4GLRI

Structure of the anti-ptau fab (pt231/ps235_1) in complex with phosphoepitope pt231/ps235
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
207
structure length
207
Chain Sequence
ALTQPTSVSANLGGSVEITCSGSDYDYGWYQQKAPGSAPVTVIYWNDKRPSDIPSRFSGSTSGSTSTLTITGVQAEDEAVYYCGAYDGSAGGGIFGAGTTLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phospho-peptide
publication title An Ultra-specific Avian Antibody to Phosphorylated Tau Protein Reveals a Unique Mechanism for Phosphoepitope Recognition.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 46
structure length 207
sequence length 207
chains with identical sequence K
ec nomenclature
pdb deposition date 2012-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4glrI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4glrI01
4Z8FL 3RDTB 2AVGA 3HE6D 5BS0E 4LMQI 3RVVD 5BV7L 3X3GH 4Z0XB 1CDGA 4L9LC 2NW3B 2B4CL 3GGWB 1M05B 1GCFA 1G9MC 1QLRB 1FC2D 3T4AA 1TVBA 1PZUB 7CGTA 1P4BH 1IQWL 1G9NH 4E41B 1B4RA 3C5JB 3FAWA 4H0IA 5GISH 5FUOH 5DWUH 2QLVB 4I3SL 5IQ9B 1GSMA 2OJZH 2OSLB 5HSFA 1MCPH 3KLSA 1IEAA 4HWUA 3VE0A 1EERB 3ZE1E 1LO4L 4N0CC 4C54A 3GMNB 2EDEA 1JHKH 2Q7YB 4WI8A 4ERSH 3DXAE 4QRPE 3X3GL 5E9DE 3VGFA 3FQUA 2ATKB 2RR3A 4MCYA 4Z76A 1R3HB 3CVHH 1YEIH 1CGTA 1P4BL 1G9NL 4Z18A 1QSFD 5GISL 1ED3A 3D3VA 5FUOL 5DWUL 3RDTD 1DQDH 2NY3B 2OJZL 1MCPL 5B3JF 5FYJD 1IGTB 4QXGH 3TYGH 1XF1A 1N0XH 1U93B 2VDNH 1CT8A 3PDGA 4G7YL 3TP4A 5IJKC 1M1SA 1JHKL 1A6TB 3MGTB 4ERSL 4E41D 5C1MB 2IPKB 2R4SH 1BWWA 1AD9B 4XMKH 4LLDB 3TIDA 3CVHL 1YEIL 3CFJB 4XMLH 2RAMA 1HYSD 2AXGB 4HIIA 5D1QD 3P9MA 4MCZA 4UB0H 1O0VA 4NQSA 1A64A 5KN5B 3FRPA 3P30H 1DQDL 4TN9A 3BMWA 5T1LA 3F7PC 3KPSB 4GT7A 2XTJE 3FZUD 4QXGL 5E2JA 3TYGL 1N0XL 2VDNL 1T5WA 4K07A 1JCKA 2C1OA 3LVEA 4E5XB 3RA7H 4MD0A 3GNML 1RVFH 5JLZB 3HCVA 2R4SL 4ORGB 5I8CB 2NY2B 3UYRH 4XMKL 3QZWA 1XF2B 3QUYA 1XGRA 2EEDA 1YMMD 5EZJA 4P23A 4XMLL 4NN6C 1Z5LB 1HOCB 1XGYH 1W72B 4UB0L 1Q8MA 4U3XA 2BHZA 1CFNA 1HHGB 3KLAB 2PTVA 2X09A 1KIPA 3RA7L 1QR4A 1RVFL 2XKUA 1KGCE 3MODH 5HYJA 4YX2H 1EMTH 4LHUA 1OP5K 3MLTA 4G9FE 3UYRL 1TITA 1YC8A 4XPBH 3I6KB 4NJAH 3WIFA 3U79A 3VRLF 4EN3A 5K9OB 2FGZA 4L8DB 5GSRB 3KPSD 4NSKB 4U31A 3SE3A 3MV8B 1DDHB 3JV5A 1K3ZA 5ERWB 1CG9A 1CGSH 5DD1H 1DP0A 2NY2D 3P9WB 1S9WA 1A7NL 2OZ4H 2O93L 3DHMA 2C5DC 3GMPB 1CFSB 5AAMA 2ZCHH 3MODL 3ULVH 3MRBA 3ZHLA 4YX2L 1EMTL 1BBJB 4NO0B 2X2YA 5BS0B 5I9QC 4XPBL 3FQTA 4GMTH 4NJAL 3OKLA 5KS9F 2J1KA 3BIAX 1IGJB 1H15B 9CGTA 2DKUA 3JWOC 4GQPH 2MTPA 3MNVA 2Z92A 1C16B 1AR1C 1OTSD 4R7DA 1CGSL 5DD1L 1GGCL 3BW9B 4LU5H 3EYOB 2IAMA 2OZ4L 4APQC 1DE4A 3BDXA 1T1WA 4Y4HB 2F8XC 2ZCHL 3ULVL 3EOAB 5TJWK 1OQOA 3K8KA 3S5LG 4ODWB 4WFFE 4XZUA 1A6WH 5IBUB 4PJGA 3MV8D 4LSPH 5CUSH 3GSVA 1QLFA 4QRPB 4P2YA 4P9HH 2P24B 5E9DB 3Q3GA 1WBYA 3RWCB 5JOFA 5ESAB 2EDLA 2DM4A 1BQHG 2P5WE 2AXHA 4Z78B 5DSCA 2FEEL 3C8KA 1U95A 1TENA 4LU5L 1U8MB 4NO0D 5BS0D 2NXZB 3TO4C 3EYFA 1QBBA 1MI5E 1R5VA 5KAQF 2HTKC 2W0FA 3CSYA 1QPXA 2YXMA 3KPRB 5CUSL 1JFQH 1KJMA 3ARFB 3BH8A 4GKSA 4W81A 4P9HL 5F1IB 5D7LB 5DEGA 3KPMA 1I1AB 4LRIC 4WU5B 4GRMA 2H26B 4S1DD 2YS4A 2WUBH 3HZVB 2VZSA 1NFDE 3AM8C 1UM5H 4Y4HD 5BQ7A 2H9GA 1MFEH 4KK8D 1ITBB 3E6HA 4LCWE 2NX5B 5CEZH 4P2QE 4QRPD 5E9DD 5I1JH 4WY7H 4NQDE 3P0GB 1XIWD 4ZXBB 4KTEH 3QH3A 2NY7L 4JFEA 3BP7A 1AJ7H 1G9NC 1FVEB 2VDLH 2CRMA 2BVPA 4MAYB 4QNPF 3DMMB 2NXZD 2WUBL 1UM5L 2WIMA 1LDPH 5FK9B 5KG9A 1GGYA 5DQJA 3H3BC 1RZGA 5EBMA 1NBYA 2VLKB 3KPRD 4MLSA 4OLEA 4LOUD 3ARFD 5ESQA 5I1JL 4OZ4A 2A74A 5D7LD 2DQJH 1I1AD 3BP4A 1UH2A 1HH9A 4KTEL 4LSUH 4PJEF 1AJ7L 3FFDB 2D2OA 3WDHA 4G9FB 2VDLL 5DUPH 4PTUA 3BFOA 3U4BH 2NX5D 3HRZB 4JKMA 4AIOA 3NABH 1O5DT 4NQCB 1LDPL 3VXMA 3IB4A 4NQXA 4WTXA 4ZXBD 4N0UE 4OIIH 1ZVYA 1INEH 4GAFB 2DQJL 4TUOA 2VXTH 3DMMD 4LSUL 2HLAB 5E08H 3MFFB 4QHUB 4W6WB 1KIRA 5C9JB 5DUPL 5CEYA 2R1YB 1T66D 2VLKD 3U4BL 3QO0B 3MJ9H 4V2BA 4NP4L 1KFAH 1MCNA 3LV3B 2QHLA 1NDMB 1V05A 4S0SD 4X4YB 1F3JB 3HR5B 3WLBB 3LEXB 3I2CH 5E5UB 1KGCD 1IC7H 1YPZA 4LLWA 1INEL 2V9TA 4G9FD 4S1RH 4DGVH 3IAPA 3NVQA 1DLHA 4UILH 3MO1B 2VXTL 2XFXA 3LZFH 3RGVC 1A0QH 4NQCD 3UTQB 4DUVA 5DJ6B 5J1AB 1X44A 3FOLA 3Q5OA 5TE7H 3TBTA 3VFTB 2F54E 5JA9A 5IM7A 4OT1H 1KFAL 4FTVB 3ARXA 2YD7A 3QG7H 4ZS6C 3OWEA 4JFHE 5MI0C 2P5WB 3H9SE 3I2CL 1LE5A 1RSFA 3MLWH 4F15B 2BC4A 4UNVA 4S1RL 4U6HA 3LEVL 4DGVL 5HYQA 2CXGA 2AV7B 5FIEA 3TA3A 3HZMA 4UILL 1CD1A 1NGZA 4NZTL 3LZFL 1A0QL 3KYOA 3THMH 5D7JA 3KWWA 3BAEH 3PWNB 3O0RH 1P4IH 5TE7L 1MCWW 3B5TA 2H3NB 1KLUB 3VXPB 2M1KA 3JVGC 1KENH 1N5AA 4ZFOL 1M7DA 3ET9F 3ABZA 3OJDA 3QG7L 2IGFH 4LNRA 5MHSE 1NFDB 2APFA 1C5BH 4XXCA 3S9DB 1OLLA 5F6HI 3DUSB 4RSVA 3ULVC 1EFXB 4WFFD 5DRXB 1IAMA 4LCWB 3FCTB 4LKXB 1KB9J 5I73B 1S8DA 5JDJA 5DJDB 1JN6B 5F1OB 1H0DA 1JNNH 1PVHA 3PGFH 3THML 4FTVD 2QADB 1LDSA 3BAEL 4IRJC 2P5WD 3O0RL 3GK8L 1L7IH 5IROC 2ZNXA 1DVFC 1AP2B 1KENL 1WBZB 3O3BB 3MRPA 4LPTA 4LP5A 4PRNB 2IGFL 1C5BL 1HSAB 3BI9X 5HI4C 1LGVA 2I9TA 4J2XA 1MI5D 1NCTA 1A14H 1MCRA 1CXHA 4P9HC 4WW2C 3MRIB 3QHZH 3F12A 4QOKE 1JNNL 5DGQA 4NKIH 5F7DA 4OKDA 3WFDH 5IKCB 4HIHB 1L7IL 1QSZA 1EFXD 4LCWD 5DMJB 1WBXB 1G1CA 4XCNB 3U7WH 3TVMB 5IW6A 4NQDD 5AUMA 1P7QA 1TQBC 1A14L 1SMOA 1EV2E 2QADD 2A6JA 3RX5A 5GS0H 5JW4N 5C3LD 4K71C 1G7IA 4NKIL 1RZ8B 1RZKH 4GAYB 2FWOA 4U1SA 1MAKA 4ZPVB 1LK2B 3WFDL 5E94A 2UUDH 4YLQT 1OT2A 1AGEA 5D8JH 4GW1B 4AQOA 4IRSB 3U7WL 43C9A 2AW2A 2YRZA 2G2RA 3L5HA 3DRTA 2OJEA 5C0EA 5C0AE 3B2VH 5GS0L 1FNEB 1KYOJ 1Y6NR 5BXFA 3L3GB 1E4KC 4I5BB 4I13B 1D6VH 1RJLB 4PJXF 1RZKL 3P73A 4NRZA 4GXVH 2NY1B 3MUGB 3TVMD 4P5KA 4O9HH 5D8JL 2F54B 2W07A 5C08E 1NCWH 3TBYB 4XVJH 4MA3B 1T83A 5D7SH 1A02N 3G9VA 4FA8A 4PJBB 3H9SB 1HXMB 4X6CA 4AEIH 3W39A 1HH6A 3B2VL 3BZ4A 1F3DJ 4JREC 5C2UB 3LKRA 4F7EA 1D6VL 1A7QH 3ARBA 4PLOB 3U46B 5DJYB 5FKPB 3NIFF 3CD4A 4IRSD 4GXVL 5GJSH 3MBED 4R4BA 1NMBL 1KPRB 3VWJA 1J18A 4O9HL 2BSTB 3DSFL 3ZDYF 3UX9B 3ZO0A 5HHME 4XVJL 1VGEL 5D7SL 2ATPA 4BK5A 4ZUTB 4OCMC 3AAZA 2WZPD 4AEIL 2NY1D 2Y06L 3WIIH 3ZHDA 4Y4KA 1EH9A 1SMAA 3VGDA 5H2BA 5HVWA 1A7QL 2F54D 4OSUH 3RNKA 3AB0B 3FN9A 5IMKA 5GJSL 3BYYA 4XVUD 5C0IA 2X4OB 1MOEA 4JZJB 1QPPA 3PHQB 2I07B 3H9SD 5IBLD 4XCEB 3FB8B 3OF6D 3REVA 5KSUA 3BO8B 1MH5B 1WIPA 2DQCH 1B9ZA 1Z2KA 2VITB 3T2OA 4Q9RL 5EU3A 5J0BA 5D96C 1K4DB 2D7QA 2Q1EA 1I9IH 5IB5B 3WIIL 4CN4A 2A77H 1EEZA 4N0YH 5C6PB 4YO0A 4HW6A 5IQ7H 1A7PH 1VEMA 3ZE1F 4Q6YA 1LEIB 4QOKB 3TO2A 3LS4H 1OB1B 2XOTA 1JWMB 4NQVA 1H8OA 1FAKT 1SJVA 3PDDA 5CP7A 4ODHH 4OV5B 4M7KH 2DQCL 5LKNA 2K3TA 2APXA 1GZPB 4MD5B 3WHE0 4N9GB 3S7GA 3QIUB 1FNSH 2JB6B 5E6IC 1I9IL 2A77L 4NC1E 3IFPB 4IDJH 4N0YL 4P2OD 1A4JB 1F42A 1ORQB 4NT6A 4OCSH 1PBYA 4Y4FA 4Y0GA 5IQ7L 4M6AA 1QFUL 4Y16B 3SDXB 1P1ZA 3CH1B 4XHJC 3LS4L 5IF0A 5CIPH 5K33A 3UBXG 2AV1B 1MLBA 4Z95H 4AIZA 2C1PB 4ODHL 3HS0B 4OCLC 4M7KL 1CIDA 4EIZC 3UYOD 3GGWA 3N0PB 4QOKD 4KRMB 3T3PF 4ZS7H 1MJ8H 4MJ6B 5C0AB 4JFOB 4IDJL 2PYEE 1CFVH 1XZ0A 2VLRB 4X6FB 5EBGA 4OCSL 2E3VA 5L0QB 1T0MA 1UVQA 4LLMB 3OAZH 5IQ9A 2GSGA 3KXFA 4QRRE 2X4RA 5GS1C 3DYMA 1OGAA 3C5ZC 5IHZA 5LVEA 1X7QA 3K7UA 1J05B 1MELA 4Y8AA 4NRYB 2EE6A 3QUZC 2VXSH 3IXTB 5D2LB 2Q7YA 2VNCA 3QIUD 4XHQA 1CXLA 4GXUN 2AQ2A 3SJVE 3SHSA 3PDOA 2FHBA 4Y16D 4P9MH 1XF3A 3BGFC 1D5BA 2OR9H 1WIUA 1G9EA 1HQ4A 1Q0XH 1PX3A 2YWYA 2OTWB 4DQOH 4RDQG 5C2BH 4LKCB 2PW1A 1IZKA 2J8OA 4TULL 4F2MB 1BZ9A 2EH7H 2DYPB 4EDXB 1FNAA 1MCWM 2VXSL 5DK0B 3CSPA 1I7ZB 3QUMA 3TNMB 5C0AD 2CKBH 2CPCA 3A6CL 4LLDA 2YMXH 4Y5YC 1UACH 3MRLB 4OLUH 4W6YB 3V9FA 1N3NA 4P9ML 3CFJA 3IJSA 2YD2A 2OR9L 1RZKC 1Q0XL 3Q5TA 1YMHB 4WFHE 4LVNB 2VZUA 3RWDB 4DQOL 1BQHA 2EE2A 4OZHB 4HGWB 5CJ8A 1E4XI 5DJ2B 5EZIH 3WFZA 5C2BL 3OB0H 5KVDH 3HAEH 5CGYC 3V8OA 5C08D 2EH7L 2XWJA 2VO5A 1RMFH 4XP6H 1JGVL 2VTFA 3ARDC 2HG5B 1NCCH 3WN5C 3V79C 3BQUC 2CKBL 2JB5H 5GHWH 3AU1A 2YMXL 1UACL 32C2A 4K7FB 4OLUL 4KI5E 4QGTA 3RHWK 1ZS8B 2ZG1A 5DVMA 1HOCA 1T0NB 3O3UN 2JLLA 2DYPD 4XNYL 3OAYH 1G7LA 1JBJA 3KJ4C 3P4NB 1HHGA 2Z8RA 1J11A 3C2AH 5HHMD 1RMFL 4M7LT 5TDPA 3VFMB 5ADOH 2B5IC 1Z3GH 5HJ3A 4BQ9A 3STZB 1NCCL 2CRZA 4FHBD 4PTTB 1ODAA 1RK1A 4P57B 4FG6D 1FSKC 2JB5L 3KPQB 5EU6A 4LEOB 5D5MA 5GHWL 3V6BR 2DL2A 4PRPB 5IVZA 4B53A 4G42B 1NGQL 1WICA 2I26N 4WUKH 3C9NB 4DGIH 5GSRA 4F37F 4DCQB 1EAJA 4U1HA 1WCQA 2WIIB 4P46A 4W4NA 1NDGB 1J8HB 4NM8H 5ERWA 1EK3A 3STLA 2AJ3B 1KPUA 4M7LH 2V2WB 3DI3B 2C26A 3E6FA 3OKMB 5ADOL 2XTLA 1Z3GL 4YGAB 3DVNA 2BVQB 2E7LA 2QSTA 1KIQB 2A0LC 3WUZA 5HHXH 1IGJA 1RHHB 1F4HA 2Y36H 3O11B 4WUKL 4DGIL 4XP9H 5DVNA 1NFDF 1GGIL 3O8XB 4U05A 5E8DH 1C16A 5JDSB 2BX5A 3OX8A 4CVXB 4NM8L 4K3HA 4K3GA 2PYEB 4HMDA 1P7KA 4OLZH 2HFTA 5TQ2H 4Q9CA 4GG6A 4WFED 4FQ1H 1FP5A 3SBWA 3BW9A 4K23H 3EGSA 3BKYH 4M7LL 3FHAA 3MXVL 4PRPD 1PKQE 1KCKA 1X4YA 4X83A 3T0EB 4OFIA 1J8HD 2EYTA 1HZHH 1JPTH 4HAFA 4ZUUB 3RWCA 2P42B 5HHXL 2VOTA 2Y36L 2DF3A 4XP9L 4Z7WB 4IHOB 3UO1H 5E8DL 3MRCA 3K74B 5TQ2L 4RX4A 3O4OB 1LEKA 1FAIH 4FQ1L 2PCPA 2ZUWA 3L3HB 4K23L 4UDUB 4CJ1A 1QFHA 5IIEA 4ESKA 3FO0H 2YBRA 4RAHA 2X4UB 1OP9A 1LEGA 4XVSL 3O8XD 5ID1B 4YUEH 1I8IB 3UTTA 3U30B 2WINB 4W70A 1HZHL 1JPTL 1VA9A 2PYED 1NGXB 1I1YA 1R3JB 4Y19E 1I4FB 1JJUA 2RGSA 4QRRD 4PS4H 3BHBB 5T1DH 1CXFA 3MLXH 2D7OA 4KDTA 3T0ED 4TQEH 1NC2A 2DBLH 3OKKA 1FAIL 3HPJA 4EXPX 4OZFH 4MHHI 1C7TA 3FO0L 2EIEA 4PD4K 5E8NA 5A2LH 2HWZH 3V0WH 4HZAA 3BP5B 1UZ8B 2OR7A 3VFRB 4J3SA 2ZUQB 4HBQA 3V4PH 2P45B 4NWUL 2VQUA 3PWPE 3QDME 3BYTA 5T3XD 4MAYA 4PS4L 5F9WB 2WWKO 4TNWK 5T1DL 3JTSB 4PGBB 4M8QA 3MLXL 3GSWB 4Y2OA 3M17B 4MJ5B 4TQEL 2DBLL 1U8LB 2ITDA 2ICWB 4JFDB 2UWEE 4MQSB 4CNIA 2NTFB 4X6DE 1EPFA 5EC2B 5CFHA 2HWZL 3MFGB 3V0WL 4X5XB 4XCFH 2GTZA 2P47B 3GMRA 3LPGA 4KKLD 4JFFE 3LSOA 3MYZA 2PF6A 2QEJA 1G0DA 4QHKJ 8FABB 3U9UA 5CZKA 3OXRB 2NZIA 1SYVB 3QIWA 2B20A 1KC5H 3BDBA 5JQHC 5FOBA 1JWSB 1MCJA 4MSWB 5DJAB 4CMHB 4NZUH 3L7FB 4XCFL 5DEZA 1H5BA 2CUHA 2AK4A 4KI5D 1FL3B 4O2EA 2VUOA 3WIHA 4CL7A 1UZ6E 4QHLB 2H8PA 2FJFA 2BSSB 3FO2B 2BXZA 4V2CB 3ULUH 1O7SA 4W6XB 4JFDD 2R1YA 4J1UB 3L5WA 5BW7C 3QO0A 3TESA 2A38A 2MNUA 3ROOB 3RVTD 4AG4H 1AXIB 1XCTA 1B3JA 4M4RA 3N50A 1NDMA 1CYGA 3WLBA 4NFDA 2DMKA 4NHUB 3C09C 3F7YA 5HI3C 4NZUL 5KOVC 4F7MA 4N8VG 3RUGF 1QBMH 1GOFA 3FOMB 4NN5B 3MO1A 2FHCA 1PGRB 3V0VB 4KGJA 4P5MA 5JIHA 3ULUL 2OQJA 1FG9C 4FNLH 5F44A 4DEPC 4O00A 2GUOA 4G80A 2C4FT 3CUPA 1DN2A 5JHDE 1DEDA 1JV5B 4P4KC 2VDKH 4WHTA 3VA2C 3EOTH 1FZMB 3QI9C 5H35A 1VESA 5C0RH 5FO8A 2FJGA 3UDWA 5D7KE 2J8UE 5C6TH 2OXGA 1S5HB 5I75C 5HGHA 3SKUD 1JRHI 2BVOB 3TBWB 1QBML 1OP5H 4PRIE 1F6LL 2HFFB 2HH0H 4PBXA 5E5RB 1NJ9B 1EO7A 4KRPB 4XX1G 4RISH 1LD9A 3OL2A 4IIQB 5I76B 4HKZA 5IV2A 5DRZB 1N6UA 1G7QA 3EOTL 4KJPC 4HS8H 4L9LB 2W9DH 3DUSA 1F6AB 3C6LB 3DX8B 4G6FD 5F7EH 1NKRA 1ERNA 5I30L 2B7DT 3MRKB 4HX1B 3MX0A 5KSAD 2VISB 2WSKA 1CGWA 1C12A 2HH0L 5L6YH 4JLRA 1FCGA 3D85A 2D03H 3FB6A 1DN0A 4RISL 5KAQG 1NAMB 3INUH 2QV2A 4EXKA 4OD1H 3PWPB 3QDMB 1Q9WA 2CRYA 4BA8A 5MERA 3L5XL 4HS8L 4P5TB 5A2FA 2W9DL 2EDXA 3S37X 2UWEB 2CUIA 4WV1C 5FM8A 4X4ZA 2EDYA 5F7EL 2C3XA 4MXQC 2X4NB 4M4PA 4KRPD 1PQZA 3MRIA 1UWEH 1TLKA 3ULSB 3MOQA 3OKOB 4X9FA 5L6YL 2X9YA 1T7WA 5B8CB 2ICEB 1T5XB 3VWKB 4ZFFA 2ICCA 3INUL 2O5YH 3C6LD 4OD1L 4XWOC 1N7MH 3AUVA 2HJLA 2DICA 1SBBA 3U0PB 3LEYH 1L0XA 4I2XA 1UKQA 4NQEE 1ORSA 2HN7B 1EDQA 4N0CD 1F8TH 3LHPL 5SWSE 1UWEL 3HC4H 2EDJA 3PWPD 4WI2A 2DIAA 3H2WA 3QDMD 4NN7C 4GAYA 1YEDA 4X4XA 1R3IH 3CFBB 1JNHA 1ZE3C 4F9LA 4HHAB 3ARTA 2O5YL 1ES0A 4PGEA 1JP5A 4GAGH 3WO4B 2JK5B 4FQHB 4PGCB 3WS3B 3BVNA 1II4E 2X10A 4GRWH 4NN6B 5DF0A 1KCRH 3GUTB 5DI8B 1F8TL 3DJ9A 3W9DA 3GO1H 3VWKD 4D94A 4OIBA 4HV8B 4WTZA 3HC4L 2BHUA 5GGUB 3HRPA 2JJVA 2UVEA 2YD5A 3WNOA 4PJAA 1NMAH 3KLDA 1AHWB 3UBXA 1CGXA 1A1OA 4EZMA 4GAGL 4QT5A 1T6VN 2AKRA 1WSST 3MRGB 4TSBH 4Y88A 5DD6B 4GH7B 4RQQB 5F97E 4PJFF 4PJHB 3GO1L 1G84A 5TFSH 4XNZC 2R0KH 4PV8A 4O58H 4XNQB 1NMAL 3QG6A 5EFIA 4BUHA 3WFBL 2UV3A 1WIOA 1YQVH 3RY6C 3FHQA 1EBPA 2BSTA 3B6SB 1RUPL 2XZAH 2R1XA 3K4AA 5EIQA 4WGWB 5GGRB 4TUKH 3WJJC 4TSBL 4G6KH 2C3VA 5D6CA 5KANG 2FYYA 4TSAH 2D31B 1Q72H 2Q86B 5TFSL 3ULUC 4JQXA 5I1AA 5HDQH 5JR1H 1PX4A 3QEHA 2H6PA 2R0KL 1ZHNA 2DQEL 5JHDD 4PREA 4JM4H 5FDWB 2AK1H 5GSVB 4APQB 2OTPA 2P8PA 5BRZB 1R5WA 3S37L 1YQVL 3JV4A 1LVEA 3W2DH 2VE6A 4JO3H 2BNQA 2W38A 2XZAL 2I24N 3BO8A 3MGOA 1INDL 3BUYA 4TUKL 1VACA 4ZTPH 4G6KL 3VCLB 1IEHA 1RFDH 4TSAL 1Z9MA 1E28B 5EO1A 4ELMA 2R0WH 3T2NH 5IB5A 1Q72L 4Z7NE 1KV3A 3OHXA 5HDQL 5JR1L 2XNAB 4CGTA 4RGNC 4JM4L 3GMMB 4GKZB 5BV7B 1I7RB 4X9IA 2OP4H 1FLTX 1X6LA 4JFYB 3PABB 1S9YB 2JIXB 2VXQH 3CFEA 3MV01 3PNWA 3MROB 3W2DL 5EN2B 1AR1D 4YK4C 1W2KT 2GJ6B 3R0MA 5DJ0A 2DLHA 5E95B 4MD5A 4YPJA 1HI6B 4ZTPL 1RFDL 1UT9A 2R39A 1EAPB 2R0WL 3T2NL 5GS3A 4APQD 5BRZD 4XBGB 2XXCB 5E4EC 4DZ8A 5K9QG 3ULVE 1KT2B 3SDXA 1EZVY 2E9IA 3OKEA 3BKCH 3P77B 4CU7A 5TDOB 2R4RH 4LLVB 4OCXL 2OP4L 2R1WA 4PUBH 2VXQL 3CXHJ 3HS0A 1EUTA 3BT2H 2AXFA 1U3YA 2Z93A 1SBSH 3REWB 3LQAH 3QXDB 4JCMA 4L4VA 5FA4B 1WFNA 3TO4D 3WNPA 4JO2H 3S96A 2AJUH 3NN8B 3DROB 2VLRA 3QUYC 3VXOB 1I1FB 1QNZH 4P23C 2HTKD 2APWA 1T2XA 2GFBB 2GJ6D 3BKCL 5DEFB 3K0WA 5IHLB 1J05A 4JZOA 1A3RH 3ZL4H 3V5KA 3CVHB 3L6FB 4NQED 3BT2L 3HC0A 4KI5F 4FQQB 1SBSL 4PJ8B 4KY1H 4JVUA 3NA9H 2VZ3A 3LN4B 3LQAL 3UJJH 3V6FB 1YNTA 3SDDB 4GKOA 5DQ9B 3BX7C 4JO2L 2AJUL 5H94B 4XNUH 4QHNB 2FIRT 1QNZL 3NCBB 3IKKA 4EN3C 1MHHB 4K7PY 3T3ME 3RPKA 1HEZA 3SE3C 5K9JH 4EDXA 1A3RL 3TN0B 1T21A 3BRGC 4OCWH 3A67H 1HYRC 3TNMA 3IF1B 1TJIH 35C8L 2YKLH 4TNVK 1LQSR 1UKSA 1KSRA 4RMUA 5C0GA 3PG2A 4NYLA 3UJJL 3I3EA 1D9KC 1C5DB 2FBJH 3CC5B 3C2SA 3L3DA 5JW5A 3EHBC 4PLNC 1MJJA 5K9JL 2NY0B 3GSXB 1FDLH 4ODXB 1AQDB 3HNVH 3SDDD 1UGNA 3TYFB 4OCWL 3A67L 2FLBT 3LQZA 4HC1A 3RFZC 1TJIL 2YKLL 4B7LA 4F57H 1CDUA 1GGBH 3GBNH 1ZA6B 3JWDL 4OFVA 4YDKH 3CZJA 2FJHA 2VLME 1ZS8A 3KPTA 5C0JA 2X40A 4JHAH 5MI0B 4WUUE 2FBJL 2Z31A 4J8RA 3TN0D 2A6KB 2W0KA 1T1YA 1CE1H 2VN7A 4HDIA 3SKJH 3P4NA 3LCYA 1QVOB 3C6SB 4YXHH 1FDLL 3KPPB 5FM4A 3TH3T 4YIQA 3HNVL 4R2GC 1RK0B 4ZOEA 1P4LB 2XKNA 4F57L 1NCBH 3GBNL 1MCEA 2LU3A 3LD8C 5AZEH 4G42A 4YDKL 1MCLA 2BNUB 3D87B 3BN9C 4DCQA 4FXGA 1NDGA 4JHAL 5J6GA 3ZDXE 2NY0D 2JJSC 3BRDA 4Y5XB 2F9BT 1CE1L 2P5EB 3L3KA 2D0HA 3SKJL 3O41A 2BY3A 4BELD 2VLLA 4I18A 4RAVB 2CLZB 4YXHL 3IDYC 5CJQH 4WFGE 2CK0H 1MCFA 5HYSB 2XQBL 5LAXA 4FQXC 1SEQH 3AS3A 2LFGA 1XR8B 5I8KH 4PY8I 5AZEL 3RWHA 1RHHA 4HJGB 5EOTB 4M3KB 1KBGL 2BSED 1A8JH 3F8UB 4ORZC 1WFOA 1M4KA 1S7VA 4LL9A 1FC1A 4HXAH 1U91A 2EEBA 1N4XH 4HUVA 5DO2C 3FO9B 1QO3A 2CK0L 2VR5A 3IJHA 2ADJB 3MV7E 5I8KL 3VD5A 3DIFA 5CHNA 4BSVB 1L4IA 1XR9B 3ULVD 2P5ED 5HHNA 2YR3A 3OGCB 1F13A 1I8KA 4IHOA 3X13B 4WIQA 3HN3A 2F15A 5DDHB 3P3YA 4X6DF 3QDGB 1TQBB 4H8WC 1CGYA 4HXAL 1KACB 4TTGA 2NW2A 5BZWA 1X5KA 1N4XL 1FL6B 4UDUA 4PB0H 2X4PA 2GITA 4HK0A 5E5MB 4N8VA 4DKEH 4JG0H 5ID1A 4K71B 1GJIA 2WINA 4JJHA 1B0WA 2XV6B 3G6JE 1R3JA 5DK2A 3IDMB 5HI4D 3QA3A 1XGPA 4PJIF 2YD8A 1UCBH 3H3KA 1B6DA 3CSBA 2L7UA 3IFNH 5E1HB 3VD4A 3BHBA 1IT9L 3DRQA 5EBLB 4GKNB 4UT7L 3O4LA 4TUJA 2XICA 4M7ZC 5HVGB 2LTQC 3VFUB 5MENB 1C1EH 3SDAA 4PB0L 4I0PB 3EZ8A 1IM9A 4DKEL 3K8LA 4JG0L 4O02H 5F3BA 4JRXA 3DVGB 3QDGD 4LDEB 3S4SB 3BDYH 1MWAA 3W0WE 1UCBL 3IFNL 4MA8H 3AC0A 4LAQH 3M17A 3QSKB 2B1HH 3NCEB 4WUUB 2ICWA 3Q6FB 4DWHA 1OSZB 2P8MB 4OF7A 5SX4I 2NTFA 1C1EL 4WO4C 2HTLD 1RUAH 4JRWA 1J0JA 3EYVA 4PRAA 3U0TB 4FP8H 5HXMA 4HIJB 1OWRM 5CEZD 2PXYA 5SX4H 3QHFH 4IMKA 2A9NH 1HQRA 4D9RE 4G8IB 3TA3C 8FABA 3N9GH 5MEND 3NH7H 1F00I 4F9PC 4MA8L 4OBSA 4LAQL 2J8UF 3MRQB 5D7JC 5IW1A 4I0PD 1GXEA 5I16A 1L9MA 2WLZA 2Y07H 4FS0A 4MSWA 3T0BA 2MMXA 5KSBA 1RUAL 3IGAB 4XXCC 5FGCB 4HBCH 3JWDC 4FP8L 3FONA 4Y5VB 1N59B 1D5ZA 2VLMD 4QHLA 4FFVC 3QHFL 2BSSA 1XGTA 5E8OA 2A9NL 5FV1L 4QCIA 1FGVH 4YFLI 4ODTH 4WUUD 2DM3A 4OF3A 1YC7A 1Z9OA 4M3JA 3N9GL 3NH7L 1ETZA 3IFOB 4FABH 2Y07L 4ELKA 4GAJH 2GT9A 5D96B 4CVZA 3I02B 3G5ZB 3SGJC 3QWRA 5FUCC 1S5IH 2CGRH 3FOMA 4JZNB 4JN2B 3RU8H 4ZFOB 1T4KA 1FGVL 4EI6B 4ODTL 4BZ1H 1BIHA 2EDFA 3D69B 4LLYB 1A6AB 4DJMA 3RWJB 4M62H 1NFIA 1CDJA 4KUCF 4HF5H 4ONOA 4WFGD 1VSCA 4FABL 2KZ1B 2VZTA 4I4WA 5EUOB 3SCMC 4GAJL 5I71C 3VXTB 4LDOB 3QUXA 1S5IL 2CGRL 3D18B 2Z9TA 3ARGA 3TZVB 3QUMH 1EA9C 2Y5TA 3RZWA 5LGJB 5EU5A 4FFZH 3G6JB 5DJCA 4NZJA 5I76A 5EO9A 2APVA 3VD7A 4HF5L 2FECI 3DURB 4EUPA 1T03L 2FLRT 2HLFC 2I9LA 4OAWA 3BMVA 4PRHB 3MJ8B 4RFNC 1QHOA 4MS8C 4HUMB 1GPOH 1TPXB 4WGVB 3MV7D 5DHYA 2BP3A 3UXFA 1OPGH 1FG2A 1J5OH 4R7NA 3TBVB 3FT3B 3QUML 2V5SA 5IHUH 3VU2A 3QB7C 3C5ZB 1RUKH 2MCG1 3DV6B 2CJUH 4FFZL 3QUZB 4J3TA 1QUNA 4XVTH 4Y7MA 4PJ5E 5E6ID 1YECH 2OK0H 1JUFB 3W0WB 5BCAA 5KW9H 4P5TA 4MDJA 3QIBC 4XHJD 2ZKHH 3NCJH 1GPOL 4LLQB 4F7PB 2X4NA 1OPGL 1J5OL 2H2SC 3HI1A 5A16A 1JI1A 5BVJB 5IHUL 3WS6A 1P69B 5J56B 4HWBA 3BXNB 3HKFA 4ODUA 5B8CA 2CJUL 4KKBC 5GGSB 4XVTL 1YECL 1RAMA 1ZGLA 2OK0L 3K2MC 3ARBC 5DJXA 4JKWA 5KW9L 5TF0A 1CS6A 4QYOA 1MIMH 5HPOA 3VWJC 2X1PA 3I6LD 4YDLC 5MEOB 1UFUA 5CZXC 4E42B 3C5ZD 3NCJL 1JPSH 3QUZD 3SE8H 1U8IB 3RKDC 1SY6L 1QA9A 3W0WD 1ZWIB 4UTBL 5E8PA 3BIKA 3QFJB 4O2FB 4AK1A 1MEXL 3VXSB 1U3ZA 1A7RH 2BCKA 1VKXB 4Y4KC 1JZ4A 3U4EA 5FFLA 4HHAA 3VH8G 3OKNA 1QP1A 4OLWH 3TBSB 2HMIC 4RGOL 1RY7B 1F02I 3U9PH 3RL1A 2GK2A 1MIML 1F90H 3UZVB 4U1GC 3BP6A 4CRPA 2Y23A 4KTYA 5J3HC 1CL7I 3T0AA 3IDNB 5DI8A 5INDA 1LNUB 4D9RD 2Z8SA 4R4NC 2E27H 3KJ4B 4G6MH 4NUGH 1EGJA 5EU7C 1A7RL 2HT2C 5GS0D 5I1LB 3NCFB 3QAZB 2B5IB 4GOSA 4D9LH 3V0AC 4M61B 1FZKA 3O3AA 4OLWL 3CFKA 4XC1L 4U6TA 4JANB 1IM3B 4L4JA 1FSKB 2BMKA 1F90L 1FO0A 4NCC2 3V6OA 5DD6A 5CGYD 3QFJD 3LDBC 4Z7NF 5GGQH 2W65B 5DURB 5D2NC 3UPRB 2Z4QA 4NHCH 1S7XB 2E27L 4C56E 1FYTA 3C60A 4G6ML 1A6PA 4NUGL 5DLMH 4AT6B 4M8VA 5ANME 4DUWA 1EJ6A 4D9LL 4D0CB 5CSZB 5T5FH 1DQML 4Y4FC 5IB3B 4MNQE 5C0NC 2R2EB 1IAIM 1B0RB 3B9KB 1WTGT 4FQLH 1Q0YH 5CEXA 2V6HA 4G6AC 2O5ZH 1UM6L 3AMLA 1AGCA 1PD6A 1MLCB 1A3LH 5GGQL 3RDTC 5IWLA 4QY8A 1JMXA 4NHCL 2CIKB 4AYFA 1MHEB 4LPXA 5DLML 4OZGE 3LPFA 1SEBB 5T5FL 1U58B 4Z5RB 3ES6A 2HVKA 4CMMA 1UEMA 4PJ5B 1MNUH 1NC4B 2B0SH 4PJXA 5DURD 5FKAA 3OPZH 1HYSC 1MIEH 2O5ZL 5J13C 3QO1B 1IAOB 1CE6A 1KTLA 1RU9H 1A3LL 1UYWH 2DI9A 5F7UA 3EJZD 1S78D 1UXWA 4BKLB 3ORJA 2XNAA 4NKDB 4NOBA 4PRDB 4WW2F 1RIUH 2PYFA 2XT1B 4RZCB 2A0LD 1NSNH 4PPTA 1AO7B 2Q6WB 1KNOB 1KTDA 4JFYA 1S9YA 2JIXA 4AL8H 3UC0H 2NY3C 1MNUL 2B0SL 5EB9A 3BD5A 2IMNA 3B3IB 3M8OH 4JJ5A 1T2JA 3P9LA 4DK3A 1F4YL 1RU9L 3D39E 1EAPA 4PGJA 1EO8H 5CIPB 3UTPE 5I1GH 2GKIA 4PJ5D 1KT2A 4HFWB 1RIUL 1NC4D 2BSRB 3T3MF 3WIHH 2QQLH 3P77A 1NSNL 4A2MA 4GBXA 5IEHA 2DQGH 2DM2A 3QUKB 4AL8L 3UC0L 1SYSA 1M7XA 1NL0H 5IJVB 4JFQA 3MRJA 4KVNH 3M8OL 1ZANH 4PLJC 1LO0H 2MQCA 4TSCH 3REWA 2DWDB 3KNBA 1EO8L 4WEBH 1AO7D 4OFYD 3DROA 3UTZA 5I1GL 4WWKB 2V2XB 1I1FA 2MWCA 4ZSOA 1MVUB 3EO9H 3OQ3B 3WIHL 2QQLL 1N64H 4XP1H 4X7TA 4H25B 4HS3B 5DJZA 2OL3A 2EIBA 1R3LB 3CX5K 1FZOB 4WDIB 3TH4T 1NL0L 3P0YH 4QHMA 4KVNL 3CZFB 5DRNB 4PJ8A 1ZANL 1LO0L 4TSCL 5EZLB 4HEPG 3DXAA 1MRFH 2N56A 3V6FA 3AGVA 3GSUA 5IVXF 4NWTH 4XGZB 2J12B 3MYJB 1KEGL 1H3XA 3L3OA 1EHNA 4JPKH 3IJYA 4PV9A 2CR6A 3ROLA 1RZ7H 4C56B 2V5RA 1N64L 3FFCB 2CKBB 4XP1L 5EBWB 4YPGB 3WJLA 5MEQB 1D6EB 1P2CB 2JCCE 4MNQB 3P0YL 3IF1A 2FX7H 1D5IH 3MQIA 5KVGH 4CADA 3VD9A 2KPNA 1MRFL 4JRYE 1HDMB 3ZDXF 5IP4A 3HAEB 2VLJE 1VFUA 3BPOC 4N0FA 1NANI 4YQXL 1WZ1H 3G04B 4JPKL 4PJCE 5LBSH 1RZ7L 1Q9LB 3C09B 4O51B 4OZGB 3PV6B 4U1JA 3NZ8B 4Z7UE 4BZYA 1CFTB 2M2DA 2G75A 4Z7VB 3IU4H 1WF5A 3WE6A 5SWQB 1NANH 4NKOB 4D0BB 3RWEB 2FX7L 4MNGB 1D5IL 2C4FU 4Q58C 4S1DC 2Z91B 3LY6A 3VMOA 4LRNH 1KCLA 3MLZH 1V3KA 4LVEA 4F7CA 3ZKXB 5EU4A 4WW1B 4BFGA 1OTUD 4C56D 5KBNC 3TGXA 3FFCD 4P4KB 5SWZE 3OR6B 3IKCA 3WFHB 1BIIB 1WZ1L 2YC1A 1NUNB 5LBSL 3GM0A 4MNQD 3O6KH 4N0RA 5CZVH 3IDGA 5I75B 3IVKB 5EULV 2X42A 4I48A 1U8QB 3L5JA 3IU4L 3PWLB 2H2PC 1EEYB 4L1HA 4QTIL 2B39A 4TVPH 2NXZC 3M1BA 4XP4H 3HC3H 4LRNL 3MLZL 2EZ0C 5CWSA 1BPVA 5FV2A 1KEMH 1XGUB 2RFXB 5HI3D 1YEFH 4YDIH 4LOUC 5L2JA 2ERJB 4Y5XA 3RVUD 2YPKB 1I1AC 4YHNA 4KQ4H 5F89B 2WWKT 3MRHA 3K2UH 1FVCB 1JF1A 4P4KD 1MHPH 3G6JF 4TVPL 3KDMB 3QI9D 2R2BA 3H9HA 3HC3L 1XR8A 3GRWA 4XP4L 1WZMA 4J3OC 4RMRA 5EOTA 3PP3K 5DRWA 4ZXBC 3L1OH 4IRZL 1YEFL 4YDIL 3UBXI 2G5BA 3HNSH 4QTHB 3QDHA 4S2SA 4MAYC 1WWWX 4WV1B 3MV9A 5JOPE 2MCPH 3EFFA 4KQ4L 1AXSB 1JWUB 4RGNE 1IFHH 3K2UL 3ZZ1A 1MHPL 1T66C 1N2RA 1RZIA 4KJPD 1MFDH 3UTPD 3D3VE 4M93C 1XR9A 3ZMRA 3P2TA 1FLRH 4UU9A 4XPGH 3MACH 4P2RB 1ONQA 4HPOH 4WWID 1BOGB 3HNSL 3IXAA 2A83B 1DUYB 1XGQA 5DDHA 2HFGH 2ENYA 3BKJH 1KLGB 1NGPH 1IFHL 4ZQKA 5LXGH 1CVRA 2VMFA 4NN7B 5ETUA 1MRDH 1DQQB 3DGGB 1MFDL 3G5VA 1H5BC 4HH9B 3ZDZF 4XPGL 3MACL 2GQHA 2Y1VA 3HG1B 4OZFB 1NFKA 3HB3C 4RFEA 4HPOL 5DD5L 3IS1X 3CJJA 2HFGL 4AENA 3BKJL 4KUZH 1W0WB 4LPUA 4FFWC 4U7SA 5LGKA 1NGPL 2UYLB 4MQ7A 4OQTA 5LXGL 1J1XH 4XWOD 1R5IB 4P2QA 3LKQB 4OM0H 1MRDL 1S9XA 1T20B 3EYUH 4GUPA 4I9WD 5HVFB 2V7NB 3JTTB 3JWNC 4Q0XH 1AGBB 2EYRA 2IANE 1MQKL 2BOCA 1CDYA 3FO1B 4ONHA 2F5BH 5HYJE 1OSZA 4KUZL 3ZKNC 5KVMC 3LKPA 1YY8B 7FABH 4AY0A 3MCLL 4M6NH 4F37K 3UDWC 1J1XL 3HG1D 4DFIA 4F15C 2D7TH 1YUHB 4F8TA 1GVIA 2YA0A 3EYUL 4YAQA 1M6OB 1EIBA 4Q0XL 5EPMB 5FYKH 1DZBA 3MRQA 1VFBB 4NPYB 1D5XB 5AD0B 2F5BL 4RWYH 5I1DA 4NC2B 7FABL 4QRSA 3O3EB 2X9WA 2Q3AA 4M6NL 1SM3H 1NCUA 2XKSA 4N0UA 1P53A 4LF3A 4S1SH 3EDDA 1AR2A 4Y5VA 2D7TL 4YDVA 3B5HA 5F7KC 3MJ9A 4OZIF 1Q38A 4C57C 3P40A 3T2QA 2VZ1A 3U48A 1Y18A 5LWYH 1M71A 3BPNB 2X6MA 1XCQA 4MB3A 2G5RA 1JL8A 5FYKL 4GQ9H 1RZJH 2QADC 4Y1AA 1WFTA 3QDAA 1FH5H 1OT1A 3D25B 2AI0H 2KQMA 3QEGH 1PEWA 3SY0A 1A22B 4PJGE 2PO6A 4BSJA 1SM3L 3G5ZA 5JW4M 3FQUB 4MCYB 1Q9OA 4S1SL 4Z76B 4JZNA 4M5ZH 2C4XA 3SE4A 1NBZA 3LPWA 3CFDA 1G6VK 1ED3B 2YUZA 3EKCA 4GQ9L 1U9KA 2YHGA 1RZJL 5EC1A 3PUCA 3GIVA 3ULUD 4QRQA 1FH5L 1NGWA 3QJHA 2AI0L 3X11A 1QZ1A 3O9WA 4X6EA 5C70A 1MCKA 3CU7A 3TVMC 3TIDB 1CFBA 2XWTB 4M5ZL 2OYPA 3TZVA 1WCBA 1GZQA 1YN7A 4HIIB 5F21B 4KDVA 1MHCA 4MCZB 1TVHA 4NQSB 2WAHA 2LABA 1JPGA 1LMKA 5HHPA 1JGLH 1FL5A 5T1LB 2EXYC 4MXWH 3KR3H 1T5WB 5CGMA 2C1OB 3HLAA 4PRHA 4F9LC 4MD0B 4JFEE 3MJ8A 3I3DA 3W82A 4YGVA 5D7IF 5HI5C 3HCVB 4UUJA 1BX2A 3O45A 3QZWB 5F9DC 1XGRB 3D3VD 3FT3A 5EZJB 4HC1H 1NAKH 2R29H 1FGNH 3SGKA 2VJXA 5DK3A 3RUGA 3T4YA 3E8UH 1HKLH 4OTXH 4XPTH 3VXQA 1JGLL 4G7VL 1CFNB 2Q76A 1I7TB 4MXWL 4KJQC 3KR3L 3NOIA 1KIPB 3U36A 3MLVH 2YRLA 1IL1A 4HUUA 5FEBA 3EZJB 4LHUB 2LE9A 3MLTB 2YD9A 1JYNA 1DBJH 3G6AA 2KQNA 5TH2A 4DVRH 3NFPA 3WIFB 4EN3B 5T1LD 1RULH 4HC1L 4XNXH 1FGNL 4ZODA 3VXME 5GJTL 3MCKA 4G8FA 4JY4A 1HKLL 4OTXL 5FGBA 4XPTL 1KOAA 4JO1H 4EDWH 1CG9B 3ILQC 1VHPA 1S9WB 1F58L 3QUYD 5CAYB 1DLFH 1H8SA 4BJLA 4P23D 3MLVL 3ARZA 3MRBB 3CGTA 5L9DL 4E42A 5F9JA 3PGCA 1CCZA 5I1CH 4UQ3A 1KCUH 1CK0H 2HKHH 3FQTB 4DVRL 1R3KA 3OKLB 5F88A 1RULL 4XNXL 5CJBA 3MNVB 3VXSA 1BOYA 2Z92B 1WT5A 1J1OH 4DTGH 1DEEA 1S9VA 2CLVA 4JQXC 3TJEH 4GRWB 5HYJD 5C0BE 1ZSDA 1YPZE 4EDWL 3AB0C 3GHBH 2IFGA 4LHUD 2IAMB 4UAOB 3RRQA 3G08A 1DLFL 5DC0A 3CDGB 1T1WB 4EN3D 3AVEA 2R0ZH 3MMEA 4X5LA 4XZUB 4PJGB 3GSVB 1KCUL 1CK0L 2HKHL 3Q3GB 1S7SB 5JOFB 1MRCH 1A1NB 3E2HB 4MAUH 1J1OL 2HJKA 3PL6B 4DTGL 3TJEL 4G5ZH 1HXYA 5DSCB 2Y25A 3I50H 3C8KB 1QFWM 1U95B 3GHBL 3QDJE 1IM3A 1AGFA 2DTSA 4NRXA 3ISWA 3QXTA 2R0ZL 1R5VB 3EHBD 1T04A 4L8CA 3CSYB 1IQDB 2W0FB 3OSKA 2VZOA 4U1IA 1KJMB 1KJ2A 3BH8B 1FN4A 1UB5A 2OS7A 2JJTA 1YNLH 5DEGB 3KPMB 4HS6A 3V6ZA 4GRMB 1MRCL 2IAMD 3QIUC 1VPOL 4MAUL 1TTFA 3IDYB 5ICYA 4G5ZL 1FIGH 3H0TA 4D0CA 2H9GB 2IALA 3E6HB 3B9KA 3HMXA 4BZ2H 4GXUM 5FA3A 3RZCA 3EYSL 3ZT5A 1MCQA 4KHXH 4EVNB 4MA7H 3QH3B 4JFEB 3WV0A 4Z7OE 5B39A 2CIKA 1I8LA 1YNLL 3N1GC 1UJ3A 2E8ZA 4R2GD 3QQ3B 5IFJA 2BVPB 4R97B 4U1NA 1K4CA 5FUCE 1RZJC 4N1EA 5KG9B 2Z35B 1FIGL 4Z5RA 1RZGB 5E2WH 5EBMB 1MWAH 1NBYB 3CU1A 5ESQB 2VDOL 3DV4A 3HZYA 2A74B 4OZ4B 4KHXL 3BP4B 4JDZA 4MA7L 5ENWA 3VXRA 1HH9B 1IAOA 1WISA 4QEGA 1IGIH 4HUWA 1W0VA 3KAAA 4GO6B 3WL9B 4RFOH 3AXLB 2IC2A 4PTUB 3CFCL 3V7AE 1UWGH 1AC0A 3GSQA 4M48H 4PJFA 5F70A 4AEEA 3VXMB 4OCYH 4NQXB 1CR9H 3ALPA 5E2WL 1MWAL 3BEWB 4JFED 4H1LG 2FZ3A 4YHOH 1OAQH 3GJFA 4TUOB 2YRPA 2N7AA 1U8NA 2NY5H 3D1MC 1IGIL 5DO2D 1KIRB 3MJGX 4N8PA 4RFOL 1WZLA 5CEYB 4NUJA 4M7ZB 1AKJA 2EC9T 1UWGL 2BSRA 2LTQB 4M48L 4D8PA 5J1TC 3RAJH 4FG6C 5HPMA 4JHWH 5IVNA 1K9TA 4LVNC 4OCYL 1CR9L 2JCCF 4HT1H 4YHOL 1OAQL 1YPZB 4LLWB 3OG6B 4XPHH 4Q9QH 5E2UL 5L8LB 1DLHB 1W0YT 2P43B 2XFXB 5IB4A 3RP1A 3VXMD 4PJCF 4WWKA 3FOLB 5E7FA 2V2XA 3VXUB 3TBTB 4Z7UF 5IM7B 3UTSE 3WEXB 3PXJA 3RAJL 4JHWL 2GCYA 3RWGB 2L4OA 2Z31C 4HS3A 1LE5B 4X6CE 4WDIA 2BRQA 1T80A 2BC4B 1TZHA 2BNRA 2EYSA 2DJSA 4XPHL 4Q9QL 4U6HB 5HYQB 1KG0A 5BVPH 3WKMH 3TA3B 3HZMB 4MJIA 4LARL 1CD1B 3VRJA 4JDVA 3GJFK 5B38G 1RZFH 1UB6A 2YPLA 3SJVA 2FR4A 3KYOB 3FL7A 5D7JB 3KWWB 1IKFH 3MYJA 5FDYA 2Y4SA 2P49B 3GFUA 1N5AB 3KYKH 3HPLA 3TF7C 1M7DB 3OJDB 4LNRB 4YPGA 1IGCL 1PLGH 4PG9A 4YHZH 4JB9H 3F7VA 4KZEH 3RWFA 4NKMA 1KXVC 4I18C 4EUPH 5JIPA 3NIDE 4YWGH 3WKML 4WHDA 3LS5H 2J2ZA 3S35X 1H0DB 1RZFL 1U8HA 4X9HA 5CGTA 3FB5A 1IKFL 3SDCA 2JJWA 3O2DA 2YD4A 3LRSA 4ETQA 2PTTB 4O51A 1JNLH 3NZ8A 3MRPB 4XCYB 4XAWH 1FV1B 1PLGL 4Z7VA 3MNZA 3TA3D 4YHZL 2DLFH 3VFSA 4KZEL 4NKOA 2I9TB 4XPAH 5EU7E 5KANI 4MNGA 5FO9A 5D7JD 4YWGL 1OD9A 3EDKA 3T0EC 4YJZL 3LS5L 3QCTH 3AMKA 3NFSH 1HHHA 3F12B 5F7DB 2AJYH 2VWEC 3WFHA 3IS0X 4CKVX 1QTYT 2APTA 2NY6B 4FFVD 5I71B 4HWBH 1PG7W 5D2NE 3SPVB 1JNLL 5D4QA 4NCDA 8CGTA 4XAWL 5IW6B 2DLFL 4FFYH 5AUMB 1P7QB 3O4OC 5DS8A 1EX0A 4MXVF 2AJVL 4UMGA 4LPWA 2A6JB 4M1CC 2IADB 3DETC 3QCTL 1KULA 5EOCH 1L0QA 3NFSL 3WNLA 4LPYA 1BZ7A 1JK8A 1ZHKA 5E1AB 1G7IB 5D72H 2FWOB 4U1SB 2WWMC 4H26A 1QSFE 2CLRA 3MA7A 1LE9A 4LSTH 1AGEB 4HWBL 3H9ZA 43C9B 2FO1A 2KKQA 2G2RB 2RJMA 4FFYL 1KIUA 5LCVH 3KYNA 2OJEB 3RNQB 5C0EB 4G3YH 4ZD3H 3S8WA 3DX9A 1AIFA 2B2XH 5BXFB 3PV7A 5EOCL 1RIVH 3EJYC 1H3GA 5A40E 4KK9C 3D6GA 1MCIA 5FYJH 5D72L 4F7CB 2X4TA 3SGEI 4CW1B 4QTHA 1P7QD 2VAAB 4LFHG 4P5KB 4LSTL 2HJFA 5F9WC 5JXEA 1EGJH 4RMWA 5D1ZB 1VENA 4NNYA 5LCVL 4EI5B 3WXWH 3S35H 1P84K 3N1MC 3IAGC 3H7BA 1U6AH 4X6CB 1PKQA 1U8PA 4G3YL 2X4QA 3W39B 1HH6B 3BZ4B 4ZD3L 4WJ5B 1FO0H 2B2XL 1RIVL 3OKDA 3LKRB 4F7EB 1TNNA 4P2RA 4MS8D 3ARBB 4XCCH 2PXYC 4M1DH 5F8RC 1BOGA 1D5MA 3LAFA 2E5EA 1S7UA 3VWJB 3VFNA 3F5WA 3LQMA 4GMSH 5I8EB 4S1QH 1EGJL 4DKFL 1RUML 3MLPA 1U3JA 5DYOA 4JDTH 4JM2A 2ATPB 3S35L 3WXWL 1DUZA 1U6AL 3AAZB 3LB6C 4CMHC 4M6MH 1FO0L 4HH9A 2QR0B 5EDXA 1PZ5A 5H2BB 1VB9A 3RNKB 5TE6H 1U3HA 3KPSE 5IB1A 5IMKB 4Y19A 5C0IB 2H2SD 2HA1A 1K3IA 3WUWG 4U1GB 4GMSL 4JVWA 3HI6H 3QPQC 2GTWB 5KSUB 5L2KB 4KKBD 3T65A 4UQ2A 3AREA 4JDTL 5DGRA 1U36A 3ARBD 2CRIA 1PYWB 3LKQA 5EU3B 1G7MB 3VG0L 1JMZA 3RJQB 1EEZB 3VWJD 4JQVC 5C3TA 4NN5C 4YO0B 3MR9B 5TE6L 5CZXD 1AGBA 2ZZUT 3TO2B 4TRPH 2ADFH 4NQVB 3IYLW 3RKDD 3FO1A 2DMBA 4KV5F 3HI6L 5CP7B 3U1SH 5D5ME 4Y4KD 1H8NA 2MQ3A 4O2CA 1KJVB 3PQYB 1ZVSA 3KYMA 4XP5L 4X6DA 2HMID 2AS5M 3BZDA 5HGBA 4AMKL 4L3CA 4QXWA 3MV8E 5TF1H 3QUXC 5F72S 2CO6B 2VN4A 2YA1A 1M6OA 4NT6B 4JFFA 4OKVA 3ARGC 4Y4FB 3LKNA 5D6DA 1VCAA 4QKXB 5J3HD 1P1ZB 4TRPL 2YSSA 2ADFL 4OGXH 5EIIA 4R4ND 3IETA 3NPSB 1IEBA 4R0LA 2P8LA 4AIZB 4PJIA 2HT2D 3U1SL 5JW4R 3O3EA 2XPGA 5GRJL 3U6RA 3T1WA 4D9QD 5AEAA 4MNHA 3C6LC 3ZYOA 5TF1L 2I60H 1XZ0B 4H5SA 1ZEAH 2ZSWB 1WAAE 4OBRA 1T0MB 1UVQB 2GSGB 3KXFB 5FB8A 2X4RB 4M43H 4BFEA 4DOHE 3WDJA 1OGAB 5IHZB 1X7QB 2NZ9C 2BK8A 3D25A 1JZ6A 5J13B 5TGBA 4F3FA 2WQ8A 3HI5H 5I1KH 5DQDH 5ID0A 4P5TC 4Y4FD 3PDOB 2OL3H 5C0ND 3ZYJA 1XF3B 3PWJB 4UT9H 1D5BB 3VDBA 4M02A 1ZGLP 2AJZA 1HQ4B 2I60L 4OLVH 3ZTJG 4CJ0A 4G6AD 2DQUH 2XACC 3RX7A 3ALWA 3WS6C 2A73B 2PW1B 2ZP0T 3UROR 1KLFA 1BZ9B 2CMRH 5B8CC 3F7RA 2IH1A 3FN0H 3VWKC 5CLTA 3QUMB 3KPRE 3ZHKA 3HI5L 5I1KL 5DQDL 2J8UA 5D7LE 2GIYA 4U7KA 2Y6SD 4JPVH 3R4DA 2XWTA 3V5DA 3KXFD 1N3NB 2E6PA 3IJSB 3LN5A 4UT9L 1OGAD 4ENED 4OLVL 3BE1H 2DBJA 2DQUL 4PRIA 4MD4A 4ZOCA 1CLOH 5IOPA 1BQHB 4N5ED 2IFFH 2NX5E 1JF5A 2WM0A 2CMRL 2XWJB 3RIAF 4Q7DA 2ZOKA 3FN0L 5HY9A 2PR4H 3MSPA 3WO4C 4TOYH 3AU1B 4JPVL 32C2B 4GRLB 2NY3D 3FT4A 3CMOH 3BE1L 4HCRA 2W60B 3PP3H 1CLOL 1G7LB 1BVKA 2VLKE 3P30L 2IFFL 4PJDB 4CDHA 1PSKH 1I7TA 1P5UA 4GW5A 5TDPB 3V5HB 3PE9A 1AHWC 1CU4H 5HJ3B 5CP3A 2PR4L 4LVOB 3ARRA 1RK1B 2PETA 3G9AB 4NQTA 4TOYL 3BUTA 5FYLH 5EU6B 5CINH 5D5MB 5IVZB 1HCFX 3V6OC 4XMPH 2J6EH 3CMOL 4U1HB 4NQCE 4P46B 1XGYL 3U0WH 3FQWB 3GJEA 4PLJD 4U1MA 5CMAB 5HHOA 3WNNA 5CBEB 5DVKA 3STLB 1KXQE 1PSKL 2DN7A 1KPUB 1ZVHA 3E6FB 1V5JA 2AK4E 2JKXA 1CU4L 1HNGA 3MRRB 4LBEA 4FMKA 2EDNA 3N85H 3DVNB 1LP9B 2XZZA 1T1ZB 4RMVA 3O6FB 2Q8BH 3BPOB 5FYLL 5CINL 5F96H 1BJMA 1XFPA 1PEZA 1QFWI 4PD4J 2VUYA 5IFHH 4XMPL 3LRGA 1A6ZA 3U0WL 3OX8B 5DD0H 3GRWH 5SWSA 4XI5C 1B4JH 1P7KB 2YD3A 3VFPA 1KB5A 4UT6H 4GG6B 3EGSB 4I3GA 4H1LA 5EU6D 4DOHB 3PF2A 3DVFA 4RAUA 5E56A 3CDGA 3N85L 3DVIA 4Z7OF 2Q8BL 4P46D 3EBAA 2EYTB 5I2IA 5F96L 4GMTL 1S7SA 4PP1D 2LV4A 1UXSA 5IFHL 3QXVA 4P49A 5I1HH 1N6QH 1A1NA 2HP4A 4LIQH 4FTVE 5A43C 5DD0L 3GRWL 2X70A 3MRCB 3PL6A 1B4JL 4J7RA 2E7HA 3EDJA 4YHKH 3OJMB 1E6OH 1LEKB 4UT6L 2PCPB 4U0RC 5IIEB 1BREA 2YBRB 2CDGA 5BV7C 4XH2A 1LEGB 2B4CC 2MSPA 1F2QA 3UTTB 1WEJH 1A6WL 1IQDA 3IDXH 4JY5H 4LSPL 5AYUH 5DZLA 1I1YB 5I1HL 1BEYH 1N6QL 4LIQL 4IOSD 1VGKA 5ITFA 1CWVA 2BRRH 1F3RB 1NC2B 4YHKL 1E6OL 4MZ3A 4U4BA 3OKKB 2J7LA 3HPJB 1FNFA 2XWBA 5E8NB 4X5WB 5DMYA 1HINH 5IBTH 1OHQA 4EVNA 5D1XA 5EO0A 1WEJL 2HT4C 3IDXL 4JY5L 1BM3H 1JFQL 5DJ8A 5IR1A 5DA0B 4RX4D 1IGYA 4OQTH 2LAAA 2H2PD 1BEYL 3QQ3A 5I6XB 3W5NA 3D0LA 5A2JH 4M8QB 2WBWB 1NEZG 2EZ0D 4R8WH 4IMLA 3BH9A 2BRRL 2Z35A 4PG2A 4MB5A 2ITDB 1MFEL 4FRWA 3UTTD 3T0WA 2F19H 4CNIB 4D0DB 5CEZL 1X5FA 2XG4A 4X99B 1TCRA 1U8KA 2GTZB 4WY7L 4M93B 3GMRB 5IBTL 3RGVA 4YDJA 3RI5F 1E27B 2DI8A 1BM3L 2KDGA 3LSOB 1K8IA 1J0HA 3WHXA 1NC2D 4PJ8C 5T1MA 3WL9A 3CCHA 4OQTL 4R4FH 3AXLA 4WENB 1MQ8A 3SDDC 3U9UB 4R8WL 4X6CF 5F6IC 3QIWB 5FOBB 1KF9B 2AEQH 2G9HA 5E8EA 3BEWA 2F19L 2XZQH 3RVWC 3QQ4A 5I15H 4LLAA 1H5BB 3WJLC 2AK4B 3TN0C 4MAYD 3VMNA 1FJ1A 4O2EB 4AM0A 4IBLT 3S6CA 2DLEA 2H8PB 2FJFB 5IMLB 4R4FL 3FMGH 1FPTH 2MKWA 3L5WB 4J3VA 2WP3O 3NABL 1EVUA 1XCTB 1KUMA 2AEQL 5IB2A 4OIIL 5L7XH 2XZQL 1QSEA 1ROWA 3F7YB 4CDGC 2VRAA 4F7MB 3PIQA 2NY0C 4KMLB 4IRJA 5FECA 5E08L 4LVHC 2YK1H 4PJAE 4P5MB 5IROA 3LH2H 3RBGA 1FFOB 1DVFA 3QIWD 4M6OH 2ZUUA 2OQJB 2R23A 3FMGL 5J4MA 3VXUA 4RBPK 1QG3A 1FPTL 2OI9B 2GUOB 4G80B 1TXKA 3CUPB 3MJ9L 3WEXA 4WHTB 4LCIH 1IGMH 5H35B 3RWGA 5FO8B 1N6VA 2AK4D 2FJGB 2I27N 4PJBE 5JZ7C 3HB3D 5L7XL 1IC7L 4WW2A 5HGHB 1OGTB 3DO7A 2EKSA 1VFAA 3ZKQD 1IAKA 1FFNA 2YK1L 5FCUH 2W92A 3LH2L 4FFWD 2DQDH 4M6OL 3BWAB 2EO1A 1AGDA 1LD9B 2FGWH 4HKZB 5IV2B 4FXLA 1G7QB 4OT1L 1CQYA 4LCIL 1IGML 4PGDB 2ZUYA 4B50A 4Y5XC 2FBOJ 3MLWL 3CLFH 3IU3A 1ZA3A 1BF2A 1ZHLB 3ECBA 4Q74A 3ZKND 5FCUL 1C12B 3GI8H 4JLRB 5DMGD 3D85B 3R0NA 5HBBA 5GIRA 3FB6B 1DN0B 1P4IL 5EZOH 1MCOH 2FGWL 1Q9WB 2FSEA 2PTTA 5MERB 2A9MH 4AH2A 3T0VA 3HUJB 4XCYA 1FV1A 5KSVA 4PJ9A 4U0QB 4DGYH 4ELME 3CLFL 1E4KA 2R69H 2P1YA 1PQZB 43CAA 1Y6KR 4OQ1A 1RUQH 3PGFL 3ZE0E 3ARSA 1A9BB 1F4AA 4J12A 3GI8L 4UI2A 2X89A 4QRUA 5EZOL 4ZUVA 1MCOL 4ZFFB 4K2UH 4OGAC 4KVCH 1A7BA 3AS2A 4BFIA 4HLZH 3SPVA 1F4XH 2HJLB 3BPCA 2A9ML 1XEDA 5IVXA 5KVFH 1RURH 5ICZA 2QBWA 1BQLH 3I6GA 4DGYL 4MA1B 1INQA 1CDCA 4I2XB 1ORSB 2R69L 1OD7A 3D85D 3VFOA 1RHFA 5FM5M 1T89C 2IADA 3QHZL 2A6IA 3SDXE 1Z9SA 3SKOA 1RUQL 5E1AA 1YEDB 4X4XB 4HIXH 2ZJSH 2HTLC 4MQXD 1JNHB 2DWEA 4FOMA 1I7UA 4K2UL 1X4XA 1U8OA 5BO1H 4KVCL 1ES0B 4PGEB 4X9GA 4ZNEA 2DLTA 5KVFL 1RURL 3BVNB 1KCSH 1BQLL 5K59F 2UY6A 4JFXA 4L4VE 5D70H 3RNQA 1G7JA 4BH7B 5C09A 4NOFA 2VLRE 3W9DB 3ZE2E 3S36X 4I0PC 4KK6D 1OSPH 4DVBA 1ZXQA 4TVPD 2ZUXA 4HIXL 4JKPH 5MP6H 4PJAB 4CW1A 2Y7QB 4I77H 5D2LE 3UBXB 1RJYA 2VAAA 4JPIA 3SEPA 5TDNA 3AFLA 1A1OB 2AJSH 1HE7A 4OM1H 4BQCA 4QT5B 1GGUA 5D1ZA 3CX2A 2AKRB 1KCSL 4EI5A 2EXYD 3WD5H 5C92A 3W9EA 1ZAGA 4WJ5A 3MC0A 5L8JB 1OSPL 5ACZA 1S7RA 5HI5D 4MX7A 4PV8B 4JKPL 4OZFG 5MP6L 1F6FB 2V17H 1KJ2H 3WXVH 3QG6B 5EFIB 4I77L 3HMWH 2HKFH 2GSIA 5H8DA 5I8EA 2AJSL 5F3HA 2PN5A 3KLHC 4OM1L 1NCWL 1KN2H 3OTTA 2R1XB 2C3HA 3ZYIA 1FYHB 5JXAH 4KDWA 4HWEH 3WD5L 2C3VB 5D6CB 2FYYB 3OR7A 4K3DH 3HMXH 4KJQD 4NO5A 3L5IA 3M45A 1ZLUK 4JFZH 2QR0A 3VI3E 4OZHE 5I1AB 3QEHB 2EKJA 2H6PB 1ZHNB 2WLYA 3QCUH 4Y5VC 2PTUA 4KZDH 1HHJA 4PREB 4YXLH 2V17L 1KJ2L 5JORA 3WXVL 2P8PB 4ZAKA 1I3VA 1R5WB 2QTEA 3JV4B 5F1KC 3L95A 4BQ8A 4F33A 2VE6B 2GTWA 4UDTB 1KN2L 2NTSP 4R9HA 5L2KA 2BNQB 3MGOB 3N1QC 3BUYB 5JXAL 5E0QA 1VACB 4HWEL 3DTXA 4K3DL 3ILQD 4FQJH 1PYWA 3HMXL 4C55A 1G7MA 5EO1B 2PO6C 4ELMB 1WAAF 2D7NA 5GS1A 2DQFA 1SVCP 3D9AH 5J11C 3OHXB 4Q6IA 3TIEA 3MR9A 3QCUL 4OSUL 4P3DA 4YXLL 3SE4C 4K8RH 3X17A 5D9SA 2DB8A 5JA8B 2FB4H 3TLRA 3CFEB 3PNWB 4WFEE 4LSRH 5B3JE 1ZLWK 1BMGA 1J0IA 2MHAA 4PRPE 3S36H 1KJVA 4WEMB 5DJ0B 3PQYA 2ARJA 2JELH 4FQJL 1MAJA 1CI5A 3PWUA 1J8HE 3D9AL 5GRVK 3GJFH 3LKOA 4DZ8B 1A7PL 3TZVC 4FMFA 4F8QA 3TNNA 3OKEB 2BNQD 3DX7A 4X7CC 1K6QH 4HWZA 4L3EA 2NXYC 3B4NA 4K8RL 2R1WB 2FB4L 2H41A 4LSRL 4LLUA 4Y5YA 2AXFB 5EA0H 1VERA 3S36L 2Z93B 1GAFH 1EXUB 3ILPA 4AQ1B 1K2DA 2JELL 1CF8H 3NGBB 1FNSL 4L4VB 1N26A 2HVJA 1S7QA 1TPXC 3S96B 1UA6H 3QEQA 5DMKA 2ZSWA 3TCLA 2LU7A 1K6QL 3ARDA 3WN5A 1K8DA 1T3FB 4JZOB 3T0EE 3BQUA 4Z95L 3V5KB 4YE4H 5FYKD 1CBVH 1A1MB 2VWEE 5EA0L 3HC0B 2YXFA 1GAFL 4V1DB 1MCBA 2E9JA 3C5SA 4J4PA 1CXEA 1CF8L 4Z7WE 4X98B 1YNTB 4ZS7L 3PWJA 4WCYH 1MJ8L 1C08B 3D2UA 1UA6L 4CVWA 1CFVL 4B41A 3VRLE 1A6VH 4UOW1 4DAGH 5T3XE 3RL2A 3FRPG 2A73A 5I17A 3QXAA 1RQ5A 1HEZB 5FGBC 1T21B 2V5MA 3I84A 4L4VD 5CSGA 3R8BB 3L3JA 2EC9U 3S5LA 4RA0C 5GS0C 2VLRD 5C0GB 4JG1H 5C7XH 1HWHB 4NYLB 2SEBA 4WCYL 2VSDA 5CILH 3L3IA 4PJ7A 2Q3ZA 4BM7A 1LHZA 4L8BA 1A6VL 4XC3H 3L3DB 5DC9B 4M1GH 5JW5B 4OZIA 3BKMH 1MJJB 2GHWB 5GQBA 3O2DH 3K1KC 4I8DA 1EO5A 3LQZB 1HHIA 1E4XH 1IILE 3ZKMD 4UZGA 3P4LA 5C0CA 2V9QA 1GYAA 4LCUB 4JG1L 3X14A 5CKGA 4GRLA 4LGPB 5ICXA 2AP2A 4XX1E 1JGEA 2FJHB 4U3CA 3CVIH 5C0JB 3HE7A 5CILL 5A3IC 2W60A 4HJ0C 5IVOA 1AE6H 2Z31B 4J8RB 4JFDE 4LSSH 4HG4K 1T1YB 5EZIL 4PJDA 3VDCA 4M1GL 4HDIB 5KVDL 3U4AA 1BQSA 3WFEH 3V5HA 3O2DL 3JUZA 3QAZC 4XP6L 3GI9H 4YIQB 2QQKH 2H45A 1E4XL 1I3GH 2XKNB 2NMSA 3NACH 2CD0A 4ZUSA 1J0KA 4KTDH 1IBGH 4Q9BA 4ALAH 3MREB 4FXGB 5D93B 5J6GB 3FQWA 4UIMA 3VRIA 2JJTC 5IGXH 2I25N 3GSRA 4LSSL 1WWAX 5CMAA 5CBEA 3L3KB 3O41B 4QHKI 5TQ0H 3TWCH 5KSBE 3WFEL 3C2AL 2VLLB 3EJZC 4I18B 1UC6A 1S78C 1DBKH 3GI9L 1UG9A 3MRRA 4YHIB 5LAXB 1LP9A 1I3GL 1X4ZA 1T1ZA 3MNWA 1CIUA 3O6FA 2GJZA 3B9KC 1AXTH 3NACL 3RZCC 5F7HA 5DR5H 2Z31D 5BZDA 4KTDL 1BJ8A 1ND0A 3RWHB 4ALAL 1QFOA 2RCSH 5D7IA 2K9UA 1QR1B 3MRDA 1RJZA 4NKQB 5IGXL 1S7VB 3GEWB 4C4KO 1UJ3C 2WBJA 1U91B 2HAZA 5TQ0L 3RKPA 4HUVB 3O6LH 4FN0A 1DBKL 1ZT7A 1QO3B 4GSDH 1OOAA 5DZOA 3JV6A 5HDLA 3SO3C 4S0TD 3SKNA 1AXTL 3IJHB 2QQNH 5DR5L 3DIFB 4J3XA 5CHNB 1DCLA 5HHNB 1DJSA 1VEOA 2RCSL 2F74A 3GIZH 1I8KB 4ZFZA 2XG5A 4L3AA 5KVEH 1BWMA 4N1HB 4OLZL 2DLIA 2NW2B 5BZWB 3BKYL 3O6LL 4GSDL 2M26A 2X4PB 2GITB 4HK0B 4RIRA 5C0DA 4N8VB 2ZOLB 1QQDA 1XT5A 2QQNL 4ODSH 3BIBX 4JR9H 1FFPA 1W8OA 4HPYH 5DK2B 2EDDA 2CXKA 3G5YA 2BHYA 1KN4H 1XGPB 3QA3B 3GIZL 5F7LB 3UO1L 3DRQB 5KVEL 5CJ5A 4PYHA 3O4LB 4DFHA 4TUJB 5KS9B 5JO5A 4JGUA 2BVEA 2ESVA 1ACZA 4X5WA 5DD3H 3SDAB 1QBLH 1YYMH 1Q1JH 1IM9B 1H3PH 3C08H 2F53A 4YUEL 5F3BB 4JRXB 4ODSL 4B5EA 2E7MA 1G9MH 4JR9L 3V4VH 4HPYL 4X4ME 2ICWJ 5F7WC 1MWAB 1UADC 4WEUD 4X6BA 4M1CD 1X5GA 1ZT1A 2WV3A 4QF1A 4WWKC 4RRPG 3DETD 5JQ6H 5B4MD 1BVLA 3VG9B 5DVOA 1XMWA 4D0DA 2WWMD 5DD3L 1QBLL 1YYML 5ACLA 4X99A 5TE4H 4UOJA 1T22B 1Q1JL 3EYVB 4PRAB 5C07B 1H3PL 3C08L 3DBXA 1E27A 2PXYB 3V4VL 1ZLVK 1L9NA 1RJCA 2QQQA 3O4LD 1HQRB 3OJVC 3V4PL 5FAAA 3ZT7A 2EO9A 1CXKA 3SDAD 4PJBF 5IW1B 3CDCA 4KAQH 5JQ6L 1IM9D 3EJYD 3WKNA 3B5GA 4KK9D 1KPVB 2YN5A 5I16B 4JRXD 2CDEA 4L4TB 3FQRA 3BJLA 1OTUC 5KSBB 5I8OH 4PY7A 3DUUA 3QQNA 1TJGH 5TE4L 2IBGA 1TZGH 3OV6A 3FONB 1DBMH 5C0FA 1D5ZB 5IMLA 5E8OB 1XGTB 3QNZA 4P48A 4QCIB 5I1EH 4IJ3C 1EUUA 3D39A 4MDIA 1OW0A 3NAAH 1ETZB 5E00A 3SDCC 3EOBA 1KC5L 3K8MA 4DZBA 3G5XA 4ELKB 2PXYD 3MLYH 2GT9B 4CVZB 5I8OL 4X8JA 4OUUA 2IPTH 4DN4H 1TJGL 3IDUA 1BLNA 2ID5A 1TZGL 2DJUA 1Q94A 1DBML 3RVUC 1I9EA 5HYFA 1FFOA 1T4KB 3ARQA 4HZLA 3FQNA 4WI7A 3ZKXC 3LB6D 1NFIB 2VABA 4IOIA 4AG4L 3FRUA 5HD8C 4X7SH 3V6OE 4HEME 4I4WB 1DTUA 2EIZA 3LKSA 4PJHE 3QUXB 2FIKA 2IPTL 1OGTA 4DN4L 3DX6A 1QYGH 3ARGB 3ZE0F 1FYTE 3QPQD 2Y5TB 2VKWA 3BWAA 2VXUH 5EU5B 1JRHH 4FNLL 5DJCB 3ZTNH 5EO9B 5JW4Q 2P44B 2JE8A 2VDKL 4OD2A 2VR9A 3SQOH 3QWRD 1DQJA 4KKAC 4EUPB 4PGDA 5C0RL 4X7SL 2ERJC 2I9LB 4OAWB 3UCRA 5C6TL 3P4MA 1FZJA 1MUJA 5DHYB 5DTFB 3SDXF 3V4UH 1FG2B 3QRGH 1ZHLA 2ZUVA 4R7NB 5EUKA 1ZOXA 5H37G 4Z77A 1SJHB 2CQVA 1G0YR 5BRZE 4R3SB 1OARH 2VXUL 4JRYA 4ZUWB 1JRHL 5J89A 1I3RA 1NCAH 2VLJA 3W5MA 4PJXE 5GGVH 3QUXD 1I85A 3SQOL 4HCRH 3V7AG 3HUJA 2LQRA 5B3NA 3ARGD 4PJCA 4MDJB 4HKJA 3QR2A 4Z7UA 5IEKA 5GZOC 1SQ2N 3ZE2F 4LDLB 1CD0A 1HSBA 1JTTA 3V4UL 3QRGL 1QLEH 3HI1B 5A16B 2X7LA 5CP3H 3HE6B 4PR5A 4K55A 1A9BA 5D2LF 4ODUB 1OARL 2D03L 1NCAL 1U2HA 5EOCJ 1YA5A 4OUOA 5SWZA 1ZGLB 5GGVL 3NIFE 2GJ6E 3K4ZA 5DJXB 4HCRL 3T8XA 1OCWH 4QYOB 3EO0A 3DSNA 3NFNA 3QNXB 2CDFB 3VFWA 3T77A 1G7HA 4HIEB 2NZ9D 4JM2C 1QA9B 2EDKA 3KPNA 5E8PB 3BIKB 5HHQA 4W4OA 3TCXA 4P5TD 2BCKB 3H6JA 3U4EB 4U3HA 3OKNB 1MCSA 1N7ML 4XRCA 5FO7A 4LMQE 1OCWL 3LEYL 3RL1B 3OAUH 2IPUG 4DN3H 1KB5H 3BP6B 1WC7A 3MUHL 5CD3A 4BH7A 3VI3F 4OZHF 4H1LH 1PKOA 5ISZA 5INDB 2VDQH 3AREC 5DXWA 4ZSOE 3QFDA 1IMHC 4NC0B 1R3IL 3OG4B 2Y7QA 2NNAA 1PDKA 2ADIA 4M5YH 5D1QB 3O3AB 1FZKB 4CBPA 3CFKB 4G7YH 2BMKB 3OAUL 1FO0B 3RIFF 4DN3L 1KB5L 5EH1A 1HHKA 1FIEA 1XAUA 1KCRL 4YHLH 2CSPA 1FQ9C 3LMJH 1YDPA 2Z4QB 2VDQL 4OI7A 5E24E 4Y2DA 3PWVA 3TPUA 1FYTB 3C60B 2G60H 3T04D 1YMMB 4MJ2A 4M5YL 5D6DC 4X7DC 4G8EB 3GNMH 5CEXB 4R0LC 1J12A 1AGCB 1TMCB 4YHLL 2FH6A 3LMJL 3PGDB 4QY8B 5AZ2H 1MREH 1MCDA 3T3PE 2G60L 1I3UA 4O58L 3UZQA 3C8HA 3E3QC 4L5FH 4K3JH 4EQ3A 1Q9KA 1CICA 3DNKA 4FXKA 3BPNC 3ES6B 2HVKB 4CMMB 2MPAH 4UDTA 4PJXB 5FKAB 1CDIA 3QNYB 3HA0A 5I74B 3AS1A 1U41A 1FYTD 3C60D 1CE6B 1KTLB 2XY1A 1CD8A 1N8ZA 3B9EA 4F7TA 5AZ2L 1UXWB 1AD0A 4ISVA 3CX5J 1MREL 4KC3B 2DS4A 4U0RB 5FYLE 4BK4A 2DDQH 2AK1L 2PYFB 4ZYKA 4RBPH 5M95B 4L5FL 4K3JL 1KTDB 2CH8A 1IE5A 1A7NH 2FX8H 2MPAL 4HMEA 2IANA 2X4SA 4U6XA 2EE9A 4JO3L 4POYA 3ESUF 4XI5D 5DUBA 4HSQA 4Z7WF 1X5XA 1H3UA 4JJ5B 4LEXH 3P9LB 4NO3A 3GKZA 3T1FA 4HGMA 5SV4A 3Q48A 1V8HA 3R1GH 1I1CA 3SKMA 3KS0H 4Z0BH 2P5EE 1NCNA 2DDQL 3CXDH 3F62A 5ITBH 1KJ3H 1ZLSH 1YQ2A 4GBXB 5IEHB 1RPQA 1GGCH 2FX8L 4LCYA 1SYSB 4JFQB 2ORBH 3MRJB 1D9KA 1EXUA 4NDMA 4LEXL 3VD3A 2FEEI 3KNBB 4YBQC 3R1GL 2XI9A 2CR3A 1S7TA 3UTZB 4U6YA 2W0LA 2JIXD 4Z0BL 4ZSOB 1R24A 2D0GA 1CLCA 3MV9E 4X9BA 3CXDL 2R4RL 1FNGA 1KJ3L 1ZLSL 5ITBL 3L9RA 2DD8H 1T3FA 4PUBL 4X7TB 2BOBA 3JZ7A 5DJZB 2OL3B 2PW2A 4LIQE 1A1MA 3I85A 4QHMB 2ORBL 3HHRB 4V1DA 3WBDA 4PGZA 1DSFH 3S88H 5LJYH 3DXAB 4I1NB 4X98A 1C08A 2AJXH 3GSUB 3F7QA 4YEEA 5HTSA 1XIWB 4GBXD 5F6IB 2YUXA 3QDGE 1H3TA 3FTGA 3L3OB 3IJYB 4PV9B 2HT4D 3ROLB 1OF2A 2EH8H 4WU7A 2DD8L 5J9PB 2X1OA 3ZL4L 1R0AH 1OQXA 3X12A 3MRFA 4XT1C 3RBSA 3GDBA 4KY1L 3RPIA 1L7TH 2NY7H 3UJIH 1DSFL 4EEEA 4CADB 2ITCA 3NA9L 3S88L 2JJSA 4QO1A 5CEZE 2AJXL 5J12B 4XXDA 1MCCA 4XNUL 4N0FB 5KSBF 3TV3H 5MENE 2EH8L 4EQ2A 5LG1A 1BGXH 4U1JB 3DECA 3FT2A 4FQXA 4PJ8D 2G75B 3B8SA 1WUNT 4JKLA 3WE6B 3DXAD 3PHOA 1R0AL 2XTJB 4LVHB 2ED7A 2IAMC 1BFSA 4H20H 4UAOC 4OI9A 4LCUA 2B8OT 1J86A 1L7TL 3UJIL 3W11D 1A9EA 3IT8D 2X44D 3RTQA 1BFOA 1T7YA 1WWCA 1ZV5A 5EU4B 1DQLH 3MRMA 5B21A 3RVWD 1T1XA 5IG7A 3KG5A 1P9MA 2J5LB 3IKCB 4KMQA 3GB7A 2CIIA 2YC1B 3TV3L 5T3ZH 3GMQA 3IDGB 3E2HC 1BGXL 4I48B 1FORH 3PL6C 2EC8A 4A6YA 5JPMA 4H20L 1GGBL 3M1BB 1TFHA 5CWSB 2VAJA 1UQSB 4Q2ZA 1VADA 1FVDA 4NJ9H 4BFBD 4POUB 1DQLL 3MREA 4WVRA 5L2JB 1V3LA 3MA9H 4JAMB 5FGSA 2X05A 2XTJD 4NP4H 4RRPA 5GRWA 4PRBB 5T3ZL 4X0KA 5SV3A 4YHNB 1OVZA 1ZHBA 1FORL 3KPLA 5FGCE 1F4WH 4YHIA 1OTTC 3MRHB 5F9OH 1JF1B 3B8YA 1NCBL 2FO4A 1SJEA 2R2BB 3H9HB 4G8GA 5JZ7D 3MGAA 5IBUG 4U1LB 1I9RH 1P6FA 2E9BA 2W9LA 4NJ9L 5D1XC 5DRWB 1ZLUH 5FYLD 1QR1A 4Y1AE 2IQAA 4UBDD 2R56H 5HGAA 4ODVH 2G5BB 1UWXK 2OCFD 3MA9L 1YYLH 5JNYA 4S2SB 4D2NA 1QRNA 1TIUA 4R97C 4QXTA 4F80A 2Q87A 3MV9B 1B0GA 1E0OB 4HKBA 3EFFB 5CJQL 2V7HA 5C0BA 5J6HA 1F4WL 4G9DA 4PG2C 4G6JH 3B43A 5F9OL 3GMLA 3LEVH 1SEQL 1N2RB 1RZIB 4NZTH 3VJ6A 1I9RL 2NYYC 3FJTA 3RGHA 1XF4A 4UU9B 1ONQB 2R56L 4ODVL 2UWEF 5EUOE 1JYWA 3IXAB 4WO4A 1YYLL 1XGQB 4JFPA 3BPLC 4GS7C 2J88H 1H3WM 3D0VB 3QDJA 4G6JL 1ZLWH 2O61A 4ZQKB 4PLKC 1BD2A 1LO5A 2ZOLA 2WP3T 1NMCB 4N90E 5ETUB 2FHFA 4CU6A 3CFIC 3N1PC 3G5VB 4F9PA 1MI5B 3CPLA 4LCCB 4U1KA 4I0CC 3RIAK 3MV9D 4RFEB 2IF7A 3GK8H 5ESVA 2ZNWA 3OXSA 4PRHE 3QWOA 4LQ1A 1WV7T 3BESR 3EAKA 3EDFA 4LPCA 1KELH 3ZTJH 4AENB 5KS9A 1A4KA 1GC1H 2NLJA 2P7TA 2XXMB 4JQIH 1QD0A 4MVBC 1U8JA 2FRGP 2J88L 3DPBA 4ZO7A 3BISA 4OGAD 2RQ8A 1UZ6F 4MQ7B 3I6LE 3DARA 3KPOA 1JE6A 1NH6A 3LQAC 4P2QB 2FL5B 4WHCA 4NQDB 5F7NC 4BUGA 3N1FC 3RUGE 1S9XB 4GUPB 1ZK9A 2QSCH 1G7PB 1X9QA 5GRVL 4BQ6A 4ZDHA 2EYRB 1OY3B 2BOCB 4RNRA 3T2PA 2CKNA 1KELL 4ONHB 1GC1L 3SGJA 2EDHA 4ZOBA 4JQIL 3LKPB 4R96B 4ONFH 4NO2B 5CCKH 4PP2A 1T22A 3HZKA 1HKFA 5C07A 1F45A 4O02L 1NGYA 1QRKA 2ADGA 2D9QB 4YAQB 3BDYL 2QSCL 5C9KA 2BJMH 2D7PA 2B1HL 3SCMA 5CBAA 3P4OB 1KPVA 4PJHF 4BSWA 4P2QD 3ZT6A 4L4TA 5I1DB 4ONFL 4QRSB 5CCKL 1G0XA 4N0UB 5T1KA 4LF3B 3QFJE 4KHTH 4YDVB 3VXSE 4MGXA 5AYQA 1UJTA 1Y18B 1M71B 1XCQB 1JZ7A 2EIDA 1IARB 3MZGB 2BJML 3S3JA 1NUGA 4Y1AB 3MJ6A 4YHPA 3SY0B 3L7EA 3MBEB 2PO6B 5J11B 4PJ9C