4GM6A

Crystal structure of pfkb family carbohydrate kinase(target efi-502146 from listeria grayi dsm 20601
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
320
structure length
320
Chain Sequence
KQVVTIGELLMRLSTQQGIPFSQTTALDIHIGGAEANVAVNLSKLGHPTRIATVVPANPIGKMAVEHLWRHQVDTAFVVEAGDRLGTYYLESGTALKAPSVVYDRQHSSFARHKSMDWDLSELLKGIRVLHVSGITIALSTFWLEMVVKIIREAKRNGIKISFDMNYRAKLWELEAAKRAYQQLLPLVDYCSAGQMDAVAFFEISSETTDYYQAMHDKYPNIELFYATKRTVISASHHLLQGHLWTQGECWESEEYAIYPIVDRVGGGDAYTAAVLHGILSEWRPDETVKFATAAAGLKHSIHGDINPFDEKTIADFAAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PfkB family carbohydrate kinase FROM Listeria grayi
rcsb
source organism Listeria grayi dsm 20601
molecule tags Transferase
molecule keywords PfkB family carbohydrate kinase
total genus 105
structure length 320
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4gm6A00
1L2LA 4K8PA 3RSSA 3RQ2A 3RTEA 2C49A 1YHJA 3H74A 1EKQA 4JKUA 3RQQA 3GO7A 2DDOA 4U7XA 3B3LA 3IE7A 3JULA 3KZHA 5EY7A 3RTGA 1TYYA 3UQDA 3UQ6A 3RSQA 1VM7A 3HYOA 1JXHA 4E69A 3NC2A 3DZVA 3NL3A 4KALA 4X8FA 3VAQA 2F7KA 3HPDA 4GM6A 1LIOA 1KYHA 1UB0A 1UA4A 1RK2A 2Q5RA 4UBEA 3Q1YA 2YXUA 3KD6A 4KADA 3RM5A 2XTBA 5C41A 5BYFA 4E84A 1LHRA 2FV7A 2AJRA 3B1RA 3LHXA 4DU5A 3CQDA 3RS9A 5C3YA 2RBCA 2JG1A 3NL6A 3RQXA 1VK4A 3K9EA 5CM5A 1DGMA 1V1SA 3RT7A 4LBXA 5BYEA 4S1MA 5C40A 2V78A 1GC5A 1VI9A 2AB8A 1U2XA 3LKIA 3UMPA 4K9IA 1C3QA 4S1IB 3RTBA 1RFUA 3RY7A 3NCAA 3ZS7A 4N08A 2C4EA 3RPHA 4JKSA 4XF7A 2QCVA 4C5JA 3N1CA 3PZSA 2VARA 1YGKA 3RRJA 2I5BA 1TD2A 2NWHA 2F02A 1LIJA 1RKSA 4DC3A 1ESQA 3H49A 1LIKA 1RKAA 3RPZA 3IBQA 3NL5A 5TQIA 4C5MA 3RSFA 3OTXA 4E8WA 5B6AA 3IN1A 3RO4A 4K93A 3NC9A 3DRWA 4PVVA 4LC4A 4C5LA 2DCNA 5F11A 4O1GA 2I6AA 3I3YA 2YXTA 3B1QA 4EOHA 2JG5A 4JJPA 1TZ6A 3IKHA 4YWRA 4N09A 1V19A 3HICA 4EBUA 4E8YA 4C5NA 2AWDA 3FHXA 4K8KA 3UQ9A 2HLZA 1WYEA 3LJSA 3KTNA 1V1AA 4E8ZA 4YL5A 2AJPA 5BYDA 2HQQA 3EWMA 1GQTA 2ABSA 3GBUA 3RT9A 3RTDA 5CGEA 4B8SA 4S1IA 5F0ZA 3NBVA 2AA0A 2AX3A 4K8CA 4XDAA 3RQHA 3UQEA 4C5KA 2R3BA 5C3ZA 5EYNA 3QAIA 5CGAA 4E3AA 1RFTA 4EN4A 1LHPA 3KEUA 2JGVA 3GO6A 1TZ3A 3MBJA 5COJA 3NM1A 5TRWA 3RSGA 3RU2A 2PKNA 1RFVA 3RREA 5BYCA 4B8RA 1LIIA 3NBWA 3VASA 3NM3A 3RQ8A 2AFBA 1ESJA 3PL2A 2PKKA 3BGKA 4LBGA 2A9ZA 1EKKA 1RKDA 2A9YA 4WJMA 3B1PA 2PKFA 3RTCA 3LOOA 3IQ0A 3MBHA 4XF6A 3Q92A 3UMOA 1JXIA 2I6BA 3RRFA 3RQ6A 4KBEA 1YGJA 4K8TA 4EUMA 3UBOA 2QHPA 3NL2A 2DDWA 3QA2A 4XCKA 2DDMA 3FHYA 3RQ5A 4K9CA 2R3EA 2HW1A 4O1LA 4S1HA 3RS8A 1V1BA 3W4SA 3K5WA 4KAHA 3B1OA 3RTAA 3RRBA 4LCAA 1BX4A 3IH0A 3B1NA 3BF5A 2PKMA 2ABQA 4KANA 3RU3A
chains in the Genus database with same CATH superfamily
1L2LA 4K8PA 3RSSA 2X5OA 4BUBA 3RQ2A 5F0ZA 3RTEA 2C49A 1YHJA 3H74A 4CVLA 1EKQA 4JKUA 1P31A 3RQQA 3GO7A 2DDOA 4U7XA 4QF5A 3B3LA 4ZIYA 3IE7A 3JULA 3KZHA 5EY7A 3RTGA 1TYYA 2WJPA 3UQDA 1GQYA 3UQ6A 3RSQA 1VM7A 3HYOA 1JXHA 4E69A 3NC2A 3DZVA 3NL3A 4KALA 4X8FA 3VAQA 2F7KA 3HPDA 1W78A 4GM6A 4BUCA 1JBVA 1LIOA 1KYHA 1UB0A 1UA4A 1RK2A 2Q5RA 4UBEA 2UUOA 3Q1YA 2YXUA 3KD6A 4KADA 3RM5A 2XTBA 5C41A 5BYFA 2Y66A 4E84A 1LHRA 2FV7A 2JFFA 2AJRA 2VTDA 3B1RA 3LHXA 4DU5A 1J6UA 3CQDA 3PYZA 3NRSA 3RS9A 3VASA 2RBCA 2JG1A 3NL6A 3RQXA 1VK4A 3K9EA 5C3YA 5CM5A 1DGMA 1E0DA 1V1SA 2VTEA 4LBXA 3RT7A 5BYEA 4S1MA 5C40A 3QCZA 2V78A 4C13A 2AM2A 1GC5A 1VI9A 2AB8A 1U2XA 3HN7A 3LKIA 4K9IA 1C3QA 1EEHA 4S1IB 4UAGA 1RFUA 3RTBA 2XJAA 3NCAA 4N08A 3RY7A 3ZM5A 3ZS7A 2C4EA 3RPHA 4JKSA 4XF7A 2QCVA 4C5JA 3N1CA 3PZSA 2VARA 1YGKA 3RRJA 2I5BA 1TD2A 2NWHA 2F02A 2WTZA 1LIJA 1RKSA 4DC3A 1ESQA 3H49A 1LIKA 1RKAA 4HV4A 3RPZA 2GC5A 2JFGA 3IBQA 3UAGA 3UMPA 3ZL8A 4C12A 3NL5A 5TQIA 4C5MA 3RSFA 3OTXA 4E8WA 5B6AA 3IN1A 2VORA 3RO4A 4K93A 3NC9A 3DRWA 4PVVA 4LC4A 4C5LA 2DCNA 5F11A 1GG4A 2XPCA 3LK7A 4O1GA 2I6AA 3I3YA 2YXTA 3B1QA 1FGSA 4EOHA 2JG5A 4JJPA 1TZ6A 3IKHA 4YWRA 4N09A 1V19A 3HICA 4EBUA 4E8YA 4QDIA 2AWDA 4C5NA 3FHXA 4K8KA 3UQ9A 2HLZA 1WYEA 3LJSA 3KTNA 1V1AA 4E8ZA 4YL5A 2AJPA 5BYDA 2HQQA 2JFHA 3EWMA 1GQTA 2ABSA 3GBUA 3RT9A 3RTDA 5CGEA 4B8SA 4S1IA 3ZM6A 2Y68A 3NBVA 2AA0A 2AX3A 4K8CA 4CVKA 4XDAA 5A5EA 3RQHA 3UQEA 4C5KA 2R3BA 5C3ZA 5EYNA 3QAIA 5CGAA 4E3AA 1RFTA 3HJ6A 4EN4A 1LHPA 1O5ZA 2JGVA 2Y67A 1TZ3A 3GO6A 3KEUA 3MBJA 1W7KA 3NM1A 5COJA 5TRWA 3RU2A 2PKNA 1RFVA 3RREA 5BYCA 4B8RA 1LIIA 3NBWA 1P3DA 3NM3A 3RQ8A 2AFBA 1ESJA 3PL2A 2PKKA 3BGKA 3RSGA 4LBGA 2A9ZA 1EKKA 1RKDA 3N2AA 2A9YA 4WJMA 2UUPA 2PKFA 3B1PA 3RTCA 3LOOA 3IQ0A 3MBHA 4XF6A 3EAGA 4CVMA 3Q92A 3UMOA 1JXIA 2I6BA 2VOSA 1JBWA 1GQQA 3RQ6A 3RRFA 4KBEA 1YGJA 4K8TA 4EUMA 3UBOA 2QHPA 2Y1OA 2DDWA 3NL2A 3QA2A 4XCKA 2DDMA 3FHYA 3RQ5A 2UAGA 2F00A 2HW1A 1UAGA 1E8CA 2GCAA 2R3EA 4K9CA 1V1BA 4O1LA 3K5WA 4KAHA 2AM1A 3B1OA 4S1HA 3RS8A 3RTAA 3W4SA 2GCBA 2GC6A 3RRBA 4LCAA 1BX4A 3IH0A 5A5FA 3B1NA 3BF5A 2PKMA 2ABQA 4KANA 3RU3A
chains in the Genus database with same CATH topology
1L2LA 4K8PA 3RSSA 3RQ2A 3RTEA 2C49A 1YHJA 3H74A 1EKQA 4JKUA 3RQQA 3GO7A 2DDOA 4U7XA 3B3LA 3IE7A 3JULA 3KZHA 5EY7A 3RTGA 1TYYA 3UQDA 3UQ6A 3RSQA 1VM7A 3HYOA 1JXHA 4E69A 3NC2A 3DZVA 3NL3A 4KALA 4X8FA 3VAQA 2F7KA 3HPDA 4GM6A 1LIOA 1KYHA 1UB0A 1UA4A 1RK2A 2Q5RA 4UBEA 3Q1YA 2YXUA 3KD6A 4KADA 3RM5A 2XTBA 5C41A 5BYFA 4E84A 1LHRA 2FV7A 2AJRA 3B1RA 3LHXA 4DU5A 3CQDA 3RS9A 5C3YA 2RBCA 2JG1A 3NL6A 3RQXA 1VK4A 3K9EA 5CM5A 1DGMA 1V1SA 3RT7A 4LBXA 5BYEA 4S1MA 5C40A 2V78A 1GC5A 1VI9A 2AB8A 1U2XA 3LKIA 3UMPA 4K9IA 1C3QA 4S1IB 3RTBA 1RFUA 3RY7A 3NCAA 3ZS7A 4N08A 2C4EA 3RPHA 4JKSA 4XF7A 2QCVA 4C5JA 3N1CA 3PZSA 2VARA 1YGKA 3RRJA 2I5BA 1TD2A 2NWHA 2F02A 1LIJA 1RKSA 4DC3A 1ESQA 3H49A 1LIKA 1RKAA 3RPZA 3IBQA 3NL5A 5TQIA 4C5MA 3RSFA 3OTXA 4E8WA 5B6AA 3IN1A 3RO4A 4K93A 3NC9A 3DRWA 4PVVA 4LC4A 4C5LA 2DCNA 5F11A 4O1GA 2I6AA 3I3YA 2YXTA 3B1QA 4EOHA 2JG5A 4JJPA 1TZ6A 3IKHA 4YWRA 4N09A 1V19A 3HICA 4EBUA 4E8YA 4C5NA 2AWDA 3FHXA 4K8KA 3UQ9A 2HLZA 1WYEA 3LJSA 3KTNA 1V1AA 4E8ZA 4YL5A 2AJPA 5BYDA 2HQQA 3EWMA 1GQTA 2ABSA 3GBUA 3RT9A 3RTDA 5CGEA 4B8SA 4S1IA 5F0ZA 3NBVA 2AA0A 2AX3A 4K8CA 4XDAA 3RQHA 3UQEA 4C5KA 2R3BA 5C3ZA 5EYNA 3QAIA 5CGAA 4E3AA 1RFTA 3HJ6A 4EN4A 1LHPA 3KEUA 2JGVA 3GO6A 1TZ3A 3MBJA 5COJA 3NM1A 5TRWA 3RSGA 3RU2A 2PKNA 1RFVA 3RREA 5BYCA 4B8RA 1LIIA 3NBWA 3VASA 3NM3A 3RQ8A 2AFBA 1ESJA 3PL2A 2PKKA 3BGKA 4LBGA 2A9ZA 1EKKA 1RKDA 2A9YA 4WJMA 3B1PA 2PKFA 3RTCA 3LOOA 3IQ0A 3MBHA 4XF6A 3Q92A 3UMOA 1JXIA 2I6BA 3RRFA 3RQ6A 4KBEA 1YGJA 4K8TA 4EUMA 3UBOA 2QHPA 3NL2A 2DDWA 3QA2A 4XCKA 2DDMA 3FHYA 3RQ5A 4K9CA 2R3EA 2HW1A 4O1LA 4S1HA 3RS8A 1V1BA 3W4SA 3K5WA 4KAHA 3B1OA 3RTAA 3RRBA 4LCAA 1BX4A 3IH0A 3B1NA 3BF5A 2PKMA 2ABQA 4KANA 3RU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2L A;  4K8P A;  3RSS A;  3RQ2 A;  3RTE A;  2C49 A;  1YHJ A;  3H74 A;  1EKQ A;  4JKU A;  3RQQ A;  3GO7 A;  2DDO A;  4U7X A;  3B3L A;  3IE7 A;  3JUL A;  3KZH A;  5EY7 A;  3RTG A;  1TYY A;  3UQD A;  3UQ6 A;  3RSQ A;  1VM7 A;  3HYO A;  1JXH A;  4E69 A;  3NC2 A;  3DZV A;  3NL3 A;  4KAL A;  4X8F A;  3VAQ A;  2F7K A;  3HPD A;  4GM6 A;  1LIO A;  1KYH A;  1UB0 A;  1UA4 A;  1RK2 A;  2Q5R A;  4UBE A;  3Q1Y A;  2YXU A;  3KD6 A;  4KAD A;  3RM5 A;  2XTB A;  5C41 A;  5BYF A;  4E84 A;  1LHR A;  2FV7 A;  2AJR A;  3B1R A;  3LHX A;  4DU5 A;  3CQD A;  3RS9 A;  5C3Y A;  2RBC A;  2JG1 A;  3NL6 A;  3RQX A;  1VK4 A;  3K9E A;  5CM5 A;  1DGM A;  1V1S A;  3RT7 A;  4LBX A;  5BYE A;  4S1M A;  5C40 A;  2V78 A;  1GC5 A;  1VI9 A;  2AB8 A;  1U2X A;  3LKI A;  3UMP A;  4K9I A;  1C3Q A;  4S1I B;  3RTB A;  1RFU A;  3RY7 A;  3NCA A;  3ZS7 A;  4N08 A;  2C4E A;  3RPH A;  4JKS A;  4XF7 A;  2QCV A;  4C5J A;  3N1C A;  3PZS A;  2VAR A;  1YGK A;  3RRJ A;  2I5B A;  1TD2 A;  2NWH A;  2F02 A;  1LIJ A;  1RKS A;  4DC3 A;  1ESQ A;  3H49 A;  1LIK A;  1RKA A;  3RPZ A;  3IBQ A;  3NL5 A;  5TQI A;  4C5M A;  3RSF A;  3OTX A;  4E8W A;  5B6A A;  3IN1 A;  3RO4 A;  4K93 A;  3NC9 A;  3DRW A;  4PVV A;  4LC4 A;  4C5L A;  2DCN A;  5F11 A;  4O1G A;  2I6A A;  3I3Y A;  2YXT A;  3B1Q A;  4EOH A;  2JG5 A;  4JJP A;  1TZ6 A;  3IKH A;  4YWR A;  4N09 A;  1V19 A;  3HIC A;  4EBU A;  4E8Y A;  4C5N A;  2AWD A;  3FHX A;  4K8K A;  3UQ9 A;  2HLZ A;  1WYE A;  3LJS A;  3KTN A;  1V1A A;  4E8Z A;  4YL5 A;  2AJP A;  5BYD A;  2HQQ A;  3EWM A;  1GQT A;  2ABS A;  3GBU A;  3RT9 A;  3RTD A;  5CGE A;  4B8S A;  4S1I A;  5F0Z A;  3NBV A;  2AA0 A;  2AX3 A;  4K8C A;  4XDA A;  3RQH A;  3UQE A;  4C5K A;  2R3B A;  5C3Z A;  5EYN A;  3QAI A;  5CGA A;  4E3A A;  1RFT A;  4EN4 A;  1LHP A;  3KEU A;  2JGV A;  3GO6 A;  1TZ3 A;  3MBJ A;  5COJ A;  3NM1 A;  5TRW A;  3RSG A;  3RU2 A;  2PKN A;  1RFV A;  3RRE A;  5BYC A;  4B8R A;  1LII A;  3NBW A;  3VAS A;  3NM3 A;  3RQ8 A;  2AFB A;  1ESJ A;  3PL2 A;  2PKK A;  3BGK A;  4LBG A;  2A9Z A;  1EKK A;  1RKD A;  2A9Y A;  4WJM A;  3B1P A;  2PKF A;  3RTC A;  3LOO A;  3IQ0 A;  3MBH A;  4XF6 A;  3Q92 A;  3UMO A;  1JXI A;  2I6B A;  3RRF A;  3RQ6 A;  4KBE A;  1YGJ A;  4K8T A;  4EUM A;  3UBO A;  2QHP A;  3NL2 A;  2DDW A;  3QA2 A;  4XCK A;  2DDM A;  3FHY A;  3RQ5 A;  4K9C A;  2R3E A;  2HW1 A;  4O1L A;  4S1H A;  3RS8 A;  1V1B A;  3W4S A;  3K5W A;  4KAH A;  3B1O A;  3RTA A;  3RRB A;  4LCA A;  1BX4 A;  3IH0 A;  3B1N A;  3BF5 A;  2PKM A;  2ABQ A;  4KAN A;  3RU3 A; 
#chains in the Genus database with same CATH topology
 1L2L A;  4K8P A;  3RSS A;  2X5O A;  4BUB A;  3RQ2 A;  5F0Z A;  3RTE A;  2C49 A;  1YHJ A;  3H74 A;  4CVL A;  1EKQ A;  4JKU A;  1P31 A;  3RQQ A;  3GO7 A;  2DDO A;  4U7X A;  4QF5 A;  3B3L A;  4ZIY A;  3IE7 A;  3JUL A;  3KZH A;  5EY7 A;  3RTG A;  1TYY A;  2WJP A;  3UQD A;  1GQY A;  3UQ6 A;  3RSQ A;  1VM7 A;  3HYO A;  1JXH A;  4E69 A;  3NC2 A;  3DZV A;  3NL3 A;  4KAL A;  4X8F A;  3VAQ A;  2F7K A;  3HPD A;  1W78 A;  4GM6 A;  4BUC A;  1JBV A;  1LIO A;  1KYH A;  1UB0 A;  1UA4 A;  1RK2 A;  2Q5R A;  4UBE A;  2UUO A;  3Q1Y A;  2YXU A;  3KD6 A;  4KAD A;  3RM5 A;  2XTB A;  5C41 A;  5BYF A;  2Y66 A;  4E84 A;  1LHR A;  2FV7 A;  2JFF A;  2AJR A;  2VTD A;  3B1R A;  3LHX A;  4DU5 A;  1J6U A;  3CQD A;  3PYZ A;  3NRS A;  3RS9 A;  3VAS A;  2RBC A;  2JG1 A;  3NL6 A;  3RQX A;  1VK4 A;  3K9E A;  5C3Y A;  5CM5 A;  1DGM A;  1E0D A;  1V1S A;  2VTE A;  4LBX A;  3RT7 A;  5BYE A;  4S1M A;  5C40 A;  3QCZ A;  2V78 A;  4C13 A;  2AM2 A;  1GC5 A;  1VI9 A;  2AB8 A;  1U2X A;  3HN7 A;  3LKI A;  4K9I A;  1C3Q A;  1EEH A;  4S1I B;  4UAG A;  1RFU A;  3RTB A;  2XJA A;  3NCA A;  4N08 A;  3RY7 A;  3ZM5 A;  3ZS7 A;  2C4E A;  3RPH A;  4JKS A;  4XF7 A;  2QCV A;  4C5J A;  3N1C A;  3PZS A;  2VAR A;  1YGK A;  3RRJ A;  2I5B A;  1TD2 A;  2NWH A;  2F02 A;  2WTZ A;  1LIJ A;  1RKS A;  4DC3 A;  1ESQ A;  3H49 A;  1LIK A;  1RKA A;  4HV4 A;  3RPZ A;  2GC5 A;  2JFG A;  3IBQ A;  3UAG A;  3UMP A;  3ZL8 A;  4C12 A;  3NL5 A;  5TQI A;  4C5M A;  3RSF A;  3OTX A;  4E8W A;  5B6A A;  3IN1 A;  2VOR A;  3RO4 A;  4K93 A;  3NC9 A;  3DRW A;  4PVV A;  4LC4 A;  4C5L A;  2DCN A;  5F11 A;  1GG4 A;  2XPC A;  3LK7 A;  4O1G A;  2I6A A;  3I3Y A;  2YXT A;  3B1Q A;  1FGS A;  4EOH A;  2JG5 A;  4JJP A;  1TZ6 A;  3IKH A;  4YWR A;  4N09 A;  1V19 A;  3HIC A;  4EBU A;  4E8Y A;  4QDI A;  2AWD A;  4C5N A;  3FHX A;  4K8K A;  3UQ9 A;  2HLZ A;  1WYE A;  3LJS A;  3KTN A;  1V1A A;  4E8Z A;  4YL5 A;  2AJP A;  5BYD A;  2HQQ A;  2JFH A;  3EWM A;  1GQT A;  2ABS A;  3GBU A;  3RT9 A;  3RTD A;  5CGE A;  4B8S A;  4S1I A;  3ZM6 A;  2Y68 A;  3NBV A;  2AA0 A;  2AX3 A;  4K8C A;  4CVK A;  4XDA A;  5A5E A;  3RQH A;  3UQE A;  4C5K A;  2R3B A;  5C3Z A;  5EYN A;  3QAI A;  5CGA A;  4E3A A;  1RFT A;  3HJ6 A;  4EN4 A;  1LHP A;  1O5Z A;  2JGV A;  2Y67 A;  1TZ3 A;  3GO6 A;  3KEU A;  3MBJ A;  1W7K A;  3NM1 A;  5COJ A;  5TRW A;  3RU2 A;  2PKN A;  1RFV A;  3RRE A;  5BYC A;  4B8R A;  1LII A;  3NBW A;  1P3D A;  3NM3 A;  3RQ8 A;  2AFB A;  1ESJ A;  3PL2 A;  2PKK A;  3BGK A;  3RSG A;  4LBG A;  2A9Z A;  1EKK A;  1RKD A;  3N2A A;  2A9Y A;  4WJM A;  2UUP A;  2PKF A;  3B1P A;  3RTC A;  3LOO A;  3IQ0 A;  3MBH A;  4XF6 A;  3EAG A;  4CVM A;  3Q92 A;  3UMO A;  1JXI A;  2I6B A;  2VOS A;  1JBW A;  1GQQ A;  3RQ6 A;  3RRF A;  4KBE A;  1YGJ A;  4K8T A;  4EUM A;  3UBO A;  2QHP A;  2Y1O A;  2DDW A;  3NL2 A;  3QA2 A;  4XCK A;  2DDM A;  3FHY A;  3RQ5 A;  2UAG A;  2F00 A;  2HW1 A;  1UAG A;  1E8C A;  2GCA A;  2R3E A;  4K9C A;  1V1B A;  4O1L A;  3K5W A;  4KAH A;  2AM1 A;  3B1O A;  4S1H A;  3RS8 A;  3RTA A;  3W4S A;  2GCB A;  2GC6 A;  3RRB A;  4LCA A;  1BX4 A;  3IH0 A;  5A5F A;  3B1N A;  3BF5 A;  2PKM A;  2ABQ A;  4KAN A;  3RU3 A; 
#chains in the Genus database with same CATH homology
 1L2L A;  4K8P A;  3RSS A;  3RQ2 A;  3RTE A;  2C49 A;  1YHJ A;  3H74 A;  1EKQ A;  4JKU A;  3RQQ A;  3GO7 A;  2DDO A;  4U7X A;  3B3L A;  3IE7 A;  3JUL A;  3KZH A;  5EY7 A;  3RTG A;  1TYY A;  3UQD A;  3UQ6 A;  3RSQ A;  1VM7 A;  3HYO A;  1JXH A;  4E69 A;  3NC2 A;  3DZV A;  3NL3 A;  4KAL A;  4X8F A;  3VAQ A;  2F7K A;  3HPD A;  4GM6 A;  1LIO A;  1KYH A;  1UB0 A;  1UA4 A;  1RK2 A;  2Q5R A;  4UBE A;  3Q1Y A;  2YXU A;  3KD6 A;  4KAD A;  3RM5 A;  2XTB A;  5C41 A;  5BYF A;  4E84 A;  1LHR A;  2FV7 A;  2AJR A;  3B1R A;  3LHX A;  4DU5 A;  3CQD A;  3RS9 A;  5C3Y A;  2RBC A;  2JG1 A;  3NL6 A;  3RQX A;  1VK4 A;  3K9E A;  5CM5 A;  1DGM A;  1V1S A;  3RT7 A;  4LBX A;  5BYE A;  4S1M A;  5C40 A;  2V78 A;  1GC5 A;  1VI9 A;  2AB8 A;  1U2X A;  3LKI A;  3UMP A;  4K9I A;  1C3Q A;  4S1I B;  3RTB A;  1RFU A;  3RY7 A;  3NCA A;  3ZS7 A;  4N08 A;  2C4E A;  3RPH A;  4JKS A;  4XF7 A;  2QCV A;  4C5J A;  3N1C A;  3PZS A;  2VAR A;  1YGK A;  3RRJ A;  2I5B A;  1TD2 A;  2NWH A;  2F02 A;  1LIJ A;  1RKS A;  4DC3 A;  1ESQ A;  3H49 A;  1LIK A;  1RKA A;  3RPZ A;  3IBQ A;  3NL5 A;  5TQI A;  4C5M A;  3RSF A;  3OTX A;  4E8W A;  5B6A A;  3IN1 A;  3RO4 A;  4K93 A;  3NC9 A;  3DRW A;  4PVV A;  4LC4 A;  4C5L A;  2DCN A;  5F11 A;  4O1G A;  2I6A A;  3I3Y A;  2YXT A;  3B1Q A;  4EOH A;  2JG5 A;  4JJP A;  1TZ6 A;  3IKH A;  4YWR A;  4N09 A;  1V19 A;  3HIC A;  4EBU A;  4E8Y A;  4C5N A;  2AWD A;  3FHX A;  4K8K A;  3UQ9 A;  2HLZ A;  1WYE A;  3LJS A;  3KTN A;  1V1A A;  4E8Z A;  4YL5 A;  2AJP A;  5BYD A;  2HQQ A;  3EWM A;  1GQT A;  2ABS A;  3GBU A;  3RT9 A;  3RTD A;  5CGE A;  4B8S A;  4S1I A;  5F0Z A;  3NBV A;  2AA0 A;  2AX3 A;  4K8C A;  4XDA A;  3RQH A;  3UQE A;  4C5K A;  2R3B A;  5C3Z A;  5EYN A;  3QAI A;  5CGA A;  4E3A A;  1RFT A;  3HJ6 A;  4EN4 A;  1LHP A;  3KEU A;  2JGV A;  3GO6 A;  1TZ3 A;  3MBJ A;  5COJ A;  3NM1 A;  5TRW A;  3RSG A;  3RU2 A;  2PKN A;  1RFV A;  3RRE A;  5BYC A;  4B8R A;  1LII A;  3NBW A;  3VAS A;  3NM3 A;  3RQ8 A;  2AFB A;  1ESJ A;  3PL2 A;  2PKK A;  3BGK A;  4LBG A;  2A9Z A;  1EKK A;  1RKD A;  2A9Y A;  4WJM A;  3B1P A;  2PKF A;  3RTC A;  3LOO A;  3IQ0 A;  3MBH A;  4XF6 A;  3Q92 A;  3UMO A;  1JXI A;  2I6B A;  3RRF A;  3RQ6 A;  4KBE A;  1YGJ A;  4K8T A;  4EUM A;  3UBO A;  2QHP A;  3NL2 A;  2DDW A;  3QA2 A;  4XCK A;  2DDM A;  3FHY A;  3RQ5 A;  4K9C A;  2R3E A;  2HW1 A;  4O1L A;  4S1H A;  3RS8 A;  1V1B A;  3W4S A;  3K5W A;  4KAH A;  3B1O A;  3RTA A;  3RRB A;  4LCA A;  1BX4 A;  3IH0 A;  3B1N A;  3BF5 A;  2PKM A;  2ABQ A;  4KAN A;  3RU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...