JW4A 2YUNA 4J9EA 2RQRA 2K6DA 1PHTA 1AOJA 1QLYA 4ESRA 1UFFA 1WDXA 1KFZA 2KYBA 2CREA 2EBPA 1VYVA 2K3BA 1UGVA 2OJ2A 3KFVA 1K76A 1GFDA 1AWJA 1H3HA 1JEGA 1AD5A 2EYYA 5IHIA 2CT4A 1UDLA 4R0KA 4K11A 3NMZC 5FWBA 3RBBB 1U06A 2HEQA 1E7OA 1WXTA 4Z89A 2AKKA 1BU1A 2ROTA 1GFCA 3R6NA 1ABQA 4AG1C 2CUBA 3CQTA 4AFZC 2AKLA 1BB9A 3TVTA 1B07A 1T0JA 2VWFA 2O31A 2GQIA 4HVWA 2E5KA 1QKWA 2F2XA 2YUQA 4D8DA 3NPFA 1VYUA 4OMMA 3VS4A 5IXFA 4J9FA 1ZX6A 4CC3A 1UJ0A 2DVJA 2ED0A 1WA7A 2B86A 2D0NA 3EG0A 3VS6A 3U23A 2YT6A 2L3SA 2EGCA 1Z9QA 1RUWA 3NHNA 4OMQA 1UJYA 1YP5A 1VA7A 1X6BA 4LE9A 1A0NB 2F2VA 4LN2A 2KROA 1JXOA 1GRIA 1M3AA 1ZUYA 1AEYA 1BBZA 2LX7A 4HVVA 5HCKA 2DBMA 2ABLA 1FMKA 1GCQA 2D1XA 3EG3A 1KSWA 4AG2C 3TSZA 1G83A 1GL5A 1CSKA 1XOVA 4RTUA 2C0TA 2FRYA 2DMOA 2D8HA 2LMJA 3PVLA 1UHFA 3A98A 1NEBA 1T3SA 2EPDA 1V1CA 2EYXA 4DEXA 2PZ1A 2KRMA 1M3CA 5FW9A 3VS1A 2DA9A 1SRMA 1OPLA 1YWPA 1I0CA 2DE0X 3IQLA 1ARKA 2FRWA 4HXJA 2GGRA 2M0YA 1AVZC 2SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I11 A;  1T0H A;  1NLO C;  1UE9 A;  1YNZ A;  1YWO A;  1LCK A;  5GJW B;  1JU5 C;  3REB B;  1UTI A;  2NUZ A;  2W10 A;  4RTY A;  3EHQ A;  1YCS B;  1AWW A;  1K1Z A;  4Y92 A;  2PTK A;  3SHW A;  2BZ8 A;  2VKN A;  1QKX A;  1TUC A;  1RI9 A;  1WI7 A;  1AWX A;  2RNA A;  5IXB A;  2JM8 A;  3M0T A;  3ULR B;  2CDT A;  2O88 A;  2JS0 A;  2KXC A;  1VYT A;  2A37 A;  2JTE A;  1SEM A;  2J6O A;  4RTX A;  4CC4 B;  2LP5 A;  1OPK A;  2RQT A;  1QWE A;  1FYN A;  1OOT A;  4AFU C;  2RQU A;  3EG2 A;  3VRZ A;  1OV3 A;  5L23 A;  2DIL A;  4ZNX A;  1GCP A;  4OMP A;  2KRN A;  2O9V A;  3VS3 A;  1K0S A;  2DL3 A;  2V1R A;  2KEA A;  3C0C A;  1CKB A;  4DEY A;  2LQW A;  3SEM A;  4HCK A;  1MV0 B;  2YUP A;  2DX1 A;  1QCF A;  3I5R A;  1K4U S;  2DLP A;  1NYF A;  1PNJ A;  2KXD A;  1ZBJ A;  2KT8 A;  2DL7 A;  1Y57 A;  2DRK A;  1UG1 A;  1NYG A;  1WLP B;  1J3T A;  2O9S A;  3EGU A;  1E6G A;  1U5S A;  2ROL A;  2DBK A;  5IHK A;  1M3B A;  2DYB A;  2J6F A;  2FG0 A;  2DL5 A;  3H0I A;  1ZUU A;  3I5S A;  4IIO A;  3UA6 A;  3UAT A;  2G6F X;  1PWT A;  2BTT A;  3EG1 A;  5ECA A;  1GBQ A;  3PE0 A;  4JPB W;  2QDL A;  3M0U A;  3LH5 A;  4F14 A;  1X27 A;  4LNP A;  1HSQ A;  4J9D A;  1W70 A;  3M0S A;  5FWC A;  2F2W A;  1SHG A;  1M8M A;  2DJQ A;  2KRS A;  1N5Z A;  1ZUK A;  4CC2 A;  1W6X A;  5I22 A;  3REA B;  2ENM A;  4M4Z A;  2JMA A;  2MCN A;  4OMN A;  4JZ4 A;  3VS5 A;  4A63 B;  1EFN A;  1SSH A;  2DL4 A;  2W0Z A;  1MUZ A;  1SPK A;  3ZL7 C;  1OEB A;  2O2O A;  2MIO A;  1S1N A;  2KGT A;  5IH2 A;  2J05 A;  2C0O A;  2K9G A;  1HD3 A;  4EIK A;  2C0I A;  2GTJ A;  4OMO A;  1X2K A;  1TUD A;  2K2M A;  2RPN A;  4CC7 A;  2VVK A;  3PVQ A;  3M0Q A;  2JXB A;  1G2B A;  4F17 A;  2LNH B;  1WIE A;  5IHN A;  1KIK A;  2IIM A;  2DM1 A;  3FJ5 A;  2EYW A;  2LZ6 B;  1SHF A;  2DRM A;  4FSS A;  3H0F A;  2NWM A;  2EQI A;  2X3X D;  1M30 A;  4Z88 A;  1X69 A;  1Z9Z A;  3H41 A;  1ABO A;  2FO0 A;  3THK A;  4AFQ C;  3JV3 A;  2DNU A;  1IO6 A;  2YSQ A;  2I0N A;  3GBQ A;  2KE9 A;  1H92 A;  4J9I A;  1PKT A;  4D8K A;  1BK2 A;  2EGE A;  3UA7 A;  1NLP C;  3TSW A;  4GLM A;  2YUO A;  2EKH A;  1WYX A;  4JJB A;  3QWY A;  2BZX A;  2KT1 A;  2AK5 A;  1MV3 A;  1KJW A;  1UUE A;  2HBW A;  1I1J A;  1E6H A;  2SRC A;  2J6K A;  2RN8 A;  2RQV A;  4Z8A A;  2KYM A;  4ORZ A;  4JZ3 A;  2GTO A;  4RTW A;  4J9B A;  4RTV A;  2J06 A;  3EHR A;  3QWX X;  2L3P A;  2X3W D;  1M27 C;  2HDA A;  2OI3 A;  1H8K A;  2ED1 A;  2JMC A;  1WFW A;  1PRL C;  2BZY A;  1WXU A;  4QT7 A;  2XMF A;  3H0H A;  4GBQ A;  1WXB A;  2OAW A;  1UHC A;  2M51 A;  4OML A;  2HCK A;  1JQQ A;  2EW3 A;  2A36 A;  3UF4 A;  2CUD A;  1AWO A;  1W1F A;  1NEG A;  2FEI A;  1K9A A;  2EVR A;  2HSP A;  3M0P A;  2JM9 A;  1UEC A;  4J9C A;  1NM7 A;  1Y0M A;  1B3Q A;  1I07 A;  4RTZ A;  1ZSG A;  2L3Q A;  1TG0 A;  2DF6 A;  5GJV B;  2RF0 A;  3VS0 A;  4J9G A;  4LUE A;  2K7A A;  2LJ0 A;  2A08 A;  1NG2 A;  2A28 A;  3VS7 A;  1GBR A;  4KRT A;  2EGA A;  2JS2 A;  3I9Q A;  2LQN A;  4AFS C;  4IIM A;  5EC7 A;  1X2Q A;  3O5Z A;  4HVU A;  1GCQ C;  1JO8 A;  2D8J A;  2KR3 A;  2LJ1 A;  1U3O A;  2FPD A;  4E6R A;  2CH4 W;  2L2P A;  1AZG B;  1SRL A;  4JJC A;  2CT3 A;  2L0A A;  2ESW A;  1JXM A;  2YDL A;  1RLQ C;  2P4R A;  2DL8 A;  2CH4 A;  2GNC A;  4JJD A;  1RLP C;  2AZV A;  1CKA A;  4WCI A;  1T3L A;  1K0X A;  2K79 A;  3M0R A;  3VS2 A;  3RNJ A;  1X43 A;  3I35 A;  2ECZ A;  1YN8 A;  4RUG A;  3VRY A;  1AZE A;  2CSQ A;  1WX6 A;  2PNI A;  1X6G A;  2CSI A;  2FPE A;  4RTT A;  2JT4 A;  2AZS A;  1PRM C;  2KBT A;  2H8H A;  2RQW A;  2FPF A;  2GBQ A;  2J7I A;  1PKS A;  4X1V A;  1QWF A;  4F16 A;  2MOX A;  2RMO A;  2KNB B;  2LJ3 A;  4LUD A;  2V1Q A;  3NGP A;  2EYZ A;  4J9H A;  1ZLM A;  2LCS A;  1HJD A;  2JW4 A;  2YUN A;  4J9E A;  2RQR A;  2K6D A;  1PHT A;  1AOJ A;  1QLY A;  4ESR A;  1UFF A;  1WDX A;  1KFZ A;  2KYB A;  2CRE A;  2EBP A;  1VYV A;  2K3B A;  1UGV A;  2OJ2 A;  3KFV A;  1K76 A;  1GFD A;  1AWJ A;  1H3H A;  1JEG A;  1AD5 A;  2EYY A;  5IHI A;  2CT4 A;  1UDL A;  4R0K A;  4K11 A;  3NMZ C;  5FWB A;  3RBB B;  1U06 A;  2HEQ A;  1E7O A;  1WXT A;  4Z89 A;  2AKK A;  1BU1 A;  2ROT A;  1GFC A;  3R6N A;  1ABQ A;  4AG1 C;  2CUB A;  3CQT A;  4AFZ C;  2AKL A;  1BB9 A;  3TVT A;  1B07 A;  1T0J A;  2VWF A;  2O31 A;  2GQI A;  4HVW A;  2E5K A;  1QKW A;  2F2X A;  2YUQ A;  4D8D A;  3NPF A;  1VYU A;  4OMM A;  3VS4 A;  5IXF A;  4J9F A;  1ZX6 A;  4CC3 A;  1UJ0 A;  2DVJ A;  2ED0 A;  1WA7 A;  2B86 A;  2D0N A;  3EG0 A;  3VS6 A;  3U23 A;  2YT6 A;  2L3S A;  2EGC A;  1Z9Q A;  1RUW A;  3NHN A;  4OMQ A;  1UJY A;  1YP5 A;  1VA7 A;  1X6B A;  4LE9 A;  1A0N B;  2F2V A;  4LN2 A;  2KRO A;  1JXO A;  1GRI A;  1M3A A;  1ZUY A;  1AEY A;  1BBZ A;  2LX7 A;  4HVV A;  5HCK A;  2DBM A;  2ABL A;  1FMK A;  1GCQ A;  2D1X A;  3EG3 A;  1KSW A;  4AG2 C;  3TSZ A;  1G83 A;  1GL5 A;  1CSK A;  1XOV A;  4RTU A;  2C0T A;  2FRY A;  2DMO A;  2D8H A;  2LMJ A;  3PVL A;  1UHF A;  3A98 A;  1NEB A;  1T3S A;  2EPD A;  1V1C A;  2EYX A;  4DEX A;  2PZ1 A;  2KRM A;  1M3C A;  5FW9 A;  3VS1 A;  2DA9 A;  1SRM A;  1OPL A;  1YWP A;  1I0C A;  2DE0 X;  3IQL A;  1ARK A;  2FRW A;  4HXJ A;  2GGR A;  2M0Y A;  1AVZ C;  2SEM A; 
#chains in the Genus database with same CATH topology
 3ZEH A;  3FEO A;  1PSF A;  3REB B;  2W10 A;  4M75 D;  1IXD A;  4RTY A;  3EHQ A;  2RI2 A;  3MJX A;  1D09 B;  3GPL A;  2EQU A;  3SHW A;  3FC3 A;  2BZ8 A;  2YHT A;  2JVV A;  4CI0 C;  1WI7 A;  4EPC A;  1EZZ B;  4FT2 A;  2JM8 A;  2RM4 A;  3CC4 A;  3H9N A;  2O88 A;  4RTX A;  4CC4 B;  1RAB B;  2OAU A;  2PVG B;  1NBE B;  3OYC A;  5D6W A;  3T9N A;  4ELY C;  5GAO l;  1FYN A;  5HK3 A;  3RER A;  4AFU C;  1QQJ A;  3GP8 A;  1MMD A;  2DIL A;  2CS7 A;  5GMK l;  3CCS A;  5KE2 A;  4C5I A;  2O9V A;  2ZCF B;  1LOJ A;  2QEX T;  2E70 A;  2DXU A;  1RAE B;  3M55 A;  1K4U S;  2FVU A;  2DLP A;  3OS1 A;  3QHS A;  4CRI A;  2RJE A;  3UT1 A;  2RJF A;  2DL7 A;  1VQ5 Q;  4P5N A;  3A1P A;  4JLG A;  3OMG A;  3TQ7 P;  1B7T A;  4XU2 A;  1RAC B;  3G71 T;  1Q82 R;  1QVG A;  3QXE B;  2O9S A;  5A0L A;  3EGU A;  4ZTJ A;  1U5S A;  4M7A B;  2DBK A;  2DD5 A;  5IHK A;  2DL5 A;  1ZUU A;  3UA6 A;  4LXC A;  2NLU A;  2QYZ A;  1UGQ B;  2G6F X;  2BTT A;  3EG1 A;  3M4Y A;  3V8K A;  4GY5 A;  4F14 A;  1YHQ A;  4DOV A;  4M7D C;  3CC4 T;  3OYD A;  5DLQ E;  1Q82 C;  2ZZD A;  2FHD A;  3OYE A;  5FU6 C;  3AHU A;  2ZPE B;  2AT1 B;  5KYU A;  4MZP A;  5HY6 A;  2F2W A;  4BY6 B;  2JOY A;  1M8M A;  2KRS A;  3MEW A;  1ACM B;  4J6W A;  4CC2 A;  5I22 A;  1D1B A;  3CCV Q;  2ENM A;  4M4Z A;  4PFO A;  4B9X A;  4OMN A;  3VS5 A;  3CCU Q;  4A63 B;  4F7U F;  1Q86 R;  2DL4 A;  2QG9 B;  2NYS A;  2QQ9 A;  1SPK A;  3ZL7 C;  2A0F B;  2MIO A;  1KHC A;  4BAC A;  3M58 A;  3CCV A;  3MEA A;  1JBM A;  4A54 A;  1EX4 A;  3CD6 A;  1AHJ B;  3E19 A;  4ANJ A;  1WJR A;  3MCA B;  2NUP A;  2CP6 A;  3SFM A;  2X4J A;  1IGU A;  2JXB A;  1RAA B;  4MMK A;  3JCM f;  1KIK A;  2IIM A;  4M75 F;  3EGD A;  3L1A A;  2EYW A;  2LZ6 B;  1SG5 A;  4C92 G;  4UC4 A;  1YCY A;  1X69 A;  3FJP A;  2CGH A;  3A8M B;  2DNU A;  4M77 C;  2HSE B;  4ME7 A;  4BI3 A;  4J9I A;  1PKT A;  2DK3 A;  5LJ5 e;  2EGE A;  3HKS A;  5LJ5 f;  5M9O A;  1YJ9 Q;  4PJM A;  5CCA A;  4M7A A;  2YUO A;  4JJB A;  1WYX A;  4BI8 B;  3DKM A;  3A8L B;  1VQ8 A;  5CQX A;  3G6E Q;  1BCM A;  1Y71 A;  1Q81 U;  1MMA A;  1KC8 U;  3QDF A;  3CCR T;  2FZC B;  4M7D G;  1G8X A;  1K73 R;  5CVI A;  4Z8A A;  2KYM A;  1VQ6 Q;  3GNG A;  3LW5 E;  3PIP A;  3CD6 Q;  4J9B A;  2J06 A;  3QWX X;  2EFI A;  2OI3 A;  2LVM A;  4RCC A;  1IGQ A;  1WXU A;  3H0H A;  3CCM Q;  2DXC A;  1H3Z A;  3CCL Q;  4MZM A;  1UHC A;  4OML A;  2LNV A;  2DXT A;  3RMQ A;  4LD9 K;  4NL3 A;  3BW1 A;  4BDY A;  5GAN 8;  5GAM g;  2FEI A;  3CC7 Q;  2GCX A;  4J9C A;  4AT1 B;  1QVG S;  1Y0M A;  2HBP A;  3URG A;  3KUF A;  1V29 B;  2K5F A;  3FIF A;  3V7S A;  1TG0 A;  2VC8 A;  3V7R A;  2RB6 A;  2DF6 A;  5GJV B;  4C8Q A;  4QW2 A;  3VS0 A;  4LUE A;  2K7A A;  1NG2 A;  3VS7 A;  4KRT A;  5KCO A;  2LQN A;  4AFS C;  4IIM A;  4FSX A;  4M7D A;  4DBH A;  3OYH A;  3O5Z A;  1VQO Q;  1WJS A;  2MAM A;  4N0A A;  1C0M A;  1U3O A;  4PJN A;  1UB4 A;  2FPD A;  2VXE A;  1QVF S;  4JJC A;  2CT3 A;  2ESW A;  2ZPB B;  2P4R A;  3PFS A;  2CH4 A;  2GNC A;  4FL6 A;  1RLP C;  2AZV A;  4HCZ A;  3PMT A;  1QVP A;  1IHW A;  2K79 A;  3CCJ A;  1MHN A;  4BE0 A;  4PJL A;  3VS2 A;  4PKC C;  5GAN 6;  5FU7 B;  1WX6 A;  4PLL A;  4PJO F;  2CSI A;  2FPE A;  1YIT A;  1KC8 C;  1N27 A;  1PRM C;  2KQW A;  2RQW A;  3L42 A;  3CCM T;  2FB7 A;  4XU0 A;  5GAO n;  4N4H A;  2VYT A;  3LYI A;  2EJF A;  3NGP A;  2RA2 A;  2HL3 A;  1HJD A;  3CMA Q;  2YUN A;  4J9E A;  4HCC A;  1PHT A;  1AOJ A;  2RO0 A;  4IUU A;  3GIB A;  1JJ2 S;  3EFO B;  1YJN T;  2EBP A;  1VQ9 A;  2RHI A;  1R8O B;  1VYV A;  1QMC A;  3CCQ A;  4M77 B;  3KFV A;  1TS9 A;  1H3H A;  5IHI A;  1UDL A;  4K11 A;  4B6M A;  2CP5 A;  5FWB A;  3RBB B;  1U06 A;  4PFP A;  1E7O A;  2AKK A;  2ROT A;  3TU4 K;  4AG1 C;  2KSS A;  4AFZ C;  9ATC B;  1BB9 A;  5GMK h;  3TVT A;  3JCM e;  3CPW P;  2DTO A;  2VWF A;  3C12 A;  2GQI A;  2E5K A;  1QKW A;  2BIV A;  2FL7 A;  4J5Y A;  2L8D A;  4D8D A;  3EH1 A;  3VS4 A;  3M54 A;  3L2U A;  4J9F A;  3CCQ T;  2F5T X;  2L3R A;  2DVJ A;  1N9S A;  3P8D A;  5CK9 A;  3WVE B;  1YP5 A;  4XTZ A;  1X6B A;  4LE9 A;  3M9Q A;  4F7U B;  1JXO A;  2DAQ A;  4HVV A;  3SB2 A;  3SWN A;  2V26 A;  5KYX B;  3HP9 A;  3EG3 A;  1KSW A;  3TSZ A;  3S6W A;  1BIB A;  2M16 A;  1GL5 A;  1CSK A;  2HZY A;  4J6Y A;  4RTU A;  2EJ9 A;  3OYF A;  2C0T A;  2DMO A;  4C5G A;  2LMJ A;  1MMG A;  1UHF A;  2QEX Q;  2QI2 A;  1VQ4 T;  5HK0 A;  2RK2 A;  1NEB A;  2EPD A;  3HHT B;  4N4G A;  1V1C A;  3RDV A;  3EFS A;  2EKO A;  2M0O A;  1M90 U;  1QW1 A;  1YWP A;  4XAX B;  2DE0 X;  4QQ6 A;  1KD1 R;  2QGF B;  2WSF E;  2EQM A;  1VIE A;  3M56 A;  3M4G A;  1WNL A;  1AVZ C;  2SEM A;  2YRV A;  4C8Q D;  4JS5 A;  4C92 E;  3EAE A;  4PNO A;  5GAO p;  1UE9 A;  1YNZ A;  3CXC P;  3M57 A;  1LCK A;  2NUZ A;  1YCS B;  2DEQ A;  1MND A;  1ZSZ B;  1OUL A;  2E64 A;  2VKN A;  3SDZ A;  4C92 C;  3FB9 A;  4PJO A;  2RNA A;  4J83 A;  5IXB A;  5LJ5 d;  4DQ2 A;  3M0T A;  1BI0 A;  3QZ5 B;  2JS0 A;  2KXC A;  4E7K A;  1VYT A;  1VOM A;  4XTU A;  3RKY A;  3P8H A;  3CCV T;  4ZTF A;  4X34 A;  1QWE A;  4OGE A;  3MKD A;  1OOT A;  2RQU A;  3JCM d;  1M90 C;  4OB1 B;  2I2L A;  1OV3 A;  5GAO r;  1SF9 A;  4C0F A;  4ZNX A;  4OMP A;  2KRN A;  4JS4 A;  1K0S A;  1QVG P;  2LQW A;  2VUB A;  2GQV A;  2YUP A;  4NS5 A;  1VQL Q;  1QCF A;  5GAN 2;  3I5R A;  1OYX A;  3OYA A;  1NYF A;  1PNJ A;  2WSE E;  2KT8 A;  1FMW A;  4XTY A;  1RAF B;  2MF2 A;  1UG1 A;  4KBM B;  1NYG A;  4M77 G;  1VQK T;  2V8K A;  1E6G A;  3CPW S;  5GAO q;  3OYI A;  1M3B A;  2DYB A;  2J6F A;  3H0I A;  4QKU A;  1XJW B;  1FWZ A;  2YRD A;  4IIO A;  2DYI A;  3UAT A;  1GBQ A;  3PE0 A;  4JPB W;  4MML A;  2QDL A;  4Z02 A;  1U1T A;  4M7A D;  3M0U A;  2E3H A;  3V8L A;  1VQ8 T;  4LNP A;  3NFC A;  2MK5 A;  3LLR A;  2OTL T;  1MMN A;  1VQP Q;  1Q82 U;  4OVA A;  3UDC A;  1I5L A;  3CCR Q;  4M77 F;  3DB3 A;  1SHG A;  1Q86 U;  2DJQ A;  5CKB A;  4HKE A;  1OZ3 A;  1N5Z A;  1VQ6 T;  5IT9 E;  3CCE A;  2JMA A;  4DOW A;  5EG2 A;  1VQ7 A;  1OEB A;  2P84 A;  2O2O A;  3S3M A;  1C6V X;  2J05 A;  3QJY A;  1JJ2 P;  2C0O A;  4C5H A;  3CC7 A;  2DZ9 A;  3JCM b;  3RKX A;  4EIK A;  4FT4 A;  3CCL T;  1DJ7 B;  1X2K A;  4GLK A;  2XU8 A;  1VQL T;  2O4X A;  4FYW B;  4C8Q B;  2K2M A;  2RPN A;  2VVK A;  3EG9 B;  1M5Q 1;  3RES A;  2F69 A;  4IUQ A;  4A4F A;  4OB3 B;  1G2B A;  1WIE A;  2XIC A;  2P0P A;  4M78 F;  3X26 B;  3I55 A;  2VXF A;  3RUX A;  2DRM A;  4FSS A;  2X3X D;  2EWN A;  2PUK B;  3UWN A;  2DKG A;  3JB9 J;  1IO6 A;  4C92 F;  2YSQ A;  1S72 Q;  1O9S A;  3OY9 A;  4BD3 A;  2RHZ A;  3LGL A;  4TVR A;  3OYM A;  1WQ7 A;  5FU6 B;  2PU9 B;  1VQO T;  3L2Z A;  4KGV B;  5J39 A;  5FRO A;  5KE3 A;  1RI0 A;  1JB0 E;  3CC4 Q;  2LT4 A;  1KHI A;  2MYS A;  2OTL Q;  1RAD B;  1YJ9 A;  1I1J A;  1E6H A;  2MPX C;  3MHX A;  4QVD A;  2RQV A;  2Y4X A;  2YXY A;  4JZ3 A;  2GTO A;  4RTW A;  1VQ9 T;  1YJN A;  3EHR A;  1RAG B;  3OYL A;  1I4K 1;  5IN1 A;  1TWB A;  4M78 C;  3O8V A;  2K2V A;  2XMF A;  1WXB A;  1K8A U;  3OYY A;  2O01 E;  2M51 A;  3QYH B;  3CME T;  2QAS A;  2HCK A;  4IUP A;  1X6O A;  2EW3 A;  8ATC B;  2A36 A;  4KUL A;  1W1F A;  1R77 A;  2QEX A;  1K9M R;  2KDS A;  1K9A A;  2EVR A;  4BE2 A;  5AT1 B;  1VQM Q;  4FYV B;  1B3Q A;  4RTZ A;  1ZSG A;  2H3J A;  4RG8 A;  5L8R E;  5A2Q E;  2IVW A;  2NUP B;  2DJZ A;  5GAO m;  1BKB A;  1JJ2 A;  4J9G A;  1KQS A;  3VYH B;  3I55 T;  4NOY A;  3I9Q A;  3A5Z B;  4WF2 A;  1X2Q A;  4HVU A;  1JO8 A;  4M77 A;  2DIQ A;  2CH4 W;  1VQN A;  3RKW A;  1VQP A;  1NPR A;  2L0A A;  3OW2 S;  3X20 B;  1RLQ C;  2VV5 A;  4M77 E;  4JJD A;  5LJ3 e;  5IAY A;  3E2U A;  1C1A A;  5GAM j;  4WCI A;  4M75 E;  2K4Y A;  1K0X A;  1TUG B;  2DEU A;  1BYM A;  4B9W A;  3BDL A;  3VRY A;  1AZE A;  2PNI A;  4C8Q E;  2QA4 Q;  4PJO E;  2RJD A;  2AZS A;  4OP0 A;  4PJJ A;  5KYN A;  2H8H A;  2FPF A;  2GBQ A;  2J7I A;  3NTH A;  4X1V A;  4F16 A;  3CME A;  3X24 B;  1VQM A;  2RMO A;  5GAM f;  2RK1 A;  1VQL A;  2KNB B;  4LUD A;  3A8O B;  5LJ3 j;  2JW4 A;  2KVQ G;  2K6D A;  4C0D B;  2LQK A;  1QLY A;  1BIA A;  2XDD A;  1WDX A;  4OB0 B;  5GAN h;  1K8A C;  4DA4 A;  1KQ1 A;  2OJ2 A;  3PT9 A;  3GLX A;  1AWJ A;  4XTV A;  2EYY A;  4PLI A;  4R0K A;  2RD1 A;  4RMO A;  3CC2 A;  1BU1 A;  2BUD A;  1ABQ A;  1Y96 B;  1B34 B;  1ZHI A;  2HKN A;  1T0J A;  5HKC A;  4HVW A;  4PL6 A;  1M2V A;  3EFO A;  4HA8 A;  4KUI A;  3JRZ A;  1O75 A;  2F2X A;  2YUQ A;  3ME9 A;  1R0B G;  4OMM A;  5CAI A;  1ZX6 A;  1RL2 A;  5FU7 C;  1Y07 A;  1UJ0 A;  5GAN 5;  1OQK A;  1WA7 A;  5DY9 A;  2B86 A;  3NTI A;  3VS6 A;  3U23 A;  4M78 D;  2L3S A;  1XTD A;  1ZSZ C;  1Z9Q A;  2QTV A;  4FU6 A;  1UJY A;  3CCR A;  1VA7 A;  1VQN Q;  1NZ9 A;  2F2V A;  4A4G A;  2KRO A;  4O5V A;  1GRI A;  1M3A A;  1AEY A;  3GOX A;  2LX7 A;  3OSV A;  1GCQ A;  4EMK C;  3G1J A;  5GMK e;  2QK0 A;  1G83 A;  3HFN A;  3I56 A;  2D8H A;  3GF5 A;  2E5Q A;  3MP1 A;  4OMF B;  4X9C A;  1YJN Q;  2OTJ Q;  5GAN d;  5GAM e;  3VYG A;  3HRT A;  1M3C A;  3VS1 A;  2DA9 A;  3VV0 A;  3AT1 B;  3G4S Q;  1OPL A;  1NE8 A;  4R55 A;  3IQL A;  1ARK A;  1I81 A;  3G71 Q;  3JCM h;  2KK4 A;  1TH7 A;  3PMI A;  3JCM Q;  5C0M A;  3LH0 A;  5I11 A;  1T0H A;  2HMA A;  3JCM V;  1N9R A;  1NLO C;  1UTI A;  1IZ6 A;  1S72 A;  4PJO B;  1AWW A;  1M4Z A;  1K1Z A;  4II1 A;  5KYY B;  3CPW A;  1RI9 A;  2QGG A;  2P4T A;  1VQ8 Q;  4BI4 A;  2RHX A;  1VQ6 A;  1HXD A;  4KGZ B;  2CDT A;  2EYQ A;  5LJ3 h;  1VQP T;  2A37 A;  2BE9 B;  2JTE A;  1SEM A;  2QDY B;  2LP5 A;  3CCE T;  1OPK A;  2B8A A;  3VU3 C;  4L6V 5;  4E7Z A;  3EG2 A;  5L23 A;  5LJ5 j;  2FYK A;  3I56 Q;  3CCS T;  2PUO B;  1GCP A;  3J80 E;  3VS3 A;  4LDY A;  1CKB A;  2BE7 D;  5GMK i;  1D0X A;  1MV0 B;  1RAH B;  2DET A;  2PQW A;  4F7U G;  3LGF A;  3JB9 G;  5I2M A;  2KXD A;  3VUB A;  2XKO C;  3VKI A;  1YI2 Q;  1Y57 A;  2HAX A;  3OYN A;  3QSU A;  4JLI A;  3JB9 F;  4LDX A;  2JUF A;  2PVO B;  4JUV A;  2RH2 A;  2XD0 A;  3OYG A;  3OW2 P;  1QCO A;  2WSC E;  4FIB A;  4EMK A;  5GMK j;  1S72 T;  2CZ1 B;  3I5S A;  3M5A A;  1Q7Y C;  1BI2 A;  3WXM B;  1G5V A;  1KC8 R;  1SKU B;  5ECA A;  1YJ9 T;  4DBR A;  1PCX A;  3MO8 A;  3TRE A;  4ZN1 A;  4C8Q F;  1QP3 A;  5CKF A;  3LH5 A;  1X27 A;  3A8G B;  4MDX A;  2MI6 A;  4M78 B;  2LTO A;  2CZ7 B;  2DER A;  5J3B A;  4M7D D;  5J26 A;  4KGX B;  3L2W A;  1ZUK A;  1W6X A;  2MCN A;  4JZ4 A;  1EFN A;  2LCC A;  2W0Z A;  1YIJ A;  1MUZ A;  3OYK A;  1IB8 A;  2JTF A;  4HCB A;  1S1N A;  2A7Y A;  2OTJ A;  4F04 B;  2KGT A;  1K8A R;  5IH2 A;  5KYW B;  1M1G A;  5KYW A;  2ZAE A;  3H6Z A;  2H3E B;  2QQS A;  2WAC A;  4OB2 B;  2K9G A;  2DPP B;  1XQH A;  3RMS A;  2E1H A;  3CME Q;  1TUD A;  5GMK m;  3HRS A;  1D3B B;  3HPW A;  3PVQ A;  3J7A F;  5KYU B;  1VQ4 A;  3JB9 H;  3OB9 A;  2QQA A;  4C8Q C;  1YI2 T;  4LDU A;  2DM1 A;  4VUB A;  1K73 C;  3FJ5 A;  3H8Z A;  1NJI C;  1SHF A;  1M1K C;  3H0F A;  2NWM A;  2EQI A;  1OX9 A;  1M30 A;  3BE3 A;  1MNE A;  1ABO A;  3JV3 A;  2X51 A;  1M1K R;  5GAM h;  3GBQ A;  2E6N A;  2KE9 A;  1H92 A;  3ZBD A;  1PD0 A;  1BK2 A;  4R56 A;  3UA7 A;  1NLP C;  4RCB A;  4QVC A;  1IHV A;  4NL2 A;  1WHM A;  2BZX A;  2Y90 A;  2E10 A;  3R6O A;  3MP8 A;  3PGG A;  2KT1 A;  2MMP A;  4N4I A;  2AK5 A;  1EIF A;  4JRQ A;  2EIF A;  1UUE A;  3JCM c;  2J6K A;  3A8H B;  3BY7 A;  1ZQ1 A;  3L2Q A;  1W2B A;  4ORZ A;  3CBM A;  1YIJ T;  2AIR B;  3PIO A;  2L3P A;  2X3W D;  2HDA A;  2E65 A;  1YJW Q;  2RHY A;  4XQ3 A;  4ATO A;  1BI3 A;  1WFW A;  2BZY A;  3QKJ A;  1WHK A;  4QT7 A;  4X9D A;  2R5M A;  4A53 A;  1Q81 C;  3JSC A;  2OAW A;  4J8O A;  2HL5 C;  4XK8 E;  1WHG A;  2M1H A;  1JQQ A;  4IUV A;  2CUD A;  1AWO A;  3LX7 A;  1NEG A;  4Y28 E;  2X4Y A;  3OA6 A;  2LRQ A;  3M0P A;  3TCJ A;  2JM9 A;  3F70 A;  1D0Z A;  1VIF A;  2QA4 A;  2G3R A;  3G7Z A;  4IUR A;  4ZN3 A;  2IG0 A;  1WHL A;  3TEE A;  4M7D E;  4C92 D;  3M53 A;  4ZGJ B;  1M90 R;  1F1B B;  5GAN 3;  4XTX A;  5GAM d;  1M9S A;  1VUB A;  2K3X A;  3X28 B;  1GBR A;  3ZFJ A;  2EGA A;  2JS2 A;  2JNG A;  2D9T A;  5EC7 A;  1YHQ Q;  1GCQ C;  2E12 A;  1B34 A;  1MGQ A;  1UGR B;  1Y96 A;  4E6R A;  5GAN 7;  1AZG B;  3G6E T;  3KBG A;  1RAI B;  3VJP A;  1YBY A;  4IUT A;  2DO3 A;  1CKA A;  2BKD N;  1T3L A;  5A0D A;  1QCN A;  4C92 A;  2GFA A;  3CD6 T;  5LJ3 d;  4M78 E;  5GAN 4;  1YIJ Q;  5KCH A;  1FMV A;  2R58 A;  3I35 A;  4RUG A;  2X4W A;  2CSQ A;  3Q1J A;  3E1S A;  1X6G A;  4RTT A;  2JT4 A;  1NJI U;  2CP7 A;  4ELZ C;  1U8R A;  1VQ7 T;  2COW A;  1PKS A;  2MOX A;  2R5A A;  4FCY A;  3QUI A;  3OMC A;  2V1Q A;  2EYZ A;  4J9H A;  4BY6 C;  7AT1 B;  4FW1 A;  1JRI A;  1TTH B;  1G3Y A;  4ESR A;  2LDM A;  1TU0 B;  3DB4 A;  2CRE A;  1Q95 G;  2K3B A;  3EH2 A;  2COZ A;  1FX7 A;  1M1K U;  1LVK A;  2QQR A;  1JEG A;  3PTA A;  2CT4 A;  4E7I A;  3G4S T;  1PG5 B;  2C06 A;  2GFU A;  2HEQ A;  3PNW C;  4JRK A;  1WXT A;  4ZGD B;  4E7H A;  4M7A C;  3G71 A;  3CQT A;  2DTH A;  5DLO A;  3I55 Q;  1ZA1 B;  1VQO A;  1Q7Y R;  1B07 A;  1NPP A;  4E7J A;  4E7S A;  3J81 E;  4OF1 A;  4FM4 B;  3HSB A;  3NPF A;  1VYU A;  4PFZ A;  3EGX B;  5FRM A;  2YLB A;  2HNI A;  3JCM g;  1KQS P;  2JTM A;  4PJO C;  3EG0 A;  3OW2 A;  2EGC A;  3NHN A;  4E2F B;  1N8R R;  4D6W A;  5A0G A;  2ZPH B;  2ATC B;  1ZUY A;  4C5E A;  1BBZ A;  1V76 A;  4BUG A;  4E7L A;  5HCK A;  1VQ7 Q;  2DBM A;  6AT1 B;  4FYY B;  2D1X A;  3S3N A;  2DFU A;  4LDV A;  4M7A E;  5LJ3 g;  3E9F A;  3HRU A;  2DXB A;  3CMA T;  5CKD A;  2FRY A;  1WQW A;  3DLL A;  1UEB A;  4BDZ A;  5D7U A;  3A98 A;  4M75 B;  4HT9 A;  4N0A C;  2DTI A;  3JCM J;  1LJO A;  3EG9 A;  2PZ1 A;  1R0C B;  2HQH A;  4M77 D;  1WJQ A;  1I0C A;  3HFO A;  3OQ5 A;  1M2O A;  4YTL A;  1VQK Q;  2GGR A;  2LX9 A;  2M0Y A;  3NTK A;  1W2B P;  1LPL A;  2CYZ B;  4M78 A;  2CP0 A;  4RKU E;  2Z0W A;  1YWO A;  2M02 A;  5GJW B;  1JU5 C;  1IRE B;  4M7A G;  4Y92 A;  2PTK A;  2X4X A;  4BB7 A;  2PVD B;  1QKX A;  1TUC A;  5CR2 A;  1AWX A;  3ULR B;  2QXF A;  1M2V B;  4BE1 A;  2KI7 A;  3G6E A;  2J6O A;  1ZBX A;  1VQN T;  4PK4 A;  3QZ9 B;  1K9M C;  3MEV A;  3EGD B;  3SWN C;  1YFN A;  2LT1 A;  1KD1 C;  2RQT A;  2ZPF B;  3CCU T;  2NUT A;  4C0G A;  3VRZ A;  1YIT Q;  5CO7 A;  3E9G A;  3FRN A;  2ZPG B;  2DL3 A;  2V1R A;  5KH6 A;  2KEA A;  2DZC A;  3C0C A;  4DEY A;  1G3T A;  1SSF A;  3CCJ Q;  3SEM A;  5AYF A;  4HCK A;  1N8R U;  2KAF A;  2DX1 A;  3C94 A;  3HTR A;  4V2S A;  2XG8 D;  2OTJ T;  1GXI E;  3V8J A;  3CPF A;  5C6S A;  3CMA A;  2VGN A;  4M7A F;  2K57 A;  4WTO B;  2COY A;  4M78 G;  2CZ0 B;  1ZBJ A;  3JCM W;  3OBW A;  2DRK A;  1WGS A;  2DIG A;  3OS2 A;  2CKK A;  2YWW A;  1WLP B;  4A4H A;  1TOV A;  1J3T A;  1OI1 A;  2ROL A;  4L59 A;  5GAN j;  2R57 A;  1U1S A;  2FG0 A;  2YLC A;  1H64 1;  1I5O B;  3FDR A;  4C8Q G;  2CP2 A;  1KD1 U;  2FZK B;  1PWT A;  1KQS S;  2LCL A;  2QQB A;  3ASK A;  1HSQ A;  3M59 A;  3KXT A;  5LJ5 g;  4JDS A;  4J9D A;  1W70 A;  3M0S A;  3MEU A;  5GAN f;  5FWC A;  3QG1 A;  3JAM E;  3OYB A;  2HQX A;  2M9U A;  2P0K A;  1N6A A;  3OYJ A;  3REA B;  3CCL A;  1OU8 A;  4LD6 A;  4XTW A;  4F7U E;  1VQ9 Q;  3QDR B;  1SSH A;  4EMH A;  4QQG A;  3RR6 A;  3I56 T;  2ZGW A;  2XDP A;  1HD3 A;  2C0I A;  2GTJ A;  4OMO A;  1KQ2 A;  3QBY A;  1Q86 C;  2GF7 A;  2LC4 A;  2VB6 A;  4CC7 A;  5FLX E;  4L5G A;  3M0Q A;  2EAY A;  4F17 A;  3CC7 T;  2LNH B;  1OU9 A;  5IHN A;  1VQM T;  1VQ5 T;  3WVD B;  2X35 A;  4E47 A;  3C95 A;  5CKH A;  4Z88 A;  1WZO A;  1Z9Z A;  3H41 A;  2VAS A;  3GNF B;  2FO0 A;  3THK A;  4AFQ C;  1UGS B;  2NUT B;  3BFM A;  2RJC A;  2HKQ B;  2I0N A;  2LQ8 A;  1PSE A;  2ZPI B;  1QVF A;  4D8K A;  3TSW A;  1X75 C;  4GLM A;  2RHU A;  4DBQ A;  2O4X B;  2XDB A;  2V8J A;  2EKH A;  4XU1 A;  3QWY A;  4IKF A;  1KG1 A;  3L2V A;  2E6Z A;  4Q5W A;  1MV3 A;  3MP6 A;  1KJW A;  4C92 B;  2HBW A;  1PD1 A;  1X01 A;  2SRC A;  2QAZ A;  2RN8 A;  3QJ6 A;  4J6X A;  2HD0 A;  4KT0 E;  3RIR A;  3OS5 A;  5CIU A;  1W4S A;  4RTV A;  4A4E A;  1TSF A;  4LDW A;  1AT1 B;  1M27 C;  1Q81 R;  1H8K A;  2JJ9 A;  2KMT A;  4ZGE B;  5CQY A;  3MET A;  4RG2 A;  2ED1 A;  3FLG A;  2JMC A;  1PRL C;  5GAN e;  5FRN A;  2IPO B;  2L5Q A;  4GBQ A;  3QYG B;  4M75 G;  5D6Y A;  3CC2 T;  2OTL A;  3HL8 A;  1Q7Y U;  2E41 A;  4QQD A;  1M8V A;  3JB9 I;  3MPU B;  1XNI A;  3UF4 A;  1QP2 A;  4M75 C;  2OX7 A;  2HQE A;  2HSP A;  4PJO D;  4AMC A;  4F7U A;  4HT8 A;  4EDU A;  4J7F A;  1UEC A;  1NM7 A;  3X25 B;  3LWH A;  1I07 A;  3ER0 A;  2L3Q A;  2XHC A;  2D6F A;  2E4H A;  1G3S A;  2EJG A;  1ZSZ A;  8AT1 B;  2RF0 A;  3EGX A;  3D7S B;  4KUD K;  2LJ0 A;  5KYX A;  2A08 A;  1P92 A;  2A28 A;  1YJW A;  1WPY A;  4MZT A;  2D8J A;  2F5K A;  2MWP A;  3BDU A;  2KR3 A;  2LJ1 A;  1FXX A;  2L2P A;  4M75 A;  1SRL A;  2FZG B;  3V7C A;  1JXM A;  2YDL A;  1HK9 A;  2DL8 A;  1OX8 A;  3CCQ Q;  1D0Y A;  3OBY A;  3CEY A;  4Y91 A;  1WHH A;  3M0R A;  4FYX B;  3SD4 A;  2RI5 A;  3RNJ A;  1X43 A;  2ECZ A;  1K73 U;  1YN8 A;  2A3L A;  4JRI A;  2K3Y A;  1I8F A;  1W2B S;  4M7D B;  3OS0 A;  1YJW T;  2KBT A;  4KH1 B;  3JCM P;  1PC0 A;  5LJ3 f;  5DM7 R;  1TXQ A;  1QWF A;  3EFR A;  2D0Q B;  3CC2 Q;  2DVE A;  3UPU A;  3L2R A;  2LJ3 A;  1ZLM A;  2KY9 A;  4EMK B;  1IRX A;  2XI9 A;  2LCS A;  2RQR A;  4FW2 A;  4JJN K;  3QO3 A;  4QVZ A;  2K5I A;  4OGC A;  1UFF A;  5I2S A;  1VQ4 Q;  2E3I A;  1KFZ A;  2KYB A;  2K5L A;  1UGV A;  2EQJ A;  1K76 A;  2JN0 A;  1GFD A;  2JZ2 A;  1AD5 A;  2EQK A;  1YI2 A;  3NMZ C;  2AHJ B;  1BCO A;  4Z89 A;  1GFC A;  3R6N A;  2CUB A;  2AKL A;  2YRC A;  1YHQ T;  1G3W A;  3C4S A;  2O31 A;  1N8R C;  4A4K A;  3QPH A;  2RI3 A;  3OSS C;  1D1A A;  2L89 A;  4KH0 B;  5IXF A;  1UGP B;  4MDW A;  3QII A;  4CC3 A;  1KK7 A;  2XID A;  3INZ A;  3CBO A;  5CKE A;  2ED0 A;  1WHJ A;  3P8B B;  1Y7X A;  3CBP A;  2F1L A;  2D0N A;  2YT6 A;  1VQ5 A;  5D6X A;  1RUW A;  4OMQ A;  1VQK A;  3LWI A;  1LNX A;  1A0N B;  4LN2 A;  4M7D F;  2QA4 T;  3CCE Q;  1HYO A;  3CXC S;  4DBF A;  5KYY A;  3CXC A;  3DLM A;  3CCU A;  2ABL A;  2V8I A;  3G4S A;  4O6J A;  1FMK A;  1OZ2 A;  4AG2 C;  3CCM A;  1NJI R;  5GAN g;  2XK0 A;  1PM3 A;  3S3O A;  2MWO A;  2CP3 A;  3SWN B;  1ZA2 B;  1YIT T;  1M1F A;  1XOV A;  3CCS Q;  1D1C A;  4C0Z A;  5LL6 S;  4JRP A;  3PVL A;  4C0D C;  3N5B B;  3CCJ T;  5I21 A;  4PJO G;  5LJ5 h;  1T3S A;  1QVF P;  2VGM A;  3JB9 D;  2EYX A;  2CZ6 B;  4DEX A;  1D3B A;  2Y4Y A;  2KRM A;  3JCM X;  2X9H A;  5FW9 A;  1SRM A;  4EMG A;  1BI1 A;  4J7I A;  2FRW A;  4HXJ A;  3VUZ A;  2P0Q A;  4XU3 A;  2QTX A;  2DD4 A;  1K9M U; 
#chains in the Genus database with same CATH homology
 5I11 A;  1T0H A;  1NLO C;  1UE9 A;  1YNZ A;  1YWO A;  1LCK A;  5GJW B;  1JU5 C;  3REB B;  1UTI A;  2NUZ A;  2W10 A;  4RTY A;  3EHQ A;  1YCS B;  1AWW A;  1K1Z A;  4Y92 A;  2PTK A;  3SHW A;  2BZ8 A;  2VKN A;  1QKX A;  1TUC A;  1RI9 A;  1WI7 A;  1AWX A;  2RNA A;  5IXB A;  2JM8 A;  3M0T A;  3ULR B;  2CDT A;  2O88 A;  2JS0 A;  2KXC A;  1VYT A;  2A37 A;  2JTE A;  1SEM A;  2J6O A;  4RTX A;  4CC4 B;  2LP5 A;  1OPK A;  2RQT A;  1QWE A;  1FYN A;  1OOT A;  4AFU C;  2RQU A;  3EG2 A;  3VRZ A;  1OV3 A;  5L23 A;  2DIL A;  4ZNX A;  1GCP A;  4OMP A;  2KRN A;  2O9V A;  3VS3 A;  1K0S A;  2DL3 A;  2V1R A;  2KEA A;  3C0C A;  1CKB A;  4DEY A;  2LQW A;  3SEM A;  4HCK A;  1MV0 B;  2YUP A;  2DX1 A;  1QCF A;  3I5R A;  1K4U S;  2DLP A;  1NYF A;  1PNJ A;  2KXD A;  1ZBJ A;  2KT8 A;  2DL7 A;  1Y57 A;  2DRK A;  1UG1 A;  1NYG A;  1WLP B;  1J3T A;  2O9S A;  3EGU A;  1E6G A;  1U5S A;  2ROL A;  2DBK A;  5IHK A;  1M3B A;  2DYB A;  2J6F A;  2FG0 A;  2DL5 A;  3H0I A;  1ZUU A;  3I5S A;  4IIO A;  3UA6 A;  3UAT A;  2G6F X;  1PWT A;  2BTT A;  3EG1 A;  5ECA A;  1GBQ A;  3PE0 A;  4JPB W;  2QDL A;  3M0U A;  3LH5 A;  4F14 A;  1X27 A;  4LNP A;  1HSQ A;  4J9D A;  1W70 A;  3M0S A;  5FWC A;  2F2W A;  1SHG A;  1M8M A;  2DJQ A;  2KRS A;  1N5Z A;  1ZUK A;  4CC2 A;  1W6X A;  5I22 A;  3REA B;  2ENM A;  4M4Z A;  2JMA A;  2MCN A;  4OMN A;  4JZ4 A;  3VS5 A;  4A63 B;  1EFN A;  1SSH A;  2DL4 A;  2W0Z A;  1MUZ A;  1SPK A;  3ZL7 C;  1OEB A;  2O2O A;  2MIO A;  1S1N A;  2KGT A;  5IH2 A;  2J05 A;  2C0O A;  2K9G A;  1HD3 A;  4EIK A;  2C0I A;  2GTJ A;  4OMO A;  1X2K A;  1TUD A;  2K2M A;  2RPN A;  4CC7 A;  2VVK A;  3PVQ A;  3M0Q A;  2JXB A;  1G2B A;  4F17 A;  2LNH B;  1WIE A;  5IHN A;  1KIK A;  2IIM A;  2DM1 A;  3FJ5 A;  2EYW A;  2LZ6 B;  1SHF A;  2DRM A;  4FSS A;  3H0F A;  2NWM A;  2EQI A;  2X3X D;  1M30 A;  4Z88 A;  1X69 A;  1Z9Z A;  3H41 A;  1ABO A;  2FO0 A;  3THK A;  4AFQ C;  3JV3 A;  2DNU A;  1IO6 A;  2YSQ A;  2I0N A;  3GBQ A;  2KE9 A;  1H92 A;  4J9I A;  1PKT A;  4D8K A;  1BK2 A;  2EGE A;  3UA7 A;  1NLP C;  3TSW A;  4GLM A;  2YUO A;  2EKH A;  1WYX A;  4JJB A;  3QWY A;  2BZX A;  2KT1 A;  2AK5 A;  1MV3 A;  1KJW A;  1UUE A;  2HBW A;  1I1J A;  1E6H A;  2SRC A;  2J6K A;  2RN8 A;  2RQV A;  4Z8A A;  2KYM A;  4ORZ A;  4JZ3 A;  2GTO A;  4RTW A;  4J9B A;  4RTV A;  2J06 A;  3EHR A;  3QWX X;  2L3P A;  2X3W D;  1M27 C;  2HDA A;  2OI3 A;  1H8K A;  2ED1 A;  2JMC A;  1WFW A;  1PRL C;  2BZY A;  1WXU A;  4QT7 A;  2XMF A;  3H0H A;  4GBQ A;  1WXB A;  2OAW A;  1UHC A;  2M51 A;  4OML A;  2HCK A;  1JQQ A;  2EW3 A;  2A36 A;  3UF4 A;  2CUD A;  1AWO A;  1W1F A;  1NEG A;  2FEI A;  1K9A A;  2EVR A;  2HSP A;  3M0P A;  2JM9 A;  1UEC A;  4J9C A;  1NM7 A;  1Y0M A;  1B3Q A;  1I07 A;  4RTZ A;  1ZSG A;  2L3Q A;  1TG0 A;  2DF6 A;  5GJV B;  2RF0 A;  3VS0 A;  4J9G A;  4LUE A;  2K7A A;  2LJ0 A;  2A08 A;  1NG2 A;  2A28 A;  3VS7 A;  1GBR A;  4KRT A;  2EGA A;  2JS2 A;  3I9Q A;  2LQN A;  4AFS C;  4IIM A;  5EC7 A;  1X2Q A;  3O5Z A;  4HVU A;  1GCQ C;  1JO8 A;  2D8J A;  2KR3 A;  2LJ1 A;  1U3O A;  2FPD A;  4E6R A;  2CH4 W;  2L2P A;  1AZG B;  1SRL A;  4JJC A;  2CT3 A;  2L0A A;  2ESW A;  1JXM A;  2YDL A;  1RLQ C;  2P4R A;  2DL8 A;  2CH4 A;  2GNC A;  4JJD A;  1RLP C;  2AZV A;  1CKA A;  4WCI A;  1T3L A;  1K0X A;  2K79 A;  3M0R A;  3VS2 A;  3RNJ A;  1X43 A;  3I35 A;  2ECZ A;  1YN8 A;  4RUG A;  3VRY A;  1AZE A;  2CSQ A;  1WX6 A;  2PNI A;  1X6G A;  2CSI A;  2FPE A;  4RTT A;  2JT4 A;  2AZS A;  1PRM C;  2KBT A;  2H8H A;  2RQW A;  2FPF A;  2GBQ A;  2J7I A;  1PKS A;  4X1V A;  1QWF A;  4F16 A;  2MOX A;  2RMO A;  2KNB B;  2LJ3 A;  4LUD A;  2V1Q A;  3NGP A;  2EYZ A;  4J9H A;  1ZLM A;  2LCS A;  1HJD A;  2JW4 A;  2YUN A;  4J9E A;  2RQR A;  2K6D A;  1PHT A;  1AOJ A;  1QLY A;  4ESR A;  1UFF A;  1WDX A;  1KFZ A;  2KYB A;  2CRE A;  2EBP A;  1VYV A;  2K3B A;  1UGV A;  2OJ2 A;  3KFV A;  1K76 A;  1GFD A;  1AWJ A;  1H3H A;  1JEG A;  1AD5 A;  2EYY A;  5IHI A;  2CT4 A;  1UDL A;  4R0K A;  4K11 A;  3NMZ C;  5FWB A;  3RBB B;  1U06 A;  2HEQ A;  1E7O A;  1WXT A;  4Z89 A;  2AKK A;  1BU1 A;  2ROT A;  1GFC A;  3R6N A;  1ABQ A;  4AG1 C;  2CUB A;  3CQT A;  4AFZ C;  2AKL A;  1BB9 A;  3TVT A;  1B07 A;  1T0J A;  2VWF A;  2O31 A;  2GQI A;  4HVW A;  2E5K A;  1QKW A;  2F2X A;  2YUQ A;  4D8D A;  3NPF A;  1VYU A;  4OMM A;  3VS4 A;  5IXF A;  4J9F A;  1ZX6 A;  4CC3 A;  1UJ0 A;  2DVJ A;  2ED0 A;  1WA7 A;  2B86 A;  2D0N A;  3EG0 A;  3VS6 A;  3U23 A;  2YT6 A;  2L3S A;  2EGC A;  1Z9Q A;  1RUW A;  3NHN A;  4OMQ A;  1UJY A;  1YP5 A;  1VA7 A;  1X6B A;  4LE9 A;  1A0N B;  2F2V A;  4LN2 A;  2KRO A;  1JXO A;  1GRI A;  1M3A A;  1ZUY A;  1AEY A;  1BBZ A;  2LX7 A;  4HVV A;  5HCK A;  2DBM A;  2ABL A;  1FMK A;  1GCQ A;  2D1X A;  3EG3 A;  1KSW A;  4AG2 C;  3TSZ A;  1G83 A;  1GL5 A;  1CSK A;  1XOV A;  4RTU A;  2C0T A;  2FRY A;  2DMO A;  2D8H A;  2LMJ A;  3PVL A;  1UHF A;  3A98 A;  1NEB A;  1T3S A;  2EPD A;  1V1C A;  2EYX A;  4DEX A;  2PZ1 A;  2KRM A;  1M3C A;  5FW9 A;  3VS1 A;  2DA9 A;  1SRM A;  1OPL A;  1YWP A;  1I0C A;  2DE0 X;  3IQL A;  1ARK A;  2FRW A;  4HXJ A;  2GGR A;  2M0Y A;  1AVZ C;  2SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...