4GMGA

Nadp+ bound structure of a thiazolinyl imine reductase from yersinia enterocolitica (irp3)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
365
structure length
358
Chain Sequence
GLVPRGSHMPSASPKQRVLIVGAKFGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPLYTSPEQITGMPDIACIVVRSTVAGGAGTQLARHFLARGVHVIQEHPLHPDDISSLQTLAQEQGCCYWINTFYPHTRAGRTWLRDAQQLRRCLAKTPPVVHATTSRQLLYSTLDLLLLALGVDTAAVECDVVGSFSDFHCLRLFWPEGEACLLLQRYLDPDDPDMHSLIMHRLLLGWPEGHLSLEASYGPVIWSSSLFVHSLYRRPEILRDPPGLTRSAAPLSWRDCCETVGPEGVSWLLHQLRSHLAGEHPPVACQNVHQIALSRLWQQILRKTGNAEIRRLTPPHHDRLAGFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Structures of a Thiazolinyl Imine Reductase from Yersinia enterocolitica Provide Insight into Catalysis and Binding to the Nonribosomal Peptide Synthetase Module of HMWP1.
pubmed doi rcsb
source organism Yersinia enterocolitica subsp. enterocolitica
molecule tags Oxidoreductase
molecule keywords Yersiniabactin biosynthetic protein YbtU
total genus 109
structure length 358
sequence length 365
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4gmgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gmgA01
3JCZA 1ZBQA 4CUZA 4XRGA 5HRUA 2PKQP 2PKRA 4IIUA 4BV9A 5IFLA 4IQ8A 3FNHA 3IUSA 2WSBA 1EFLA 2C5EA 2NVUB 4KDEA 1PQPA 1QLJA 3IL2A 4MVJA 2ZTUA 4O6VA 2FOIA 4UAGA 4DGSA 1FDWA 3LT0A 3B70A 3H9QA 1GZ6A 4MPDA 3UVEA 1NQAO 4CMAA 4Z3DA 5U1PA 1E5LA 2EIHA 3ZHYA 3WGTA 2G76A 4BNLA 4FBGA 1DPGA 1JN0A 3CMCO 2GSDA 4EUEA 2C59A 3BZUA 3RI3A 1YQDA 4MP8A 3S2GA 1ZSNA 5JLAA 1R4MA 2DT5A 1DIAA 3IIEA 1LX6A 2GUGA 4E5MA 5KJFA 4XRRA 1E77A 1LU9A 3ROKA 1EK6A 3ICCA 3Q11A 3QVOA 1BXGA 4KZPA 1JW9B 1KS9A 2CZCA 4Y9DA 1BXKA 2WE7A 3D3WB 3W8FA 1C14A 3K8ZA 4K26A 3SJ7A 3KTDA 1I01A 2AG5A 4FR5A 4YB8A 4R69A 1UAGA 2IDZA 1WMAA 1ZXBA 2CF5A 5L4NA 4YJHB 4FJ0A 1NXQA 2OL4A 4QTZA 3V2HA 1H9BA 1MV8A 1T1RA 4URFA 4QO7A 4OH1A 3PLRA 1UXJA 2OBYA 4IZIA 1BVRA 1A5ZA 4QQRA 2YJZA 1YL6A 3NEPX 3WLEA 2FHSA 4GBJA 3QV1A 1NTOA 3GN1A 5CP8A 3INRA 1AXEA 1ARZA 3DZFA 4BO3A 5H81A 3TFOA 4DLAA 1E3EA 4YTEA 3PI7A 3KYCA 4BO2A 4JP3A 4BNJA 3RC9A 3DWFA 3KVOA 5FF9A 2Q1WA 3P5SA 1XELA 4DQUA 4DC0A 4G5HA 5JXWA 1P1FA 4AJNA 1GZ4A 2AMFA 3LYLA 3JV7A 2ZJ0A 2WYVA 3VH2A 3U3XA 3L6DA 1DFIA 4IDFA 2GNAA 2B37A 4IQGA 1PGOA 3FF4A 2VNSA 1QLHA 1U5AA 4RORA 1E0DA 3ETDA 4B7UA 3RBVA 1ENPA 1NNUA 4CQLB 4MINA 2CY0A 1C1DA 4U0JA 4ALIA 3FR7A 5CFZA 4BNNA 4MVJP 3LVFO 3M6IA 2NQ8A 2FY8A 1ZSYA 4IJKA 1EUZA 3AOGA 4L8VA 1RM4A 1DLIA 1LDYA 3H3FA 3H8VA 5ENDA 1NFFA 3JQGA 4TVBA 5DCWA 1O0SA 1A7KA 1UZMA 1YOVB 3G1TA 4WLOA 2ZATA 2QZZA 3PFFA 4E12A 1NBOA 3O9ZA 1BG6A 1LQTA 3GMDA 4J49A 3VVCA 4YT8A 2AQHA 3BTVA 2B0JA 1CJCA 2X86A 4QFDA 4CM8A 2VYNA 4CMHA 4ALMA 4DIBA 1C0PA 3EK2A 2WM3A 5DP1A 2Q49A 4J0EA 2Q22A 3Q9NA 4CLOA 5I7VA 3JQBA 2I9PA 5EQFA 4GQAA 3ZDFA 1HE2A 1R0SA 4CLDA 4ALNA 4GVLA 3IC5A 4E2ZA 1NQ5A 3QE3A 4OKIA 2W2KB 3SLKA 3X2FA 4L73A 1T2AA 2IZ1A 2UYYA 3QP9A 4YPOA 2O3QA 4LISA 5JAQA 3PYLA 4W9NA 1TI7A 2R00C 1UXIA 2AA3A 3OQ1A 1HDXA 4HNHA 2WWRA 4L74A 1VL6A 4L76A 1R0LA 4RPGA 3B1FA 2JD1A 3RU7A 2YDXA 3GVIA 4QEDA 4DBZA 4TKMA 4JP2A 1WP4A 2R00A 3IDSA 2EF1A 2NVUA 3PXXA 2R2GA 2UUOA 4QECA 2ZTVA 5COBA 5KCZA 4XDZA 1MFZA 3GAFA 2OORA 1KEUA 1V35A 2VHWA 3R0IA 4CM5A 3RUAA 3TOZA 5A02A 1D3AA 3KO8A 4PZEA 1SO8A 5JY1A 2P9CA 3BIOA 1DFHA 2AQIA 2EERA 4E0BA 2VYND 2BELA 3ZGYA 3BAZA 4J91A 3RVDA 1DB3A 4KUGA 5AOVA 4Q39A 4YEDA 3WXBA 3WIEA 5KJEA 2GN8A 4Q3DA 1E7MA 1NWCA 2B5WA 1LNQA 3GVXA 4G65A 4DREA 1E3WB 4MVJG 1ISFA 3RJ5A 1PU2A 2OBNA 2D5CA 5T67A 2ZTLA 1T25A 3EY4A 3ZHXA 1J5PA 1VSUA 1RM0A 1K6JA 1SOWA 1ULUA 4MP6A 1PS8A 1QRRA 2Q45A 3AY7A 4R16A 4B4OA 3COSA 4MKXA 2V7PA 2FSVA 2SCUA 3R3JA 1DIBA 1EQ2A 1X0XA 2ZB7A 4II3A 3PWZA 3TF5A 1WLYA 1SB9A 4N18A 1XIVA 1VC2A 4CQMD 5L7WA 3KYDA 4NIMA 3SVTA 1MX3A 2X0NA 1F8FA 1EUCA 1UXGA 1D4FA 3KM0A 1S6YA 5CDSA 1OI7A 2PR2A 1YDEA 3VDRA 2GDZA 1RYDA 1ZK0A 4I8XA 4BNUA 2I3AA 4PVCA 1H9AA 3T4XA 4BNGA 3BXXA 3C7CB 3I6QA 3S2EA 5T5QA 3M2TA 4XEHA 4PLFA 1HYHA 1L7EA 3UUWA 3GRKA 1MFPA 3ZCXA 2R6JA 3DMYA 2NVBA 1PIWA 5F5NA 4GGOA 2NU9A 5CEJA 4YQYA 2BFPA 2HO5A 4FC6A 2NU6A 3H5RA 3IUPA 3RFTA 5FWNA 2QW8A 1ONNA 3ANLA 5F1KA 2NACA 1NR7A 3ZWAA 1VJTA 3DDNA 4DIOA 3I9LA 3NTOA 3MZ0A 1C1DB 3E82A 4RZIA 3IKVA 2C7GA 1E3LA 5L95A 4C4OA 3ZNQA 4BIIA 2YW9A 4HUJA 2WMDA 3NJ4A 3NDRA 1XA0A 4IJUA 4E21A 1GQQA 1MG0A 5KTKA 3GRPA 3DTTA 5L40A 4MO2A 4DXHA 3B20A 1U3VA 4UVDA 5BR7A 4R41A 4CQMA 2JFHA 3HZZA 4RF2A 1H5QA 4YCAA 3BMQB 1FMCA 4UUMA 3JYLA 2AW5A 2Q46A 3H9JA 1AE1A 5C3MA 4MVJI 5JDCA 1IZ0A 1HLPA 3NKLA 5G0SA 4D7AA 4B8ZA 3MJCA 3JQCA 3RU9A 1LC3A 3WMWA 5T57A 1DC4A 4AJLA 4J1TA 4YT5A 4AJKA 2UVDA 3PJFA 2OP0A 4PLWA 4FCCA 3KB6A 5JO9A 2Y1OA 1I3LA 4GMGA 3QWIA 5HWSA 1BXZA 3VH4A 4AICA 1SZJG 5JFOA 2Y0DA 2X9VA 3RQSA 1WW8A 2C7VA 3AJRA 3ETGA 3HHPA 4ALJA 2GD1O 3JD0A 1Y5RA 4R9SA 3JYOA 4A73A 3AK4A 4U8GA 1B7GO 1R66A 5DOVA 5KVCA 1MB4A 3I9OA 4OGWA 4H7PA 4R5HA 1ONOA 2VYVA 4IMPA 4WNCA 2HJSA 1PJBA 3B6ZA 5C37A 1IOLA 3RUEA 1W6UA 3WGYA 4FQ8A 3E1KA 4ZRMA 2E6UX 3L6OO 1HYGA 2EWMA 3RWBA 4CM4A 3RIHA 2I65A 3A1NA 2BHLA 3ZU3A 4FN4A 1KVQA 1SCUA 3LQFA 1B15A 3S8MA 3ZV3A 4JBIA 4WUVA 4NBTA 4CM9D 1ADBA 3OHSX 4BNZA 4M87A 2YZ7A 4ZA2A 1X1EA 3P19A 3F1LA 1SEVA 1BW9B 2YFQA 3KLPX 1HDZA 2X9NA 1ENOA 2HU2A 4EUFA 3WNVA 4YRAA 3ZWPA 2X7HA 1E3JA 4RVUA 4H16A 4AJIA 3CZMA 4IBOA 4J4HA 3EZYA 4NJMA 7MDHA 5L53A 4PG7A 5THQA 4WKGA 1V3UA 4KMSA 3DHYA 2Y1GA 3LF1A 2RHRA 3ABIA 2J3KA 2Q2WA 3D1LA 2IRWA 4Q3EA 4J9VA 1TLTA 4FDAA 3IOYA 3WB9A 2DTEA 2YUTA 4Y6SA 4FGWA 3TZKA 4GAEA 4FD3A 4E4YA 3INGA 1EVZA 1LQUA 5KJCA 3NTQA 4HADA 1QP8A 3GEDA 4I5EA 3VPHA 1GEEA 2ZJ1A 3ZWBA 4R9RA 2LDBA 4IM7A 4XGNA 1ISJA 4IIVA 4ONEA 5TIIA 1KIFA 1JLLA 3D4NA 4DPKA 1UP7A 3PIIA 1W73A 3GDGA 4AVYA 4KP7A 3QLJA 4I1IA 3A9WA 2EG9A 3JQ6A 4NK4A 1LI4A 5GZ1A 3RUHA 1D7OA 3ST7A 3TWOA 4XWYA 1ZVMA 5CEEA 2DC1A 3EHEA 4YQZA 2PY6A 3GUCA 4XB1A 2HMSA 4E33A 3D3EA 3WLFA 5DBIA 5JMPA 3E9QA 4IDGA 1VKOA 4OAQA 5ILOA 3DAPA 5TGDA 1ULSA 2I6TA 3DAFA 3DL2A 2EW8A 4M8SA 4YJDA 1V8BA 1ZH8A 5EQDA 1L1FA 3RUFA 4BKQA 4CR7A 4E31A 5A03A 3JQ7A 8ADHA 2YHIA 3KYDB 1U8FO 4DUPA 4FGSA 1HL3A 3W1VA 1Q2XA 1MA0A 2ET6A 4MVJM 5ILGA 4PCVA 5EIOA 4IDEA 5BSGA 3LU1A 3WGGA 3VDQA 4YRBA 3EDMA 1Y9AA 4MKZA 5TNXA 4YJFB 2PD6A 1YJQA 4ZQGA 4BMNA 1I24A 1BHSA 4MVJF 2C29D 4FJ1A 1SNYA 2W90A 4KTVE 1WDLA 4E5NA 4I5GA 1MXHA 3TQHA 1Z7EA 4WPGA 5IZCA 1XU7A 4AJHA 5TT0A 2ZYDA 4FC7A 1R12A 4WJZA 2VRCD 3FBGA 3E6AA 2V6MA 1G6KA 3EYWA 1LSSA 3W6UA 4KUEA 1U9JA 4R3NA 1TVEA 3EVTA 1HDOA 1UP4A 4NG5A 5JPIA 3DBLB 4R3WA 3T7CA 4AFNA 1EVYA 2ZQYA 1H6DA 2TMGA 3DC2A 3DHEA 4JK3A 1ZW1A 1WVGA 3MJ4A 4LVCA 4A5OA 3WGIA 4D79A 3ZW9A 2FR0A 3ZWVA 4CQMB 4DC1A 2X5OA 4GX0A 4OOFA 4PLTA 3ZWMA 5AXBA 2VRBA 2VZ0A 1UZLA 1AGNA 5MGBA 3DAGA 3RC2A 1E92A 4JROA 3ZU2A 4F45A 3CZRA 4UVHA 1NFQA 2VN8A 4DPMA 3UXYA 5JCJD 2I5PO 3KSUA 1YONA 2H1SA 3PJDA 3QW2A 5L4LA 3ZWXA 2AHRA 3EW7A 1AN9A 1V0JA 3DOOA 3BMOB 3CTMA 2Y66A 5LDGA 4XKJA 5T8KC 3AUUA 1TXGA 5MDHA 5F5LA 3CIFA 4OM8A 2X0JA 5C7IO 4R1NA 2VOEA 3PIDA 3OECA 4F3YA 1BSVA 1QG6A 2VRCA 2BFOA 3DZHA 5G4KB 1U5CA 3VTFA 1NPDA 1NVGA 4LCEA 3WDSA 4UUNA 3JQ8A 4Q3BA 3SC4A 4PG4A 1I3NA 1ZMTA 1WDKA 1HDYA 4CUKA 4I9NA 4RF3A 1VL8A 4PLZA 1PJ4A 1RM5A 4BUCA 3MTGA 3OJLA 5LC1A 4RF5A 5JS6A 1HT0A 4WOJA 3L9XA 3KOUA 1ISGA 4M54A 5KWEA 4AG3A 5U4QA 1N92A 3I4CA 4EJ6A 4EJ0A 5DOZA 1ZIDA 3WSWA 3VZPA 2F1KA 1QYVA 4J2OA 2P9GA 3NT2A 1FXSA 4Q3CA 1QKIA 2W2LA 1YH3A 4BV8A 1SB8A 3QWFA 4BKUA 3ULKA 4BKPA 3H9UA 2VZ8A 5LCXA 2B69A 4BO5A 1VL0A 2Y99A 3ZI0A 2EKLA 1O8CA 3CXRA 1ISMA 2DM6A 2VOJA 3WR5A 5FI5A 2P4HX 3PGXA 4BNFA 1HSZA 3OETA 1Y8RB 3DBHA 1GYQA 4M55A 5EMHA 1V3VA 1EEHA 2ZCUA 2XXJA 3OM9A 3F46A 4P4LA 1G0OA 2IEBA 5JE8A 1CQJA 3TNLA 4BL5A 5F1OA 4E5YA 1B14A 2PWZA 4WLEA 3E48A 4FIZA 1QMGA 4CL8A 3V8BA 1XYGA 2PZKA 3ONFA 1U8XX 4YT4A 1ADCA 3U62A 4W7IA 4E5KA 4JX8A 4TRNA 4W9NC 1K6XA 3ZU4A 1VPDA 1WAMA 2QIOA 4LMPA 4OXKA 2DBRA 2JCXA 5IF3A 4PLCA 4YDRA 4R54A 4P38A 2TMDA 4D46A 1W4ZA 4B8WA 1R37A 2PGJA 5I7SA 1LC0A 2VT3A 3GZNA 5B1YA 3HDQA 5C5IA 3QHAA 3U4HA 3ZV5A 3V1TC 1QYDA 4BOYA 1GY8A 1PZFA 4WEOA 5BNIA 1LBEA 3GR6A 3L0DA 5T73A 5BSFA 1YBMA 2JAHA 4YT2A 2OP1A 3D64A 1L7DA 1P44A 1NHGA 5FYDA 3SJUA 5A3VA 1DJNA 2ZCVA 2BH9A 3NV9A 4DL9A 2GRAA 2FSSA 4B3IA 4FOOA 3OA2A 5BSHA 1O9BA 4HFRA 2DBZA 3EZLA 3GMSA 3HB4X 3PYMA 1A72A 3TFQA 2HSDA 2DFVA 3PHGA 2ZQZA 3JD2A 1HTBA 4IDCA 3RUIA 3Q1LA 1C0KA 1RKXA 2DUUA 4J7CA 3OA0A 4NBUA 3CINA 5L45A 1TB4A 2PZJA 3OH8A 4RPHA 5A9SA 4MOWA 1BVUA 2AEFA 3RFVA 1U2DA 4KTTE 3NDIA 1IE3A 1P1RA 3UGKA 2Y1CA 4I08A 2WEKA 3TL3A 1KC1A 4JQCA 4XB2A 1I32A 3DEYX 4ZN6A 1E7SA 5K9ZA 4DIFA 2VWQA 1KY4A 1JQBA 1GZ3A 5KJ6A 2ZB3A 1SC6A 3E03A 2O48X 4NJOA 3GFBA 5K6AA 2HUNA 4RZHA 4RCVA 4WLVA 4XD2A 2NTNA 4GX2A 4QXMA 4UUPA 3AOEC 3AI3A 4CV2A 3MOIA 3OQBA 3K92A 4Z0TA 4ND2A 3CUKA 1EDOA 1DSSG 1HZZA 3MJEA 1XLTA 2A35A 4WCFC 3FTPA 1PSDA 5ER6A 3WWZA 5I8WA 1GTMA 1JDJA 4OJNA 2X1HA 3WFJA 4DQVA 4NQZA 1JVBA 1HETA 2CVOA 4ZQBA 3ZNPA 4C7KA 1PGJA 1J4AA 2IZZA 4KWHA 4TZTA 2DUWA 4RQUA 4TWRA 1GCOA 1NM5A 4Z0HO 1BDMA 3KEOA 2NLOA 3DONA 1E1KA 1EBFA 1NVMB 3C1TA 2G5CA 1LDBA 4EEZA 1E6UA 1I33A 1YOVA 4YAGA 2AEJA 2OZPA 3K31A 5TF4A 1HDGO 9LDBA 1IZ9A 4J6FA 2H63A 1B8PA 3LK7A 3LLSA 1W0CA 4TVOA 2A94A 1E7YA 1ZNQO 4NBWA 3BMNB 4OQZA 1ENYA 3EUWA 4B3JA 4J9UE 4O1MA 1GEGA 4RL6A 1GQYA 3QWHA 4OKNA 3RASA 3VZQA 1H0KA 4A03A 1B3RA 4R5MA 5KVVA 1JKJA 4OSPA 5ADHA 4GKBA 2IODA 3I52A 1LSOA 2B4QA 3ON5A 2XF8A 6ADHA 1KVTA 4BNVA 3RSHA 2VTDA 1ZSVA 1V6AA 3FD8A 4M49A 4MVJE 5IN4A 5JYFA 4PLPA 1TT5B 1HKUA 2VUUA 2VHZA 3DZBA 1M6HA 3OJEA 2EP5A 3UOGA 2P4QA 2H5LA 1FK8A 4FS3A 1ZK1A 3RBZA 1P0FA 4HWKA 2EJWA 4A27A 3AUSA 4XYLA 1YS4A 4OQYA 4E5PA 1JAXA 3I6IA 5JMWA 4BKOA 1NQOA 1XHLA 4BMVA 1ISIA 3FHLA 5U9CA 2RBEA 3BYZA 1XSEA 4DBVO 2BFMA 3OIGA 1M76A 6LDHA 2J5RA 1K5HA 3PGJA 4WOKA 1G0NA 2GN9A 8LDHA 4TSKA 1QSGA 3JSAA 3OQ6A 4OXNA 1E3IA 5GZ3A 1Y8RA 1KVRA 2O50A 1HE5A 3NGXA 3DHNA 3H2SA 3W4KA 5KNLA 4J7XA 5TSDA 4RQTA 4P4NA 3ANMA 3VKUA 5IJZA 4FFNA 2NV6A 1FDVA 5KJ1A 5HM8A 2FZWA 4CMIA 4DRYA 3JYQA 3Q2IA 2Z1MA 2YFHA 3VPFA 4EDFA 3AM4A 2JFGA 3JQAD 3NUGA 1DJQA 1Z75A 4CLEA 2E49A 4L4RA 1QYXA 3P7MA 3M1LA 3DBVO 4ZGWA 5DBGA 4EGFA 1LEHA 2QX7A 4TRJA 4XDYA 3N58A 1TA4A 1LDGA 1UH5A 1VE9A 3GHHA 5A9SB 5F1PA 2AE1A 3G79A 4OL9A 4RDHA 1IYZA 4XR4A 2YV3A 3H5NA 2QYTA 1WMBA 4ITUA 4P4GA 4YAJA 2WYUA 2RH8A 3EVNA 2PLAA 3O4RA 2JKVA 2Z5LA 2BLLA 3LC2O 2O3TA 1OOEA 1H6CA 1TT7A 1C3VA 5KVSA 1HXHA 3INTA 4YJGB 1CIVA 1MC4A 4LSMA 2B35A 3NYWA 3ANNA 3WQSB 2Q4EA 1P0CA 4LN1A 3LSYA 3TZ6A 3FN4A 3I4FA 3LT4A 2J3HA 2NNLD 5BNFA 3GEGA 3WX0A 2IYPA 1ID1A 5HTOA 4NMHA 3WWYA 3W4JA 4YR9A 5CG1A 2O3UA 4ND5A 1B8VA 3U09A 3W8DA 2HLPA 2D8AA 4KUHA 2GN6A 3I9KA 5G0UA 1PS0A 4W6ZA 5TJ9A 1LSUA 2HK8A 2I99A 5K6AC 1LTHR 4RPJA 3C7DB 1DC5A 3E9NA 4RVHA 2Y93A 3SXPA 3V2UA 4PLYA 4RV9A 4D42A 1GYRA 4BQRA 2BD0A 3DZKA 1JKFA 1QYWA 1Q7CA 3TZHA 5A4DA 3G3EA 1PQWA 1Z45A 2IEDA 4WGGA 3GFGA 2PD4A 1YO6A 3TN7A 1LA2A 1PX0A 1Y81A 2BMAA 1B2LA 3C1OA 3HDHA 4JXKA 4N7RA 4CV1A 1IHXA 4CLHA 4CR6A 1BTOA 1NP3A 3L4SO 2YHUA 4NFYA 4RVGA 1Z6ZA 4NJMB 4E30A 1HDCA 3BTUA 2HK9A 2HJRA 3D4OA 2RHCA 3PJGA 3QWBA 1YL5A 1Y1PA 1LDEA 2RCYA 4ZJUA 2Y1EA 1O94A 3NX4A 3NAQA 3DB2A 3LZ6A 1YQGA 3S55A 3O03A 2X5JO 3E9MA 2C5AA 1I2ZA 3VZSA 1PTJA 1CRWG 5GZ6A 1OC2A 3D0OA 1T26A 4ILKA 5DCYA 1NQTA 3AI1A 1SPXA 5F3RA 3MWEB 4AJ4A 3QVTA 4ROSA 3PQDA 3MJSA 3K9QO 5I7EA 5IAAA 5ES3A 5ICSA 1BGVA 1U1IA 1GUYA 4O0LA 3F47A 1I2CA 1R4MB 1KETA 4XQGA 1A71A 5JW6A 2HQ1A 1D1SA 4JNKA 1FJHA 1KYQA 1VI2A 2P9EA 3HB5X 3SC6A 1LDNA 1NASA 3AI2A 4WK6A 4BGUA 1LLCA 4PRKA 4D3SA 1G1AA 3VPGA 1O89A 4BNXA 4A0SA 3GNQA 1E5QA 2EV9A 3N74A 1ZK3A 3RD5A 4DLLA 1SMKA 4IDAA 1OZAA 2PD3A 4YVFA 4GLOA 3FTNA 3RC7A 4J4TA 3WBBA 3K2EA 1HF3A 3OJ0A 2X0IA 1J0XO 4EW6A 3L07A 3RFXA 1DXYA 4AL4A 1YL7A 2Q4BA 3KYCB 5BNTA 4IGFA 2J6IA 4BNHA 4BHTA 4UREA 1BRMA 1KEWA 2QHXA 1LRJA 4N54A 4PG6A 5T8KA 3ASUA 4CM1A 3GPDG 2NTJA 4NU6A 2ILTA 3PZBA 2CUKA 4YBZA 3KRTA 2P2SA 3PHLA 1Q1NA 1XGKA 5HS6A 2P5YA 4ZD6A 4PFJA 5G2OA 4A26A 1YDWA 2F00A 4QSMA 3T4EA 4DQXA 3AOEA 4Z9FA 2X23A 4RJTA 1AXGA 3CPSA 1C0IA 4BNIA 3F1KA 5JNLA 4D0SA 3OEYA 2UDPA 4BO9A 1U4SA 2DPGA 4OOEA 3RKRA 4WLNA 2JCVA 2NVWA 1CQIA 3I3OA 1JVSA 3I9JA 2HMVA 1N7HA 1C1XA 1JWAB 3ROQA 1DRWA 3JTMA 2VWGA 3GG2A 1DIHA 2D4AA 1WWKA 1T2EA 3G1UA 2CD9A 3NGLA 4IQ0A 4L0QA 4PZCA 4MKRA 2CNBA 3NJ8A 4CM8B 5A9TA 3QVSA 1LXCA 1PL8A 1T24A 1ZK4A 3SX2A 3VKVA 5ITVA 4E2YA 3CMMA 1YWGO 1I30A 5JAIA 5EINA 1E1MA 4PZDA 4EYEA 4ND3A 5A05A 3JQ9A 3LT2A 3WIDA 3EMKA 2AQ8A 4UVGA 4XX0A 3PHIA 5TS3A 3RJ9A 4YRDA 1DRVA 3D3WA 2VT2A 2FP4A 1PEDA 3FNFA 2X4GA 1IL0A 3I9MA 4B4UA 4JJGA 5G4LA 2A4KA 5DBFA 1DC3A 5F21A 1P1KA 5G0TA 3L4BC 3PRJA 1VJ1A 1T1SA 2J3IA 2P68A 3GA0A 3ADOA 2PK3A 1JA9A 4MJLA 5C7OO 4OYRA 3CH6A 4BO6A 5DN9A 3RUCA 3GG9A 1K3TA 2XOXA 3ONEA 4ZQFA 1J6UA 2XPCA 3ONDA 2V6BA 1YXMA 4EUHA 3UICA 5EN4A 1ADGA 3HDJA 2QG4A 2JJYA 4M89A 4N5MA 3CE6A 4NR0A 2YQ5A 3OBBA 4QX6A 3FR8A 2P5UA 2VCYA 1E1LA 3Q0EA 1Q0HA 3AUAA 3DQPA 2Q50A 1MGOA 3GGPA 3MCVA 4FFRA 3WSVA 1CWUA 2Y0EA 5L9AA 3WOHA 2J8ZA 4IGEA 4G2NA 3QVWA 3ZHZA 4R01A 1I3MA 4NI5A 1HZJA 2BFAA 1Y8QB 2WE8A 5DZSA 2HAEA 1KVUA 4B7XA 1KY5A 4DMLA 3D5TA 1RWBA 3QY9A 3SLGA 3GDOA 1OAAA 3JYPA 4XCVA 2WD7B 4Q3AA 4DMMA 1GV1A 1EQUA 3DBHB 3ZH2A 1XWFA 1XKQA 5AYVA 1BXGB 1Q0LA 4R1TA 2DBVO 5FEUA 4HBGA 1ZKMA 4LGVA 1WNTA 2I76A 4TRRA 5I7FA 4I9UA 1Q7BA 4FJ2A 2NQTA 3GZ4A 4NDNE 4RVFA 4CLOB 4DA9A 1KERA 4E2WA 5IDXA 5IXYA 4KOAA 3U5TA 3IP1A 1DBVO 2BGKA 3HN2A 4IDBA 3T7EA 2VHVA 2DKNA 2E82A 1QORA 2E48A 3V1UA 3R3SA 2JCYA 1P74A 3A06A 3GAZA 3PDJA 3ZWCA 4BS9A 4F46A 1IUKA 2ZKLA 5M6DA 4S1VA 2QQ5A 2HMTA 3GVPA 4Z9YA 5K0ZA 3PJEA 3JYNA 2B36A 2CSUA 2H6EA 4Y67A 4Z0PA 1VSVA 5A5FA 2GR9A 2EP7A 4HP8A 1P31A 2C07A 3FSRA 5JYAA 2OMEA 1RPNA 1Y7TA 4CM3A 2YQ4A 3Q3CA 1PZEA 4HY3A 5JCXA 3DOJA 4ZICA 4B3HA 1ZUD1 4O59O 4YAIA 2YV2A 3F4LA 5IDYA 1EDZA 1O6ZA 2GPTA 4CQLA 2Y0CA 3C24A 3IP3A 1B3BA 1VKNA 5KOIA 3UW3A 3KSDO 4GVXA 4B4VA 4FPXA 4L9RA 4Z3KA 2QZ9A 3G0OA 2P91A 2RIRA 4JGBA 2C0CA 1UR5A 1NVTA 1AHIA 2VZ9A 4PLHA 5J23A 4CODB 2YYYA 2O3RA 3OP4A 3RAJA 3FPCA 1LLDA 2JAPA 4GWGA 4L4XA 2J3JA 1VM6A 1H2BA 1HWYA 5EL0A 2PTGA 5H83A 3K2BA 4UVEA 4L4SA 1PJCA 5TQVA 4BO4A 2NU7A 4I5FA 4NNJA 2D59A 1Z82A 3A14A 4LSWA 5HS4A 1ADFA 1H93A 4ZQHA 3OICA 4YA6A 3WTCA 2OOSA 1K0UA 4K6FA 4BO1A 3U4IA 4ND1A 1PJQA 4JIGA 1P1JA 1P1HA 3RBXA 1P1IA 2CDAA 3H7AA 4PG5A 1C0LA 1SAYA 5JDCC 4CR8A 4J1SA 4D44A 1H2HA 5B4TA 1ZZEA 5TC4A 3FCOA 1N8KA 2GERA 1R16A 2W2KA 2VYVD 3MTJA 1GR0A 1CETA 1QYCA 2I66A 3P2YA 1YBVA 2FMUA 2B4TO 3TJRA 1PGPA 1DOHA 5FI3A 3ZV4A 1KEPA 2DLDA 3GZNB 3ZWYA 5ENVA 1OFGA 3C8MA 3CSDA 1NX6A 3VHRA 3PQFA 4FFLA 3KEQA 3H65A 3FRJA 4J43A 3WMXA 3JQBC 3KLMX 1NPYA 1E1NA 3MJVA 3PDUA 3WYEA 4UVIA 2BI8A 3DBRA 3KBOA 2X0RA 1IB6A 3ZW8A 4CMBA 3KHUA 1DIRA 1A4UA 1U3WA 4IMRA 5EESA 4GSLA 1WZEA 2VQ3A 4RVSA 1MG5A 2O4UX 4CLRB 5KIAA 2G1UA 1J49A 4AJ2A 5G0VA 3VC7A 4E6PA 2HMWA 3LF2A 5BT9A 4U7WA 1UDCA 3OEWA 3L6EA 4ALLA 2I3GA 1NFRA 4R51A 2HKIA 2QRJA 3BMQA 1PQUA 4BB6A 4AJ1A 1DLJA 1LRLA 1B26A 4PGFA 1CYDA 2WDZA 4K1LA 1FDTA 3HADA 2NU8A 3QVXA 5DP2A 4A7PA 5JDIA 2PNFA 3QA9A 2IZ0A 1OC4A 7ADHA 1F06A 3C3XA 1DC6A 3I9NA 3PHHA 1QR6A 3GGOA 5B12A 5I9NA 3O8QA 5IG2A 5THKA 5CPFA 4NK5A 4CLXA 4LK3A 1V9LA 3OFSA 3IJPA 1HE3A 3JD3A 4ALKA 3PLNA 5LDHA 2FN7A 1X13A 4EI2A 4HFMA 4GKVA 4WLUA 4ZRNA 5DDIP 1GYPA 1RJWA 1UJMA 5ITWA 2JL1A 1KC3A 5CDTA 4TQGA 3VOSA 2PA3A 5HA5A 4PLVA 3JD1A 3LT1A 4L75A 3UF0A 2A92A 2QRLA 4TMFA 2EW2A 1Q0QA 1F17A 1MLDA 2CVQA 4JBGA 4NHEA 2OXIA 1LLUA 1E3SA 2WD7A 3NT4A 3F5QA 3UHAA 1FDSA 2E4AA 2EGGA 4D0RA 2O2YA 1MP0A 2AG8A 2JD2A 1LDMA 5CG2A 1F0YA 5EPOA 4CMCA 1UUFA 3F3SA 1Y8QA 1HRDA 4GX5A 4INAA 1M67A 3DFZA 3PWKA 4NZ9A 2VNAA 3OF2A 2DTXA 4JJFA 1IULA 2JD0A 2D0IA 1KEVA 4KWIA 3OJOA 4MVJH 1Z73A 4MVJD 5JC1A 1BDBA 2NWQA 1GQ2A 5JDIC 3OSUA 5KVQA 2FR1A 4GI2A 4CMEC 4O5OA 1AHHA 4OO3A 1N1EA 1PR3A 3AW9A 3BA1A 4XJSA 1T2CA 3Q6IA 1RM3A 2PH3A 1E6WA 3GGGA 1DIGA 1X7GA 3TZQA 3AU8A 1EMDA 2UV8A 1ML3A 4YAEA 3GNSA 3D7LA 1IY8A 2DQ4A 2Q2VA 4F6LA 2Q99A 3GC6A 1VRWA 3WGZA 2IYOA 3WGQA 4E2XA 2GCGA 2D1YA 5JY6A 3TOXA 5A3JA 5BSEA 1GFSA 2DBQA 1Z74A 2FR8A 4J7UA 4BNWA 4EITA 1ZEJA 3GUYA 3PYXA 1N5DA 1GV0A 2E37A 2PGLA 1PZHA 4CM7A 5A1TA 4XQ9A 3W4IA 4XQCA 2PZLA 4CMGA 1T2DA 1I3KA 1Y5MA 3GH3A 1WZIA 4CMIB 1PJSA 5AVOA 4XGKA 2ZYAA 1HLDA 1YQXA 3DFUA 4CM4B 3K96A 1S7CA 2X8LA 5DCUA 5CAEA 2CMDA 3ZWNA 3VVBA 5I9LA 1ZJZA 2RAFA 4R1SA 2WTBA 1PJLA 4BVAA 4GWKA 4FOSA 2I67A 3BMCA 4CL3A 1EVJA 4XR9A 4A10A 2V65A 3NT5A 1KVSA 3OMLA 4YJFA 3EC7A 1F12A 3BHIA 4CM9A 3VPSA 1BW9A 1GPDG 1X1TA 3H4VA 1R4NB 4WCFA 3TPCA 2GASA 2C2YA 2FPIA 3VZRA 1H6AA 4YWJA 2W4QA 1I10A 2GZ2A 2EHDA 3ZWWA 2EGHA 3WGOA 3UH1A 3KZVA 1XDWA 2CDBA 1H94A 2EEZA 5B37A 1WXDA 4BKRA 2X9GA 4OIMA 5CDUA 4Q9NA 3R6DA 1GCUA 3H9GA 3PZRA 5KKCA 4CV3A 4D41A 3D4PA 3E5RA 1YRLA 5TT1A 4O63O 3ICPA 5TLSA 1PL7A 4HFJA 1PL6A 4EBFA 3RUDA 3F5SA 3H3JA 3LC7O 3IAHA 2OGUA 3LDHA 3MWDB 2W8ZA 1IHYA 1PGNA 1DEHA 4MDHA 2CF6A 1HDRA 3PFWO 2EKQA 3DBRB 4KQXA 4P22A 1XQ1A 4CPDA 2J5QA 1HYEA 4TROA 3PQEA 1XQ6A 3DR3A 3GEMA 3TSCA 2HRZA 2UUPA 2ZB4A 4BNTA 5L7TA 2DVMA 1PGQA 3C7AA 4PG8A 1DAOA 1Z7BA 4W7HA 1XEAA 4YACA 2PZMA 4DPLA 3L77A 1ZCJA 3ZNOA 4HXYA 3WFIA 3BMOA 4KQWA 4B4WA 4RLSA 4CM6A 1GUZA 3GVHA 1R0KA 3GLQA 2PKQO 4G81A 1MC5A 1CERA 5CEFA 1IPEA 3QWAA 3ZN2A 4BO0A 5JC8A 4LRSB 1X7HA 3ZHBA 3PEFA 3JQ7B 4XIJA 2UAGA 4FFPA 2NSDA 1E7WA 4IUYA 3ENKA 1LRKA 1A7AA 3JQ8B 4W82A 5EJ2A 3SEFA 4J4BA 3I5MA 5KKAA 4ID9A 1KOLA 4Z9XA 3IMFA 1EK5A 4XYEA 2ZYGA 1LSJA 1DDOA 4BGIA 2FWMX 3AFNA 3O26A 4D45A 4YYZA 4J90A 4XGIA 5IDWA 3DOCA 3DMTA 4ZQEA 2HK7A 1I36A 3HFGA 3WTBA 5B4VA 2YDYA 4GX1A 4D43A 4H3VA 1LLQA 3S2FA 1PJ2A 3V5NA 5CPBA 3WJAA 3VTZA 2Q1SA 3NTRA 4LMRA 1H6BA 4GMFA 3ETEA 3MEQA 4J2HA 3PHJA 2G17A 2BI7A 3CEAA 1JKIA 1E3WA 5DT9A 1EFKA 2PH5A 4N5LA 2XAAA 2O3SA 4AJJA 4M86A 3I83A 3F4BA 5CDYA 4LCJA 2GYYA 3BHMA 3KYBA 2POQX 4M1QA 2C2XA 1P45A 5IZCC 5BQFA 3IJRA 3ITDA 1N9GB 3UAGA 3AUTA 1GUFA 2JHFA 4OMUA 1U28A 4RF4A 4MIOA 4MIYA 4E13A 3HDYA 3KUXA 1GAEO 4R4JA 1ZFNA 1V3TA 4JLWA 4XYGA 1EE2A 5T6BA 1X15A 5JYDA 1EZ4A 1A27A 4UULA 4BQPA 4KDFA 2FRDA 2CFCA 1B0AA 3PWSA 5AQ1A 2BGMA 1GPJA 1ONPA 1R4NA 4WCFB 4B7CA 1FF9A 1JAYA 4K28A 1DO8A 4EEXA 3JQ9C 1A4IA 1O95A 4WASA 2QRKA 2GO1A 5G4KA 1U7HA 4GSKA 3RCBA 3AM3A 4GLLA 4R1UA 4WE3A 1JTVA 1VLLA 3GK3A 5CDGA 2JHGA 1DFGA 2GF2A 3V2GA 4D3FA 1EBUA 3D5QA 3BHJA 3IKTA 3ZV6A 3WJ7A 3GNTA 2RH4A 2DTDA 1YVEI 5FFFA 2VWHA 1WPQA 2O23A 2EJVA 5GMOA 4S3MA 5TJHA 1I0ZA 2O7QA 3K30A 3SBOA 4QFCA 1AUPA 5HBRA 3PP8A 4JJIA 3UCXA 3DTYA 3I1JA 3JD4A 1RYEA 3WICA 2IXAA 4JN6B 2GGSA 3ZWOA 4NFHA 4U0KA 2GLXA 5DNAA 4UEKA 3BMCB 1WDMA 9LDTA 1PJ3A 3OIDA 1BWSA 1JU9A 4HNGA 1U7TA 2W2LD 1I2BA 2BF7A 4I5DA 4DVJA 5A04A 3JQFC 5COAA 4NH4A 3EAGA 3KXDA 2FPGA 3QRWA 1R15A 3PTZA 2Q3EA 4LRTB 1B16A 1XU9A 2J5KA 3LC1O 4K9DA 1D1TA 4GGPA 3S1LA 5EERA 2Q2QA 3HG7A 4XYMA 4DLBA 3RC1A 3STHA 2C20A 3GT0A 1U3UA 4CV0A 3ITKA 4E32A 2X58A 3C85A 4BO8A 1TT5A 3MOGA 4IINA 1UDBA 3LLVA 4NFSA 3HN7A 3S2IA 2VWPA 3W6ZA 4UEJA 1ZK2A 1PJTA 4II2A 4WECA 3CKYA 3JQDA 2YY7A 4HKTA 3A28A 4J16A 2VHYA 3QIVA 2Q1UA 1YKFA 1YB1A 1HEUA 4HX5A 1MXFA 2G82A 4E3ZA 5I8ZA 3GVCA 5JYEA 1R6DA 1TEHA 4MP3A 5JAZA 1GD1O 4CMKA 1PR9A 4DYDA 2D5AA 4IS3A 3HQ4O 2O2SA 4RVDA 1HE4A 1I8TA 3GHYA 3HSKA 1SEPA 1FDUA 1ENZA 1E7RA 2IXBA 3E5MA 3H5AA 4IZHA 3AM5A 2ZIZA 2A9FA 4F6CA 3WNQA 1U3TA 2WD8A 4DYVA 1X14A 2Y68A 4XIYA 3ENNA 3KV3O 2NUAA 4OHUA 3VAZA 3H6KA 1K2WA 4U6QA 5G0WA 1UAYA 3VH1A 4IXTA 4N5NA 2D2IA 3ZU5A 3JQAA 3ZNNA 1QV6A 3X2EA 3L4BA 1YJ8A 4OSOA 1U2GA 1CDOA 1YBAA 5ER9A 5JSFA 2BKAA 4U6SA 5IDQA 1NHWA 2FPPA 3JQEA 4BGEA 5JBIA 1E6EA 1DHRA 4IJVA 2B5VA 5TX7A 4DWVA 4RPKA 3JQFA 1Y9EA 4XA8A 3DXFA 2PGDA 3BMNA 3K5PA 2AEMA 4I9HA 3ROPA 1NWHA 4J1QA 5J9GA 3K6JA 2C82A 2HMUA 4GL4A 1CEQA 4ND4A 4NU5A 3H2ZA 3OJFA 2V6GA 1UDAA 5C7LO 1DAPA 1F8GA 4FW8A 1IPFA 1PS9A 1Y6JA 4IJWA 4XZ3A 3HWRA 4TRMA 1U4OA 2VUSA 3L9WA 2FZEA 4XJTA 4FFMA 4PLGA 5IN5A 3ASVA 2BGLA 2BRUA 2O3JA 4J3FA 3BTSA 1ORRA 1EUDA 4BO7A 3E18A 4FSHA 5JAMA 4TZKA 3FWNA 4ZVVA 3IS3A 1UZNA 3F9IA 3PPIA 3UKOA 2HCTA 4XYBA 4ZU3A 4W99A 1N9GA 4Q3NA 2AE2A 3DZJA 3E8XA 3WGHA 4U5QA 1DRUA 3HNPA 2ZTMA 3GN2A 3ADPA 1P3DA 4XQEA 2X22A 4ZHSA 4BNKA 3I23A 4FB5A 3G49A 4NBRA 2V6FA 2WYWA 5DF1A 2Y67A 2HRBA 3OIFA 1XR3A 4J1NA 4YJHA 4WLFA 3UN1A 1M6WA 1PZGA 5TRTA 1D8AA 4AJOA 2Q1TA 1LJ8A 2DAPA 1P33A 1UXHA 2IE0A 3FNGA 5L51A 4YXFA 2VTEA 3WQQA 3RKUA 5L3ZA 2GZ1A 2EKPA 4K6CA 2LDXA 3WYCA 1OMOA 2G0TA 4PRLA 1HSOA 4UUOA 2PFGA 4JBHA 3KETA 5IXSA 1GU7A 1VJ0A 1K89A 4Y8VA 1GADO 3HUDA 4GPD1 2YV1A 4QO8A 3GOHA 2CDCA 3A4VA 3F6YA 3VH3A 4BNYA 4WCDA 5A5EA 3NRCA 3ORFA 4CMEA 1M66A 1O5IA 4CMJA 1Q7GA 3ZZNA 3AY3A 5IZ4A 5DULA 1KBZA 3TL2A 3V1YA 4IDDA 2O7SA 1EVIA 3Q9UA 1BMDA 1N1GA 1NYTA 1JWBB 2Z95A 4DTIA 4BMSA 3B1JA 4NPCA 2DPHA 3ROMA 2B83A 3NDJA 2X6TA 3DBLA 4QUKA 3UCEA 3WQRA 1N7GA 3M1AA 3C1AA 1YGYA 3HE3A 1GL3A 4IY1A 4R68A 4EJMA 1PWXA 2WJPA 3HFSA 1XCBA 2JFFA 2Y05A 1A9YA 4RDIA 4BB5A 3MJTA 2AXQA 3QSGA 5JCJA 5B4UA 3DO5A 4CUJA 4X54A 4OXYA 1ZEMA 1X7DA 2EXXA 1OBFO 4Y6RA 3GPIA 4Z6KA 4RPLA 4H15A 3G17A 4HV4A 3IQDB 4CLRA 3GDFA 3TRIA 3AU9A 3QQPA 4LVUA 1YB4A 2VUTA 3GQVA 5JO0A 2ZK7A 5H82A 3U9LA 5AXDA 5L7YA 1T4BA 2OUIA 1CF2O 2ZB8A 1SBYA 3AFMA 3PK0A 3KSZO 1ZJYA 2VHXA 4LW8A 5I9MA 2H9IA 2YHIB 1A9ZA 2OO5A 1GDHA 4YAKA 3U0BA 5CHEA 3AY6A 5T64A 4D3DA 1ZO8A 3EGOA 2Y1FA 3PVZA 4BNMA 2QYSA 1DHTA 3DZIA 3O8QB 2Z1NA 3HJAA 3TDKA 2DFDA 2X5KO 1E7QA 1YE3A 2CVZA 3U4CA 3AWDA 3WG9A 2C54A 3P2OA 4PN3A 1ZXLA 2NTVA 1EE9A 4HFNA 1N2SA 3BTOA 1X0VA 3WS7A 1P77A 2O4CA 5AXAA 3W8EA 4IXWA 4Y98A 2GZ3A 4P8RA 4NBVA 4Y6PA 3FWZA 2W98A 4EZBA 1ISHA 1NPTO 3U49A 1C1XB 4GH5A 4RGBA 4JCOA 1YB5A 4RLHA 4YJGA 2HDHA 4ESOA 4WEQA 3QJ5A 3GY0A 3FNEA 3B1KA 1NAHA 3FI9A 3U4DA 3RROA 4C7JA 2OHXA 1PWZA 1I5RA 3JQGB 4A2CA 1W8DA 5AXCA 2GN4A 4B79A 5L4SA 1K6IA 2D3TA 4RO0A 3WBFA 3R1IA 3M2PA 4IPTA 2NADA 1QV7A 1NAIA 4WNIA 3GF4A 1F14A 4AJPA 3H9EO 1NR1A 4FFOA 5A9RA 3TZCA 3N7UA 3UFXA 4CJXA 4J0FA 5ICMA 1T4DA 3JQAB 4PIVA 4BGVA 1QXSA 1MUUA 4UEOA 4AJEA 4QT0A 2OFPA 2XXBA 2AQKA 2DU8A 3WYBA 1B8UA 1M75A 3DMTC 1M2WA 1UXKA 2PV7A 2Y1DA 4TKLA 3UCFA 1T2FA 1XG5A 1P9LA 4MIEA 1UP6A 1LUAA 4W4TA 4PVDA 1ZMOA 3DZGA 3O38A 1SOVA 2NM0A 4IS2A 5GY7A 3Q2KA 5COQA 3VPXA 2B4RO 3K73O 5A06A 3FPLA 3FBTA
chains in the Genus database with same CATH superfamily
2O9JA 3JCZA 3AESA 4LOIA 4NMMA 2PS0A 3QUSA 4YAUA 4REQA 1ZBQA 5WRFA 4XRGA 5CH5A 5HRUA 2IVZA 5EQJB 4MQBA 4QAQA 4B75A 5JD4A 1PFUA 2BCEA 1OWPA 4JZYA 2GBIA 3W05A 2WWYA 4EA6A 3BREA 3LO5A 3CPHA 2C5BA 2ZYVX 3MF4A 4P7GA 1PQPA 1QLJA 3OZIA 3AJAA 4MS4B 3T5MA 4LZAA 3UMVA 2X8WA 2HHLA 3IR5A 3PQCA 2VPXA 4POAA 4UAGA 5IKPA 3KJQA 1Z9BA 1XMJA 4OA8A 1F4PA 1ETHA 2ZUDA 3TW4A 5G3ZA 4G0NA 3HKBA 5G3YA 4URZR 1RQXA 1NQAO 3CRZA 5E9WA 1MF7A 3UVEA 3VXKA 2C7RA 2ZOSA 3M9WA 1RWNA 4JEHA 3AT1A 3KU1A 2GZAA 1LBSA 3SN6A 4BNLA 2W8BA 3UAXA 2QENA 1Z29A 2XCOA 4LPKA 1THMA 3HL4A 2C59A 2QRPA 3AIMA 3RI3A 4F1WA 2EX4A 4RM2A 3S2GA 3G82C 3JXEA 5JLAA 4AY5A 1OFUX 2VSXA 5LYJF 5CVDA 3IIEA 4BBZA 1VB5A 2E2WA 4E5MA 5KJFA 4O8CA 3BGDA 4DCVA 5HP4A 1QV9A 4J03A 3KCNA 3Q11A 3QVOA 1BXGA 1I6LA 1PWEA 4I6JA 4WSOA 4Y1RB 2CZCA 4Y9DA 2WE7A 4H7JA 2KE5A 3Q12A 4RETA 1C14A 3K8ZA 3OTQA 2B82A 3SJ7A 1QG2A 3Q3EA 3HM2A 4FR5A 4JSYA 5G1OA 4DM4A 4CFSA 4DYHA 1JL3A 2WK1A 3V1LA 2C8LA 2QRQA 2GQ0A 1ZXBA 5DTIA 2J3QA 3OQIA 2AWOA 1WDWB 2AG6A 3V2HA 1OREA 2Q3CA 4MB0A 4UUBA 3VVMA 3TG8A 1IN1A 1SH7A 3OG9A 1P5FA 4OH1A 3PLRA 5TQ2A 2OBYA 1BVRA 1A5ZA 2I71A 3QBEA 5D5PA 2VJPA 4P1ZA 4E22A 1C9YA 1LLFA 1VIMA 3AR4A 4J07A 3UJ9A 3K6SA 2ZJ7A 3DZFA 1UIRA 5H81A 4RVNA 4C1NA 5LKAA 3TFOA 4DLAA 2J30A 1E3EA 2VH2A 3EOZA 4YTEA 3SXJA 1FJXA 3P94A 3U3DA 2RHDA 3RC9A 3K5IA 4UTRA 2I6SA 1TIPA 3LUGA 5FF9A 5B3JA 1FA9A 1XELA 4GYJA 2R6DA 4ASUD 1CEYA 2DJIA 5JZOA 5JXWA 2GCOA 5A4JA 1L5OA 1XX6A 3HDVA 2CVHA 5EWJB 1Y34E 3PNYA 3VSCA 1Z4LA 4I1RA 3MYRA 3PUVA 3ZQKA 2WYVA 3L6DA 1XNHA 4IDFA 4LC0A 4Y30A 2OFFA 2ZRDA 1F51E 4NENA 4NABA 1JNXX 1Q22A 1TGYA 2BE7A 1WUIS 2G1AA 2XQIA 3KWLA 1RKUA 4UAJA 1NBME 3WJ1A 3C5HA 5TVKA 3PSHA 2OV4A 1GG2A 1ZGBA 3RPEA 5EWMB 2Z8ZA 3RBVA 1WBJB 1KU6A 5ELLA 1P2DA 2CY0A 4OXQA 2VBCA 3EF3A 3M6IA 1GKLA 4IJKA 1IN6A 4FYKA 1RM4A 3H8VA 2Z43A 2IXFA 3N76A 4IXDA 5LKRA 1Y33E 3V46A 1JHYA 2GRUA 3AR7A 1XP8A 4YY3B 1IZ7A 3MCAA 3N0WA 3ORYA 4MYHA 5DCWA 1F48A 1YOVB 1GSIA 3G1TA 4AUNA 2ZATA 1OFIA 3WA7A 4LHSA 2ZJ2A 1RXYA 2O0HA 3O4VA 3HNRA 3L8YA 2AQHA 2R6ZA 3BTVA 4ZANA 4D99A 2X86A 4B82A 2ZJFA 1Y4AE 2FSUA 4ALMA 3BZWA 2WM3A 5DP1A 2AJBA 4L0DA 4YBRA 1MVOA 4DIKA 5JCPA 4H27A 2YHBA 1RP7A 2I9PA 1FBTA 2PUTA 4BXOB 4JXJA 4R3UC 1CUZA 3SOZA 4TYMA 3W9UA 1ZR4A 4GQAA 1BH2A 1R0SA 4Z4GA 3NBYC 1OV6A 3FTEA 2DFPA 2I87A 2L82A 2QLMA 4Q3OA 4ALNA 1GNRA 4D8VA 3GEHA 2ZR9A 5FPTA 4CTMA 1IWBB 3VISA 1NQ5A 1Q1GA 3QE3A 3A0UA 1ZAKA 4ZCPA 4NRDA 2UYYA 1DTWA 4EB3A 3IMCA 5LQKA 2VK2A 3Q7IA 2O3QA 3NBAA 3DDSA 5CM2Z 5GJVC 5JAQA 2WTAA 3G9QA 2O2DA 5D3ZA 5H9VA 2D74A 4PX9A 2EX1A 4HNHA 1HDXA 3V55A 2WWRA 4L76A 1VL6A 4BZZA 1QU2A 4WN3A 1TW2A 1W5BA 3LPNA 4MV9A 2XNDA 2D0OB 4JP2A 3G6WA 1WP4A 4H7HA 5LZ2A 2VSNA 2O5CA 4KN5A 2QY9A 3IDSA 4MCAA 2COUA 2NVUA 3BXPA 3O7MA 2UYGA 2EC5A 5KNBA 2RAPA 3O82A 2R2GA 3S1AA 5HHTA 3NTVA 4Z5XA 5DIZA 5COBA 3EEYA 3BL5A 4XDZA 4YJ3F 4LZWA 4EPVA 5KREA 4PYJA 1V35A 3ILVA 1R5BA 3H2IA 4CM5A 2I1QA 3B2QA 1FS5A 2ZBVA 2F43B 3TOZA 5JU6A 1X42A 1MN6A 2BGJA 2BP7A 3FE2A 5EIBD 1G8SA 2R62A 1FE8A 1J99A 1RYMA 2ZRCA 2Q6KA 4NLLA 4F97A 2D1FA 1YR6A 5IM4F 4LVOA 3AEQA 4QU8A 4YCDA 1DWQA 2OA0A 1G3MA 3T99A 3VSBA 3ZGYA 4AMZA 3ZCRA 4KUGA 3ANYB 5L6LB 1DT3A 2JA1A 3K0HA 1DJPA 1Y9DA 4PPNA 4YEDA 4EHIA 3ZIAD 1SOAA 2HRRA 2XLBA 1F2UB 1L5VA 1E7MA 3F8TA 4Q3DA 4M1ZA 1NWCA 1OXKB 3Q7QA 2B5WA 4ZOEA 4EQZA 3L7JA 4UFNA 1YU6A 1Z6YA 4NZPA 1CS4C 1E3WB 2ZFUA 3RJ5A 3GRRA 1H8HD 3DZ4B 1O8BA 2A0UA 3G2OA 1DJMA 4ENSA 1VSUA 1DU4A 1SOWA 2FNAA 3AY7A 1QRRA 2VP6A 1TVMA 3D3JA 4ENWA 1I5OA 3NAGA 2A0FA 4KQ2A 4XB6B 1L4GA 3GFSA 5FADA 5HRAA 1X1SA 1AN0A 5C9ZA 4KPUA 2ZB7A 5LD2B 1JHPA 1NJ1A 1NF8A 3VGPA 2ZDGA 1L5GB 3BS4A 1SB9A 1T0PA 5ESXA 3BK2A 4U63A 1NRXA 4J6EA 4PZZA 4KXLA 1UBNA 3SZ3A 2X0NA 1F8FA 1GU0A 1NR5A 1TKCA 5HZGA 2TRSB 1D4FA 1S6YA 3MT9A 5L6MB 5HMMA 3M3DA 2WAAA 4G1BA 2A9JA 1YDEA 5SYAA 5I51A 2LGJA 1RYDA 1ZK0A 1XQVA 3RG2A 3VBEA 1RFLA 3EVCA 1JLLB 3TAXA 3ZQUA 1KORA 2GYUA 2XHEA 2C94A 4BNGA 4GW3A 3BXXA 3C7CB 1GAQA 4D8WA 1V45E 1BDHA 5DWVA 4UCXA 3M2TA 5EWJA 4LE1A 3UK7A 4BWYA 3GRKA 1MFPA 4PTLA 3CW8X 3O75A 2HA4A 2R6JA 1VHWA 1DQZA 2NUBA 4H0FA 4OF4A 1XTIA 2FUG6 4YRPA 3SMQA 5FJIA 3WICA 1QRTA 1JEDA 4YUWA 5DB4A 2VXOA 1OGJA 1C29B 3RLIA 3EP5B 3HWSA 2QG6A 2XCLA 3IUPA 4GOOD 5J1TB 1FX0B 4K9QA 2PMEA 5BVGA 2VR1A 5EKXA 4EHDA 3Q0IA 4HC4A 1A9XB 4UEWA 5F64A 1QB7A 5KYNA 1DKOA 6ABPA 2IPMA 1EG2A 1IDN1 2WD9A 4R0VA 5HDBB 3V2IA 5BUCA 1E3LA 2BFDA 3W06A 1BS9A 2OAQ1 4RGQA 3E84A 2F3QA 2YW9A 4HUJA 3CG0A 3GCGA 3GFTA 4D4KA 3LBYA 2PJRA 2B9EA 4KN6A 1BFKA 3ESBA 2WWVD 5HJEA 2M32A 2IW1A 1QH1A 5F9MA 2Z1DA 2A5DA 2NT4A 1MG0A 2QEQA 3OZGA 2P2LA 3E7PA 3DTTA 4EVQA 3B20A 1QCCA 3LKZA 4UVDA 4K9KA 4EW1A 4R41A 4KEAA 3GT4A 3KQSA 2V0CA 4RF2A 3K9CA 3RVLA 3BMQB 4JLNA 4B83A 1NW8A 1SUSA 4UUMA 3ZNPA 5CK4A 2RAUA 1AE1A 4NL4H 4AIIA 1TZJA 1ZA1A 2KSQA 2OV1A 2XIJA 5G0SA 4D7AA 4IHAA 3KR9A 1WV0A 1CULC 1IBCA 1RADA 5AHKA 1NONA 3SKYA 1LC3A 1VMKA 3AG6A 4IVPA 4KK4A 3WMWA 4J1TA 1KY3A 4XW2A 4V1CA 1U8CB 3RSLA 4PLWA 3DFIA 4DCCA 3NTLA 3GP8A 4DV7B 1I3LA 4GMGA 4AICA 1SZJG 4G5GA 2Y0DA 4UJ5A 1ODIA 2X9VA 3IMGA 1XZDA 2C7VA 2JHAA 1NI3A 4LF9B 3QXXA 3ETGA 5FHQA 1SG0A 3KZKA 1B8OA 4EFKA 1XEWX 4DLWA 1U11A 2PWAA 2VDUE 5HSGA 4UDYX 5DOVA 2WHQA 2VSOA 3LP8A 2B21A 1WSDA 3W2TA 1VZ2A 4H7PA 4LWQA 4C4PA 4R5HA 5IJ0A 5D3QA 3N7TA 4AY3A 1W29A 4EGSA 1CUIA 2UZ1A 2OKGA 2HJSA 1PJBA 4HB2A 4MCJA 4CDGA 2Q4TA 1GLGA 1HNWB 1IOLA 1W6UA 3QU2A 4H59A 1UFVA 1D1QA 2V6JA 4ZRMA 3WGMA 1IFXA 3H0KA 4F4FA 1QNFA 1V4BA 2RB4A 1TTQB 4OLBA 1JHMA 1N6IA 2PQ6A 3FIUA 5BW6B 4C4XA 2IKQA 1VL1A 4I36A 1ESMA 2ZQ5A 3NCHA 4CM4A 1ZJ5A 5DNWA 4RADA 4CETA 4DM3A 1SG6A 4X24A 4F21A 5JIBA 1D7AA 4BV3A 4FN4A 2IUSA 4FMDB 3IPYA 2XRFA 1RXWA 1B15A 3ZV3A 3D6FA 4I9FA 4WNYA 2IWRA 1XZNA 1YCFA 4WUVA 5GIOE 2OBLA 1ADBA 4KIGA 4BNZA 2BBWA 4AIRA 3V9AA 3F1LA 2ACWA 1VG9B 1BW9B 1RLOA 4M53A 2X9NA 1ENOA 2WM8A 3PNVA 4PEVA 4B48A 5AKJA 3UQZA 4B6OA 4NY1A 2BIFA 4RHXA 1IRIA 1W9HA 2X7HA 3GGJA 3ZWPA 4WBXC 2O8CA 4ZMRA 3W5BA 2V7QA 4IBOA 4ESHA 2J41A 3PG5A 4HDCA 2PWYA 7MDHA 5JAOA 3CVJA 4X61A 2Y1GA 2O7VA 2OV3A 2RHRA 1ZHOA 3IQHX 2WJ6A 1J7JA 3D1LA 1SUIA 1P0IA 5KS2A 1BAPA 3WIUA 3RVNA 1TLTA 3BCUA 3WLTA 5CBKA 4FDAA 1BU5A 3IOYA 5FLXA 3EIEA 5BSRA 3V4ZA 2VUHB 4RTMA 3AF3A 3SE7A 2Z2IA 5EE0A 4HADA 1P29A 3GEDA 4I5EA 4Y6LA 5FPYA 1JHRA 4BX2A 1C5KA 4QOJA 4RFSA 4BATA 1ABFA 1YS9A 4EGCB 4HNAA 4B71A 2Z08A 3OOWA 3SBXA 4GHWA 3UHPA 4E14A 1ZXXA 2IH2A 4D2IA 1G6Q1 3HO6A 2DH5A 3NWEA 3WWCA 2BCGY 4DRXA 2QTMA 5TIIA 3OJXA 4RAQA 1D4ZA 3I37X 3R74A 4ZV4A 3KCQA 1U1EA 2ODAA 1JLLA 2G4VA 2OFOA 5HFJA 5LQJA 5D51S 4UOEA 2JIRA 3QUTA 1UOEA 2RCNA 4IGAA 5EC8A 1W5AA 2V9CA 4YRLA 3AX6A 1PRYA 3H3XA 1EXDA 5FUMA 2OO5C 4D6PA 4K6OA 1DAKA 4U2FA 1WMEA 5KDDA 2CJFA 2GEFA 1LI4A 1PR5A 3LWBA 4YWHA 1D7OA 3RUHA 5HIAA 1NKTA 1O6FA 4RUKA 5F4ZA 1ZW6A 4GFDA 1DBRA 3CLUD 4HWGA 4Q03A 1PNTA 2H31A 3PGMA 3VRHA 4WCVA 1E5VA 3OKPA 4O5AA 1J00A 4CG1A 1JFVA 1C3XA 4PX5A 3GUCA 2ZI5A 4QPJC 4YQZA 4U02A 3SR4A 4B3FX 4EB8A 1DINA 4E33A 3D3EA 4EMBA 3A6FA 5AOCA 3NM6B 2RBGA 1RAFA 4TYYA 1WUJS 1G5IA 4IDGA 3T1YB 3X1XA 4HXFB 2QW1A 5E1BA 1ULSA 2I6TA 4FBMA 3DL2A 2EW8A 1C3JA 1IZ8A 3M4YA 1ZH8A 4QU0A 4YJDA 1H2FA 3UGQA 1W35A 4BKQA 3ND9A 3GLGA 2HM7A 2QJWA 3HUFA 3KYDB 1U8FO 2V54A 3WMFA 2IBTA 4FGSA 3E9CA 2REQA 4IH4A 4RK7A 5K51A 3SSMA 1XEFA 3VU9B 2LE0A 1KI3A 2W2PA 3LX8A 1ATIA 1CFZA 3RFFA 5KTRA 3B1XA 3N6VA 4KRYA 1T1EA 1SUFA 4DW8A 1I7SB 3PTAA 2AD1A 3FNIA 3HU1A 3E3LA 1Z68A 4XM0A 4FK8A 3EDMA 1Y9AA 5EWLA 2XCRB 2J9GA 3MM4A 4YJFB 5TNXA 2PFKA 3AUYA 4ZZ1A 1UBLS 3LXMA 3G0HA 4IWXA 1I24A 3SJAA 4KGDA 4FT4A 4EY5A 4HOYA 5C35A 4CEJB 2X5NA 1SNYA 1VE7A 1DQRA 4W8GA 1GIAA 1LGYA 2DGDA 4I5GA 2ZWOA 4LXIA 5F12A 4BQOA 3PGVA 3TQHA 5JAHA 5G1NA 4HWRA 3GLIA 5IZCA 4AW9A 2RI1A 2PEZA 4QUAA 5TT0A 3BSFA 1R12A 2V6MA 1CZRA 1G6KA 1YHZA 2MMGA 3EVTA 1I4TD 4MRVA 2PJUA 3NHFA 1UP4A 4FGZA 5LYJB 4RYDA 1QPZA 3DBLB 3GELA 4H6PA 4G0OA 3QFFA 4QG3A 4KOEC 2I55A 1JMYA 2HRCA 2FZGA 1EVYA 3NKVA 3NQ41 3NANA 3QY0A 3TUJC 4B6EA 4UD6A 1OILA 4Q37A 1E9DA 2QRMA 2OB2A 2BL4A 2ICAA 4DY4A 2Y27A 4JK3A 1T35A 1M8GA 5LOVF 4WN9A 4LVCA 5AW6A 4ZO7A 1B93A 4PU0A 4U7JA 5T7BA 4ZGGA 3MWDA 1CIPA 3WHIA 2LTAA 4X92A 3ETCA 4Q3LA 2R79A 1CDZA 4AZTA 3MGCA 4M9RA 4OOFA 4EW2A 1QIFA 4PLTA 3PCTA 1ODSA 4NPHA 5KOJA 3IRUA 2VRBA 3QEOA 1MZVA 1UZLA 2GF9A 2GEJA 2VRNA 5LQSA 5JQGF 3DAGA 2HC9A 3NR2A 4PZ9A 4UUAA 3ZU2A 1QH8A 3GFRA 2JEOA 2KLBA 4IIBA 4TTJA 3WC4A 1KYIA 5C1PA 1Q7TA 4XX0B 1KMCA 5AW5A 1A0OA 2FEKA 2VDKB 3TE7A 1YS7A 1YJXA 2I5PO 4FB4A 3W5DA 1XZCA 1NT2A 2H1SA 3P0FA 3V8RA 1W0KD 2BMJA 4P9NA 5I3CA 1EJBA 4O2RA 4OQXA 1E2HA 2Q0XA 3EFOA 2ZI4A 3MERA 5I4BA 1GM5A 2QUHA 3CTMA 3E61A 4QA9A 1KXJA 4QATA 2CNNA 1G2QA 3QA3E 3CCBA 1TXGA 1VOTA 1U7XA 3JWGA 1V47A 3DZDA 3T7TA 1H2WA 3CIFA 3FCXA 3WQBA 1JDPA 5C7IO 4DSZA 2B3DA 2B34A 4R98A 2BFOA 1SKYE 3F5FA 2WV9A 3D9QX 1Q92A 1NPDA 4LCEA 1XCGB 2BSXA 3WDSA 2CV1A 3SC4A 2VH5R 1I3NA 1ZMTA 1U2RA 1HDYA 3S7ZA 1KJIA 1QCZA 3ZJUA 4ETNA 1FRZA 1T3GA 4MI3A 3Q8MA 1T36B 3P0EA 3PUJA 3ZOKA 3BFXA 3BRWA 2XCTB 2JJ1D 1IK4A 2AOTA 4DIEA 4Q19A 2G25A 4S1OA 5BOSB 2X77A 2WOJA 4M54A 2GPSA 5KWEA 4AG3A 3LPAA 2IQ5A 5AVWA 1IAVA 1NRWA 3H16A 3KR0A 1YB2A 1YNSA 2AMJA 3QW4B 4GZ5A 2AZDA 4XTCS 1N1DA 5DOZA 1AF7A 2F1KA 3ACBA 1I7LA 1VHLA 4F84A 1FXSA 5DH9A 3KQQA 4P54A 5CT4A 3K0AA 4B3MB 2CWWA 1QKIA 1YH3A 4BV8A 1OH7A 2IOFK 1AKYA 3ZCQA 5DLPA 5ARDA 3H17A 4JB8A 1TYZA 3FYUC 4YS6A 1P2GA 3EDOA 2VZ8A 4PHHA 3K9LA 1QPGA 1J39A 4ZO4A 3R7FA 1VL0A 1XHFA 1C2TA 3KFXA 3KYJB 1W0KA 4JA2A 2CLKB 2RGUA 1QS0A 4IIJF 4KQKA 4PO8A 2H08A 4Y3UA 3WR5A 4BNFA 4DMFA 4P4SB 5B1DA 1HSZA 1GYQA 1OLSB 4G0MA 3V1KA 4TGLA 3CLRC 5EMHA 1JU3A 2ACEA 4K3VA 1JIJA 4ZI3A 4ZZ0A 3L8ZA 3DT8A 3WSTA 1G0OA 2YJ5A 4KYUA 4NF2A 3ZHTA 4H3HB 3UJNA 1CQJA 1SBCA 2QU8A 2PKXA 4IAOA 3ZE2B 1JDUA 3L6RA 4N01A 4BL5A 5LNK6 1QIHA 3CBQA 4RY2A 4RELA 3WRYA 2W2NA 4FKBA 5LP6A 3V8BA 5CFLA 1QDLB 4W8OA 1RZ3A 3KQOA 4GRAA 5JECA 1U8XX 3VAAA 2H4FA 3A11A 1ULTA 2JJ1A 2FPRA 4W9NC 4IQFA 1DQYA 4MX8A 1YUMA 4Y9TA 1VPDA 2B2CA 4AB1A 2Z6VA 2WFAA 3OD5A 4PS0A 4R54A 3MMNA 2TMDA 3O1HB 4HQOA 5K05A 3WL6A 3F7MA 4XWTA 5AI8A 2NPFA 1E63A 3K0BA 3V3TA 4KREA 4C0BA 1SUBA 3HDQA 3P97A 2NNWB 3KWMA 2DHQA 1RC0A 3ZV5A 3KZ1E 3OPXA 1T13A 4ZAGA 3UXEA 3GR6A 4LBYA 5IWCA 5T73A 5BSFA 1YBMA 5JMOA 3D81A 3D0QA 2PCLA 1KNXA 2OP1A 3PKIA 2XE6A 5AUQA 1ZR2A 1GJRA 5AT1A 3L1VA 4WKCA 4IYJA 3UHJA 1RKVA 4XH9B 4TYNA 5K2OA 1NHGA 2E7ZA 3SJUA 4ZDKA 1DJNA 2F67A 4HNRA 3LTEA 4C4YA 2FG5A 3OM0A 1CNFA 2O7NA 3B5EA 3ESYA 3G0BA 4U2KA 2PYIA 3NYRA 4JLUA 3UWPA 4AAYA 3OA2A 4OV6B 1O96B 1MC8A 1BCSB 1R64A 4FVTA 3GMSA 3IEPA 4N0QA 4MUHA 2Z4SA 3PYMA 3MJDA 1AKRA 3IV6A 2ZE7A 1U0EA 1XVUA 4EO4A 2G6TA 1M7BA 3RYHA 1ZRNA 2Y92A 4IDCA 3UMBA 5CFOA 4KLNA 3OA0A 3CINA 2EZ4A 2LPMA 1E8NA 2DQSA 1H4TA 3OH8A 4RPHA 2GBCA 2QJFA 3A3YA 4MOWA 2AEFA 1ZJJA 4CKBA 3CRMA 3FAKA 2MSNA 2NG1A 1ZGHA 4LBVA 5HR5A 1Z7YA 1J97A 3PC8A 4MS1B 3OKAA 1AQIA 1YVUA 1YTLA 2E55A 4JJ8A 3PC7A 2B92A 1KI2A 1PYOA 1H8EA 3K09C 3IV9A 4P5DA 1JYEA 1Y6QA 1ORVA 3DEYX 3GEPA 2W11A 4MA0A 1P4AA 2DFNA 1Z2DA 4CNBA 1RKBA 1JQBA 5KJ6A 2XT6A 3E03A 3NXSA 5IJ9B 1VSBA 3ACDA 3K6KA 2ABWA 4RCVA 1JBKA 1RFGE 1KE1A 4IIGA 1G3IA 3BSYA 5JG7A 2BF4A 4O2AA 4UUPA 1H5UA 3PEUA 4PZYA 2Q0QA 3GOQA 3OZFA 1HZZC 5KPDA 4WT7A 3K92A 2P2YA 4Z0TA 2X0FA 4IZ6A 2W6ZA 5F76A 4X1OA 4BLWA 1DSSG 4BLQA 4JLSA 4BCDA 2B2XA 1BS2A 2P8JA 2OE2A 2RHGB 3GRAA 4MNTA 5ER6A 4KWCA 4DQVA 1KO1A 2XE8A 2CLSA 4NQZA 5IC6A 3TCNA 1JVBA 3EP4B 3ZVLA 1LCIA 5BVHB 4D97A 4ZQBA 4YAFA 4C7KA 1D2EA 1PGJA 1UMDA 2YMPA 4RQUA 1GKUB 4Y2RA 4AF8A 3DONA 1E1KA 1T4GA 1EBFA 3GLHB 1P19A 3C1TA 1LDBA 3AB8A 3MB8A 1XDDA 1G55A 1YOVA 5JCZA 3VPAA 5JHHB 4GM1A 5LWHA 3K31A 2FPMA 4MWDA 4BWGA 1B8PA 3LK7A 4OHRA 3OHPA 3DMHA 5A4AA 1WY7A 5CFRA 4PE5B 4NBWA 4OQZA 4DIMA 2QQFA 4CBVA 1E6LA 1YZFA 4MEAA 1GEGA 1XUOA 2WF9A 4LY0A 4OKNA 4TL8A 3RASA 1I3CA 1NYQA 2Q5QA 4A03A 4R5MA 1E2QA 1QMIA 2QAGC 4DNPA 1JKJA 5ADHA 2VQDA 5AUNB 4DHEA 4KHPB 4W5RA 4ROTA 3P9XA 1UBTS 1WHTB 2B4QA 4HF7A 4O4HF 5EKTA 3GJRA 2XF8A 4OM7A 6ADHA 4F12A 2GARA 1GTVA 1GA4A 3TQCA 4CF3A 3RSHA 3PC6A 3IQEA 3S70A 1Z34A 1MTZA 5DLYA 1GFWA 3D7MA 1ZSVA 4KYVA 3FOCA 3SYRA 1K6EA 4PYIA 1HKUA 4DDWA 3C0KA 3H4TA 2VAXA 1FXWF 3RVBA 4HMQA 3L40A 3MUOA 1I0LA 4LZNA 3CNLA 1QE5A 4QUGA 5ES4B 1E6KA 3AMVA 3DCYA 4PWZA 5KAMA 5JRJA 1BQEA 3RBZA 2AOVA 3CJRA 4H31A 3OWOA 4A27A 4XYLA 5JEDA 1GGKA 2IU4A 5J3JA 1U9YA 3EP6B 1U0HC 1EUDB 5BMVA 1JAXA 2PH1A 1S4MA 2YJ4A 5LA6B 3C4VA 2ZXFA 3EGCA 5AM0A 3CRNA 4KAAA 4RCZA 1SCQA 2RBEA 4EABA 2FWIA 3X44A 1TMOA 4YCLA 2BFMA 2NTYC 1II8A 4ER3A 3F73A 2CL5A 1M76A 2X1LA 1EJ0A 3TGPA 3GV0A 2EKZA 1K5HA 2WIJA 2WTXA 4PO3X 4UEQA 2GN9A 3R5SA 1OVGA 2X2OA 3TXXA 2NPOA 5DBOA 5JPDA 1QSGA 3C6BA 4PC7A 5FRDA 4OI1A 3I39X 1SU4A 4EB6A 3CLVA 1Y8RA 4DCMA 3B2NA 4EG3A 3TUZC 1KZGB 1VL5A 1BD4A 3PT5A 1L4NA 3DHNA 4WI1A 1W36C 4AUKA 4P4NA 3M49A 3VKUA 1Q0TA 1BXRA 3GJ0A 1Q1AA 4NKRA 2PRIA 1R9MA 6PFKA 4DRYA 4RH1A 4RS3A 3EDRA 4V1CI 3JYQA 2IF2A 3Q2IA 3Q87B 2FLKA 3J80A 4U8HA 5FBQB 4HQFA 2P69A 3EEOA 3PQ4A 2MSEB 2A5FA 1PVDA 3SSNA 3ZQ4A 1PFGA 4CLEA 4DSOA 5BORA 2IHKA 3FTQA 4D8XA 1C7EA 3FUTA 4BCCA 4DDMA 5IKXA 1QYXA 2WHPA 3DLIA 3DBVO 2GPYA 5ALOA 4MAFA 4MO9A 5DM60 3LUBA 4KSBA 3FRHA 1U8AA 1OZGA 4GOLD 2ZS7A 1UH5A 1AV6A 3HR7A 1MO5A 4N65A 2FVYA 3G89A 3L04A 5F1PA 2D6FA 4CG0A 4ARIA 2AE1A 4DTCA 2I2XB 1O58A 1GTG1 2V4ZA 1XTKA 2ZSFA 1IYZA 1YA8A 3IR6A 4OL9A 2YV3A 4ZK2A 1MRNA 1YBHA 1WMBA 4ITUA 4P4GA 5JXJA 2ZYHA 5K0LA 3EVNA 1BD3A 2PLAA 3IQWA 5KBYA 1ILWA 3O4RA 4A0FA 1EUCB 3K72B 1RHMA 3KHSA 3L06A 2Z5LA 3LC2O 3KOUA 4I3GA 4XFDA 4YMSA 5DO9A 3TW8B 2IYSA 4RE5A 3EXIB 5CBPB 3HTXA 1EU1A 5JS1A 5L3VA 4B44A 1O6GA 1TCCA 3LOUA 3NYWA 3A1FA 3WQSB 1ESEA 4QGAA 3LSYA 4MTCA 4NZMA 3KQVA 3RABA 1DUVG 4HRAA 3ZXIA 4CU5A 3TZ6A 4RABA 2NNLD 3ELWA 1L5FA 2E5FA 5CT9A 1QO9A 3WX0A 4NE7A 5BR8B 2ONKA 1UJCA 1ZZGA 4HLNA 1SIOA 2ZWMA 1PZXA 2O3UA 3BDVA 4FEGA 4KAFA 4TLCA 3W8DA 5KWIA 2QLBA 4II7A 1HFKA 2CCGA 1S4QA 1Q0UA 2DH6A 1X94A 2DWUA 3B51X 4W6ZA 4DR7B 5TJ9A 2XBUA 2R6FA 2V0NA 2HK8A 2DG2A 3P26A 1LVGA 1LTHR 2NUPB 3NBXX 1Z4MA 4PGHA 4RPJA 5REQA 3TQSA 4EELA 3E9NA 1BMTA 4V02A 4C0SA 4BRWA 2RHHA 3BZBA 1ONSA 4PLYA 4B2YA 3MCWA 3HO8A 3NAMA 5DKFA 2CHFA 3DZKA 3V1MA 5JV5A 1KIAA 1Q7CA 1QYWA 3HPRA 5JTTA 3G3EA 4EG6A 1PQWA 1M1YE 4IF4A 2IEDA 3A4TA 4RFVA 3TN7A 1U7ZA 1CVLA 3QHQA 5K20A 1SCAA 2YN0A 2G77B 1Y81A 1B2LA 1UJ6A 1WB6A 2M6SA 3E3NA 3IBFA 4JXKA 4EF5A 1JFSA 4LWZA 4ISBA 4LZOA 4NFYA 2YZ2A 2WNIA 5JSZB 5E7JA 2QA5A 3CF6R 1Z6ZA 3OWHA 3QK7A 4RVGA 1TIKA 4B6QA 1M2GA 4US2R 3IR7A 1HDCA 3BTUA 3NHKA 2AS0A 4X20B 2YFKA 4XPZA 4B9EA 2YXEA 3Q9LA 2RHCA 3PJGA 3QWBA 1I6WA 1S2DA 1Y1PA 3PQ6A 3QJYA 3EAFA 1LDEA 2RCYA 1F1JA 2Y1EA 3TD2A 1U98A 3Q5GA 4MR7B 1UWVA 3W6PA 1NE7A 4J1TC 2J07A 4P0TA 3RYIB 3STVA 2H07A 4JFRA 3GJ3A 1NMEA 5I5EA 5K0FA 1E59A 1PTJA 4ZO8A 1ZUNA 1OC2A 1GNTA 3D0OA 3M3PA 1JAHA 5I5GA 2HSGA 3OZAA 1XMOB 3NBKA 4LTNA 4ILKA 1E66A 1NQTA 4Z4IA 2P77A 1IXZA 2ZBDA 1WXXA 1SPXA 2WV7A 2GVDC 3AI1A 3I30X 2GVZC 4PFQA 2PTHA 4H6XA 3PQDA 4HGOA 1NLYA 3JALA 4BDSA 4DCUA 2NXCA 5I7EA 1GR1A 5I4CA 5KMGB 4L85A 4FX5A 5TV2A 1KETA 3COZA 2YVAA 1NMXA 3DFKA 3WRWA 3HB5X 3SC6A 5A4KA 1N8NA 4N3GA 4ZPXA 3TG2A 2QT9A 3AI2A 1ECCA 4O4LB 3MTBA 4BQNA 4CG3A 1G1AA 1NY5A 3NOXA 5DFAA 5K8VA 1GPBA 2CMHA 4A0SA 4PSDA 4HAIA 4DABA 2EV9A 4HAZA 1ZK3A 1GTL1 1NBEA 3RD5A 3VTAA 3JQRA 1I7QB 4JODA 5CCEA 4LDRA 4BNMA 1DEKA 2O5EA 1YRBA 4MV6A 4IV8A 4QTTB 3RC7A 4YLEA 4V0QA 4UCWA 1SA0A 3LV8A 3RRJA 3WBBA 4D4LA 1F2VA 3GJTA 1O6BA 3K2EA 3GD5A 1TCBA 2SNIE 2C3OA 2X0IA 4MV1A 2P5SA 2DMRA 1FFSA 1SG9A 1SBIA 4REQB 1YZNA 2Q4BA 4OQDA 3KYCB 5BNTA 4IGFA 2ERCA 3O6VA 5JEEA 1D0IA 4YI3A 5K3FA 4CF4A 4X00A 5C1BA 4N54A 1XF9A 2H9AA 3HLKA 4JC4A 4UMVA 1DG3A 1X8JA 2Y1WA 3EZ7A 1HM5A 1Q3TA 3GPDG 1OB2A 4X94A 3AEZA 3UV3A 3PZBA 4YBZA 5ICCA 2F6RA 3A6LA 3LLMA 3BH7A 3PFBA 1I80A 3PHLA 1Q1NA 4GBED 4IIEA 4MB6A 4BPRA 3ZDDA 1RLMA 2QSUA 2B94A 2XB9A 3HKDA 4CCYB 4CFYA 2I8AA 5G2OA 1H0HA 1XDBA 1GZ7A 5BWNA 4NU0A 1J5EB 2GESA 2QTFA 4YR7A 4Z9FA 2VDNB 2FMXA 4L9SA 4BNIA 1WXGA 3MHTA 3O3OB 4LGCA 4PN7A 1JHAA 2DCMA 1S89A 3TTUA 2J3DA 2UXCB 4HDQB 4GQIA 1AUQA 4BVHA 1TA0A 2XI4A 2EW1A 3A2LA 3IVXA 2QJOA 2NVWA 1S01A 2LWIA 3PQ7A 3RKRA 1PQ4A 3B13B 1FUKA 3V4PB 1N2EA 3MBIA 4DN6A 4BFTA 4B3CA 1EFPA 2ISCA 5AJZA 3EX7C 3U5ZB 2DEUA 3JATB 1Q1ZA 3WB1A 1Z2OX 1YASA 2GVNA 1WWKA 5BN1A 4BLTA 2P78A 2REBA 3DV9A 3EIFA 1Z5OA 4L0QA 3AF1A 4PZCA 1CJUC 2QP4A 2XQFA 1MCZA 2CNBA 1JMKC 1U94A 4TXLA 2OD2A 4CM8B 3DP9A 3EWNA 5C53B 3QVSA 3BERA 4H4EA 3P9IA 3BFKA 2NUPA 1YWGO 4I50A 1X70A 3C6XA 4TWBA 5JAIA 3OLWA 4ND3A 5CIQA 5BRJA 2PZEA 3TQRA 3WIDA 3EMKA 1WCWA 4UVGA 3JQPA 4XX0A 5TS3A 4KVFA 1DRVA 4YRDA 1R0WA 1OQAA 2FP4A 1XZKA 2X4GA 1TW3A 2D5BA 1CB0A 3QF4B 4D8YA 4D56A 5JXGA 1DVRA 1JG2A 1EHIA 2A4KA 1DC3A 3GRYA 3L43A 1P1KA 2QVGA 3DEAA 1HT1E 3OPQA 1DO0A 1XD8A 2W00A 1FBNA 2PK3A 3L8MA 2OCGA 3CLTC 4MJLA 3IQGX 3OCVA 3EN0A 5IAKA 5C7OO 2BGTA 3DLTA 3CH6A 5T4EA 3W7BA 5FAKA 1WLSA 3FPBA 2HQBA 1E9FA 1K3TA 4JH0A 3VVLA 1J6UA 1KA9H 3ODPA 4TVSA 3LCUA 4NMWA 3IBYA 3O4FA 4KQIA 1IPHA 3B8EA 2X0EA 3ZWXA 3QLTA 4HZIA 2G83A 4MLPA 5DXJA 3K53A 4ME6A 2JJYA 4TT3D 4N5MA 4IKOA 1JJAA 1W76A 2HLHA 3Q72A 2YQ5A 1AD2A 3OBBA 2YWBA 4PO1A 1GGFA 1V26A 1Q0HA 1J1UA 2INGX 3ICEA 1F8UA 1N5LA 2HREA 3TRDA 4EBBA 4HUQA 7YASA 4PQEA 3OLCX 2XWJI 1Z3IX 3WSVA 5FOWA 1QVVA 1XTJA 3WOHA 4EB0A 4GXQA 2FWNA 4DA4A 1TPZA 4G2NA 3FYUA 3SEAA 3IUBA 4TMXA 1UT5A 5HUJA 3E8MA 4P35A 4R01A 3JVVA 5FPQA 4MTLA 2BFAA 2XCIA 2IYUA 2WE8A 5DHUA 3FVVA 3VJLA 4LJYA 2VP4A 5ECYA 4ZEXA 2Q41A 3G9TA 2HA7A 1DXHA 1COZA 4B7XA 1KY5A 1RYHA 1Z0SA 2H29A 5H0IA 1NNLA 4DMLA 2XRZA 1J33A 4W5WA 3QY9A 2XXAA 1J06A 2Z56A 4OJYA 4XCVA 1HDEA 4JBXA 4DNQA 4XSVA 2QP9X 2WWIA 1GV1A 2JFQA 1KQOA 2WKSA 1EP1B 1XWFA 2G08A 2XD4A 3LVRE 1A9OA 2RK3A 1BXGB 3EOAI 5K3SA 3SBEA 1U0JA 2BR4A 2VJDA 1WPXA 4YCJA 3MK31 2ZSJA 3AEUB 3SIXA 3KX2A 5HQTA 3TD9A 1N6OA 4TRRA 1Q6YA 1KFCB 2RAVA 1NOIA 1V37A 5H1YA 3WHKA 4BP9A 5BW5A 1WXFA 3ROGA 4FJ2A 2EWWA 3LUHA 4TMTA 4NDNE 3ZU6A 4HEJA 4CLOB 2XUPA 4E2WA 4Q6WA 3RFUA 4LNAA 4NEQA 3W78A 5B3JC 1HNZB 5B55A 3LRXA 3BJMA 3D8NA 1UANA 3JRWA 1T6YA 1MAWA 3H2GA 5KO2A 2O20A 3EZ9A 2ZS8A 4R81A 4UJ3A 4CKYA 1FLNA 4MGKR 1GL9B 1O95C 1P74A 1X19A 2C1XA 3WLLA 3T3NA 1V5IA 3GT3A 3PDJA 1T5HX 4F46A 2QVXX 1FSFA 2ZKLA 5M6DA 4Z9YA 5FOXA 2HMTA 5K0ZA 3D8UA 3R5FA 4MMYB 5ALTA 4DCTA 1CUEA 3S1SA 1WU8A 2CSUA 2QE6A 4G84A 4K2AA 4MWTA 1NVFA 2IT1A 2JI9A 3FGZA 2VZLA 4FLEA 4L0CA 4QJIA 5AIAA 3NATA 3BRQA 2X8AA 2C2HA 2C07A 4IRXA 1T0JB 2YN2A 2ZI7A 1DQSA 5ECWA 3TLJA 2LR0A 3F74A 3HHEA 3JVEA 3GLFA 1IATA 3DV2A 4HDKB 1XBTA 3S1AB 1PK7A 4FT2A 3L7IA 4E46A 2H57A 4E94A 5DGIA 1JDBB 2MDTA 2YV2A 2PQMA 5IDYA 1ZD3A 3C3JA 4M0EA 3C24A 3IP3A 2PZAA 2IZ6A 3TL6A 1WZNA 4D81A 3UW3A 3KSDO 4PRZA 2PT5A 1F20A 1P8AA 2QNIA 2ZRJA 5AM4A 3R6TA 1BFUA 2IYEA 4MRSA 1QIJA 2ZJ8A 3BK1A 3G0DA 2YW2A 2VJQA 1QRDA 4XARA 3IE1A 4NSNA 5FBLB 1XPUA 1UR5A 3R0QA 5BQ5A 2C7QA 3Q2OA 3ZE1B 4KR0A 4CODB 2VTBA 3ZJVA 4MVXA 1OZ0A 2YWGA 4L4XA 4X6XA 5DYYA 3GA5A 4HB3A 2IHJA 5EL0A 2JGMA 1NVWQ 4I50B 1JU4A 4PHGA 1R00A 3WIBA 4LF6B 1DGQA 1XPOA 2Z9DA 2NU7A 3F3MA 2XYQA 4H3SA 4I5FA 2F3TA 4NNJA 1H93A 4UU1A 1NSYA 2WW8A 16PKA 1P73A 2R1VB 3OICA 4YA6A 3MJHA 4DM7A 3HKCB 2J33A 3W5UA 3QENA 2RMKA 3RBXA 821PA 2CL7X 2CDAA 1SKQA 5CXXA 2ZAMA 3W34A 2J9FA 3U39A 3I2JA 5DYWA 1CLUA 2B4KA 3FCOA 4XUCA 5AVSA 3PBKA 4TUYA 1M8FA 2GERA 4QE3A 1YJCA 2HWWA 4LDZA 1NQXA