4GM2A

The crystal structure of a peptidase from plasmodium falciparum
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
183
structure length
183
Chain Sequence
PSLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGDIDNNKIINLNGITDVISIVDVINYISSDVYTYCLGKAYGIACILASSGKKGYRFSLKNSSFCLNQSYSIIPFNQATNIEIQNKEIMNTKKKVIEIISKNTEKDTNVISNVLERDKYFNADEAVDFKLIDHILEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Inactive Subunit of the Apicoplast-localized Caseinolytic Protease Complex of Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 67
structure length 183
sequence length 183
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4gm2A00
3LAOA 1FC9A 2FZSA 1N6FA 4KPKA 3QWDA 3NJBA 3WG5A 3NJDA 3GLMA 1SZOA 2CE3A 5G1SA 1ON3A 3KTHA 3KTKA 4OMRA 4F47A 5JBWA 4U1AA 1EF8A 3P2LA 4YLHA 1SG4A 3H0SA 4JCTA 1RJMA 1WDKA 2X58A 2F9IB 4FZWA 3KTGA 4U0HA 3HINA 2J5GA 1W2XA 2PG8A 2J5IB 4FB8A 2HW5A 3P85A 4EMPA 2VSSA 4B3JA 1XNVA 4ASIA 3U9SB 1WDLA 4LK5A 3PGQA 3Q0GA 4JCQA 3TV5A 4MI2A 3RSTA 2DUBA 1WDMA 3PE8A 2ZL0A 5JBXA 1J7XA 4FNBA 5FUSA 2VREA 4EMMA 3HRXA 1Y7OA 3ZW8A 4IZDA 5DL1A 3IAVA 4QFEA 3V5EA 5DZKA 1MJ3A 2F9YA 1XX4A 2ZL3A 1YG8A 2VSUE 3M6MA 3U9TB 4ZDFA 2WTBA 1UYTA 3L3SA 1RJNA 2FBMA 3T3WA 3PEAA 4JCRA 3TVUA 4HC8A 3STAA 3OC7A 1UYRA 1XNYA 3BEZA 3QK8A 3G64A 4QIIA 4B3HA 4FZWC 4FJWD 3R9TA 2X24A 4KD6A 1VRGA 5INIA 4U0GA 4JCSA 4K2NA 2Q34A 4JVTA 1NZYA 1UYVA 2EJ5A 3SWXA 5E0SA 4QIJA 5DU8A 4JJTA 2QQ3A 4EMLA 4NEKA 3OT6A 2FW2A 4ZDBA 5KJPA 3KQFA 1PJHA 5DTWA 3H0QA 3GF7A 2Q35A 1XNWA 2NP9A 2VSUA 3Q7HA 5G1QA 2BZRA 4RYFA 3QYRA 3I47A 3TZ3A 1TYFA 4DI1A 3ZW9A 3RSIA 1K39A 5MGBA 4JSBA 3H02A 3MT6A 5KDRA 4FN7A 4OG1A 3LKEA 2ZQRA 2VSSF 4L6WA 4I42A 3P5MA 4ZDCA 1FC6A 3RRVA 1X0UA 3R9SA 2C8TA 1FCFA 3R9QA 2VX2A 2PPYA 2A81A 3JU1A 1HNUA 2VSUC 1NZYB 3GF3A 2VSUF 3MOYA 3FF6A 4JWVA 1OD2A 5FIFA 5DU4A 3QXIA 4ELWA 3QREA 1PIXA 3K50A 1HNOA 4MXIA 4MOUA 5IKLB 4U18A 3DJAA 1XO6A 1Q52A 4WCZA 1N6EA 2F9YB 2F9IA 2Q2XA 3QMJA 3KTIA 1HZDA 1UIYA 4FNDA 4JFCA 3H0UA 4ELSA 1UYSA 5DKPA 3K8XA 4IZCA 5C9GA 2J5II 5CTBA 2VSSE 2ZL2A 3TRRA 2F6IA 2DEOA 3MYBA 4ZDEA 5G1RA 5DUFA 4WZ8B 2W3PA 3T8BA 1N6DA 5DZKH 1ON9A 1WZ8A 3U9RB 2CBYA 1TG6A 4RYFH 5DUCA 5INGA 4Q1IA 4I52A 4JYJA 4B3IA 4OLQA 3TT7A 5DTPA 3T88A 3V5IA 2UZFA 2A7KA 5E0SH 5INFA 5CTCA 3BPPA 3BF0A 1EY3A 4L8KA 3PZKA 4JOTA 3TT6A 2J5GD 3QKAA 3IBBA 3SLLA 1OD4A 4HNKA 2ZQQA 4ZDDA 2A7SA 4I4ZA 4Q0GA 3R6HA 3HLN1 1YG6A 2ZL4A 4ELXA 4KNPA 1Q51A 3ZWBA 3OMEA 4KWBA 3TLFA 5DU6A 4FN8A 3ZWAA 3ST9A 4U19A 2F6QA 3MFMA 3T89A 4K3WA 3Q1TA 3QXZA 5E0NX 3N6RB 3ZWCA 3T8AA 2D3TA 2J5SA 3KTJA 5KDRB 3H0JA 1JXZA 4JYLA 2J5IA 3R0OA 1DUBA 1EF9A 2PBPA 3GKBA 3FDUA 4NNQA 2GTRA 3GMAA 4WYOB 3ISAA 4GHNA 3IB9A 4Z0MA 3VIVA 3HP0A 5C90A 2IEXA 3M6NA 3TVWA 4ZU2A 3Q0JA 4RCNA 4U0GH 1O8UA 4K29A 1DCIA 4G2RA 1K32A 3TDCA 1FC7A 4IZBA 4GM2A 3HE2A 3DORA 3H81A
chains in the Genus database with same CATH superfamily
3LAOA 1FC9A 2FZSA 1N6FA 4KPKA 3QWDA 3NJBA 3WG5A 3NJDA 3GLMA 1SZOA 2CE3A 5G1SA 1ON3A 3KTHA 3KTKA 4OMRA 4F47A 5JBWA 4U1AA 1EF8A 3P2LA 4YLHA 1SG4A 3H0SA 4JCTA 1RJMA 1WDKA 2X58A 2F9IB 2YJGA 4FZWA 3KTGA 4U0HA 3HINA 2J5GA 1W2XA 2PG8A 2J5IB 4FB8A 2HW5A 3P85A 4EMPA 2VSSA 4B3JA 1XNVA 4ASIA 3U9SB 1WDLA 4LK5A 3PGQA 3Q0GA 4JCQA 3TV5A 4MI2A 3RSTA 2DUBA 1WDMA 3PE8A 2ZL0A 5JBXA 1J7XA 4FNBA 5FUSA 2VREA 4EMMA 3HRXA 1Y7OA 3ZW8A 4IZDA 5DL1A 3IAVA 4QFEA 3V5EA 5DZKA 1MJ3A 2F9YA 1XX4A 2ZL3A 1YG8A 2VSUE 4HDTA 3M6MA 3U9TB 4ZDFA 2WTBA 1UYTA 3L3SA 1RJNA 2FBMA 3T3WA 3PEAA 4JCRA 3TVUA 4HC8A 3STAA 3OC7A 1UYRA 1XNYA 3BEZA 3QK8A 3G64A 4QIIA 4B3HA 4FZWC 4FJWD 3R9TA 2X24A 4KD6A 3BPTA 1VRGA 5INIA 4U0GA 4JCSA 4K2NA 2Q34A 4JVTA 1NZYA 1UYVA 2EJ5A 3SWXA 5E0SA 4QIJA 5DU8A 4JJTA 2QQ3A 4EMLA 4NEKA 3OT6A 2FW2A 4ZDBA 5KJPA 3KQFA 1PJHA 5DTWA 3H0QA 3GF7A 2Q35A 1XNWA 2NP9A 2VSUA 3Q7HA 5G1QA 2BZRA 4RYFA 3QYRA 3I47A 3TZ3A 1TYFA 4DI1A 3ZW9A 3RSIA 1K39A 5MGBA 4JSBA 3H02A 3MT6A 5KDRA 4FN7A 4OG1A 3LKEA 2ZQRA 2VSSF 4L6WA 4I42A 3P5MA 4ZDCA 1FC6A 3RRVA 1X0UA 3R9SA 2C8TA 1FCFA 3R9QA 2VX2A 2PPYA 2A81A 3JU1A 1HNUA 5HUQA 2VSUC 1NZYB 3GF3A 2VSUF 3MOYA 3FF6A 4JWVA 1OD2A 5FIFA 5DU4A 3QXIA 4ELWA 3QREA 1PIXA 3K50A 1HNOA 4MXIA 4MOUA 5IKLB 4U18A 3DJAA 1XO6A 1Q52A 4WCZA 1N6EA 2F9YB 2F9IA 2Q2XA 3QMJA 3KTIA 1HZDA 1UIYA 4FNDA 4JFCA 3H0UA 4ELSA 1UYSA 5DKPA 3K8XA 4IZCA 5C9GA 2J5II 5CTBA 2VSSE 2ZL2A 3TRRA 2F6IA 2DEOA 3MYBA 4ZDEA 5G1RA 5DUFA 4WZ8B 2W3PA 3T8BA 1N6DA 5DZKH 1ON9A 1WZ8A 3U9RB 2CBYA 1TG6A 4RYFH 5DUCA 5INGA 4Q1IA 4I52A 4JYJA 4B3IA 4OLQA 3TT7A 5DTPA 3T88A 3V5IA 2UZFA 2A7KA 5E0SH 5INFA 5CTCA 3BPPA 3BF0A 1EY3A 4L8KA 3PZKA 4JOTA 3TT6A 2J5GD 3QKAA 3IBBA 3SLLA 1OD4A 4HNKA 2ZQQA 4ZDDA 2A7SA 4I4ZA 4Q0GA 3R6HA 3HLN1 1YG6A 2ZL4A 4ELXA 4KNPA 1Q51A 3ZWBA 3OMEA 4KWBA 3TLFA 5DU6A 4FN8A 3ZWAA 3ST9A 4U19A 2F6QA 3MFMA 4J2UA 3T89A 4K3WA 3Q1TA 3QXZA 5E0NX 3N6RB 3ZWCA 3T8AA 4NARA 2D3TA 2J5SA 3KTJA 5KDRB 3H0JA 1JXZA 4JYLA 2J5IA 3R0OA 1DUBA 1EF9A 2PBPA 3GKBA 3FDUA 4NNQA 2GTRA 3GMAA 4WYOB 3ISAA 4GHNA 3IB9A 4Z0MA 3VIVA 3HP0A 5C90A 2IEXA 3M6NA 3TVWA 4ZU2A 3Q0JA 4RCNA 4U0GH 1O8UA 4K29A 1DCIA 4G2RA 1K32A 3TDCA 1FC7A 4IZBA 4GM2A 3HE2A 3DORA 3H81A
chains in the Genus database with same CATH topology
3LAOA 1FC9A 2FZSA 1N6FA 4KPKA 3QWDA 3NJBA 3WG5A 3NJDA 3GLMA 1SZOA 2CE3A 5G1SA 1ON3A 3KTHA 3KTKA 4OMRA 4F47A 5JBWA 4U1AA 1EF8A 3P2LA 4YLHA 1SG4A 3H0SA 4JCTA 1RJMA 1WDKA 2X58A 2F9IB 2YJGA 4FZWA 3KTGA 4U0HA 3HINA 2J5GA 1W2XA 2PG8A 2J5IB 4FB8A 2HW5A 3P85A 4EMPA 2VSSA 4B3JA 1XNVA 4ASIA 3U9SB 1WDLA 4LK5A 3PGQA 3Q0GA 4JCQA 3TV5A 4MI2A 3RSTA 2DUBA 1WDMA 3PE8A 2ZL0A 5JBXA 1J7XA 4FNBA 5FUSA 2VREA 4EMMA 3HRXA 1Y7OA 3ZW8A 4IZDA 5DL1A 3IAVA 4QFEA 3V5EA 5DZKA 1MJ3A 2F9YA 1XX4A 2ZL3A 1YG8A 2VSUE 4HDTA 3M6MA 3U9TB 4ZDFA 2WTBA 1UYTA 3L3SA 1RJNA 2FBMA 3T3WA 3PEAA 4JCRA 3TVUA 4HC8A 3STAA 3OC7A 1UYRA 1XNYA 3BEZA 3QK8A 3G64A 4QIIA 4B3HA 4FZWC 4FJWD 3R9TA 2X24A 4KD6A 3BPTA 1VRGA 5INIA 4U0GA 4JCSA 4K2NA 2Q34A 4JVTA 1NZYA 1UYVA 2EJ5A 3SWXA 5E0SA 4QIJA 5DU8A 4JJTA 2QQ3A 4EMLA 4NEKA 3OT6A 2FW2A 4ZDBA 5KJPA 3KQFA 1PJHA 5DTWA 3H0QA 3GF7A 2Q35A 1XNWA 2NP9A 2VSUA 3Q7HA 5G1QA 2BZRA 4RYFA 3QYRA 3I47A 3TZ3A 1TYFA 4DI1A 3ZW9A 3RSIA 1K39A 5MGBA 4JSBA 3H02A 3MT6A 5KDRA 4FN7A 4OG1A 3LKEA 2ZQRA 2VSSF 4L6WA 4I42A 3P5MA 4ZDCA 1FC6A 3RRVA 1X0UA 3R9SA 2C8TA 1FCFA 3R9QA 2VX2A 2PPYA 2A81A 3JU1A 1HNUA 5HUQA 2VSUC 1NZYB 3GF3A 2VSUF 3MOYA 3FF6A 4JWVA 1OD2A 5FIFA 5DU4A 3QXIA 4ELWA 3QREA 1PIXA 3K50A 1HNOA 4MXIA 4MOUA 5IKLB 4U18A 3DJAA 1XO6A 1Q52A 4WCZA 1N6EA 2F9YB 2F9IA 2Q2XA 3QMJA 3KTIA 1HZDA 1UIYA 4FNDA 4JFCA 3H0UA 4ELSA 1UYSA 5DKPA 3K8XA 4IZCA 5C9GA 2J5II 5CTBA 2VSSE 2ZL2A 3TRRA 2F6IA 2DEOA 3MYBA 4ZDEA 5G1RA 5DUFA 4WZ8B 2W3PA 3T8BA 1N6DA 5DZKH 1ON9A 1WZ8A 3U9RB 2CBYA 1TG6A 4RYFH 5DUCA 5INGA 4Q1IA 4I52A 4JYJA 4B3IA 4OLQA 3TT7A 5DTPA 3T88A 3V5IA 2UZFA 2A7KA 5E0SH 5INFA 5CTCA 3BPPA 3BF0A 1EY3A 4L8KA 3PZKA 4JOTA 3TT6A 2J5GD 3QKAA 3IBBA 3SLLA 1OD4A 4HNKA 2ZQQA 4ZDDA 2A7SA 4I4ZA 4Q0GA 3R6HA 3HLN1 1YG6A 2ZL4A 4ELXA 4KNPA 1Q51A 3ZWBA 3OMEA 4KWBA 3TLFA 5DU6A 4FN8A 3ZWAA 3ST9A 4U19A 2F6QA 3MFMA 4J2UA 3T89A 4K3WA 3Q1TA 3QXZA 5E0NX 3N6RB 3ZWCA 3T8AA 4NARA 2D3TA 2J5SA 3KTJA 5KDRB 3H0JA 1JXZA 4JYLA 2J5IA 3R0OA 1DUBA 1EF9A 2PBPA 3GKBA 3FDUA 4NNQA 2GTRA 3GMAA 4WYOB 3ISAA 4GHNA 3IB9A 4Z0MA 3VIVA 3HP0A 5C90A 2IEXA 3M6NA 3TVWA 4ZU2A 3Q0JA 4RCNA 4U0GH 1O8UA 4K29A 1DCIA 4G2RA 1K32A 3TDCA 1FC7A 4IZBA 4GM2A 3HE2A 3DORA 3H81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAO A;  1FC9 A;  2FZS A;  1N6F A;  4KPK A;  3QWD A;  3NJB A;  3WG5 A;  3NJD A;  3GLM A;  1SZO A;  2CE3 A;  5G1S A;  1ON3 A;  3KTH A;  3KTK A;  4OMR A;  4F47 A;  5JBW A;  4U1A A;  1EF8 A;  3P2L A;  4YLH A;  1SG4 A;  3H0S A;  4JCT A;  1RJM A;  1WDK A;  2X58 A;  2F9I B;  4FZW A;  3KTG A;  4U0H A;  3HIN A;  2J5G A;  1W2X A;  2PG8 A;  2J5I B;  4FB8 A;  2HW5 A;  3P85 A;  4EMP A;  2VSS A;  4B3J A;  1XNV A;  4ASI A;  3U9S B;  1WDL A;  4LK5 A;  3PGQ A;  3Q0G A;  4JCQ A;  3TV5 A;  4MI2 A;  3RST A;  2DUB A;  1WDM A;  3PE8 A;  2ZL0 A;  5JBX A;  1J7X A;  4FNB A;  5FUS A;  2VRE A;  4EMM A;  3HRX A;  1Y7O A;  3ZW8 A;  4IZD A;  5DL1 A;  3IAV A;  4QFE A;  3V5E A;  5DZK A;  1MJ3 A;  2F9Y A;  1XX4 A;  2ZL3 A;  1YG8 A;  2VSU E;  3M6M A;  3U9T B;  4ZDF A;  2WTB A;  1UYT A;  3L3S A;  1RJN A;  2FBM A;  3T3W A;  3PEA A;  4JCR A;  3TVU A;  4HC8 A;  3STA A;  3OC7 A;  1UYR A;  1XNY A;  3BEZ A;  3QK8 A;  3G64 A;  4QII A;  4B3H A;  4FZW C;  4FJW D;  3R9T A;  2X24 A;  4KD6 A;  1VRG A;  5INI A;  4U0G A;  4JCS A;  4K2N A;  2Q34 A;  4JVT A;  1NZY A;  1UYV A;  2EJ5 A;  3SWX A;  5E0S A;  4QIJ A;  5DU8 A;  4JJT A;  2QQ3 A;  4EML A;  4NEK A;  3OT6 A;  2FW2 A;  4ZDB A;  5KJP A;  3KQF A;  1PJH A;  5DTW A;  3H0Q A;  3GF7 A;  2Q35 A;  1XNW A;  2NP9 A;  2VSU A;  3Q7H A;  5G1Q A;  2BZR A;  4RYF A;  3QYR A;  3I47 A;  3TZ3 A;  1TYF A;  4DI1 A;  3ZW9 A;  3RSI A;  1K39 A;  5MGB A;  4JSB A;  3H02 A;  3MT6 A;  5KDR A;  4FN7 A;  4OG1 A;  3LKE A;  2ZQR A;  2VSS F;  4L6W A;  4I42 A;  3P5M A;  4ZDC A;  1FC6 A;  3RRV A;  1X0U A;  3R9S A;  2C8T A;  1FCF A;  3R9Q A;  2VX2 A;  2PPY A;  2A81 A;  3JU1 A;  1HNU A;  2VSU C;  1NZY B;  3GF3 A;  2VSU F;  3MOY A;  3FF6 A;  4JWV A;  1OD2 A;  5FIF A;  5DU4 A;  3QXI A;  4ELW A;  3QRE A;  1PIX A;  3K50 A;  1HNO A;  4MXI A;  4MOU A;  5IKL B;  4U18 A;  3DJA A;  1XO6 A;  1Q52 A;  4WCZ A;  1N6E A;  2F9Y B;  2F9I A;  2Q2X A;  3QMJ A;  3KTI A;  1HZD A;  1UIY A;  4FND A;  4JFC A;  3H0U A;  4ELS A;  1UYS A;  5DKP A;  3K8X A;  4IZC A;  5C9G A;  2J5I I;  5CTB A;  2VSS E;  2ZL2 A;  3TRR A;  2F6I A;  2DEO A;  3MYB A;  4ZDE A;  5G1R A;  5DUF A;  4WZ8 B;  2W3P A;  3T8B A;  1N6D A;  5DZK H;  1ON9 A;  1WZ8 A;  3U9R B;  2CBY A;  1TG6 A;  4RYF H;  5DUC A;  5ING A;  4Q1I A;  4I52 A;  4JYJ A;  4B3I A;  4OLQ A;  3TT7 A;  5DTP A;  3T88 A;  3V5I A;  2UZF A;  2A7K A;  5E0S H;  5INF A;  5CTC A;  3BPP A;  3BF0 A;  1EY3 A;  4L8K A;  3PZK A;  4JOT A;  3TT6 A;  2J5G D;  3QKA A;  3IBB A;  3SLL A;  1OD4 A;  4HNK A;  2ZQQ A;  4ZDD A;  2A7S A;  4I4Z A;  4Q0G A;  3R6H A;  3HLN 1;  1YG6 A;  2ZL4 A;  4ELX A;  4KNP A;  1Q51 A;  3ZWB A;  3OME A;  4KWB A;  3TLF A;  5DU6 A;  4FN8 A;  3ZWA A;  3ST9 A;  4U19 A;  2F6Q A;  3MFM A;  3T89 A;  4K3W A;  3Q1T A;  3QXZ A;  5E0N X;  3N6R B;  3ZWC A;  3T8A A;  2D3T A;  2J5S A;  3KTJ A;  5KDR B;  3H0J A;  1JXZ A;  4JYL A;  2J5I A;  3R0O A;  1DUB A;  1EF9 A;  2PBP A;  3GKB A;  3FDU A;  4NNQ A;  2GTR A;  3GMA A;  4WYO B;  3ISA A;  4GHN A;  3IB9 A;  4Z0M A;  3VIV A;  3HP0 A;  5C90 A;  2IEX A;  3M6N A;  3TVW A;  4ZU2 A;  3Q0J A;  4RCN A;  4U0G H;  1O8U A;  4K29 A;  1DCI A;  4G2R A;  1K32 A;  3TDC A;  1FC7 A;  4IZB A;  4GM2 A;  3HE2 A;  3DOR A;  3H81 A; 
#chains in the Genus database with same CATH topology
 3LAO A;  1FC9 A;  2FZS A;  1N6F A;  4KPK A;  3QWD A;  3NJB A;  3WG5 A;  3NJD A;  3GLM A;  1SZO A;  2CE3 A;  5G1S A;  1ON3 A;  3KTH A;  3KTK A;  4OMR A;  4F47 A;  5JBW A;  4U1A A;  1EF8 A;  3P2L A;  4YLH A;  1SG4 A;  3H0S A;  4JCT A;  1RJM A;  1WDK A;  2X58 A;  2F9I B;  2YJG A;  4FZW A;  3KTG A;  4U0H A;  3HIN A;  2J5G A;  1W2X A;  2PG8 A;  2J5I B;  4FB8 A;  2HW5 A;  3P85 A;  4EMP A;  2VSS A;  4B3J A;  1XNV A;  4ASI A;  3U9S B;  1WDL A;  4LK5 A;  3PGQ A;  3Q0G A;  4JCQ A;  3TV5 A;  4MI2 A;  3RST A;  2DUB A;  1WDM A;  3PE8 A;  2ZL0 A;  5JBX A;  1J7X A;  4FNB A;  5FUS A;  2VRE A;  4EMM A;  3HRX A;  1Y7O A;  3ZW8 A;  4IZD A;  5DL1 A;  3IAV A;  4QFE A;  3V5E A;  5DZK A;  1MJ3 A;  2F9Y A;  1XX4 A;  2ZL3 A;  1YG8 A;  2VSU E;  4HDT A;  3M6M A;  3U9T B;  4ZDF A;  2WTB A;  1UYT A;  3L3S A;  1RJN A;  2FBM A;  3T3W A;  3PEA A;  4JCR A;  3TVU A;  4HC8 A;  3STA A;  3OC7 A;  1UYR A;  1XNY A;  3BEZ A;  3QK8 A;  3G64 A;  4QII A;  4B3H A;  4FZW C;  4FJW D;  3R9T A;  2X24 A;  4KD6 A;  3BPT A;  1VRG A;  5INI A;  4U0G A;  4JCS A;  4K2N A;  2Q34 A;  4JVT A;  1NZY A;  1UYV A;  2EJ5 A;  3SWX A;  5E0S A;  4QIJ A;  5DU8 A;  4JJT A;  2QQ3 A;  4EML A;  4NEK A;  3OT6 A;  2FW2 A;  4ZDB A;  5KJP A;  3KQF A;  1PJH A;  5DTW A;  3H0Q A;  3GF7 A;  2Q35 A;  1XNW A;  2NP9 A;  2VSU A;  3Q7H A;  5G1Q A;  2BZR A;  4RYF A;  3QYR A;  3I47 A;  3TZ3 A;  1TYF A;  4DI1 A;  3ZW9 A;  3RSI A;  1K39 A;  5MGB A;  4JSB A;  3H02 A;  3MT6 A;  5KDR A;  4FN7 A;  4OG1 A;  3LKE A;  2ZQR A;  2VSS F;  4L6W A;  4I42 A;  3P5M A;  4ZDC A;  1FC6 A;  3RRV A;  1X0U A;  3R9S A;  2C8T A;  1FCF A;  3R9Q A;  2VX2 A;  2PPY A;  2A81 A;  3JU1 A;  1HNU A;  5HUQ A;  2VSU C;  1NZY B;  3GF3 A;  2VSU F;  3MOY A;  3FF6 A;  4JWV A;  1OD2 A;  5FIF A;  5DU4 A;  3QXI A;  4ELW A;  3QRE A;  1PIX A;  3K50 A;  1HNO A;  4MXI A;  4MOU A;  5IKL B;  4U18 A;  3DJA A;  1XO6 A;  1Q52 A;  4WCZ A;  1N6E A;  2F9Y B;  2F9I A;  2Q2X A;  3QMJ A;  3KTI A;  1HZD A;  1UIY A;  4FND A;  4JFC A;  3H0U A;  4ELS A;  1UYS A;  5DKP A;  3K8X A;  4IZC A;  5C9G A;  2J5I I;  5CTB A;  2VSS E;  2ZL2 A;  3TRR A;  2F6I A;  2DEO A;  3MYB A;  4ZDE A;  5G1R A;  5DUF A;  4WZ8 B;  2W3P A;  3T8B A;  1N6D A;  5DZK H;  1ON9 A;  1WZ8 A;  3U9R B;  2CBY A;  1TG6 A;  4RYF H;  5DUC A;  5ING A;  4Q1I A;  4I52 A;  4JYJ A;  4B3I A;  4OLQ A;  3TT7 A;  5DTP A;  3T88 A;  3V5I A;  2UZF A;  2A7K A;  5E0S H;  5INF A;  5CTC A;  3BPP A;  3BF0 A;  1EY3 A;  4L8K A;  3PZK A;  4JOT A;  3TT6 A;  2J5G D;  3QKA A;  3IBB A;  3SLL A;  1OD4 A;  4HNK A;  2ZQQ A;  4ZDD A;  2A7S A;  4I4Z A;  4Q0G A;  3R6H A;  3HLN 1;  1YG6 A;  2ZL4 A;  4ELX A;  4KNP A;  1Q51 A;  3ZWB A;  3OME A;  4KWB A;  3TLF A;  5DU6 A;  4FN8 A;  3ZWA A;  3ST9 A;  4U19 A;  2F6Q A;  3MFM A;  4J2U A;  3T89 A;  4K3W A;  3Q1T A;  3QXZ A;  5E0N X;  3N6R B;  3ZWC A;  3T8A A;  4NAR A;  2D3T A;  2J5S A;  3KTJ A;  5KDR B;  3H0J A;  1JXZ A;  4JYL A;  2J5I A;  3R0O A;  1DUB A;  1EF9 A;  2PBP A;  3GKB A;  3FDU A;  4NNQ A;  2GTR A;  3GMA A;  4WYO B;  3ISA A;  4GHN A;  3IB9 A;  4Z0M A;  3VIV A;  3HP0 A;  5C90 A;  2IEX A;  3M6N A;  3TVW A;  4ZU2 A;  3Q0J A;  4RCN A;  4U0G H;  1O8U A;  4K29 A;  1DCI A;  4G2R A;  1K32 A;  3TDC A;  1FC7 A;  4IZB A;  4GM2 A;  3HE2 A;  3DOR A;  3H81 A; 
#chains in the Genus database with same CATH homology
 3LAO A;  1FC9 A;  2FZS A;  1N6F A;  4KPK A;  3QWD A;  3NJB A;  3WG5 A;  3NJD A;  3GLM A;  1SZO A;  2CE3 A;  5G1S A;  1ON3 A;  3KTH A;  3KTK A;  4OMR A;  4F47 A;  5JBW A;  4U1A A;  1EF8 A;  3P2L A;  4YLH A;  1SG4 A;  3H0S A;  4JCT A;  1RJM A;  1WDK A;  2X58 A;  2F9I B;  2YJG A;  4FZW A;  3KTG A;  4U0H A;  3HIN A;  2J5G A;  1W2X A;  2PG8 A;  2J5I B;  4FB8 A;  2HW5 A;  3P85 A;  4EMP A;  2VSS A;  4B3J A;  1XNV A;  4ASI A;  3U9S B;  1WDL A;  4LK5 A;  3PGQ A;  3Q0G A;  4JCQ A;  3TV5 A;  4MI2 A;  3RST A;  2DUB A;  1WDM A;  3PE8 A;  2ZL0 A;  5JBX A;  1J7X A;  4FNB A;  5FUS A;  2VRE A;  4EMM A;  3HRX A;  1Y7O A;  3ZW8 A;  4IZD A;  5DL1 A;  3IAV A;  4QFE A;  3V5E A;  5DZK A;  1MJ3 A;  2F9Y A;  1XX4 A;  2ZL3 A;  1YG8 A;  2VSU E;  4HDT A;  3M6M A;  3U9T B;  4ZDF A;  2WTB A;  1UYT A;  3L3S A;  1RJN A;  2FBM A;  3T3W A;  3PEA A;  4JCR A;  3TVU A;  4HC8 A;  3STA A;  3OC7 A;  1UYR A;  1XNY A;  3BEZ A;  3QK8 A;  3G64 A;  4QII A;  4B3H A;  4FZW C;  4FJW D;  3R9T A;  2X24 A;  4KD6 A;  3BPT A;  1VRG A;  5INI A;  4U0G A;  4JCS A;  4K2N A;  2Q34 A;  4JVT A;  1NZY A;  1UYV A;  2EJ5 A;  3SWX A;  5E0S A;  4QIJ A;  5DU8 A;  4JJT A;  2QQ3 A;  4EML A;  4NEK A;  3OT6 A;  2FW2 A;  4ZDB A;  5KJP A;  3KQF A;  1PJH A;  5DTW A;  3H0Q A;  3GF7 A;  2Q35 A;  1XNW A;  2NP9 A;  2VSU A;  3Q7H A;  5G1Q A;  2BZR A;  4RYF A;  3QYR A;  3I47 A;  3TZ3 A;  1TYF A;  4DI1 A;  3ZW9 A;  3RSI A;  1K39 A;  5MGB A;  4JSB A;  3H02 A;  3MT6 A;  5KDR A;  4FN7 A;  4OG1 A;  3LKE A;  2ZQR A;  2VSS F;  4L6W A;  4I42 A;  3P5M A;  4ZDC A;  1FC6 A;  3RRV A;  1X0U A;  3R9S A;  2C8T A;  1FCF A;  3R9Q A;  2VX2 A;  2PPY A;  2A81 A;  3JU1 A;  1HNU A;  5HUQ A;  2VSU C;  1NZY B;  3GF3 A;  2VSU F;  3MOY A;  3FF6 A;  4JWV A;  1OD2 A;  5FIF A;  5DU4 A;  3QXI A;  4ELW A;  3QRE A;  1PIX A;  3K50 A;  1HNO A;  4MXI A;  4MOU A;  5IKL B;  4U18 A;  3DJA A;  1XO6 A;  1Q52 A;  4WCZ A;  1N6E A;  2F9Y B;  2F9I A;  2Q2X A;  3QMJ A;  3KTI A;  1HZD A;  1UIY A;  4FND A;  4JFC A;  3H0U A;  4ELS A;  1UYS A;  5DKP A;  3K8X A;  4IZC A;  5C9G A;  2J5I I;  5CTB A;  2VSS E;  2ZL2 A;  3TRR A;  2F6I A;  2DEO A;  3MYB A;  4ZDE A;  5G1R A;  5DUF A;  4WZ8 B;  2W3P A;  3T8B A;  1N6D A;  5DZK H;  1ON9 A;  1WZ8 A;  3U9R B;  2CBY A;  1TG6 A;  4RYF H;  5DUC A;  5ING A;  4Q1I A;  4I52 A;  4JYJ A;  4B3I A;  4OLQ A;  3TT7 A;  5DTP A;  3T88 A;  3V5I A;  2UZF A;  2A7K A;  5E0S H;  5INF A;  5CTC A;  3BPP A;  3BF0 A;  1EY3 A;  4L8K A;  3PZK A;  4JOT A;  3TT6 A;  2J5G D;  3QKA A;  3IBB A;  3SLL A;  1OD4 A;  4HNK A;  2ZQQ A;  4ZDD A;  2A7S A;  4I4Z A;  4Q0G A;  3R6H A;  3HLN 1;  1YG6 A;  2ZL4 A;  4ELX A;  4KNP A;  1Q51 A;  3ZWB A;  3OME A;  4KWB A;  3TLF A;  5DU6 A;  4FN8 A;  3ZWA A;  3ST9 A;  4U19 A;  2F6Q A;  3MFM A;  4J2U A;  3T89 A;  4K3W A;  3Q1T A;  3QXZ A;  5E0N X;  3N6R B;  3ZWC A;  3T8A A;  4NAR A;  2D3T A;  2J5S A;  3KTJ A;  5KDR B;  3H0J A;  1JXZ A;  4JYL A;  2J5I A;  3R0O A;  1DUB A;  1EF9 A;  2PBP A;  3GKB A;  3FDU A;  4NNQ A;  2GTR A;  3GMA A;  4WYO B;  3ISA A;  4GHN A;  3IB9 A;  4Z0M A;  3VIV A;  3HP0 A;  5C90 A;  2IEX A;  3M6N A;  3TVW A;  4ZU2 A;  3Q0J A;  4RCN A;  4U0G H;  1O8U A;  4K29 A;  1DCI A;  4G2R A;  1K32 A;  3TDC A;  1FC7 A;  4IZB A;  4GM2 A;  3HE2 A;  3DOR A;  3H81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...