4GM6A

Crystal structure of pfkb family carbohydrate kinase(target efi-502146 from listeria grayi dsm 20601
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
320
structure length
320
Chain Sequence
KQVVTIGELLMRLSTQQGIPFSQTTALDIHIGGAEANVAVNLSKLGHPTRIATVVPANPIGKMAVEHLWRHQVDTAFVVEAGDRLGTYYLESGTALKAPSVVYDRQHSSFARHKSMDWDLSELLKGIRVLHVSGITIALSTFWLEMVVKIIREAKRNGIKISFDMNYRAKLWELEAAKRAYQQLLPLVDYCSAGQMDAVAFFEISSETTDYYQAMHDKYPNIELFYATKRTVISASHHLLQGHLWTQGECWESEEYAIYPIVDRVGGGDAYTAAVLHGILSEWRPDETVKFATAAAGLKHSIHGDINPFDEKTIADFAAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PfkB family carbohydrate kinase FROM Listeria grayi
rcsb
source organism Listeria grayi dsm 20601
molecule tags Transferase
molecule keywords PfkB family carbohydrate kinase
total genus 105
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4gm6A00
1LIJA 3RRBA 2AX3A 2HLZA 3RU2A 4C5JA 3K5WA 3QA2A 3RTCA 3RQHA 1TYYA 2PKMA 1BX4A 3W4SA 4C5LA 3NL6A 2JG1A 4C5MA 5CGAA 2AFBA 3I3YA 3LKIA 3VAQA 2C49A 3NBVA 5BYDA 3NL2A 3RSSA 4GM6A 4E8ZA 3H74A 3NCAA 3RSGA 3RTAA 1YGJA 2YXTA 4YWRA 4XF6A 5COJA 3VASA 4EN4A 2AJRA 5BYEA 5C40A 3UBOA 1L2LA 2A9YA 3RM5A 1LIOA 1LIIA 3RTGA 4KADA 3IKHA 3UMPA 4WJMA 3RQXA 3LOOA 3UMOA 4DC3A 3NM1A 4LBGA 3GBUA 4N09A 4E3AA 4KAHA 2R3EA 5F0ZA 4DU5A 1VI9A 5CM5A 4S1IA 3HPDA 3RSQA 2AWDA 3IE7A 3RT7A 3RTBA 3DRWA 2C4EA 3MBJA 4KBEA 4EUMA 2RBCA 3RQ5A 2I5BA 2R3BA 3IBQA 4EBUA 4XDAA 3H49A 4KANA 3NBWA 3PZSA 4E8WA 2I6AA 3RS9A 3NL3A 1RFTA 3GO7A 4K8TA 4UBEA 4E8YA 1LIKA 3BF5A 1GC5A 1V19A 4S1IB 4B8SA 1GQTA 2PKNA 3OTXA 1VK4A 4LCAA 2F7KA 3RT9A 3RU3A 3UQ9A 3MBHA 3RRJA 4E84A 3FHYA 1RK2A 1TZ6A 3NC9A 3LJSA 2QHPA 3PL2A 3Q1YA 4C5NA 3RY7A 5C3ZA 2QCVA 3BGKA 3K9EA 2ABQA 1ESQA 1WYEA 3QAIA 4B8RA 4EOHA 1TZ3A 3RSFA 1VM7A 3DZVA 3LHXA 1YHJA 3GO6A 3UQDA 4U7XA 2PKFA 4O1GA 3FHXA 1V1AA 5EY7A 3RQ8A 2NWHA 2JGVA 4JKSA 3RQ2A 5BYCA 3RREA 2AA0A 3B1OA 3KTNA 1JXHA 5B6AA 1RKSA 2XTBA 4S1MA 3NL5A 3RPZA 3EWMA 3RTDA 1RKAA 3RPHA 3CQDA 1RFVA 2YXUA 3RO4A 4K9CA 1ESJA 4XCKA 3NC2A 4KALA 3NM3A 3JULA 2A9ZA 4XF7A 3RQ6A 3B3LA 2V78A 2PKKA 4N08A 2DDWA 2Q5RA 1UB0A 4S1HA 2FV7A 5F11A 3B1PA 3KEUA 3RTEA 3B1NA 4K8PA 2I6BA 2ABSA 4LC4A 3RQQA 3KD6A 4C5KA 4YL5A 3B1QA 3RRFA 1V1BA 3KZHA 5BYFA 2AJPA 5CGEA 4JJPA 2JG5A 1LHPA 3N1CA 5TRWA 5C3YA 5C41A 1EKQA 3ZS7A 5TQIA 4PVVA 3IQ0A 4K8CA 2AB8A 1DGMA 1V1SA 1KYHA 2DCNA 2VARA 4JKUA 3HYOA 4O1LA 1YGKA 2HW1A 4K8KA 3IN1A 4K9IA 3UQ6A 1RKDA 4LBXA 3Q92A 1RFUA 2DDOA 4X8FA 3IH0A 3RS8A 4E69A 1U2XA 3B1RA 4K93A 2F02A 1EKKA 1LHRA 3UQEA 3HICA 2HQQA 2DDMA 1TD2A 5EYNA 1C3QA 1UA4A 1JXIA
chains in the Genus database with same CATH superfamily
1LIJA 3RRBA 2AX3A 3UAGA 2HLZA 3RU2A 4C5JA 4HV4A 3K5WA 3QA2A 3RTCA 3RQHA 4UAGA 1TYYA 4BUCA 2PKMA 1BX4A 1W7KA 1UAGA 3W4SA 4C5LA 3NL6A 2JG1A 2Y66A 4C12A 2AFBA 4C5MA 3I3YA 5CGAA 3LKIA 3VAQA 2C49A 2GC6A 3NBVA 5BYDA 3NL2A 3RSSA 3NRSA 4GM6A 3H74A 2X5OA 3NCAA 4E8ZA 5C40A 3RSGA 3RTAA 1YGJA 2YXTA 3PYZA 4YWRA 4XF6A 5COJA 3VASA 4EN4A 2AJRA 2JFHA 1J6UA 3UBOA 3ZM5A 1L2LA 2A9YA 3RM5A 5BYEA 1LIOA 1LIIA 2Y1OA 3RTGA 4KADA 3IKHA 3UMPA 4WJMA 3RQXA 2GCAA 3LOOA 3UMOA 4DC3A 2F00A 3NM1A 4LBGA 3GBUA 4N09A 4E3AA 4KAHA 2R3EA 5F0ZA 4DU5A 1GQYA 1VI9A 5CM5A 4S1IA 3HPDA 3RSQA 4CVLA 2AWDA 1JBWA 3IE7A 3RT7A 3RTBA 2Y67A 5C3ZA 2UAGA 3DRWA 2C4EA 3MBJA 4KBEA 4EUMA 2RBCA 3RQ5A 2I5BA 2R3BA 3IBQA 4EBUA 4XDAA 2UUPA 2XPCA 4CVKA 3H49A 1EEHA 3NBWA 4KANA 3PZSA 4E8WA 2I6AA 3RS9A 3NL3A 1RFTA 1O5ZA 3GO7A 4K8TA 4UBEA 1LIKA 3BF5A 4E8YA 1GC5A 1V19A 4S1IB 4B8SA 1GQTA 2PKNA 3OTXA 1VK4A 4LCAA 2F7KA 2VTEA 3RT9A 3RU3A 3MBHA 3RRJA 3UQ9A 3ZL8A 4E84A 3FHYA 1RK2A 1TZ6A 2XJAA 3NC9A 4ZIYA 3LJSA 2JFFA 2AM1A 1JBVA 2QHPA 2VTDA 3PL2A 3Q1YA 3QCZA 3RY7A 4C5NA 2QCVA 1FGSA 2JFGA 3BGKA 2ABQA 1ESQA 1WYEA 3K9EA 3QAIA 4QDIA 1GG4A 4B8RA 4EOHA 1TZ3A 3RSFA 1VM7A 3DZVA 3LHXA 1YHJA 3GO6A 3UQDA 4U7XA 2PKFA 2Y68A 4O1GA 3FHXA 1V1AA 3LK7A 5EY7A 3RQ8A 2NWHA 2JGVA 4JKSA 3RQ2A 5BYCA 3RREA 2AA0A 3B1OA 3KTNA 1JXHA 1P31A 1RKSA 2XTBA 4S1MA 3HJ6A 3NL5A 2WTZA 3EWMA 3RPZA 1RKAA 3RPHA 3RTDA 3CQDA 1RFVA 2YXUA 3RO4A 4K9CA 4BUBA 1ESJA 4XCKA 3NC2A 4KALA 3NM3A 3JULA 2A9ZA 4XF7A 1E8CA 3B3LA 3RQ6A 2PKKA 2V78A 4N08A 2DDWA 2Q5RA 1UB0A 4S1HA 2FV7A 2UUOA 5F11A 2GC5A 3B1PA 3KEUA 3RTEA 3B1NA 3HN7A 4K8PA 2I6BA 2ABSA 4LC4A 1W78A 3RQQA 1P3DA 3KD6A 4C5KA 4YL5A 3B1QA 3RRFA 1E0DA 3N2AA 1GQQA 1V1BA 3KZHA 5BYFA 2AJPA 5CGEA 4JJPA 2JG5A 1LHPA 3N1CA 5TRWA 5C3YA 5A5FA 3EAGA 1EKQA 3ZS7A 5TQIA 5C41A 4PVVA 3IQ0A 4K8CA 4CVMA 2AB8A 1DGMA 1V1SA 1KYHA 2DCNA 2VARA 4JKUA 3HYOA 4O1LA 3ZM6A 2AM2A 5B6AA 1YGKA 2HW1A 4K8KA 3IN1A 4K9IA 3UQ6A 2GCBA 1RKDA 4LBXA 3Q92A 1RFUA 2DDOA 4C13A 4X8FA 3IH0A 3RS8A 4E69A 1U2XA 3B1RA 4QF5A 2VORA 4K93A 2F02A 2WJPA 1EKKA 1LHRA 3UQEA 3HICA 2HQQA 2DDMA 2VOSA 1TD2A 5EYNA 1C3QA 1UA4A 1JXIA 5A5EA
chains in the Genus database with same CATH topology
1LIJA 3RRBA 2AX3A 2HLZA 3RU2A 4C5JA 3K5WA 3QA2A 3RTCA 3RQHA 1TYYA 2PKMA 1BX4A 3W4SA 4C5LA 3NL6A 2JG1A 4C5MA 5CGAA 2AFBA 3I3YA 3LKIA 3VAQA 2C49A 3NBVA 5BYDA 3NL2A 3RSSA 4GM6A 4E8ZA 3H74A 3NCAA 3RSGA 3RTAA 1YGJA 2YXTA 4YWRA 4XF6A 5COJA 3VASA 4EN4A 2AJRA 5BYEA 5C40A 3UBOA 1L2LA 2A9YA 3RM5A 1LIOA 1LIIA 3RTGA 4KADA 3IKHA 3UMPA 4WJMA 3RQXA 3LOOA 3UMOA 4DC3A 3NM1A 4LBGA 3GBUA 4N09A 4E3AA 4KAHA 2R3EA 5F0ZA 4DU5A 1VI9A 5CM5A 4S1IA 3HPDA 3RSQA 2AWDA 3IE7A 3RT7A 3RTBA 3DRWA 2C4EA 3MBJA 4KBEA 4EUMA 2RBCA 3RQ5A 2I5BA 2R3BA 3IBQA 4EBUA 4XDAA 3H49A 4KANA 3NBWA 3PZSA 4E8WA 2I6AA 3RS9A 3NL3A 1RFTA 3GO7A 4K8TA 4UBEA 4E8YA 1LIKA 3BF5A 1GC5A 1V19A 4S1IB 4B8SA 1GQTA 2PKNA 3OTXA 1VK4A 4LCAA 2F7KA 3RT9A 3RU3A 3UQ9A 3MBHA 3RRJA 4E84A 3FHYA 1RK2A 1TZ6A 3NC9A 3LJSA 2QHPA 3PL2A 3Q1YA 4C5NA 3RY7A 5C3ZA 2QCVA 3BGKA 3K9EA 2ABQA 1ESQA 1WYEA 3QAIA 4B8RA 4EOHA 1TZ3A 3RSFA 1VM7A 3DZVA 3LHXA 1YHJA 3GO6A 3UQDA 4U7XA 2PKFA 4O1GA 3FHXA 1V1AA 5EY7A 3RQ8A 2NWHA 2JGVA 4JKSA 3RQ2A 5BYCA 3RREA 2AA0A 3B1OA 3KTNA 1JXHA 5B6AA 1RKSA 2XTBA 4S1MA 3HJ6A 3NL5A 3EWMA 3RPZA 3RTDA 1RKAA 3RPHA 3CQDA 1RFVA 2YXUA 3RO4A 4K9CA 1ESJA 4XCKA 3NC2A 4KALA 3NM3A 3JULA 2A9ZA 4XF7A 3RQ6A 3B3LA 2V78A 2PKKA 4N08A 2DDWA 2Q5RA 1UB0A 4S1HA 2FV7A 5F11A 3B1PA 3KEUA 3RTEA 3B1NA 4K8PA 2I6BA 2ABSA 4LC4A 3RQQA 3KD6A 4C5KA 4YL5A 3B1QA 3RRFA 1V1BA 3KZHA 5BYFA 2AJPA 5CGEA 4JJPA 2JG5A 1LHPA 3N1CA 5TRWA 5C3YA 5C41A 1EKQA 3ZS7A 5TQIA 4PVVA 3IQ0A 4K8CA 2AB8A 1DGMA 1V1SA 1KYHA 2DCNA 2VARA 4JKUA 3HYOA 4O1LA 1YGKA 2HW1A 4K8KA 3IN1A 4K9IA 3UQ6A 1RKDA 4LBXA 3Q92A 1RFUA 2DDOA 4X8FA 3IH0A 3RS8A 4E69A 1U2XA 3B1RA 4K93A 2F02A 1EKKA 1LHRA 3UQEA 3HICA 2HQQA 2DDMA 1TD2A 5EYNA 1C3QA 1UA4A 1JXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LIJ A;  3RRB A;  2AX3 A;  2HLZ A;  3RU2 A;  4C5J A;  3K5W A;  3QA2 A;  3RTC A;  3RQH A;  1TYY A;  2PKM A;  1BX4 A;  3W4S A;  4C5L A;  3NL6 A;  2JG1 A;  4C5M A;  5CGA A;  2AFB A;  3I3Y A;  3LKI A;  3VAQ A;  2C49 A;  3NBV A;  5BYD A;  3NL2 A;  3RSS A;  4GM6 A;  4E8Z A;  3H74 A;  3NCA A;  3RSG A;  3RTA A;  1YGJ A;  2YXT A;  4YWR A;  4XF6 A;  5COJ A;  3VAS A;  4EN4 A;  2AJR A;  5BYE A;  5C40 A;  3UBO A;  1L2L A;  2A9Y A;  3RM5 A;  1LIO A;  1LII A;  3RTG A;  4KAD A;  3IKH A;  3UMP A;  4WJM A;  3RQX A;  3LOO A;  3UMO A;  4DC3 A;  3NM1 A;  4LBG A;  3GBU A;  4N09 A;  4E3A A;  4KAH A;  2R3E A;  5F0Z A;  4DU5 A;  1VI9 A;  5CM5 A;  4S1I A;  3HPD A;  3RSQ A;  2AWD A;  3IE7 A;  3RT7 A;  3RTB A;  3DRW A;  2C4E A;  3MBJ A;  4KBE A;  4EUM A;  2RBC A;  3RQ5 A;  2I5B A;  2R3B A;  3IBQ A;  4EBU A;  4XDA A;  3H49 A;  4KAN A;  3NBW A;  3PZS A;  4E8W A;  2I6A A;  3RS9 A;  3NL3 A;  1RFT A;  3GO7 A;  4K8T A;  4UBE A;  4E8Y A;  1LIK A;  3BF5 A;  1GC5 A;  1V19 A;  4S1I B;  4B8S A;  1GQT A;  2PKN A;  3OTX A;  1VK4 A;  4LCA A;  2F7K A;  3RT9 A;  3RU3 A;  3UQ9 A;  3MBH A;  3RRJ A;  4E84 A;  3FHY A;  1RK2 A;  1TZ6 A;  3NC9 A;  3LJS A;  2QHP A;  3PL2 A;  3Q1Y A;  4C5N A;  3RY7 A;  5C3Z A;  2QCV A;  3BGK A;  3K9E A;  2ABQ A;  1ESQ A;  1WYE A;  3QAI A;  4B8R A;  4EOH A;  1TZ3 A;  3RSF A;  1VM7 A;  3DZV A;  3LHX A;  1YHJ A;  3GO6 A;  3UQD A;  4U7X A;  2PKF A;  4O1G A;  3FHX A;  1V1A A;  5EY7 A;  3RQ8 A;  2NWH A;  2JGV A;  4JKS A;  3RQ2 A;  5BYC A;  3RRE A;  2AA0 A;  3B1O A;  3KTN A;  1JXH A;  5B6A A;  1RKS A;  2XTB A;  4S1M A;  3NL5 A;  3RPZ A;  3EWM A;  3RTD A;  1RKA A;  3RPH A;  3CQD A;  1RFV A;  2YXU A;  3RO4 A;  4K9C A;  1ESJ A;  4XCK A;  3NC2 A;  4KAL A;  3NM3 A;  3JUL A;  2A9Z A;  4XF7 A;  3RQ6 A;  3B3L A;  2V78 A;  2PKK A;  4N08 A;  2DDW A;  2Q5R A;  1UB0 A;  4S1H A;  2FV7 A;  5F11 A;  3B1P A;  3KEU A;  3RTE A;  3B1N A;  4K8P A;  2I6B A;  2ABS A;  4LC4 A;  3RQQ A;  3KD6 A;  4C5K A;  4YL5 A;  3B1Q A;  3RRF A;  1V1B A;  3KZH A;  5BYF A;  2AJP A;  5CGE A;  4JJP A;  2JG5 A;  1LHP A;  3N1C A;  5TRW A;  5C3Y A;  5C41 A;  1EKQ A;  3ZS7 A;  5TQI A;  4PVV A;  3IQ0 A;  4K8C A;  2AB8 A;  1DGM A;  1V1S A;  1KYH A;  2DCN A;  2VAR A;  4JKU A;  3HYO A;  4O1L A;  1YGK A;  2HW1 A;  4K8K A;  3IN1 A;  4K9I A;  3UQ6 A;  1RKD A;  4LBX A;  3Q92 A;  1RFU A;  2DDO A;  4X8F A;  3IH0 A;  3RS8 A;  4E69 A;  1U2X A;  3B1R A;  4K93 A;  2F02 A;  1EKK A;  1LHR A;  3UQE A;  3HIC A;  2HQQ A;  2DDM A;  1TD2 A;  5EYN A;  1C3Q A;  1UA4 A;  1JXI A; 
#chains in the Genus database with same CATH topology
 1LIJ A;  3RRB A;  2AX3 A;  3UAG A;  2HLZ A;  3RU2 A;  4C5J A;  4HV4 A;  3K5W A;  3QA2 A;  3RTC A;  3RQH A;  4UAG A;  1TYY A;  4BUC A;  2PKM A;  1BX4 A;  1W7K A;  1UAG A;  3W4S A;  4C5L A;  3NL6 A;  2JG1 A;  2Y66 A;  4C12 A;  2AFB A;  4C5M A;  3I3Y A;  5CGA A;  3LKI A;  3VAQ A;  2C49 A;  2GC6 A;  3NBV A;  5BYD A;  3NL2 A;  3RSS A;  3NRS A;  4GM6 A;  3H74 A;  2X5O A;  3NCA A;  4E8Z A;  5C40 A;  3RSG A;  3RTA A;  1YGJ A;  2YXT A;  3PYZ A;  4YWR A;  4XF6 A;  5COJ A;  3VAS A;  4EN4 A;  2AJR A;  2JFH A;  1J6U A;  3UBO A;  3ZM5 A;  1L2L A;  2A9Y A;  3RM5 A;  5BYE A;  1LIO A;  1LII A;  2Y1O A;  3RTG A;  4KAD A;  3IKH A;  3UMP A;  4WJM A;  3RQX A;  2GCA A;  3LOO A;  3UMO A;  4DC3 A;  2F00 A;  3NM1 A;  4LBG A;  3GBU A;  4N09 A;  4E3A A;  4KAH A;  2R3E A;  5F0Z A;  4DU5 A;  1GQY A;  1VI9 A;  5CM5 A;  4S1I A;  3HPD A;  3RSQ A;  4CVL A;  2AWD A;  1JBW A;  3IE7 A;  3RT7 A;  3RTB A;  2Y67 A;  5C3Z A;  2UAG A;  3DRW A;  2C4E A;  3MBJ A;  4KBE A;  4EUM A;  2RBC A;  3RQ5 A;  2I5B A;  2R3B A;  3IBQ A;  4EBU A;  4XDA A;  2UUP A;  2XPC A;  4CVK A;  3H49 A;  1EEH A;  3NBW A;  4KAN A;  3PZS A;  4E8W A;  2I6A A;  3RS9 A;  3NL3 A;  1RFT A;  1O5Z A;  3GO7 A;  4K8T A;  4UBE A;  1LIK A;  3BF5 A;  4E8Y A;  1GC5 A;  1V19 A;  4S1I B;  4B8S A;  1GQT A;  2PKN A;  3OTX A;  1VK4 A;  4LCA A;  2F7K A;  2VTE A;  3RT9 A;  3RU3 A;  3MBH A;  3RRJ A;  3UQ9 A;  3ZL8 A;  4E84 A;  3FHY A;  1RK2 A;  1TZ6 A;  2XJA A;  3NC9 A;  4ZIY A;  3LJS A;  2JFF A;  2AM1 A;  1JBV A;  2QHP A;  2VTD A;  3PL2 A;  3Q1Y A;  3QCZ A;  3RY7 A;  4C5N A;  2QCV A;  1FGS A;  2JFG A;  3BGK A;  2ABQ A;  1ESQ A;  1WYE A;  3K9E A;  3QAI A;  4QDI A;  1GG4 A;  4B8R A;  4EOH A;  1TZ3 A;  3RSF A;  1VM7 A;  3DZV A;  3LHX A;  1YHJ A;  3GO6 A;  3UQD A;  4U7X A;  2PKF A;  2Y68 A;  4O1G A;  3FHX A;  1V1A A;  3LK7 A;  5EY7 A;  3RQ8 A;  2NWH A;  2JGV A;  4JKS A;  3RQ2 A;  5BYC A;  3RRE A;  2AA0 A;  3B1O A;  3KTN A;  1JXH A;  1P31 A;  1RKS A;  2XTB A;  4S1M A;  3HJ6 A;  3NL5 A;  2WTZ A;  3EWM A;  3RPZ A;  1RKA A;  3RPH A;  3RTD A;  3CQD A;  1RFV A;  2YXU A;  3RO4 A;  4K9C A;  4BUB A;  1ESJ A;  4XCK A;  3NC2 A;  4KAL A;  3NM3 A;  3JUL A;  2A9Z A;  4XF7 A;  1E8C A;  3B3L A;  3RQ6 A;  2PKK A;  2V78 A;  4N08 A;  2DDW A;  2Q5R A;  1UB0 A;  4S1H A;  2FV7 A;  2UUO A;  5F11 A;  2GC5 A;  3B1P A;  3KEU A;  3RTE A;  3B1N A;  3HN7 A;  4K8P A;  2I6B A;  2ABS A;  4LC4 A;  1W78 A;  3RQQ A;  1P3D A;  3KD6 A;  4C5K A;  4YL5 A;  3B1Q A;  3RRF A;  1E0D A;  3N2A A;  1GQQ A;  1V1B A;  3KZH A;  5BYF A;  2AJP A;  5CGE A;  4JJP A;  2JG5 A;  1LHP A;  3N1C A;  5TRW A;  5C3Y A;  5A5F A;  3EAG A;  1EKQ A;  3ZS7 A;  5TQI A;  5C41 A;  4PVV A;  3IQ0 A;  4K8C A;  4CVM A;  2AB8 A;  1DGM A;  1V1S A;  1KYH A;  2DCN A;  2VAR A;  4JKU A;  3HYO A;  4O1L A;  3ZM6 A;  2AM2 A;  5B6A A;  1YGK A;  2HW1 A;  4K8K A;  3IN1 A;  4K9I A;  3UQ6 A;  2GCB A;  1RKD A;  4LBX A;  3Q92 A;  1RFU A;  2DDO A;  4C13 A;  4X8F A;  3IH0 A;  3RS8 A;  4E69 A;  1U2X A;  3B1R A;  4QF5 A;  2VOR A;  4K93 A;  2F02 A;  2WJP A;  1EKK A;  1LHR A;  3UQE A;  3HIC A;  2HQQ A;  2DDM A;  2VOS A;  1TD2 A;  5EYN A;  1C3Q A;  1UA4 A;  1JXI A;  5A5E A; 
#chains in the Genus database with same CATH homology
 1LIJ A;  3RRB A;  2AX3 A;  2HLZ A;  3RU2 A;  4C5J A;  3K5W A;  3QA2 A;  3RTC A;  3RQH A;  1TYY A;  2PKM A;  1BX4 A;  3W4S A;  4C5L A;  3NL6 A;  2JG1 A;  4C5M A;  5CGA A;  2AFB A;  3I3Y A;  3LKI A;  3VAQ A;  2C49 A;  3NBV A;  5BYD A;  3NL2 A;  3RSS A;  4GM6 A;  4E8Z A;  3H74 A;  3NCA A;  3RSG A;  3RTA A;  1YGJ A;  2YXT A;  4YWR A;  4XF6 A;  5COJ A;  3VAS A;  4EN4 A;  2AJR A;  5BYE A;  5C40 A;  3UBO A;  1L2L A;  2A9Y A;  3RM5 A;  1LIO A;  1LII A;  3RTG A;  4KAD A;  3IKH A;  3UMP A;  4WJM A;  3RQX A;  3LOO A;  3UMO A;  4DC3 A;  3NM1 A;  4LBG A;  3GBU A;  4N09 A;  4E3A A;  4KAH A;  2R3E A;  5F0Z A;  4DU5 A;  1VI9 A;  5CM5 A;  4S1I A;  3HPD A;  3RSQ A;  2AWD A;  3IE7 A;  3RT7 A;  3RTB A;  3DRW A;  2C4E A;  3MBJ A;  4KBE A;  4EUM A;  2RBC A;  3RQ5 A;  2I5B A;  2R3B A;  3IBQ A;  4EBU A;  4XDA A;  3H49 A;  4KAN A;  3NBW A;  3PZS A;  4E8W A;  2I6A A;  3RS9 A;  3NL3 A;  1RFT A;  3GO7 A;  4K8T A;  4UBE A;  4E8Y A;  1LIK A;  3BF5 A;  1GC5 A;  1V19 A;  4S1I B;  4B8S A;  1GQT A;  2PKN A;  3OTX A;  1VK4 A;  4LCA A;  2F7K A;  3RT9 A;  3RU3 A;  3UQ9 A;  3MBH A;  3RRJ A;  4E84 A;  3FHY A;  1RK2 A;  1TZ6 A;  3NC9 A;  3LJS A;  2QHP A;  3PL2 A;  3Q1Y A;  4C5N A;  3RY7 A;  5C3Z A;  2QCV A;  3BGK A;  3K9E A;  2ABQ A;  1ESQ A;  1WYE A;  3QAI A;  4B8R A;  4EOH A;  1TZ3 A;  3RSF A;  1VM7 A;  3DZV A;  3LHX A;  1YHJ A;  3GO6 A;  3UQD A;  4U7X A;  2PKF A;  4O1G A;  3FHX A;  1V1A A;  5EY7 A;  3RQ8 A;  2NWH A;  2JGV A;  4JKS A;  3RQ2 A;  5BYC A;  3RRE A;  2AA0 A;  3B1O A;  3KTN A;  1JXH A;  5B6A A;  1RKS A;  2XTB A;  4S1M A;  3HJ6 A;  3NL5 A;  3EWM A;  3RPZ A;  3RTD A;  1RKA A;  3RPH A;  3CQD A;  1RFV A;  2YXU A;  3RO4 A;  4K9C A;  1ESJ A;  4XCK A;  3NC2 A;  4KAL A;  3NM3 A;  3JUL A;  2A9Z A;  4XF7 A;  3RQ6 A;  3B3L A;  2V78 A;  2PKK A;  4N08 A;  2DDW A;  2Q5R A;  1UB0 A;  4S1H A;  2FV7 A;  5F11 A;  3B1P A;  3KEU A;  3RTE A;  3B1N A;  4K8P A;  2I6B A;  2ABS A;  4LC4 A;  3RQQ A;  3KD6 A;  4C5K A;  4YL5 A;  3B1Q A;  3RRF A;  1V1B A;  3KZH A;  5BYF A;  2AJP A;  5CGE A;  4JJP A;  2JG5 A;  1LHP A;  3N1C A;  5TRW A;  5C3Y A;  5C41 A;  1EKQ A;  3ZS7 A;  5TQI A;  4PVV A;  3IQ0 A;  4K8C A;  2AB8 A;  1DGM A;  1V1S A;  1KYH A;  2DCN A;  2VAR A;  4JKU A;  3HYO A;  4O1L A;  1YGK A;  2HW1 A;  4K8K A;  3IN1 A;  4K9I A;  3UQ6 A;  1RKD A;  4LBX A;  3Q92 A;  1RFU A;  2DDO A;  4X8F A;  3IH0 A;  3RS8 A;  4E69 A;  1U2X A;  3B1R A;  4K93 A;  2F02 A;  1EKK A;  1LHR A;  3UQE A;  3HIC A;  2HQQ A;  2DDM A;  1TD2 A;  5EYN A;  1C3Q A;  1UA4 A;  1JXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...