4GLMA

Crystal structure of the sh3 domain of dnmbp protein [homo sapiens]
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
LTYGVALYRFQALEPNELDFEVGDKIRILATLEDGWLEGSLKGRTGIFPYRFVKLCPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Dynamin-binding protein
total genus 11
structure length 58
sequence length 58
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4glmA00
1EFNA 2JT4A 2GBQA 1BU1A 4OMNA 2LMJA 4RTVA 2EYZA 1NEGA 4OMOA 4X1VA 1M30A 2BZXA 4GLMA 1WDXA 2JS0A 2RF0A 4DEXA 1UECA 3M0PA 4F14A 2EGEA 3EG2A 2HSPA 1HJDA 3H0FA 4QT7A 2FPFA 4ESRA 2DLPA 1GRIA 2NUZA 1T3SA 1GCQA 2D1XA 5I22A 5IHKA 1YWOA 2RQUA 2QDLA 2AKKA 1X27A 2HDAA 2LJ3A 2KR3A 1VYVA 2B86A 2DNUA 3UATA 4JJCA 2EW3A 2DRKA 3M0UA 2X3WD 2X3XD 2DILA 4HVUA 4LNPA 2LNHB 5FW9A 2DYBA 1MV3A 4JJDA 1RI9A 1FMKA 1PRLC 3R6NA 3PVLA 4EIKA 3UF4A 1GBQA 3THKA 2C0OA 2EKHA 3EG0A 1NLPC 2GTOA 1B3QA 2K9GA 4J9CA 2MOXA 3I35A 1E7OA 1QCFA 1X2QA 2MIOA 1ABQA 1X2KA 3EHRA 2O9SA 2BTTA 2DRMA 2E5KA 2OAWA 4JJBA 2CUBA 1NYFA 1Z9QA 2GQIA 4RTZA 4D8DA 1ZUKA 1PWTA 2CT4A 4OMQA 1UFFA 2DVJA 2DBKA 3NPFA 2D8JA 2KYBA 2YUOA 1GFDA 2JM9A 2DMOA 2K2MA 2DBMA 2EYYA 4Z88A 1U06A 2RQTA 1K4US 2ESWA 2J6OA 1WXUA 1AD5A 2GNCA 2K3BA 2MCNA 3VS5A 5IH2A 1KFZA 2J05A 3VS4A 2ROTA 2VVKA 1YWPA 5FWCA 3NHNA 1SRLA 3JV3A 4AFSC 4CC3A 3EG3A 2OJ2A 1UHFA 2EYWA 4AFQC 2DL4A 2G6FX 1ABOA 1BB9A 2BZYA 1W1FA 1YNZA 1TG0A 2W0ZA 2CH4W 4RTTA 1N5ZA 1IO6A 1XOVA 1YCSB 1I0CA 4ORZA 1OV3A 3VS3A 2YT6A 2KBTA 1OPKA 2DJQA 3SEMA 1PHTA 1MUZA 1U3OA 1X6GA 2CT3A 1GL5A 1M27C 1ZUUA 1J3TA 2LCSA 2M51A 2O2OA 5ECAA 1W6XA 2FPEA 1Y57A 1V1CA 2I0NA 2EQIA 2EPDA 1KJWA 1SHFA 2ED1A 3EHQA 4ZNXA 1GFCA 2JM8A 2L2PA 4Z8AA 3I5SA 2L3SA 3RNJA 2KRNA 4CC2A 2DM1A 2AKLA 2KXCA 1WYXA 4HXJA 1VYUA 2L0AA 2J6FA 1ARKA 5IXFA 4RTYA 1PNJA 3PVQA 1TUCA 3REBB 3QWXX 2O88A 4CC4B 2YUQA 2FRWA 3NMZC 4IIMA 2LX7A 3UA7A 1UE9A 1PKTA 1T0JA 1AZEA 1AWWA 2OI3A 4F16A 1K9AA 1TUDA 1JEGA 1G83A 3KFVA 2KEAA 2KGTA 2CH4A 2JW4A 2P4RA 3TSZA 2O9VA 1JO8A 2YUNA 1H8KA 2DE0X 1UJ0A 4OMPA 2C0TA 1AZGB 4DEYA 5I11A 2KROA 2DL3A 1WXTA 2K7AA 2VWFA 2J06A 4OMLA 2ED0A 1FYNA 2EGAA 3I9QA 2CSIA 2DF6A 3VS0A 3CQTA 2A37A 2A36A 2RQWA 2GTJA 2F2WA 2L3QA 3I5RA 2CREA 1X43A 2AZVA 4E6RA 1S1NA 2KRMA 4AFZC 1WX6A 2BZ8A 3M0QA 2DA9A 1T3LA 1KSWA 2LZ6B 3EG1A 1Z9ZA 1X69A 4J9HA 3REAB 1M8MA 4RTXA 1AWXA 4OMMA 4K11A 3VS6A 1UGVA 4R0KA 1T0HA 2D8HA 4LUDA 1SSHA 4Y92A 1JXMA 1GCPA 2NWMA 4Z89A 1UDLA 3VRYA 2HEQA 2LP5A 3NGPA 2DL8A 1JU5C 2A08A 2LQNA 2RQVA 2KE9A 1NG2A 2FO0A 3SHWA 3RBBB 1QWEA 1K0XA 2FEIA 2K6DA 2CDTA 1M3BA 2IIMA 1M3CA 4J9GA 4M4ZA 1QLYA 1G2BA 3GBQA 1W70A 2DL7A 4AFUC 1SRMA 2A28A 1AVZC 2KNBB 1SEMA 1CKAA 1I1JA 2LJ0A 5IHIA 3LH5A 2LQWA 1CSKA 1GCQC 3VS7A 1QKXA 1HD3A 2HBWA 3M0RA 1UTIA 2SEMA 2ROLA 2KT8A 3EGUA 4LN2A 2W10A 2CSQA 1YP5A 5IHNA 1JQQA 2SRCA 2JTEA 4J9BA 1AWOA 5EC7A 4J9EA 5L23A 2J6KA 4RTUA 4AG2C 1BBZA 2FRYA 1VA7A 1VYTA 3PE0A 4FSSA 4D8KA 1GBRA 3VS2A 1K0SA 3IQLA 1RLPC 3O5ZA 2O31A 3A98A 3H0HA 1SPKA 2LJ1A 1JXOA 2RN8A 1WFWA 4KRTA 1OPLA 2FG0A 3M0TA 5FWBA 1QWFA 1WLPB 2F2XA 3ULRB 1RLQC 4GBQA 3UA6A 2RQRA 2KRSA 1I07A 2JMCA 2EVRA 2V1RA 1ZUYA 3VRZA 1SHGA 2DX1A 1QKWA 4JPBW 2GGRA 2KYMA 1UHCA 1A0NB 3H0IA 2ENMA 5GJWB 2EBPA 1BK2A 1NEBA 2L3PA 3C0CA 2V1QA 2RNAA 4AG1C 3TSWA 1NLOC 1U5SA 1M3AA 2K79A 3QWYA 4JZ3A 1ZSGA 2H8HA 1ZLMA 1WA7A 2M0YA 2DL5A 1K76A 1WXBA 1E6GA 1AEYA 3FJ5A 2YSQA 1ZBJA 4F17A 1X6BA 1PKSA 3ZL7C 1YN8A 2HCKA 1LCKA 1NYGA 1MV0B 2AZSA 2PZ1A 3VS1A 5HCKA 1PRMC 4HVVA 2CUDA 2AK5A 3M0SA 2EYXA 4IIOA 5IXBA 1Y0MA 1K1ZA 3TVTA 1OEBA 2JS2A 3H41A 1UJYA 2YDLA 1KIKA 4CC7A 4RTWA 4J9FA 4LE9A 1H3HA 1H92A 2D0NA 1WIEA 2PTKA 1UUEA 2JMAA 2KXDA 4LUEA 4WCIA 1AOJA 2KT1A 2C0IA 2XMFA 3U23A 2J7IA 2VKNA 1ZX6A 4HCKA 1AWJA 2YUPA 4J9IA 1OOTA 1HSQA 2EGCA 2RPNA 4RUGA 2ECZA 4A63B 1RUWA 2F2VA 4J9DA 2PNIA 1E6HA 2ABLA 1B07A 4HVWA 1NM7A 2FPDA 2RMOA 2JXBA 1UG1A 5GJVB 4JZ4A 1CKBA 1WI7A
chains in the Genus database with same CATH superfamily
2JT4A 2LNVA 3HL8A 2GBQA 4OMNA 2K5IA 1N8RR 2EYZA 1NEGA 1VQ7A 5GAOr 1WDXA 2RF0A 1UECA 4C8QE 2OTJA 1JRIA 4F14A 4C8QC 3LW5E 2O4XB 3RKXA 2DLPA 2DTHA 5GAN7 1RL2A 1B7TA 1S72A 5FU6B 2RK1A 2EQJA 2QGGA 1I8FA 3TEEA 1JJ2P 1VYVA 1NE8A 4JS5A 3MCAB 2PUKB 2B86A 2DNUA 3UATA 1IGUA 3CPWA 1YIJA 4M7DG 4OB1B 2DRKA 3BFMA 1K9MU 2X3WD 2VASA 4HVUA 2E6ZA 2LNHB 1VQ4A 2BUDA 3CCJT 1KQSP 2DZ9A 3JCMP 1XTDA 5LJ5d 4EMKA 3THKA 2C0OA 1M4ZA 3TU4K 5GAN3 2LT1A 2M1HA 1D0YA 3OYKA 3EHRA 1WHJA 4DA4A 2E41A 1VQ4Q 1Z9QA 4C0ZA 2VUBA 4PLIA 2DBKA 5HY6A 2D8JA 8ATCB 1GFDA 2JM9A 3EGDB 3CMAQ 2COWA 1JJ2S 3MEAA 1QVFP 3QZ9B 2K3BA 2J05A 3VS4A 3CMAA 4PFZA 3JV3A 4AFSC 4CC3A 4C92F 1NJIU 6AT1B 4AFQC 2RHXA 4N4GA 2BZYA 2WACA 3QPHA 5GAMe 4JUVA 4P5NA 3L2VA 1YITT 2YHTA 2NYSA 3MHXA 3CXCS 2MWPA 2KSSA 1IO6A 1NJIC 4XTWA 3JCMc 3GP8A 3OMCA 3V8LA 4XTVA 5KCOA 3R6OA 4PK4A 5LJ3g 1BI3A 3PFSA 1BI2A 4C5EA 2QQRA 3X26B 4O6JA 1M27C 2LCSA 2O2OA 1W6XA 1U8RA 3CCVA 1V1CA 3A8LB 3S3NA 2I0NA 2PVDB 5J3BA 3A5ZB 4HT8A 2HAXA 5CKDA 1GFCA 4Z8AA 3V7CA 3PTAA 3TQ7P 3NTKA 3CMAT 5I2SA 2DM1A 2MAMA 2DXBA 1WYXA 4HXJA 1ARKA 3HRUA 1VQ6Q 4RTYA 4EPCA 1TUCA 4M77B 4PJOF 3QWXX 4JLIA 3NMZC 4IIMA 3CCRA 1VOMA 4LD9K 2OI3A 2QQ9A 4F7UG 3OYYA 1JEGA 1G83A 3CCST 1FWZA 2WSCE 2YRCA 3GIBA 2KEAA 2RB6A 4XTZA 1PC0A 1G3WA 1H8KA 4ZGDB 2HSEB 2Z0WA 2OAUA 2IPOB 2K3XA 4E2FB 4A4GA 2QTXA 2DYIA 3G4SA 2KROA 4ME7A 5CKFA 1D0XA 2OTLQ 2FB7A 2CP3A 2ED0A 1FYNA 1SKUB 3I9QA 1YJNT 5GAMf 2A37A 1YJ9A 2A36A 2OTLA 1KQ2A 2QG9B 4DBFA 5CQXA 3PMTA 2L3QA 3I5RA 4RG2A 4IUQA 3EG9A 5GAN4 4E6RA 3BE3A 3GNFB 2L5QA 3PMIA 1WX6A 2DA9A 4E47A 1NPRA 2LZ6B 3REAB 1UGVA 4R0KA 2E70A 1T0HA 4M78C 2FL7A 1YI2A 2DFUA 4LUDA 5GAOn 2D6FA 3NGPA 4CI0C 1JU5C 5M9OA 5GAOp 1VQLT 3CD6T 2LQNA 3OW2A 2KE9A 1G3SA 2LCLA 4KUDK 1OQKA 3RBBB 4QVCA 2FEIA 4E7JA 3HRSA 4B9XA 1M3BA 2IIMA 4M7DF 3M54A 2F69A 2DXUA 4QVZA 1QLYA 3JAME 3QJ6A 4FYWB 4RCBA 2A28A 3VYHB 1WQ7A 4QW2A 1VQ7Q 2PU9B 3S3OA 4M75C 4C0FA 3LH5A 4C5GA 3OYAA 1X6OA 1JB0E 4XU1A 5IAYA 5GAOl 4J5YA 2LCCA 2MMPA 1OULA 4M75D 2DD5A 1AWOA 3SWNC 5EC7A 2YWWA 2DVEA 2FRYA 1VA7A 2OTJT 1TTHB 4B9WA 4GY5A 3UDCA 2VXFA 3UT1A 1BIAA 4LDWA 3O5ZA 1KHIA 1UGSB 3OS1A 3OYGA 1TUGB 2RN8A 1WFWA 4KRTA 1C6VX 5CK9A 2QDYB 4R56A 2ZAEA 2CP7A 2DAQA 4FYVB 2MPXC 2RQRA 1V76A 2V26A 2JMCA 1Q86U 4IUUA 2V1RA 4NL2A 1IHVA 2DX1A 2XIDA 3PNWC 1IGQA 1UHCA 1V29B 4KBMB 3H0IA 1U1SA 2EBPA 1NEBA 2L3PA 1QW1A 5FRMA 2KI7A 4X9CA 4II1A 3RR6A 5GMKm 4KUIA 2CKKA 4BD3A 4JZ3A 1ZSGA 3I55T 1WA7A 3QDFA 2B8AA 4KH0B 1K76A 1YJNQ 1R0BG 1VQKT 3E9GA 4MMLA 1FMVA 3FJ5A 2ZGWA 4ANJA 1X6BA 1PKSA 4M78E 5D6WA 2DETA 2K5LA 1VIFA 4M7DB 5A2QE 1NYGA 1MV0B 4OB0B 2AZSA 2MF2A 2HBPA 1M1FA 4M75B 3WXMB 4XK8E 2CUDA 3SFMA 4IIOA 3RDVA 3X20B 1Y0MA 3TVTA 1UGQB 2KDSA 1KIKA 3CC7A 4C0DC 4CC7A 3OMGA 4LE9A 2D0NA 1VQ8A 4F7UA 3OY9A 4ATOA 1BCMA 2KVQG 4Y91A 1TXQA 4BI8B 3DLMA 2KT1A 3BY7A 3MJXA 2XMFA 1WHKA 1ZX6A 1AWJA 2XDPA 4FT2A 4J9IA 3CMEQ 4HKEA 2HMAA 5IN1A 1UGRB 2QGFB 3JB9D 2QA4A 2DXCA 1VQ9T 4HVWA 3RMQA 2JXBA 3CCEA 1QMCA 3MEUA 2ZZDA 1ACMB 1WI7A 3F70A 4ZGEB 1YHQA 2E10A 2OTLT 5LJ5f 3CPWS 5GMKj 2JNGA 4X1VA 3X24B 2BE9B 3CMEA 4GLMA 1EIFA 3M0PA 3A1PA 2EGEA 3E19A 4X34A 3EG2A 3OW2P 2MWOA 1MGQA 4ESRA 2NUZA 1GRIA 4OP0A 4PJJA 2RJEA 3FJPA 1FX7A 4Q5WA 5I22A 1WHHA 3CCEQ 4XQ3A 4C92B 1K73C 2AKKA 3QIIA 2QTVA 1MMGA 2K5FA 4FYYB 2LJ3A 2R5AA 1TU0B 3EAEA 1OYXA 2HKNA 3A8HB 4BE2A 1WHGA 5D7UA 2C06A 2EW3A 3M0UA 2X3XD 5KYUA 2DILA 5GANf 5LL6S 5FW9A 4M77C 4M78D 1OU9A 3R6NA 3PVLA 4EIKA 3WVDB 3UF4A 2WSEE 3J7AF 5GMKi 5DM7R 3EG0A 3ME9A 2EFIA 1NLPC 5KYYA 3SWNA 3BW1A 2LT4A 4M78G 1B3QA 2K9GA 4J9CA 3A8MB 2YXYA 2MOXA 4XAXB 1YJNA 1ZQ1A 3LX7A 2MIOA 3CCRT 1VQLQ 4M77D 4ZTFA 3CD6Q 2DJZA 2JJ9A 2VC8A 2O9SA 2DRMA 2ZPEB 5EG2A 2OAWA 2V8IA 2CUBA 3G6EQ 2GQIA 4RTZA 4D8DA 1N27A 2LQ8A 2CT4A 4EMKB 4OMQA 1JBMA 2DVJA 3T9NA 2KYBA 2DMOA 4PLLA 1LVKA 1MMNA 2EYYA 1K4US 2J6OA 2MCNA 5IH2A 3OYJA 1KFZA 5LJ3f 4C8QG 2ROTA 2L8DA 1H641 5DLQE 4C92E 2GF7A 1SRLA 3HSBA 1UB4A 2OJ2A 1UHFA 1VQMT 3OYEA 4RCCA 4NL3A 1BB9A 2DIGA 4KT0E 2EYQA 2JUFA 4IURA 2QEXA 3VJPA 1XOVA 1I0CA 4C92G 3VS3A 2DXTA 2CZ0B 1QP3A 3JB9G 4LXCA 4PJOD 4ZN3A 2AIRB 3CBMA 2ZCFB 1U3OA 1VQMQ 2DO3A 5CIUA 3OYIA 5LJ3j 1GL5A 4BB7A 4C92A 2E3HA 4XTYA 2M51A 5ECAA 4MZMA 2FPEA 1QVFA 1VQMA 1YHQQ 2VYTA 2EQIA 5GANg 4M78A 1EX4A 2EPDA 2DIQA 1SHFA 4UC4A 1FMWA 1KC8U 4MDXA 4ZNXA 2JM8A 3RNJA 2KRNA 1D0ZA 4CC2A 3J80E 4KGXB 5HK0A 1YIJT 2QA4Q 3I56T 5IXFA 2QK0A 2X51A 3PVQA 1VQ8T 1MNDA 2FRWA 1Y96B 3S6WA 2QEXT 1AZEA 2YRVA 4F16A 1K9AA 2KQWA 2HZYA 3KFVA 5AT1B 2JW4A 3JSCA 2P4RA 3CCVT 2F5TX 2YUNA 2DE0X 1RADB 2NLUA 5I21A 2C0TA 4JRKA 5GANj 1ZSZC 2RK2A 1AZGB 3QO3A 4DEYA 3G6ET 5FRNA 4QKUA 2KMTA 2K57A 2DL3A 1WXTA 2K7AA 3O8VA 8AT1B 9ATCB 2MK5A 1M1KU 3CQTA 4B6MA 4BI3A 2RQWA 1DJ7B 3CCSQ 1M5Q1 2VGMA 4DOWA 1M90U 2AZVA 4J6XA 1QP2A 1S1NA 2KRMA 4BE1A 2BZ8A 3G1JA 3JCMe 4QQ6A 5GMKh 2COZA 3EG1A 1Z9ZA 2M9UA 3E9FA 1X69A 3RKYA 4M75A 3SD4A 4A4FA 5CQYA 1M8MA 4RTXA 3RUXA 4K11A 1M90C 4JRQA 2D8HA 4OB2B 4Y92A 4WTOB 2NWMA 4X9DA 4Z89A 1HK9A 2BE7D 3OYCA 1WPYA 2LP5A 3VU3C 2DL8A 2GFUA 2A08A 2V8JA 2RQVA 3DLLA 1VQNT 2M16A 4JLGA 5GANh 2FO0A 3QKJA 3RERA 4M75F 1TOVA 2CDTA 1WJRA 4M4ZA 1MNEA 2DEQA 4Y28E 1VQ5A 1W2BP 1W70A 4KH1B 2DL7A 3FDRA 4AFUC 5FU7C 4MMKA 3META 2HL5C 2EKOA 1M2OA 1NPPA 2E4HA 5J39A 1LJOA 1CKAA 1I1JA 4IUPA 2LJ0A 2P0KA 1EZZB 2A0FB 2RI3A 2LQWA 5LJ5g 1GCQC 4XU0A 1YFNA 1TS9A 3VS7A 1KD1R 1B34A 3C4SA 1VQ9Q 2H3JA 2X4XA 3CCUT 1G8XA 4JJNK 4J7IA 5IHNA 3SDZA 5CO7A 2SRCA 4TVRA 4YTLA 2JTEA 2CGHA 2IVWA 2JZ2A 4J9EA 1VQOQ 3RMSA 2DTOA 2ZPGB 5C0MA 1WGSA 2V8KA 5A0LA 1K0SA 2E64A 4PJLA 3JRZA 4DOVA 1K8AU 3A98A 3H0HA 4PJOB 1IREB 1OPLA 1VQ8Q 4BUGA 5FWBA 1WLPB 3EH2A 5A0GA 4GBQA 3UA6A 3QYHB 1I07A 1C1AA 2EVRA 3D7SB 1K8AC 4IUVA 3I55Q 3E2UA 1QVFS 1KQSA 1QKWA 2EJGA 2GGRA 4JPBW 1PCXA 1Q82U 1W4SA 1A0NB 1VQNQ 1F1BB 4C92C 3QG1A 2AT1B 1BK2A 3TSWA 1M3AA 2FZGB 5GAN2 3QJYA 4NS5A 3FIFA 1BYMA 3BDUA 4PJOA 4N0AA 1MMAA 1Q82C 1WXBA 5CKHA 1E6GA 3OA6A 3DB3A 1ZBJA 2FVUA 1M1GA 1N9RA 1YN8A 2E6NA 1LCKA 2OTJQ 2CP0A 3CBOA 2NUTB 4HVVA 4HCCA 2DZCA 2EYXA 5LJ3d 1OEBA 1XNIA 2JS2A 4M7DE 1UJYA 5D6XA 4M77E 3LGLA 4RTWA 1ZSZB 3HKSA 4J9FA 1H3HA 1VQKA 1H92A 1WHLA 3JB9J 2XICA 4A4EA 3V7RA 4LUEA 1AOJA 5FROA 2LTOA 2NUPA 2EJFA 2FZKB 2C0IA 2GFAA 2VKNA 4HCKA 2RO0A 1OOTA 5HK3A 4PJOC 1VQ6A 2EGCA 2RPNA 3M9QA 1RUWA 1VQOT 3LYIA 3CCMQ 2F2VA 5IT9E 1E6HA 1YIJQ 1B07A 3KBGA 4NOYA 1NM7A 2FPDA 2L3RA 4E7KA 3QZ5B 5GJVB 3EGXB 3DKMA 1CKBA 3L2ZA 4MZTA 4RKUE 3HFNA 1EFNA 2FHDA 4E7SA 2QEXQ 4XU2A 4RTVA 5GANd 1M30A 2BZXA 2LRQA 2JS0A 3JCMb 4F04B 3P8DA 4OB3B 2JTMA 4QT7A 1I5LA 3AHUA 3CC4T 2WSFE 1T3SA 1GCQA 3LGFA 1VQPT 1OZ3A 2RQUA 4M77F 3HHTB 1VQ9A 3CCET 2KR3A 5GAN8 2QASA 2YLBA 5GMKe 3JCMh 1ZA2B 4JDSA 1ZBXA 2HKQB 2LC4A 1K73R 1OX8A 1PD1A 2GQVA 2FZCB 4PJOE 2R57A 4HCBA 1MV3A 1NBEB 1SSFA 2BKDN 3PIPA 1PRLC 3M4YA 3BDLA 1GBQA 2EKHA 1IB8A 2GTOA 3GNGA 3MP6A 3ASKA 3I35A 5LJ5h 1QCFA 1X2QA 4V2SA 2BIVA 4Z02A 2BTTA 4M7DD 2LDMA 2E5KA 3CCSA 1OZ2A 1PM3A 3GPLA 1ZUKA 3DB4A 5KYWB 1D1AA 3HFOA 1UFFA 3L42A 5CCAA 3NPFA 2CP6A 2YUOA 2K2MA 2DBMA 3M58A 1U06A 2XDDA 2ESWA 1AD5A 5GAMg 3VS5A 3L2RA 1YWPA 3WVEB 5FWCA 3NHNA 1I81A 3VYGA 4A4KA 1BCOA 1K73U 4PFPA 4L5GA 3EH1A 2G6FX 1ABOA 1RACB 1D09B 3URGA 1IXDA 1YNZA 3G71A 1WQWA 4L6V5 3J81E 2CZ1B 4RTTA 3OYMA 1N5ZA 1YCSB 2JTFA 2VGNA 3FEOA 1KD1C 2KBTA 1OPKA 4A54A 2DJQA 4MDWA 2CT3A 4FW1A 1ZUUA 1J3TA 3JCMW 5HKCA 3GOXA 1R8OB 1Y57A 4FT4A 4PFOA 5FU7B 1RAAB 3MO8A 1KJWA 5GMKl 2ED1A 4LDUA 2L2PA 2KK4A 1IZ6A 1KHCA 5LJ3h 3HPWA 5GAN6 2P84A 1S72T 2KXCA 3CCLA 2J6FA 2MYSA 3H9NA 1MMDA 4KGVB 3REBB 5GAOq 5KYYB 1M2VB 3JCMX 2O88A 4M78F 1ZA1B 3CPWP 2LX7A 3C12A 3A8OB 2EAYA 4AT1B 5KCHA 3LWIA 1PKTA 2CS7A 4QQGA 1N6AA 1TUDA 1RAIB 4OGEA 3OS0A 3FRNA 4AMCA 1SF9A 2KGTA 2CH4A 3P8BB 2O9VA 3LWHA 1UJ0A 4OMPA 3OYBA 3EFSA 3OS5A 2HQEA 4LDXA 1KQSS 3MP1A 3I56Q 2K2VA 2MI6A 3JCMg 2VWFA 4FCYA 4C8QF 4OMLA 4M7AE 7AT1B 3VS0A 1Q81U 2RJFA 2GTJA 2NUPB 4BDYA 1W2BA 1X01A 2LX9A 2QXFA 2E1HA 3L2UA 1M1KR 1X43A 1VUBA 2XK0A 4FYXB 3ZEHA 4ELZC 3EG9B 4AFZC 3JCMd 4M7AG 2RHIA 2XU8A 4VUBA 4XTUA 1Q81C 3CC2T 1T3LA 1KSWA 1YITA 4BI4A 2AHJB 3JB9H 3E1SA 4OGCA 1KC8C 1AWXA 3VS6A 4BDZA 3M53A 3G6EA 2RJDA 2P0QA 1SSHA 5CR2A 1H3ZA 2NUTA 1O9SA 3RKWA 1BKBA 3SHWA 2QAZA 1QWEA 1RI0A 3X28B 1K0XA 1VQKQ 1C0MA 2YRDA 3JB9I 1M3CA 3QUIA 1G2BA 2RA2A 1WJQA 1LOJA 1SRMA 1AVZC 2XG8D 2KNBB 3CCRQ 5GANe 5IHIA 1HYOA 1K9MR 1CSKA 1YJWT 4C0GA 4M78B 3X25B 2RH2A 1QKXA 2HBWA 3M0RA 1UTIA 4PNOA 2SEMA 1M1KC 3EGUA 2W10A 3OYLA 1YP5A 2YLCA 3FC3A 1NZ9A 4RMOA 3CCMA 4RTUA 2Y90A 3QYGB 4AG2C 2QI2A 2QQBA 1VYTA 4D8KA 1GBRA 3ER0A 4A53A 2HNIA 2O31A 2X9HA 1SPKA 2IG0A 1JXOA 4D6WA 1D3BA 4C8QA 5KYNA 1QWFA 1SG5A 3MP8A 3QBYA 1RLQC 3CPFA 4DQ2A 3M56A 4M7DC 2KRSA 3CCUA 1BI1A 3GF5A 3NTHA 3VRZA 1SHGA 3SB2A 3CCJQ 2P4TA 1YJ9T 5J26A 5CKEA 5KE2A 3CCMT 3EFOA 2RD1A 2V1QA 4PJNA 1NLOC 1U5SA 3QWYA 4JRIA 2EQUA 2H8HA 1ZLMA 1I4K1 2M0YA 3MEVA 3EFRA 2DEUA 2DPPB 2YSQA 3C94A 2E5QA 1R0CB 4HCZA 4F17A 3ZL7C 5KH6A 2HCKA 3JCMQ 2A3LA 1PRMC 3OYHA 2AK5A 3OW2S 4J6WA 1PD0A 5IXBA 2X4WA 3MEWA 1K1ZA 3VKIA 5GAMd 1YCYA 4J8OA 1BI0A 2EQKA 2YDLA 1P92A 1RABB 1K9MC 2QQAA 4F7UB 1YHQT 2EWNA 2PTKA 1WHMA 3QXEB 3V8JA 5KYUB 1S72Q 1PG5B 2RI5A 3M59A 2K4YA 4EMKC 4O5VA 2KAFA 1I5OB 1N8RU 4IKFA 3U23A 1WZOA 3ZBDA 2YUPA 1HSQA 1W2BS 3PGGA 4RUGA 3SWNB 2O4XA 4J9DA 2PNIA 1N8RC 2VB6A 2ABLA 1RAFB 3MPUB 1WJSA 2H3EB 1BIBA 4QQDA 2XI9A 1RAHB 2VXEA 1BU1A 2LMJA 4OVAA 1O75A 4OMOA 3KXTA 1QQJA 4DBQA 1G3TA 2QQSA 1QVPA 4DEXA 2LQKA 1U1TA 4LD6A 2D0QB 3NFCA 3M55A 3OB9A 2HSPA 1HJDA 3H0FA 2FPFA 4FW2A 1R77A 2D1XA 4OF1A 5IHKA 1YWOA 3JCMJ 2QDLA 3CCLQ 1X27A 2VV5A 3CC4Q 1VQOA 2HDAA 2XHCA 1D1CA 3LLRA 1VQPQ 3CCQQ 4A4HA 1RAGB 1QVGA 3OYFA 1LNXA 4CRIA 3G71Q 4E7LA 4PL6A 1VQ6T 4JJCA 2PQWA 1Q7YR 2ZPBB 4M77G 4LNPA 5A0DA 2DYBA 2M02A 4JJDA 1RI9A 3QSUA 1FMKA 5DLOA 1YJWA 4BY6B 3I55A 5KYXA 3CC4A 4QVDA 3I56A 3CXCP 2ATCB 1PSEA 4M7DA 4J83A 1E7OA 4PJOG 1ABQA 1X2KA 2P0PA 3H8ZA 3UPUA 2L89A 2Y4XA 3OYNA 4JJBA 4LDYA 2ZPHB 1NYFA 1YI2Q 1PWTA 2JOYA 1D3BB 2E65A 1TWBA 3PIOA 2G3RA 2CYZB 3CC2Q 1YITQ 4F7UF 2M0OA 4BACA 4Z88A 2XD0A 4ZGJB 2RQTA 1WXUA 4KGZB 4C8QD 2GNCA 4E7HA 4IUTA 2VVKA 4LDVA 4ELYC 3EFOB 5KE3A 2R58A 3EG3A 2EYWA 2R5MA 3FLGA 2DL4A 5CKBA 3CCVQ 3CEYA 1XQHA 3OBWA 3AT1B 1IRXA 1W1FA 4WF2A 1TG0A 1TH7A 2W0ZA 1QVGS 2CH4W 1VQLA 3CD6A 3OYDA 4ORZA 2EIFA 3HP9A 1OV3A 2YT6A 2RI2A 2E12A 3CBPA 3OS2A 4L59A 3SEMA 1PHTA 1MUZA 4C0DB 1X6GA 3EGDA 1M90R 5KYWA 1VQ7T 3Q1JA 3HTRA 1G5VA 2RHUA 2GCXA 4C5HA 4FM4B 1X75C 3EHQA 4J6YA 3PT9A 3G71T 3I5SA 2L3SA 2ZPFB 5CVIA 1VQ4T 1QVGP 5I2MA 2QYZA 3G4SQ 4F7UE 2AKLA 3JCMf 1VYUA 2L0AA 3L2QA 1N9SA 2PVGB 1PNJA 3RIRA 3G4ST 4XU3A 5DY9A 4CC4B 2YUQA 4DBRA 4JRPA 5KYXB 1PSFA 3UA7A 1OU8A 1UE9A 4FU6A 1OI1A 1T0JA 1AWWA 3VUBA 1UGPB 1M8VA 5C6SA 4HT9A 1Y07A 3EGXA 2CP5A 1Q81R 3TSZA 3V7SA 1KK7A 3M4GA 3CCUQ 3ZFJA 1JO8A 4FL6A 1VQ5Q 1GXIE 4PKCC 5I11A 1YI2T 4J7FA 4EMGA 2X4YA 5CAIA 2RHZA 2E3IA 2J06A 2D9TA 2EGAA 1Q82R 2CSIA 4BY6C 2DF6A 1KD1U 2COYA 1VIEA 1Y96A 3VUZA 3CCQA 4M7AF 5GAN5 1G3YA 2F2WA 3OSVA 2CREA 4M77A 3CCLT 3M0QA 3NTIA 1D1BA 2ZPIB 4N4HA 2HD0A 1ZHIA 2I2LA 3GLXA 4J9HA 2EQMA 4ZN1A 2X35A 1KQ1A 2DKGA 4OMMA 1M2VA 3UWNA 5FLXE 2DD4A 3C95A 1JXMA 2PUOB 1GCPA 3CCQT 1UDLA 4FIBA 3VRYA 1AHJB 2A7YA 2HEQA 2RM4A 5LJ5j 1Q86C 4PJMA 1Y7XA 1B34B 3L2WA 3A8GB 4RG8A 1NG2A 4M75G 4FSXA 1UEBA 1QCOA 3CCJA 4C92D 3OSSC 4JS4A 2X4JA 4XTXA 2K6DA 1HXDA 4J9GA 1Q95G 3GBQA 2HQXA 3CC2A 2LVMA 1KC8R 4M7AA 1SEMA 2DTIA 2HL3A 3RESA 2XKOC 1LPLA 4EMHA 2KY9A 1Q7YU 5L8RE 2PVOB 4KULA 1HD3A 3QHSA 5LJ3e 2ROLA 2KT8A 4LN2A 2DK3A 4MZPA 2CSQA 1M9SA 2K3YA 1JQQA 1Q86R 3QDRB 1Q7YC 4J9BA 1WNLA 5L23A 4HA8A 2J6KA 1NJIR 2XDBA 1BBZA 3PE0A 4FSSA 3V8KA 5D6YA 3VS2A 3IQLA 1RLPC 2EJ9A 2RJCA 2LJ1A 1RAEB 1YBYA 5GAOm 1QCNA 2FG0A 3M0TA 2F2XA 2FYKA 3ULRB 4M7AD 1Y71A 4GLKA 1IHWA 1KG1A 4E7ZA 1AT1B 1ZUYA 2Y4YA 4N0AC 3CC7Q 1FXXA 2KYMA 4E7IA 4M7AC 2CZ7B 3JB9F 2F5KA 5GJWB 1OX9A 2ENMA 3M57A 3LH0A 3C0CA 2RHYA 2RNAA 4AG1C 2K79A 4DBHA 4C8QB 1VQPA 1ZSZA 4M7AB 2DL5A 3P8HA 2JN0A 3HRTA 5FU6C 3S3MA 5GAMj 1AEYA 1TSFA 3TCJA 3CC7T 2HQHA 3VV0A 1YJWQ 3INZA 4BE0A 1YJ9Q 2PZ1A 3VS1A 5HCKA 2DERA 3N5BB 3M5AA 2F1LA 4M75E 3M0SA 5LJ5e 3OBYA 3MKDA 3JCMV 3H41A 1VQNA 4C5IA 3H6ZA 1VQ5T 2QA4T 3OQ5A 4R55A 1WIEA 1UUEA 2JMAA 1K8AR 3CXCA 2KXDA 4WCIA 2CZ6B 5AYFA 3L1AA 3CMET 3TREA 3FB9A 2J7IA 4OMFB 5GAMh 1MHNA 2OX7A 4EDUA 4N4IA 2CP2A 2ECZA 4A63B 3G7ZA 3KUFA 2RMOA 2JVVA 1JJ2A 1UG1A 4JZ4A 4ZTJA 2O01E 1XJWB
chains in the Genus database with same CATH topology
1EFNA 2JT4A 2GBQA 1BU1A 4OMNA 2LMJA 4RTVA 2EYZA 1NEGA 4OMOA 4X1VA 1M30A 2BZXA 4GLMA 1WDXA 2JS0A 2RF0A 4DEXA 1UECA 3M0PA 4F14A 2EGEA 3EG2A 2HSPA 1HJDA 3H0FA 4QT7A 2FPFA 4ESRA 2DLPA 1GRIA 2NUZA 1T3SA 1GCQA 2D1XA 5I22A 5IHKA 1YWOA 2RQUA 2QDLA 2AKKA 1X27A 2HDAA 2LJ3A 2KR3A 1VYVA 2B86A 2DNUA 3UATA 4JJCA 2EW3A 2DRKA 3M0UA 2X3WD 2X3XD 2DILA 4HVUA 4LNPA 2LNHB 5FW9A 2DYBA 1MV3A 4JJDA 1RI9A 1FMKA 1PRLC 3R6NA 3PVLA 4EIKA 3UF4A 1GBQA 3THKA 2C0OA 2EKHA 3EG0A 1NLPC 2GTOA 1B3QA 2K9GA 4J9CA 2MOXA 3I35A 1E7OA 1QCFA 1X2QA 2MIOA 1ABQA 1X2KA 3EHRA 2O9SA 2BTTA 2DRMA 2E5KA 2OAWA 4JJBA 2CUBA 1NYFA 1Z9QA 2GQIA 4RTZA 4D8DA 1ZUKA 1PWTA 2CT4A 4OMQA 1UFFA 2DVJA 2DBKA 3NPFA 2D8JA 2KYBA 2YUOA 1GFDA 2JM9A 2DMOA 2K2MA 2DBMA 2EYYA 4Z88A 1U06A 2RQTA 1K4US 2ESWA 2J6OA 1WXUA 1AD5A 2GNCA 2K3BA 2MCNA 3VS5A 5IH2A 1KFZA 2J05A 3VS4A 2ROTA 2VVKA 1YWPA 5FWCA 3NHNA 1SRLA 3JV3A 4AFSC 4CC3A 3EG3A 2OJ2A 1UHFA 2EYWA 4AFQC 2DL4A 2G6FX 1ABOA 1BB9A 2BZYA 1W1FA 1YNZA 1TG0A 2W0ZA 2CH4W 4RTTA 1N5ZA 1IO6A 1XOVA 1YCSB 1I0CA 4ORZA 1OV3A 3VS3A 2YT6A 2KBTA 1OPKA 2DJQA 3SEMA 1PHTA 1MUZA 1U3OA 1X6GA 2CT3A 1GL5A 1M27C 1ZUUA 1J3TA 2LCSA 2M51A 2O2OA 5ECAA 1W6XA 2FPEA 1Y57A 1V1CA 2I0NA 2EQIA 2EPDA 1KJWA 1SHFA 2ED1A 3EHQA 4ZNXA 1GFCA 2JM8A 2L2PA 4Z8AA 3I5SA 2L3SA 3RNJA 2KRNA 4CC2A 2DM1A 2AKLA 2KXCA 1WYXA 4HXJA 1VYUA 2L0AA 2J6FA 1ARKA 5IXFA 4RTYA 1PNJA 3PVQA 1TUCA 3REBB 3QWXX 2O88A 4CC4B 2YUQA 2FRWA 3NMZC 4IIMA 2LX7A 3UA7A 1UE9A 1PKTA 1T0JA 1AZEA 1AWWA 2OI3A 4F16A 1K9AA 1TUDA 1JEGA 1G83A 3KFVA 2KEAA 2KGTA 2CH4A 2JW4A 2P4RA 3TSZA 2O9VA 1JO8A 2YUNA 1H8KA 2DE0X 1UJ0A 4OMPA 2C0TA 1AZGB 4DEYA 5I11A 2KROA 2DL3A 1WXTA 2K7AA 2VWFA 2J06A 4OMLA 2ED0A 1FYNA 2EGAA 3I9QA 2CSIA 2DF6A 3VS0A 3CQTA 2A37A 2A36A 2RQWA 2GTJA 2F2WA 2L3QA 3I5RA 2CREA 1X43A 2AZVA 4E6RA 1S1NA 2KRMA 4AFZC 1WX6A 2BZ8A 3M0QA 2DA9A 1T3LA 1KSWA 2LZ6B 3EG1A 1Z9ZA 1X69A 4J9HA 3REAB 1M8MA 4RTXA 1AWXA 4OMMA 4K11A 3VS6A 1UGVA 4R0KA 1T0HA 2D8HA 4LUDA 1SSHA 4Y92A 1JXMA 1GCPA 2NWMA 4Z89A 1UDLA 3VRYA 2HEQA 2LP5A 3NGPA 2DL8A 1JU5C 2A08A 2LQNA 2RQVA 2KE9A 1NG2A 2FO0A 3SHWA 3RBBB 1QWEA 1K0XA 2FEIA 2K6DA 2CDTA 1M3BA 2IIMA 1M3CA 4J9GA 4M4ZA 1QLYA 1G2BA 3GBQA 1W70A 2DL7A 4AFUC 1SRMA 2A28A 1AVZC 2KNBB 1SEMA 1CKAA 1I1JA 2LJ0A 5IHIA 3LH5A 2LQWA 1CSKA 1GCQC 3VS7A 1QKXA 1HD3A 2HBWA 3M0RA 1UTIA 2SEMA 2ROLA 2KT8A 3EGUA 4LN2A 2W10A 2CSQA 1YP5A 5IHNA 1JQQA 2SRCA 2JTEA 4J9BA 1AWOA 5EC7A 4J9EA 5L23A 2J6KA 4RTUA 4AG2C 1BBZA 2FRYA 1VA7A 1VYTA 3PE0A 4FSSA 4D8KA 1GBRA 3VS2A 1K0SA 3IQLA 1RLPC 3O5ZA 2O31A 3A98A 3H0HA 1SPKA 2LJ1A 1JXOA 2RN8A 1WFWA 4KRTA 1OPLA 2FG0A 3M0TA 5FWBA 1QWFA 1WLPB 2F2XA 3ULRB 1RLQC 4GBQA 3UA6A 2RQRA 2KRSA 1I07A 2JMCA 2EVRA 2V1RA 1ZUYA 3VRZA 1SHGA 2DX1A 1QKWA 4JPBW 2GGRA 2KYMA 1UHCA 1A0NB 3H0IA 2ENMA 5GJWB 2EBPA 1BK2A 1NEBA 2L3PA 3C0CA 2V1QA 2RNAA 4AG1C 3TSWA 1NLOC 1U5SA 1M3AA 2K79A 3QWYA 4JZ3A 1ZSGA 2H8HA 1ZLMA 1WA7A 2M0YA 2DL5A 1K76A 1WXBA 1E6GA 1AEYA 3FJ5A 2YSQA 1ZBJA 4F17A 1X6BA 1PKSA 3ZL7C 1YN8A 2HCKA 1LCKA 1NYGA 1MV0B 2AZSA 2PZ1A 3VS1A 5HCKA 1PRMC 4HVVA 2CUDA 2AK5A 3M0SA 2EYXA 4IIOA 5IXBA 1Y0MA 1K1ZA 3TVTA 1OEBA 2JS2A 3H41A 1UJYA 2YDLA 1KIKA 4CC7A 4RTWA 4J9FA 4LE9A 1H3HA 1H92A 2D0NA 1WIEA 2PTKA 1UUEA 2JMAA 2KXDA 4LUEA 4WCIA 1AOJA 2KT1A 2C0IA 2XMFA 3U23A 2J7IA 2VKNA 1ZX6A 4HCKA 1AWJA 2YUPA 4J9IA 1OOTA 1HSQA 2EGCA 2RPNA 4RUGA 2ECZA 4A63B 1RUWA 2F2VA 4J9DA 2PNIA 1E6HA 2ABLA 1B07A 4HVWA 1NM7A 2FPDA 2RMOA 2JXBA 1UG1A 5GJVB 4JZ4A 1CKBA 1WI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFN A;  2JT4 A;  2GBQ A;  1BU1 A;  4OMN A;  2LMJ A;  4RTV A;  2EYZ A;  1NEG A;  4OMO A;  4X1V A;  1M30 A;  2BZX A;  4GLM A;  1WDX A;  2JS0 A;  2RF0 A;  4DEX A;  1UEC A;  3M0P A;  4F14 A;  2EGE A;  3EG2 A;  2HSP A;  1HJD A;  3H0F A;  4QT7 A;  2FPF A;  4ESR A;  2DLP A;  1GRI A;  2NUZ A;  1T3S A;  1GCQ A;  2D1X A;  5I22 A;  5IHK A;  1YWO A;  2RQU A;  2QDL A;  2AKK A;  1X27 A;  2HDA A;  2LJ3 A;  2KR3 A;  1VYV A;  2B86 A;  2DNU A;  3UAT A;  4JJC A;  2EW3 A;  2DRK A;  3M0U A;  2X3W D;  2X3X D;  2DIL A;  4HVU A;  4LNP A;  2LNH B;  5FW9 A;  2DYB A;  1MV3 A;  4JJD A;  1RI9 A;  1FMK A;  1PRL C;  3R6N A;  3PVL A;  4EIK A;  3UF4 A;  1GBQ A;  3THK A;  2C0O A;  2EKH A;  3EG0 A;  1NLP C;  2GTO A;  1B3Q A;  2K9G A;  4J9C A;  2MOX A;  3I35 A;  1E7O A;  1QCF A;  1X2Q A;  2MIO A;  1ABQ A;  1X2K A;  3EHR A;  2O9S A;  2BTT A;  2DRM A;  2E5K A;  2OAW A;  4JJB A;  2CUB A;  1NYF A;  1Z9Q A;  2GQI A;  4RTZ A;  4D8D A;  1ZUK A;  1PWT A;  2CT4 A;  4OMQ A;  1UFF A;  2DVJ A;  2DBK A;  3NPF A;  2D8J A;  2KYB A;  2YUO A;  1GFD A;  2JM9 A;  2DMO A;  2K2M A;  2DBM A;  2EYY A;  4Z88 A;  1U06 A;  2RQT A;  1K4U S;  2ESW A;  2J6O A;  1WXU A;  1AD5 A;  2GNC A;  2K3B A;  2MCN A;  3VS5 A;  5IH2 A;  1KFZ A;  2J05 A;  3VS4 A;  2ROT A;  2VVK A;  1YWP A;  5FWC A;  3NHN A;  1SRL A;  3JV3 A;  4AFS C;  4CC3 A;  3EG3 A;  2OJ2 A;  1UHF A;  2EYW A;  4AFQ C;  2DL4 A;  2G6F X;  1ABO A;  1BB9 A;  2BZY A;  1W1F A;  1YNZ A;  1TG0 A;  2W0Z A;  2CH4 W;  4RTT A;  1N5Z A;  1IO6 A;  1XOV A;  1YCS B;  1I0C A;  4ORZ A;  1OV3 A;  3VS3 A;  2YT6 A;  2KBT A;  1OPK A;  2DJQ A;  3SEM A;  1PHT A;  1MUZ A;  1U3O A;  1X6G A;  2CT3 A;  1GL5 A;  1M27 C;  1ZUU A;  1J3T A;  2LCS A;  2M51 A;  2O2O A;  5ECA A;  1W6X A;  2FPE A;  1Y57 A;  1V1C A;  2I0N A;  2EQI A;  2EPD A;  1KJW A;  1SHF A;  2ED1 A;  3EHQ A;  4ZNX A;  1GFC A;  2JM8 A;  2L2P A;  4Z8A A;  3I5S A;  2L3S A;  3RNJ A;  2KRN A;  4CC2 A;  2DM1 A;  2AKL A;  2KXC A;  1WYX A;  4HXJ A;  1VYU A;  2L0A A;  2J6F A;  1ARK A;  5IXF A;  4RTY A;  1PNJ A;  3PVQ A;  1TUC A;  3REB B;  3QWX X;  2O88 A;  4CC4 B;  2YUQ A;  2FRW A;  3NMZ C;  4IIM A;  2LX7 A;  3UA7 A;  1UE9 A;  1PKT A;  1T0J A;  1AZE A;  1AWW A;  2OI3 A;  4F16 A;  1K9A A;  1TUD A;  1JEG A;  1G83 A;  3KFV A;  2KEA A;  2KGT A;  2CH4 A;  2JW4 A;  2P4R A;  3TSZ A;  2O9V A;  1JO8 A;  2YUN A;  1H8K A;  2DE0 X;  1UJ0 A;  4OMP A;  2C0T A;  1AZG B;  4DEY A;  5I11 A;  2KRO A;  2DL3 A;  1WXT A;  2K7A A;  2VWF A;  2J06 A;  4OML A;  2ED0 A;  1FYN A;  2EGA A;  3I9Q A;  2CSI A;  2DF6 A;  3VS0 A;  3CQT A;  2A37 A;  2A36 A;  2RQW A;  2GTJ A;  2F2W A;  2L3Q A;  3I5R A;  2CRE A;  1X43 A;  2AZV A;  4E6R A;  1S1N A;  2KRM A;  4AFZ C;  1WX6 A;  2BZ8 A;  3M0Q A;  2DA9 A;  1T3L A;  1KSW A;  2LZ6 B;  3EG1 A;  1Z9Z A;  1X69 A;  4J9H A;  3REA B;  1M8M A;  4RTX A;  1AWX A;  4OMM A;  4K11 A;  3VS6 A;  1UGV A;  4R0K A;  1T0H A;  2D8H A;  4LUD A;  1SSH A;  4Y92 A;  1JXM A;  1GCP A;  2NWM A;  4Z89 A;  1UDL A;  3VRY A;  2HEQ A;  2LP5 A;  3NGP A;  2DL8 A;  1JU5 C;  2A08 A;  2LQN A;  2RQV A;  2KE9 A;  1NG2 A;  2FO0 A;  3SHW A;  3RBB B;  1QWE A;  1K0X A;  2FEI A;  2K6D A;  2CDT A;  1M3B A;  2IIM A;  1M3C A;  4J9G A;  4M4Z A;  1QLY A;  1G2B A;  3GBQ A;  1W70 A;  2DL7 A;  4AFU C;  1SRM A;  2A28 A;  1AVZ C;  2KNB B;  1SEM A;  1CKA A;  1I1J A;  2LJ0 A;  5IHI A;  3LH5 A;  2LQW A;  1CSK A;  1GCQ C;  3VS7 A;  1QKX A;  1HD3 A;  2HBW A;  3M0R A;  1UTI A;  2SEM A;  2ROL A;  2KT8 A;  3EGU A;  4LN2 A;  2W10 A;  2CSQ A;  1YP5 A;  5IHN A;  1JQQ A;  2SRC A;  2JTE A;  4J9B A;  1AWO A;  5EC7 A;  4J9E A;  5L23 A;  2J6K A;  4RTU A;  4AG2 C;  1BBZ A;  2FRY A;  1VA7 A;  1VYT A;  3PE0 A;  4FSS A;  4D8K A;  1GBR A;  3VS2 A;  1K0S A;  3IQL A;  1RLP C;  3O5Z A;  2O31 A;  3A98 A;  3H0H A;  1SPK A;  2LJ1 A;  1JXO A;  2RN8 A;  1WFW A;  4KRT A;  1OPL A;  2FG0 A;  3M0T A;  5FWB A;  1QWF A;  1WLP B;  2F2X A;  3ULR B;  1RLQ C;  4GBQ A;  3UA6 A;  2RQR A;  2KRS A;  1I07 A;  2JMC A;  2EVR A;  2V1R A;  1ZUY A;  3VRZ A;  1SHG A;  2DX1 A;  1QKW A;  4JPB W;  2GGR A;  2KYM A;  1UHC A;  1A0N B;  3H0I A;  2ENM A;  5GJW B;  2EBP A;  1BK2 A;  1NEB A;  2L3P A;  3C0C A;  2V1Q A;  2RNA A;  4AG1 C;  3TSW A;  1NLO C;  1U5S A;  1M3A A;  2K79 A;  3QWY A;  4JZ3 A;  1ZSG A;  2H8H A;  1ZLM A;  1WA7 A;  2M0Y A;  2DL5 A;  1K76 A;  1WXB A;  1E6G A;  1AEY A;  3FJ5 A;  2YSQ A;  1ZBJ A;  4F17 A;  1X6B A;  1PKS A;  3ZL7 C;  1YN8 A;  2HCK A;  1LCK A;  1NYG A;  1MV0 B;  2AZS A;  2PZ1 A;  3VS1 A;  5HCK A;  1PRM C;  4HVV A;  2CUD A;  2AK5 A;  3M0S A;  2EYX A;  4IIO A;  5IXB A;  1Y0M A;  1K1Z A;  3TVT A;  1OEB A;  2JS2 A;  3H41 A;  1UJY A;  2YDL A;  1KIK A;  4CC7 A;  4RTW A;  4J9F A;  4LE9 A;  1H3H A;  1H92 A;  2D0N A;  1WIE A;  2PTK A;  1UUE A;  2JMA A;  2KXD A;  4LUE A;  4WCI A;  1AOJ A;  2KT1 A;  2C0I A;  2XMF A;  3U23 A;  2J7I A;  2VKN A;  1ZX6 A;  4HCK A;  1AWJ A;  2YUP A;  4J9I A;  1OOT A;  1HSQ A;  2EGC A;  2RPN A;  4RUG A;  2ECZ A;  4A63 B;  1RUW A;  2F2V A;  4J9D A;  2PNI A;  1E6H A;  2ABL A;  1B07 A;  4HVW A;  1NM7 A;  2FPD A;  2RMO A;  2JXB A;  1UG1 A;  5GJV B;  4JZ4 A;  1CKB A;  1WI7 A; 
#chains in the Genus database with same CATH topology
 2JT4 A;  2LNV A;  3HL8 A;  2GBQ A;  4OMN A;  2K5I A;  1N8R R;  2EYZ A;  1NEG A;  1VQ7 A;  5GAO r;  1WDX A;  2RF0 A;  1UEC A;  4C8Q E;  2OTJ A;  1JRI A;  4F14 A;  4C8Q C;  3LW5 E;  2O4X B;  3RKX A;  2DLP A;  2DTH A;  5GAN 7;  1RL2 A;  1B7T A;  1S72 A;  5FU6 B;  2RK1 A;  2EQJ A;  2QGG A;  1I8F A;  3TEE A;  1JJ2 P;  1VYV A;  1NE8 A;  4JS5 A;  3MCA B;  2PUK B;  2B86 A;  2DNU A;  3UAT A;  1IGU A;  3CPW A;  1YIJ A;  4M7D G;  4OB1 B;  2DRK A;  3BFM A;  1K9M U;  2X3W D;  2VAS A;  4HVU A;  2E6Z A;  2LNH B;  1VQ4 A;  2BUD A;  3CCJ T;  1KQS P;  2DZ9 A;  3JCM P;  1XTD A;  5LJ5 d;  4EMK A;  3THK A;  2C0O A;  1M4Z A;  3TU4 K;  5GAN 3;  2LT1 A;  2M1H A;  1D0Y A;  3OYK A;  3EHR A;  1WHJ A;  4DA4 A;  2E41 A;  1VQ4 Q;  1Z9Q A;  4C0Z A;  2VUB A;  4PLI A;  2DBK A;  5HY6 A;  2D8J A;  8ATC B;  1GFD A;  2JM9 A;  3EGD B;  3CMA Q;  2COW A;  1JJ2 S;  3MEA A;  1QVF P;  3QZ9 B;  2K3B A;  2J05 A;  3VS4 A;  3CMA A;  4PFZ A;  3JV3 A;  4AFS C;  4CC3 A;  4C92 F;  1NJI U;  6AT1 B;  4AFQ C;  2RHX A;  4N4G A;  2BZY A;  2WAC A;  3QPH A;  5GAM e;  4JUV A;  4P5N A;  3L2V A;  1YIT T;  2YHT A;  2NYS A;  3MHX A;  3CXC S;  2MWP A;  2KSS A;  1IO6 A;  1NJI C;  4XTW A;  3JCM c;  3GP8 A;  3OMC A;  3V8L A;  4XTV A;  5KCO A;  3R6O A;  4PK4 A;  5LJ3 g;  1BI3 A;  3PFS A;  1BI2 A;  4C5E A;  2QQR A;  3X26 B;  4O6J A;  1M27 C;  2LCS A;  2O2O A;  1W6X A;  1U8R A;  3CCV A;  1V1C A;  3A8L B;  3S3N A;  2I0N A;  2PVD B;  5J3B A;  3A5Z B;  4HT8 A;  2HAX A;  5CKD A;  1GFC A;  4Z8A A;  3V7C A;  3PTA A;  3TQ7 P;  3NTK A;  3CMA T;  5I2S A;  2DM1 A;  2MAM A;  2DXB A;  1WYX A;  4HXJ A;  1ARK A;  3HRU A;  1VQ6 Q;  4RTY A;  4EPC A;  1TUC A;  4M77 B;  4PJO F;  3QWX X;  4JLI A;  3NMZ C;  4IIM A;  3CCR A;  1VOM A;  4LD9 K;  2OI3 A;  2QQ9 A;  4F7U G;  3OYY A;  1JEG A;  1G83 A;  3CCS T;  1FWZ A;  2WSC E;  2YRC A;  3GIB A;  2KEA A;  2RB6 A;  4XTZ A;  1PC0 A;  1G3W A;  1H8K A;  4ZGD B;  2HSE B;  2Z0W A;  2OAU A;  2IPO B;  2K3X A;  4E2F B;  4A4G A;  2QTX A;  2DYI A;  3G4S A;  2KRO A;  4ME7 A;  5CKF A;  1D0X A;  2OTL Q;  2FB7 A;  2CP3 A;  2ED0 A;  1FYN A;  1SKU B;  3I9Q A;  1YJN T;  5GAM f;  2A37 A;  1YJ9 A;  2A36 A;  2OTL A;  1KQ2 A;  2QG9 B;  4DBF A;  5CQX A;  3PMT A;  2L3Q A;  3I5R A;  4RG2 A;  4IUQ A;  3EG9 A;  5GAN 4;  4E6R A;  3BE3 A;  3GNF B;  2L5Q A;  3PMI A;  1WX6 A;  2DA9 A;  4E47 A;  1NPR A;  2LZ6 B;  3REA B;  1UGV A;  4R0K A;  2E70 A;  1T0H A;  4M78 C;  2FL7 A;  1YI2 A;  2DFU A;  4LUD A;  5GAO n;  2D6F A;  3NGP A;  4CI0 C;  1JU5 C;  5M9O A;  5GAO p;  1VQL T;  3CD6 T;  2LQN A;  3OW2 A;  2KE9 A;  1G3S A;  2LCL A;  4KUD K;  1OQK A;  3RBB B;  4QVC A;  2FEI A;  4E7J A;  3HRS A;  4B9X A;  1M3B A;  2IIM A;  4M7D F;  3M54 A;  2F69 A;  2DXU A;  4QVZ A;  1QLY A;  3JAM E;  3QJ6 A;  4FYW B;  4RCB A;  2A28 A;  3VYH B;  1WQ7 A;  4QW2 A;  1VQ7 Q;  2PU9 B;  3S3O A;  4M75 C;  4C0F A;  3LH5 A;  4C5G A;  3OYA A;  1X6O A;  1JB0 E;  4XU1 A;  5IAY A;  5GAO l;  4J5Y A;  2LCC A;  2MMP A;  1OUL A;  4M75 D;  2DD5 A;  1AWO A;  3SWN C;  5EC7 A;  2YWW A;  2DVE A;  2FRY A;  1VA7 A;  2OTJ T;  1TTH B;  4B9W A;  4GY5 A;  3UDC A;  2VXF A;  3UT1 A;  1BIA A;  4LDW A;  3O5Z A;  1KHI A;  1UGS B;  3OS1 A;  3OYG A;  1TUG B;  2RN8 A;  1WFW A;  4KRT A;  1C6V X;  5CK9 A;  2QDY B;  4R56 A;  2ZAE A;  2CP7 A;  2DAQ A;  4FYV B;  2MPX C;  2RQR A;  1V76 A;  2V26 A;  2JMC A;  1Q86 U;  4IUU A;  2V1R A;  4NL2 A;  1IHV A;  2DX1 A;  2XID A;  3PNW C;  1IGQ A;  1UHC A;  1V29 B;  4KBM B;  3H0I A;  1U1S A;  2EBP A;  1NEB A;  2L3P A;  1QW1 A;  5FRM A;  2KI7 A;  4X9C A;  4II1 A;  3RR6 A;  5GMK m;  4KUI A;  2CKK A;  4BD3 A;  4JZ3 A;  1ZSG A;  3I55 T;  1WA7 A;  3QDF A;  2B8A A;  4KH0 B;  1K76 A;  1YJN Q;  1R0B G;  1VQK T;  3E9G A;  4MML A;  1FMV A;  3FJ5 A;  2ZGW A;  4ANJ A;  1X6B A;  1PKS A;  4M78 E;  5D6W A;  2DET A;  2K5L A;  1VIF A;  4M7D B;  5A2Q E;  1NYG A;  1MV0 B;  4OB0 B;  2AZS A;  2MF2 A;  2HBP A;  1M1F A;  4M75 B;  3WXM B;  4XK8 E;  2CUD A;  3SFM A;  4IIO A;  3RDV A;  3X20 B;  1Y0M A;  3TVT A;  1UGQ B;  2KDS A;  1KIK A;  3CC7 A;  4C0D C;  4CC7 A;  3OMG A;  4LE9 A;  2D0N A;  1VQ8 A;  4F7U A;  3OY9 A;  4ATO A;  1BCM A;  2KVQ G;  4Y91 A;  1TXQ A;  4BI8 B;  3DLM A;  2KT1 A;  3BY7 A;  3MJX A;  2XMF A;  1WHK A;  1ZX6 A;  1AWJ A;  2XDP A;  4FT2 A;  4J9I A;  3CME Q;  4HKE A;  2HMA A;  5IN1 A;  1UGR B;  2QGF B;  3JB9 D;  2QA4 A;  2DXC A;  1VQ9 T;  4HVW A;  3RMQ A;  2JXB A;  3CCE A;  1QMC A;  3MEU A;  2ZZD A;  1ACM B;  1WI7 A;  3F70 A;  4ZGE B;  1YHQ A;  2E10 A;  2OTL T;  5LJ5 f;  3CPW S;  5GMK j;  2JNG A;  4X1V A;  3X24 B;  2BE9 B;  3CME A;  4GLM A;  1EIF A;  3M0P A;  3A1P A;  2EGE A;  3E19 A;  4X34 A;  3EG2 A;  3OW2 P;  2MWO A;  1MGQ A;  4ESR A;  2NUZ A;  1GRI A;  4OP0 A;  4PJJ A;  2RJE A;  3FJP A;  1FX7 A;  4Q5W A;  5I22 A;  1WHH A;  3CCE Q;  4XQ3 A;  4C92 B;  1K73 C;  2AKK A;  3QII A;  2QTV A;  1MMG A;  2K5F A;  4FYY B;  2LJ3 A;  2R5A A;  1TU0 B;  3EAE A;  1OYX A;  2HKN A;  3A8H B;  4BE2 A;  1WHG A;  5D7U A;  2C06 A;  2EW3 A;  3M0U A;  2X3X D;  5KYU A;  2DIL A;  5GAN f;  5LL6 S;  5FW9 A;  4M77 C;  4M78 D;  1OU9 A;  3R6N A;  3PVL A;  4EIK A;  3WVD B;  3UF4 A;  2WSE E;  3J7A F;  5GMK i;  5DM7 R;  3EG0 A;  3ME9 A;  2EFI A;  1NLP C;  5KYY A;  3SWN A;  3BW1 A;  2LT4 A;  4M78 G;  1B3Q A;  2K9G A;  4J9C A;  3A8M B;  2YXY A;  2MOX A;  4XAX B;  1YJN A;  1ZQ1 A;  3LX7 A;  2MIO A;  3CCR T;  1VQL Q;  4M77 D;  4ZTF A;  3CD6 Q;  2DJZ A;  2JJ9 A;  2VC8 A;  2O9S A;  2DRM A;  2ZPE B;  5EG2 A;  2OAW A;  2V8I A;  2CUB A;  3G6E Q;  2GQI A;  4RTZ A;  4D8D A;  1N27 A;  2LQ8 A;  2CT4 A;  4EMK B;  4OMQ A;  1JBM A;  2DVJ A;  3T9N A;  2KYB A;  2DMO A;  4PLL A;  1LVK A;  1MMN A;  2EYY A;  1K4U S;  2J6O A;  2MCN A;  5IH2 A;  3OYJ A;  1KFZ A;  5LJ3 f;  4C8Q G;  2ROT A;  2L8D A;  1H64 1;  5DLQ E;  4C92 E;  2GF7 A;  1SRL A;  3HSB A;  1UB4 A;  2OJ2 A;  1UHF A;  1VQM T;  3OYE A;  4RCC A;  4NL3 A;  1BB9 A;  2DIG A;  4KT0 E;  2EYQ A;  2JUF A;  4IUR A;  2QEX A;  3VJP A;  1XOV A;  1I0C A;  4C92 G;  3VS3 A;  2DXT A;  2CZ0 B;  1QP3 A;  3JB9 G;  4LXC A;  4PJO D;  4ZN3 A;  2AIR B;  3CBM A;  2ZCF B;  1U3O A;  1VQM Q;  2DO3 A;  5CIU A;  3OYI A;  5LJ3 j;  1GL5 A;  4BB7 A;  4C92 A;  2E3H A;  4XTY A;  2M51 A;  5ECA A;  4MZM A;  2FPE A;  1QVF A;  1VQM A;  1YHQ Q;  2VYT A;  2EQI A;  5GAN g;  4M78 A;  1EX4 A;  2EPD A;  2DIQ A;  1SHF A;  4UC4 A;  1FMW A;  1KC8 U;  4MDX A;  4ZNX A;  2JM8 A;  3RNJ A;  2KRN A;  1D0Z A;  4CC2 A;  3J80 E;  4KGX B;  5HK0 A;  1YIJ T;  2QA4 Q;  3I56 T;  5IXF A;  2QK0 A;  2X51 A;  3PVQ A;  1VQ8 T;  1MND A;  2FRW A;  1Y96 B;  3S6W A;  2QEX T;  1AZE A;  2YRV A;  4F16 A;  1K9A A;  2KQW A;  2HZY A;  3KFV A;  5AT1 B;  2JW4 A;  3JSC A;  2P4R A;  3CCV T;  2F5T X;  2YUN A;  2DE0 X;  1RAD B;  2NLU A;  5I21 A;  2C0T A;  4JRK A;  5GAN j;  1ZSZ C;  2RK2 A;  1AZG B;  3QO3 A;  4DEY A;  3G6E T;  5FRN A;  4QKU A;  2KMT A;  2K57 A;  2DL3 A;  1WXT A;  2K7A A;  3O8V A;  8AT1 B;  9ATC B;  2MK5 A;  1M1K U;  3CQT A;  4B6M A;  4BI3 A;  2RQW A;  1DJ7 B;  3CCS Q;  1M5Q 1;  2VGM A;  4DOW A;  1M90 U;  2AZV A;  4J6X A;  1QP2 A;  1S1N A;  2KRM A;  4BE1 A;  2BZ8 A;  3G1J A;  3JCM e;  4QQ6 A;  5GMK h;  2COZ A;  3EG1 A;  1Z9Z A;  2M9U A;  3E9F A;  1X69 A;  3RKY A;  4M75 A;  3SD4 A;  4A4F A;  5CQY A;  1M8M A;  4RTX A;  3RUX A;  4K11 A;  1M90 C;  4JRQ A;  2D8H A;  4OB2 B;  4Y92 A;  4WTO B;  2NWM A;  4X9D A;  4Z89 A;  1HK9 A;  2BE7 D;  3OYC A;  1WPY A;  2LP5 A;  3VU3 C;  2DL8 A;  2GFU A;  2A08 A;  2V8J A;  2RQV A;  3DLL A;  1VQN T;  2M16 A;  4JLG A;  5GAN h;  2FO0 A;  3QKJ A;  3RER A;  4M75 F;  1TOV A;  2CDT A;  1WJR A;  4M4Z A;  1MNE A;  2DEQ A;  4Y28 E;  1VQ5 A;  1W2B P;  1W70 A;  4KH1 B;  2DL7 A;  3FDR A;  4AFU C;  5FU7 C;  4MMK A;  3MET A;  2HL5 C;  2EKO A;  1M2O A;  1NPP A;  2E4H A;  5J39 A;  1LJO A;  1CKA A;  1I1J A;  4IUP A;  2LJ0 A;  2P0K A;  1EZZ B;  2A0F B;  2RI3 A;  2LQW A;  5LJ5 g;  1GCQ C;  4XU0 A;  1YFN A;  1TS9 A;  3VS7 A;  1KD1 R;  1B34 A;  3C4S A;  1VQ9 Q;  2H3J A;  2X4X A;  3CCU T;  1G8X A;  4JJN K;  4J7I A;  5IHN A;  3SDZ A;  5CO7 A;  2SRC A;  4TVR A;  4YTL A;  2JTE A;  2CGH A;  2IVW A;  2JZ2 A;  4J9E A;  1VQO Q;  3RMS A;  2DTO A;  2ZPG B;  5C0M A;  1WGS A;  2V8K A;  5A0L A;  1K0S A;  2E64 A;  4PJL A;  3JRZ A;  4DOV A;  1K8A U;  3A98 A;  3H0H A;  4PJO B;  1IRE B;  1OPL A;  1VQ8 Q;  4BUG A;  5FWB A;  1WLP B;  3EH2 A;  5A0G A;  4GBQ A;  3UA6 A;  3QYH B;  1I07 A;  1C1A A;  2EVR A;  3D7S B;  1K8A C;  4IUV A;  3I55 Q;  3E2U A;  1QVF S;  1KQS A;  1QKW A;  2EJG A;  2GGR A;  4JPB W;  1PCX A;  1Q82 U;  1W4S A;  1A0N B;  1VQN Q;  1F1B B;  4C92 C;  3QG1 A;  2AT1 B;  1BK2 A;  3TSW A;  1M3A A;  2FZG B;  5GAN 2;  3QJY A;  4NS5 A;  3FIF A;  1BYM A;  3BDU A;  4PJO A;  4N0A A;  1MMA A;  1Q82 C;  1WXB A;  5CKH A;  1E6G A;  3OA6 A;  3DB3 A;  1ZBJ A;  2FVU A;  1M1G A;  1N9R A;  1YN8 A;  2E6N A;  1LCK A;  2OTJ Q;  2CP0 A;  3CBO A;  2NUT B;  4HVV A;  4HCC A;  2DZC A;  2EYX A;  5LJ3 d;  1OEB A;  1XNI A;  2JS2 A;  4M7D E;  1UJY A;  5D6X A;  4M77 E;  3LGL A;  4RTW A;  1ZSZ B;  3HKS A;  4J9F A;  1H3H A;  1VQK A;  1H92 A;  1WHL A;  3JB9 J;  2XIC A;  4A4E A;  3V7R A;  4LUE A;  1AOJ A;  5FRO A;  2LTO A;  2NUP A;  2EJF A;  2FZK B;  2C0I A;  2GFA A;  2VKN A;  4HCK A;  2RO0 A;  1OOT A;  5HK3 A;  4PJO C;  1VQ6 A;  2EGC A;  2RPN A;  3M9Q A;  1RUW A;  1VQO T;  3LYI A;  3CCM Q;  2F2V A;  5IT9 E;  1E6H A;  1YIJ Q;  1B07 A;  3KBG A;  4NOY A;  1NM7 A;  2FPD A;  2L3R A;  4E7K A;  3QZ5 B;  5GJV B;  3EGX B;  3DKM A;  1CKB A;  3L2Z A;  4MZT A;  4RKU E;  3HFN A;  1EFN A;  2FHD A;  4E7S A;  2QEX Q;  4XU2 A;  4RTV A;  5GAN d;  1M30 A;  2BZX A;  2LRQ A;  2JS0 A;  3JCM b;  4F04 B;  3P8D A;  4OB3 B;  2JTM A;  4QT7 A;  1I5L A;  3AHU A;  3CC4 T;  2WSF E;  1T3S A;  1GCQ A;  3LGF A;  1VQP T;  1OZ3 A;  2RQU A;  4M77 F;  3HHT B;  1VQ9 A;  3CCE T;  2KR3 A;  5GAN 8;  2QAS A;  2YLB A;  5GMK e;  3JCM h;  1ZA2 B;  4JDS A;  1ZBX A;  2HKQ B;  2LC4 A;  1K73 R;  1OX8 A;  1PD1 A;  2GQV A;  2FZC B;  4PJO E;  2R57 A;  4HCB A;  1MV3 A;  1NBE B;  1SSF A;  2BKD N;  3PIP A;  1PRL C;  3M4Y A;  3BDL A;  1GBQ A;  2EKH A;  1IB8 A;  2GTO A;  3GNG A;  3MP6 A;  3ASK A;  3I35 A;  5LJ5 h;  1QCF A;  1X2Q A;  4V2S A;  2BIV A;  4Z02 A;  2BTT A;  4M7D D;  2LDM A;  2E5K A;  3CCS A;  1OZ2 A;  1PM3 A;  3GPL A;  1ZUK A;  3DB4 A;  5KYW B;  1D1A A;  3HFO A;  1UFF A;  3L42 A;  5CCA A;  3NPF A;  2CP6 A;  2YUO A;  2K2M A;  2DBM A;  3M58 A;  1U06 A;  2XDD A;  2ESW A;  1AD5 A;  5GAM g;  3VS5 A;  3L2R A;  1YWP A;  3WVE B;  5FWC A;  3NHN A;  1I81 A;  3VYG A;  4A4K A;  1BCO A;  1K73 U;  4PFP A;  4L5G A;  3EH1 A;  2G6F X;  1ABO A;  1RAC B;  1D09 B;  3URG A;  1IXD A;  1YNZ A;  3G71 A;  1WQW A;  4L6V 5;  3J81 E;  2CZ1 B;  4RTT A;  3OYM A;  1N5Z A;  1YCS B;  2JTF A;  2VGN A;  3FEO A;  1KD1 C;  2KBT A;  1OPK A;  4A54 A;  2DJQ A;  4MDW A;  2CT3 A;  4FW1 A;  1ZUU A;  1J3T A;  3JCM W;  5HKC A;  3GOX A;  1R8O B;  1Y57 A;  4FT4 A;  4PFO A;  5FU7 B;  1RAA B;  3MO8 A;  1KJW A;  5GMK l;  2ED1 A;  4LDU A;  2L2P A;  2KK4 A;  1IZ6 A;  1KHC A;  5LJ3 h;  3HPW A;  5GAN 6;  2P84 A;  1S72 T;  2KXC A;  3CCL A;  2J6F A;  2MYS A;  3H9N A;  1MMD A;  4KGV B;  3REB B;  5GAO q;  5KYY B;  1M2V B;  3JCM X;  2O88 A;  4M78 F;  1ZA1 B;  3CPW P;  2LX7 A;  3C12 A;  3A8O B;  2EAY A;  4AT1 B;  5KCH A;  3LWI A;  1PKT A;  2CS7 A;  4QQG A;  1N6A A;  1TUD A;  1RAI B;  4OGE A;  3OS0 A;  3FRN A;  4AMC A;  1SF9 A;  2KGT A;  2CH4 A;  3P8B B;  2O9V A;  3LWH A;  1UJ0 A;  4OMP A;  3OYB A;  3EFS A;  3OS5 A;  2HQE A;  4LDX A;  1KQS S;  3MP1 A;  3I56 Q;  2K2V A;  2MI6 A;  3JCM g;  2VWF A;  4FCY A;  4C8Q F;  4OML A;  4M7A E;  7AT1 B;  3VS0 A;  1Q81 U;  2RJF A;  2GTJ A;  2NUP B;  4BDY A;  1W2B A;  1X01 A;  2LX9 A;  2QXF A;  2E1H A;  3L2U A;  1M1K R;  1X43 A;  1VUB A;  2XK0 A;  4FYX B;  3ZEH A;  4ELZ C;  3EG9 B;  4AFZ C;  3JCM d;  4M7A G;  2RHI A;  2XU8 A;  4VUB A;  4XTU A;  1Q81 C;  3CC2 T;  1T3L A;  1KSW A;  1YIT A;  4BI4 A;  2AHJ B;  3JB9 H;  3E1S A;  4OGC A;  1KC8 C;  1AWX A;  3VS6 A;  4BDZ A;  3M53 A;  3G6E A;  2RJD A;  2P0Q A;  1SSH A;  5CR2 A;  1H3Z A;  2NUT A;  1O9S A;  3RKW A;  1BKB A;  3SHW A;  2QAZ A;  1QWE A;  1RI0 A;  3X28 B;  1K0X A;  1VQK Q;  1C0M A;  2YRD A;  3JB9 I;  1M3C A;  3QUI A;  1G2B A;  2RA2 A;  1WJQ A;  1LOJ A;  1SRM A;  1AVZ C;  2XG8 D;  2KNB B;  3CCR Q;  5GAN e;  5IHI A;  1HYO A;  1K9M R;  1CSK A;  1YJW T;  4C0G A;  4M78 B;  3X25 B;  2RH2 A;  1QKX A;  2HBW A;  3M0R A;  1UTI A;  4PNO A;  2SEM A;  1M1K C;  3EGU A;  2W10 A;  3OYL A;  1YP5 A;  2YLC A;  3FC3 A;  1NZ9 A;  4RMO A;  3CCM A;  4RTU A;  2Y90 A;  3QYG B;  4AG2 C;  2QI2 A;  2QQB A;  1VYT A;  4D8K A;  1GBR A;  3ER0 A;  4A53 A;  2HNI A;  2O31 A;  2X9H A;  1SPK A;  2IG0 A;  1JXO A;  4D6W A;  1D3B A;  4C8Q A;  5KYN A;  1QWF A;  1SG5 A;  3MP8 A;  3QBY A;  1RLQ C;  3CPF A;  4DQ2 A;  3M56 A;  4M7D C;  2KRS A;  3CCU A;  1BI1 A;  3GF5 A;  3NTH A;  3VRZ A;  1SHG A;  3SB2 A;  3CCJ Q;  2P4T A;  1YJ9 T;  5J26 A;  5CKE A;  5KE2 A;  3CCM T;  3EFO A;  2RD1 A;  2V1Q A;  4PJN A;  1NLO C;  1U5S A;  3QWY A;  4JRI A;  2EQU A;  2H8H A;  1ZLM A;  1I4K 1;  2M0Y A;  3MEV A;  3EFR A;  2DEU A;  2DPP B;  2YSQ A;  3C94 A;  2E5Q A;  1R0C B;  4HCZ A;  4F17 A;  3ZL7 C;  5KH6 A;  2HCK A;  3JCM Q;  2A3L A;  1PRM C;  3OYH A;  2AK5 A;  3OW2 S;  4J6W A;  1PD0 A;  5IXB A;  2X4W A;  3MEW A;  1K1Z A;  3VKI A;  5GAM d;  1YCY A;  4J8O A;  1BI0 A;  2EQK A;  2YDL A;  1P92 A;  1RAB B;  1K9M C;  2QQA A;  4F7U B;  1YHQ T;  2EWN A;  2PTK A;  1WHM A;  3QXE B;  3V8J A;  5KYU B;  1S72 Q;  1PG5 B;  2RI5 A;  3M59 A;  2K4Y A;  4EMK C;  4O5V A;  2KAF A;  1I5O B;  1N8R U;  4IKF A;  3U23 A;  1WZO A;  3ZBD A;  2YUP A;  1HSQ A;  1W2B S;  3PGG A;  4RUG A;  3SWN B;  2O4X A;  4J9D A;  2PNI A;  1N8R C;  2VB6 A;  2ABL A;  1RAF B;  3MPU B;  1WJS A;  2H3E B;  1BIB A;  4QQD A;  2XI9 A;  1RAH B;  2VXE A;  1BU1 A;  2LMJ A;  4OVA A;  1O75 A;  4OMO A;  3KXT A;  1QQJ A;  4DBQ A;  1G3T A;  2QQS A;  1QVP A;  4DEX A;  2LQK A;  1U1T A;  4LD6 A;  2D0Q B;  3NFC A;  3M55 A;  3OB9 A;  2HSP A;  1HJD A;  3H0F A;  2FPF A;  4FW2 A;  1R77 A;  2D1X A;  4OF1 A;  5IHK A;  1YWO A;  3JCM J;  2QDL A;  3CCL Q;  1X27 A;  2VV5 A;  3CC4 Q;  1VQO A;  2HDA A;  2XHC A;  1D1C A;  3LLR A;  1VQP Q;  3CCQ Q;  4A4H A;  1RAG B;  1QVG A;  3OYF A;  1LNX A;  4CRI A;  3G71 Q;  4E7L A;  4PL6 A;  1VQ6 T;  4JJC A;  2PQW A;  1Q7Y R;  2ZPB B;  4M77 G;  4LNP A;  5A0D A;  2DYB A;  2M02 A;  4JJD A;  1RI9 A;  3QSU A;  1FMK A;  5DLO A;  1YJW A;  4BY6 B;  3I55 A;  5KYX A;  3CC4 A;  4QVD A;  3I56 A;  3CXC P;  2ATC B;  1PSE A;  4M7D A;  4J83 A;  1E7O A;  4PJO G;  1ABQ A;  1X2K A;  2P0P A;  3H8Z A;  3UPU A;  2L89 A;  2Y4X A;  3OYN A;  4JJB A;  4LDY A;  2ZPH B;  1NYF A;  1YI2 Q;  1PWT A;  2JOY A;  1D3B B;  2E65 A;  1TWB A;  3PIO A;  2G3R A;  2CYZ B;  3CC2 Q;  1YIT Q;  4F7U F;  2M0O A;  4BAC A;  4Z88 A;  2XD0 A;  4ZGJ B;  2RQT A;  1WXU A;  4KGZ B;  4C8Q D;  2GNC A;  4E7H A;  4IUT A;  2VVK A;  4LDV A;  4ELY C;  3EFO B;  5KE3 A;  2R58 A;  3EG3 A;  2EYW A;  2R5M A;  3FLG A;  2DL4 A;  5CKB A;  3CCV Q;  3CEY A;  1XQH A;  3OBW A;  3AT1 B;  1IRX A;  1W1F A;  4WF2 A;  1TG0 A;  1TH7 A;  2W0Z A;  1QVG S;  2CH4 W;  1VQL A;  3CD6 A;  3OYD A;  4ORZ A;  2EIF A;  3HP9 A;  1OV3 A;  2YT6 A;  2RI2 A;  2E12 A;  3CBP A;  3OS2 A;  4L59 A;  3SEM A;  1PHT A;  1MUZ A;  4C0D B;  1X6G A;  3EGD A;  1M90 R;  5KYW A;  1VQ7 T;  3Q1J A;  3HTR A;  1G5V A;  2RHU A;  2GCX A;  4C5H A;  4FM4 B;  1X75 C;  3EHQ A;  4J6Y A;  3PT9 A;  3G71 T;  3I5S A;  2L3S A;  2ZPF B;  5CVI A;  1VQ4 T;  1QVG P;  5I2M A;  2QYZ A;  3G4S Q;  4F7U E;  2AKL A;  3JCM f;  1VYU A;  2L0A A;  3L2Q A;  1N9S A;  2PVG B;  1PNJ A;  3RIR A;  3G4S T;  4XU3 A;  5DY9 A;  4CC4 B;  2YUQ A;  4DBR A;  4JRP A;  5KYX B;  1PSF A;  3UA7 A;  1OU8 A;  1UE9 A;  4FU6 A;  1OI1 A;  1T0J A;  1AWW A;  3VUB A;  1UGP B;  1M8V A;  5C6S A;  4HT9 A;  1Y07 A;  3EGX A;  2CP5 A;  1Q81 R;  3TSZ A;  3V7S A;  1KK7 A;  3M4G A;  3CCU Q;  3ZFJ A;  1JO8 A;  4FL6 A;  1VQ5 Q;  1GXI E;  4PKC C;  5I11 A;  1YI2 T;  4J7F A;  4EMG A;  2X4Y A;  5CAI A;  2RHZ A;  2E3I A;  2J06 A;  2D9T A;  2EGA A;  1Q82 R;  2CSI A;  4BY6 C;  2DF6 A;  1KD1 U;  2COY A;  1VIE A;  1Y96 A;  3VUZ A;  3CCQ A;  4M7A F;  5GAN 5;  1G3Y A;  2F2W A;  3OSV A;  2CRE A;  4M77 A;  3CCL T;  3M0Q A;  3NTI A;  1D1B A;  2ZPI B;  4N4H A;  2HD0 A;  1ZHI A;  2I2L A;  3GLX A;  4J9H A;  2EQM A;  4ZN1 A;  2X35 A;  1KQ1 A;  2DKG A;  4OMM A;  1M2V A;  3UWN A;  5FLX E;  2DD4 A;  3C95 A;  1JXM A;  2PUO B;  1GCP A;  3CCQ T;  1UDL A;  4FIB A;  3VRY A;  1AHJ B;  2A7Y A;  2HEQ A;  2RM4 A;  5LJ5 j;  1Q86 C;  4PJM A;  1Y7X A;  1B34 B;  3L2W A;  3A8G B;  4RG8 A;  1NG2 A;  4M75 G;  4FSX A;  1UEB A;  1QCO A;  3CCJ A;  4C92 D;  3OSS C;  4JS4 A;  2X4J A;  4XTX A;  2K6D A;  1HXD A;  4J9G A;  1Q95 G;  3GBQ A;  2HQX A;  3CC2 A;  2LVM A;  1KC8 R;  4M7A A;  1SEM A;  2DTI A;  2HL3 A;  3RES A;  2XKO C;  1LPL A;  4EMH A;  2KY9 A;  1Q7Y U;  5L8R E;  2PVO B;  4KUL A;  1HD3 A;  3QHS A;  5LJ3 e;  2ROL A;  2KT8 A;  4LN2 A;  2DK3 A;  4MZP A;  2CSQ A;  1M9S A;  2K3Y A;  1JQQ A;  1Q86 R;  3QDR B;  1Q7Y C;  4J9B A;  1WNL A;  5L23 A;  4HA8 A;  2J6K A;  1NJI R;  2XDB A;  1BBZ A;  3PE0 A;  4FSS A;  3V8K A;  5D6Y A;  3VS2 A;  3IQL A;  1RLP C;  2EJ9 A;  2RJC A;  2LJ1 A;  1RAE B;  1YBY A;  5GAO m;  1QCN A;  2FG0 A;  3M0T A;  2F2X A;  2FYK A;  3ULR B;  4M7A D;  1Y71 A;  4GLK A;  1IHW A;  1KG1 A;  4E7Z A;  1AT1 B;  1ZUY A;  2Y4Y A;  4N0A C;  3CC7 Q;  1FXX A;  2KYM A;  4E7I A;  4M7A C;  2CZ7 B;  3JB9 F;  2F5K A;  5GJW B;  1OX9 A;  2ENM A;  3M57 A;  3LH0 A;  3C0C A;  2RHY A;  2RNA A;  4AG1 C;  2K79 A;  4DBH A;  4C8Q B;  1VQP A;  1ZSZ A;  4M7A B;  2DL5 A;  3P8H A;  2JN0 A;  3HRT A;  5FU6 C;  3S3M A;  5GAM j;  1AEY A;  1TSF A;  3TCJ A;  3CC7 T;  2HQH A;  3VV0 A;  1YJW Q;  3INZ A;  4BE0 A;  1YJ9 Q;  2PZ1 A;  3VS1 A;  5HCK A;  2DER A;  3N5B B;  3M5A A;  2F1L A;  4M75 E;  3M0S A;  5LJ5 e;  3OBY A;  3MKD A;  3JCM V;  3H41 A;  1VQN A;  4C5I A;  3H6Z A;  1VQ5 T;  2QA4 T;  3OQ5 A;  4R55 A;  1WIE A;  1UUE A;  2JMA A;  1K8A R;  3CXC A;  2KXD A;  4WCI A;  2CZ6 B;  5AYF A;  3L1A A;  3CME T;  3TRE A;  3FB9 A;  2J7I A;  4OMF B;  5GAM h;  1MHN A;  2OX7 A;  4EDU A;  4N4I A;  2CP2 A;  2ECZ A;  4A63 B;  3G7Z A;  3KUF A;  2RMO A;  2JVV A;  1JJ2 A;  1UG1 A;  4JZ4 A;  4ZTJ A;  2O01 E;  1XJW B; 
#chains in the Genus database with same CATH homology
 1EFN A;  2JT4 A;  2GBQ A;  1BU1 A;  4OMN A;  2LMJ A;  4RTV A;  2EYZ A;  1NEG A;  4OMO A;  4X1V A;  1M30 A;  2BZX A;  4GLM A;  1WDX A;  2JS0 A;  2RF0 A;  4DEX A;  1UEC A;  3M0P A;  4F14 A;  2EGE A;  3EG2 A;  2HSP A;  1HJD A;  3H0F A;  4QT7 A;  2FPF A;  4ESR A;  2DLP A;  1GRI A;  2NUZ A;  1T3S A;  1GCQ A;  2D1X A;  5I22 A;  5IHK A;  1YWO A;  2RQU A;  2QDL A;  2AKK A;  1X27 A;  2HDA A;  2LJ3 A;  2KR3 A;  1VYV A;  2B86 A;  2DNU A;  3UAT A;  4JJC A;  2EW3 A;  2DRK A;  3M0U A;  2X3W D;  2X3X D;  2DIL A;  4HVU A;  4LNP A;  2LNH B;  5FW9 A;  2DYB A;  1MV3 A;  4JJD A;  1RI9 A;  1FMK A;  1PRL C;  3R6N A;  3PVL A;  4EIK A;  3UF4 A;  1GBQ A;  3THK A;  2C0O A;  2EKH A;  3EG0 A;  1NLP C;  2GTO A;  1B3Q A;  2K9G A;  4J9C A;  2MOX A;  3I35 A;  1E7O A;  1QCF A;  1X2Q A;  2MIO A;  1ABQ A;  1X2K A;  3EHR A;  2O9S A;  2BTT A;  2DRM A;  2E5K A;  2OAW A;  4JJB A;  2CUB A;  1NYF A;  1Z9Q A;  2GQI A;  4RTZ A;  4D8D A;  1ZUK A;  1PWT A;  2CT4 A;  4OMQ A;  1UFF A;  2DVJ A;  2DBK A;  3NPF A;  2D8J A;  2KYB A;  2YUO A;  1GFD A;  2JM9 A;  2DMO A;  2K2M A;  2DBM A;  2EYY A;  4Z88 A;  1U06 A;  2RQT A;  1K4U S;  2ESW A;  2J6O A;  1WXU A;  1AD5 A;  2GNC A;  2K3B A;  2MCN A;  3VS5 A;  5IH2 A;  1KFZ A;  2J05 A;  3VS4 A;  2ROT A;  2VVK A;  1YWP A;  5FWC A;  3NHN A;  1SRL A;  3JV3 A;  4AFS C;  4CC3 A;  3EG3 A;  2OJ2 A;  1UHF A;  2EYW A;  4AFQ C;  2DL4 A;  2G6F X;  1ABO A;  1BB9 A;  2BZY A;  1W1F A;  1YNZ A;  1TG0 A;  2W0Z A;  2CH4 W;  4RTT A;  1N5Z A;  1IO6 A;  1XOV A;  1YCS B;  1I0C A;  4ORZ A;  1OV3 A;  3VS3 A;  2YT6 A;  2KBT A;  1OPK A;  2DJQ A;  3SEM A;  1PHT A;  1MUZ A;  1U3O A;  1X6G A;  2CT3 A;  1GL5 A;  1M27 C;  1ZUU A;  1J3T A;  2LCS A;  2M51 A;  2O2O A;  5ECA A;  1W6X A;  2FPE A;  1Y57 A;  1V1C A;  2I0N A;  2EQI A;  2EPD A;  1KJW A;  1SHF A;  2ED1 A;  3EHQ A;  4ZNX A;  1GFC A;  2JM8 A;  2L2P A;  4Z8A A;  3I5S A;  2L3S A;  3RNJ A;  2KRN A;  4CC2 A;  2DM1 A;  2AKL A;  2KXC A;  1WYX A;  4HXJ A;  1VYU A;  2L0A A;  2J6F A;  1ARK A;  5IXF A;  4RTY A;  1PNJ A;  3PVQ A;  1TUC A;  3REB B;  3QWX X;  2O88 A;  4CC4 B;  2YUQ A;  2FRW A;  3NMZ C;  4IIM A;  2LX7 A;  3UA7 A;  1UE9 A;  1PKT A;  1T0J A;  1AZE A;  1AWW A;  2OI3 A;  4F16 A;  1K9A A;  1TUD A;  1JEG A;  1G83 A;  3KFV A;  2KEA A;  2KGT A;  2CH4 A;  2JW4 A;  2P4R A;  3TSZ A;  2O9V A;  1JO8 A;  2YUN A;  1H8K A;  2DE0 X;  1UJ0 A;  4OMP A;  2C0T A;  1AZG B;  4DEY A;  5I11 A;  2KRO A;  2DL3 A;  1WXT A;  2K7A A;  2VWF A;  2J06 A;  4OML A;  2ED0 A;  1FYN A;  2EGA A;  3I9Q A;  2CSI A;  2DF6 A;  3VS0 A;  3CQT A;  2A37 A;  2A36 A;  2RQW A;  2GTJ A;  2F2W A;  2L3Q A;  3I5R A;  2CRE A;  1X43 A;  2AZV A;  4E6R A;  1S1N A;  2KRM A;  4AFZ C;  1WX6 A;  2BZ8 A;  3M0Q A;  2DA9 A;  1T3L A;  1KSW A;  2LZ6 B;  3EG1 A;  1Z9Z A;  1X69 A;  4J9H A;  3REA B;  1M8M A;  4RTX A;  1AWX A;  4OMM A;  4K11 A;  3VS6 A;  1UGV A;  4R0K A;  1T0H A;  2D8H A;  4LUD A;  1SSH A;  4Y92 A;  1JXM A;  1GCP A;  2NWM A;  4Z89 A;  1UDL A;  3VRY A;  2HEQ A;  2LP5 A;  3NGP A;  2DL8 A;  1JU5 C;  2A08 A;  2LQN A;  2RQV A;  2KE9 A;  1NG2 A;  2FO0 A;  3SHW A;  3RBB B;  1QWE A;  1K0X A;  2FEI A;  2K6D A;  2CDT A;  1M3B A;  2IIM A;  1M3C A;  4J9G A;  4M4Z A;  1QLY A;  1G2B A;  3GBQ A;  1W70 A;  2DL7 A;  4AFU C;  1SRM A;  2A28 A;  1AVZ C;  2KNB B;  1SEM A;  1CKA A;  1I1J A;  2LJ0 A;  5IHI A;  3LH5 A;  2LQW A;  1CSK A;  1GCQ C;  3VS7 A;  1QKX A;  1HD3 A;  2HBW A;  3M0R A;  1UTI A;  2SEM A;  2ROL A;  2KT8 A;  3EGU A;  4LN2 A;  2W10 A;  2CSQ A;  1YP5 A;  5IHN A;  1JQQ A;  2SRC A;  2JTE A;  4J9B A;  1AWO A;  5EC7 A;  4J9E A;  5L23 A;  2J6K A;  4RTU A;  4AG2 C;  1BBZ A;  2FRY A;  1VA7 A;  1VYT A;  3PE0 A;  4FSS A;  4D8K A;  1GBR A;  3VS2 A;  1K0S A;  3IQL A;  1RLP C;  3O5Z A;  2O31 A;  3A98 A;  3H0H A;  1SPK A;  2LJ1 A;  1JXO A;  2RN8 A;  1WFW A;  4KRT A;  1OPL A;  2FG0 A;  3M0T A;  5FWB A;  1QWF A;  1WLP B;  2F2X A;  3ULR B;  1RLQ C;  4GBQ A;  3UA6 A;  2RQR A;  2KRS A;  1I07 A;  2JMC A;  2EVR A;  2V1R A;  1ZUY A;  3VRZ A;  1SHG A;  2DX1 A;  1QKW A;  4JPB W;  2GGR A;  2KYM A;  1UHC A;  1A0N B;  3H0I A;  2ENM A;  5GJW B;  2EBP A;  1BK2 A;  1NEB A;  2L3P A;  3C0C A;  2V1Q A;  2RNA A;  4AG1 C;  3TSW A;  1NLO C;  1U5S A;  1M3A A;  2K79 A;  3QWY A;  4JZ3 A;  1ZSG A;  2H8H A;  1ZLM A;  1WA7 A;  2M0Y A;  2DL5 A;  1K76 A;  1WXB A;  1E6G A;  1AEY A;  3FJ5 A;  2YSQ A;  1ZBJ A;  4F17 A;  1X6B A;  1PKS A;  3ZL7 C;  1YN8 A;  2HCK A;  1LCK A;  1NYG A;  1MV0 B;  2AZS A;  2PZ1 A;  3VS1 A;  5HCK A;  1PRM C;  4HVV A;  2CUD A;  2AK5 A;  3M0S A;  2EYX A;  4IIO A;  5IXB A;  1Y0M A;  1K1Z A;  3TVT A;  1OEB A;  2JS2 A;  3H41 A;  1UJY A;  2YDL A;  1KIK A;  4CC7 A;  4RTW A;  4J9F A;  4LE9 A;  1H3H A;  1H92 A;  2D0N A;  1WIE A;  2PTK A;  1UUE A;  2JMA A;  2KXD A;  4LUE A;  4WCI A;  1AOJ A;  2KT1 A;  2C0I A;  2XMF A;  3U23 A;  2J7I A;  2VKN A;  1ZX6 A;  4HCK A;  1AWJ A;  2YUP A;  4J9I A;  1OOT A;  1HSQ A;  2EGC A;  2RPN A;  4RUG A;  2ECZ A;  4A63 B;  1RUW A;  2F2V A;  4J9D A;  2PNI A;  1E6H A;  2ABL A;  1B07 A;  4HVW A;  1NM7 A;  2FPD A;  2RMO A;  2JXB A;  1UG1 A;  5GJV B;  4JZ4 A;  1CKB A;  1WI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...