4GMGA

Nadp+ bound structure of a thiazolinyl imine reductase from yersinia enterocolitica (irp3)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
365
structure length
358
Chain Sequence
GLVPRGSHMPSASPKQRVLIVGAKFGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPLYTSPEQITGMPDIACIVVRSTVAGGAGTQLARHFLARGVHVIQEHPLHPDDISSLQTLAQEQGCCYWINTFYPHTRAGRTWLRDAQQLRRCLAKTPPVVHATTSRQLLYSTLDLLLLALGVDTAAVECDVVGSFSDFHCLRLFWPEGEACLLLQRYLDPDDPDMHSLIMHRLLLGWPEGHLSLEASYGPVIWSSSLFVHSLYRRPEILRDPPGLTRSAAPLSWRDCCETVGPEGVSWLLHQLRSHLAGEHPPVACQNVHQIALSRLWQQILRKTGNAEIRRLTPPHHDRLAGFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Structures of a Thiazolinyl Imine Reductase from Yersinia enterocolitica Provide Insight into Catalysis and Binding to the Nonribosomal Peptide Synthetase Module of HMWP1.
pubmed doi rcsb
source organism Yersinia enterocolitica subsp. enterocolitica
molecule tags Oxidoreductase
molecule keywords Yersiniabactin biosynthetic protein YbtU
total genus 109
structure length 358
sequence length 365
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4gmgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gmgA01
4R5HA 1Z45A 4DUPA 1PGPA 1ONPA 1TB4A 3W1VA 1RM4A 3DBRA 1EDOA 4FOOA 2Q2WA 4IS3A 5KJFA 3PJDA 1EFKA 2HK7A 1U7HA 1KEWA 5JW6A 4NJOA 5BT9A 5K0ZA 4CLOA 4NBWA 1M6WA 1HRDA 1YB1A 2VUTA 1NPTO 3PDUA 4UVDA 1YBAA 5U1PA 1QORA 4R41A 3PDJA 5BSFA 1PX0A 2YFHA 1NWHA 3DBLA 4RPGA 3ORFA 4FSHA 1I10A 5KCZA 2GRAA 1I2ZA 1MUUA 2X5KO 2IEBA 3GG2A 3L4SO 2YHIA 2GO1A 3RIHA 4EEZA 2X8LA 1R0KA 2DT5A 3AOEA 3VH3A 3S2FA 1KVQA 2VRBA 4D0RA 3H6KA 5C7IO 3PYLA 4JJGA 4XJTA 1I3LA 2EF1A 1DB3A 4CMIB 5AQ1A 3H8VA 4WUVA 3RASA 2HRBA 3DC2A 5KIAA 1E92A 3PGXA 4RZHA 2G17A 4PLYA 4D3FA 4P22A 3D3EA 4E4YA 1DFGA 5FF9A 2O23A 1ZXBA 1YE3A 4DVJA 3HDHA 2GR9A 3F47A 5AVOA 5BSEA 3V8BA 5JCXA 4BNUA 4CL3A 3VZSA 2DPHA 3LLSA 4CMKA 4MVJG 2PLAA 4YJDA 4JGBA 1WNTA 2AHRA 3DBHA 1D1SA 4YEDA 3WQSB 4MVJM 3SVTA 1Z6ZA 3UW3A 3SXPA 3QLJA 3VHRA 5KVQA 2Q1SA 4HY3A 4PVCA 5IJZA 3NEPX 5I7EA 1RJWA 4I1IA 2YQ4A 3DZKA 1KIFA 2DBRA 4E21A 5IXYA 2XAAA 4TKMA 4Y6RA 3ZWMA 4L8VA 4ND2A 3FNHA 2ZB3A 4M86A 1B14A 3TFQA 3HFSA 4D46A 4IDEA 2XPCA 5CDUA 3E8XA 3PTZA 1ENOA 4ZRMA 1LX6A 4QEDA 2PGLA 4FC6A 2DUWA 3S2IA 3R3SA 5FEUA 2HMVA 2BI7A 4JX8A 2RH8A 4D43A 1T1RA 1DHRA 3DAPA 2HJSA 3WMXA 5CP8A 4TRJA 5L53A 2C07A 3C1TA 1HDCA 1LSSA 1ZSVA 3OFSA 4ND5A 1GYRA 2VUUA 4MP8A 3MWEB 4XQCA 1LQUA 3GZNA 3ONDA 2YV2A 1BXZA 2A94A 4BV8A 2FSSA 5A5FA 3AI1A 2EKLA 3C3XA 2VHWA 3RUAA 4YAGA 5TQVA 1IUKA 3EDMA 3FTPA 3HG7A 3WIEA 5HA5A 3DBRB 3WB9A 3DAFA 1HTBA 3PWKA 1YB5A 3BAZA 3SC6A 2CY0A 4OOEA 5I7FA 3PHJA 3I9JA 1EMDA 4J3FA 4DMLA 4FCCA 5H81A 3P2YA 3OA2A 3D1LA 1LC0A 1O95A 4FIZA 4R69A 1WW8A 1UDAA 1E6UA 1R4MB 2JHGA 4KZPA 3GVHA 1J5PA 4YBZA 4BNJA 1CEQA 1NFRA 5KKAA 5A3JA 4CM7A 3BMQA 1WLYA 3JQAD 1WMAA 2NQ8A 1I36A 1OOEA 4BMSA 3GH3A 4AVYA 2VN8A 1XQ1A 2CUKA 1N7HA 1OZAA 4YQYA 2DLDA 2XXJA 1N1GA 1Z74A 9LDTA 2FY8A 3QY9A 4N54A 3DONA 2FP4A 2IODA 4IJKA 1SPXA 4OYRA 3WGOA 2C59A 3WSWA 4DLLA 4FOSA 2X9GA 3BMOB 1ORRA 3KYBA 3JD0A 1GUFA 4WLVA 1U5CA 2HRZA 5HS4A 2FWMX 4II3A 1TT7A 8LDHA 1EVZA 2IZZA 1B16A 3JD1A 2D5AA 3UF0A 3FNFA 4RVDA 4F6LA 5AXAA 4AJIA 3EMKA 2Q4BA 1AE1A 3F4LA 1MP0A 1E3IA 1G0OA 2B37A 2QQ5A 3K6JA 4J90A 2PZMA 4DC1A 2XXBA 3NTQA 3WYEA 1LLCA 5IN4A 3PIDA 2SCUA 1C3VA 2YY7A 5LDGA 1GYQA 1IZ9A 1D4FA 4KQWA 4E2ZA 4HXYA 5JAZA 3PLNA 4Z9XA 3E1KA 2Q3EA 4O0LA 4J6FA 3R6DA 2D3TA 2VWHA 4NR0A 3MEQA 4J91A 1LDGA 1YGYA 3C24A 1N2SA 3IL2A 4N7RA 4DREA 2O3TA 4J7UA 9LDBA 1W73A 5F5NA 4OSPA 1ZSNA 2CD9A 1VLLA 2CDAA 3DL2A 5I9LA 4MVJH 1Q0HA 3JQBC 4CQLA 4IZIA 1KEUA 2I99A 2H63A 2FN7A 4Y8VA 2GASA 3AFMA 1PL8A 2ZB8A 1YDEA 3D7LA 1WPQA 3AWDA 4IMPA 5KJ6A 5A5EA 1LDMA 1O94A 1YQDA 3D0OA 1HSZA 1QG6A 4E2XA 1DEHA 1WXDA 2W2KB 3OJFA 3NDRA 3RC2A 4UEKA 1ML3A 4QFCA 3E48A 4Q3EA 4W99A 1QV6A 1HXHA 2D0IA 1C0LA 3HN2A 4JNKA 3KLMX 3U49A 3TN7A 4D0SA 1ENZA 1A5ZA 1PR3A 5CDGA 5L7YA 1H2BA 3HUDA 3U4HA 1B8UA 2QYSA 3MJTA 1C0KA 3JD3A 1BG6A 3CMCO 4E5MA 4BNGA 1YVEI 1ADBA 1PR9A 3ICPA 5COQA 4DRYA 3KO8A 4TRRA 1HZJA 4YVFA 4CM1A 4J2HA 1I2CA 2J5RA 1ISJA 1DLIA 4RQTA 1GV0A 2GDZA 4BQPA 5EQDA 4DLBA 1PWXA 4YAIA 3FSRA 1VE9A 4L4RA 1V0JA 2NVUB 4Z6KA 3L6EA 1X7DA 4URFA 4K6CA 5A05A 3PWSA 2W90A 4QSMA 4K9DA 3GDGA 1MG5A 4DQXA 4UVHA 3ZWVA 2P5YA 1ISGA 1BXGA 3Q2IA 2YDXA 4DPKA 3DZHA 4TRNA 3WGYA 3X2FA 3GVXA 3TL3A 3KXDA 3U9LA 4E5NA 2EP5A 2Z5LA 3NV9A 3IUSA 5C3MA 4J2OA 5G0TA 1R0SA 3SJUA 1GEEA 4XDZA 4B8WA 5B37A 1NYTA 4F46A 5CHEA 1ID1A 3PFFA 1D8AA 1HWYA 3U3XA 3SLGA 4EJMA 4GL4A 3OF2A 1Q2XA 3ENNA 4O1MA 2GGSA 3OQ6A 1WZIA 4FGSA 5GY7A 2GZ3A 4MP6A 4CPDA 4I5FA 4IJWA 4YJHB 3L4BC 2RIRA 2I3GA 1XELA 3S1LA 4B4UA 3ZW9A 1T26A 3UN1A 4R51A 5K6AC 4B4VA 2HUNA 4W82A 5B12A 3NGXA 4FD3A 1LRKA 1UJMA 4EJ6A 1GR0A 1JLLA 4BO8A 4BVAA 2V6MA 1H0KA 2EP7A 3LF1A 4X54A 4TVBA 4M49A 5TJHA 4TSKA 4RL6A 1PJ2A 1V3UA 1N1EA 2BFPA 2VNAA 3RUDA 3VDRA 3FI9A 2DBZA 1OBFO 1DIRA 3Q6IA 2PV7A 3JYQA 3UFXA 3MTGA 2FRDA 3EAGA 3OM9A 3HB5X 4QXMA 2IRWA 3FPLA 1WZEA 5IDWA 4U5QA 4DPMA 3OIFA 1QRRA 4ALIA 2YUTA 2NM0A 2DM6A 3H5NA 3PJGA 1WMBA 3DMTC 1WDKA 3AUAA 3QVOA 3DQPA 3S8MA 3BIOA 4M55A 2J3HA 2GUGA 3D3WA 1QLHA 3PFWO 4CMIA 1UH5A 5JFOA 4J7XA 2O2YA 4TZKA 4R16A 2WE7A 2XF8A 3T4EA 4CUZA 4U7WA 3JTMA 2ZTMA 4R1NA 1U8FO 3Q3CA 2BFMA 1EVJA 4P4LA 5IG2A 3OJEA 3BZUA 2QHXA 4LMRA 5CG2A 1W0CA 3TWOA 1CRWG 2VNSA 5DNAA 4FFOA 4EUFA 4DYDA 4QX6A 4OKIA 4ND1A 4BGIA 1T24A 3RROA 1TT5B 1PJ3A 1GUZA 3WDSA 3L9WA 5JPIA 3QQPA 4YRDA 4DMMA 5F21A 1UP6A 3VPHA 3WLFA 3P5SA 1WDLA 3RD5A 2CDBA 1IYZA 1ZVMA 2CVOA 3H2SA 4LN1A 4KOAA 1YJQA 1NQOA 3I3OA 2IXBA 2E6UX 3ZU2A 3C8MA 4OQZA 3I6IA 2E4AA 4L74A 3V5NA 4UREA 1R66A 3AM4A 2NVUA 4O5OA 3E9QA 1KS9A 2X9NA 1DJNA 2G76A 4WNIA 4YT8A 1Y81A 5T6BA 1ZK2A 4Z9YA 4H3VA 1HT0A 1VRWA 3I4FA 4DBZA 1A71A 2Y68A 3WTBA 3O8QB 1DAPA 4OAQA 1A27A 3LC2O 4BL5A 4CMCA 4RLSA 3LVFO 3Q2KA 4BO5A 4B7UA 3OIDA 3JYLA 1C14A 1K2WA 4PZEA 4ND4A 3GC6A 3VPSA 2G82A 1E5LA 1DRWA 4NFYA 2CF6A 4PG8A 2RHCA 1UUFA 2PKQO 3WFIA 4GGPA 3V1YA 4IGFA 3WQQA 3RUFA 1EK5A 4PLGA 4CQMD 1RM0A 3OQBA 4Q3AA 2EEZA 5H82A 1X0VA 2BHLA 1DIAA 5JNLA 2YW9A 3OQ1A 1AXEA 2OMEA 2ZK7A 4A27A 2DTXA 1F8GA 3KSUA 4PRKA 4ALJA 3ICCA 4BGUA 1C0IA 4YACA 2FHSA 4RZIA 2JHFA 3BXXA 3B1KA 3UHAA 4FC7A 1M66A 1HLDA 3H3JA 1JAYA 4LMPA 2AE2A 1A9ZA 4FPXA 1O5IA 3KETA 3PYXA 4PG5A 2V6FA 3KYCA 2E49A 2W2KA 2ZTVA 4PLHA 1BHSA 3A9WA 3WQRA 2O3QA 2YQ5A 4UEOA 4N5LA 3VPGA 3L77A 4OMUA 2E37A 2BGLA 5JDCA 1BDMA 3FN4A 5A4DA 2VYNA 1W8DA 4EDFA 4NI5A 5GZ1A 4DTIA 3LDHA 3GMDA 2VQ3A 3AM3A 5ADHA 2NNLD 1FDWA 4I9UA 2EKPA 3BMNA 4G2NA 1PTJA 2PH5A 3JCZA 4AJJA 2JD0A 1IL0A 2Q2VA 3ST7A 5I7SA 3PQDA 2D5CA 4PLFA 5IZ4A 1ZIDA 1I24A 1XGKA 1Y6JA 3ZHYA 3L4BA 4NPCA 1I33A 2VTDA 1UZNA 3I9KA 1E5QA 1F06A 3DB2A 3ZN2A 3HQ4O 2R6JA 2B35A 1Q0QA 2J8ZA 1NVTA 4GGOA 1S6YA 4OXKA 4QO7A 3VAZA 1LXCA 3LU1A 2AQKA 4O59O 4CM6A 5THQA 1LBEA 4CM5A 1UXIA 4HADA 4NHEA 3VH1A 3VZRA 4B3HA 7ADHA 1FDSA 1B7GO 3CSDA 1XR3A 2YHIB 3RFTA 3E9NA 1EE9A 5T73A 1DPGA 2Z1MA 1Y5MA 3DHYA 3C1OA 3JQBA 4CMBA 3F4BA 3OH8A 3TF5A 3JQAA 1T2FA 4ALNA 1GADO 3I4CA 4D45A 1ZFNA 3O8QA 4IINA 4MVJE 1C1DA 2ZJ1A 4P38A 1E3JA 1LRJA 1ZZEA 4Q3BA 4RF5A 1M6HA 2VWGA 2GF2A 5JYAA 3ZDFA 3PHLA 3TZ6A 4ALMA 3OA0A 1N9GA 3JQGA 7MDHA 1B8PA 3BHMA 1E7WA 4WLEA 5BSGA 3TDKA 3GFBA 4B4OA 3ANLA 1X7HA 2Y99A 3BMQB 1Y7TA 2EGGA 3VC7A 4LRSB 3KLPX 3G3EA 4JP3A 2NTJA 2A9FA 5TT1A 5JLAA 3H4VA 3KZVA 3D4PA 3PK0A 4J9VA 1XU9A 4BNNA 2YFQA 4NH4A 4YT2A 2X1HA 2AE1A 5ICMA 3A28A 1PQWA 3QSGA 2OL4A 4GH5A 4GX1A 4YRAA 2I66A 2GN8A 2X23A 4GVXA 3FCOA 4QFDA 4QQRA 4DIBA 1QYXA 2C7GA 1PL7A 4RF2A 4EEXA 2V6GA 2HMUA 4L4SA 2VZ0A 3QWFA 4R9RA 2QRLA 2I76A 3IAHA 1HSOA 5ILGA 4FJ1A 4NMHA 1CERA 5IN5A 1Y9AA 3HE3A 4J4BA 5JBIA 1H6BA 3DO5A 4JJIA 4PIVA 5I9NA 2W2LD 1F17A 3L6OO 3PEFA 5GMOA 3WBBA 2NTVA 1OFGA 1K6JA 4AG3A 4Y67A 3KSDO 1CWUA 5CPBA 4OXNA 2H1SA 5I8ZA 3D64A 5IXSA 3E18A 2P4QA 4YAEA 1SEVA 4IGEA 4FJ2A 3GEGA 4IQ8A 4YTEA 1P1KA 3TPCA 2GN9A 3U62A 1SMKA 3I83A 1XKQA 2X86A 4ZQHA 1GQQA 1YOVB 4ZQBA 1Z82A 4RJTA 1CETA 1PWZA 3GHYA 4LW8A 5TNXA 4JP2A 4R1TA 4W4TA 1TA4A 5HRUA 3RC7A 1S7CA 3ZNPA 2JD1A 3PHHA 1E3SA 4JBIA 5A06A 1CJCA 3V2HA 3VKUA 4CODB 1SB9A 5IAAA 2RHRA 3IDSA 4CL8A 1OAAA 1HE4A 1VJ0A 3W6UA 3BMCA 4PLCA 1I8TA 5DCWA 3GMSA 3S2EA 3CPSA 1OC2A 1PJBA 3FRJA 1JQBA 3F46A 2DVMA 5F5LA 2PZJA 1PEDA 1WP4A 3RUEA 3CIFA 2CF5A 5BSHA 1G1AA 3GAFA 4IZHA 5ICSA 3MJVA 4H7PA 1Y8RB 4LSMA 3DEYX 4RO0A 4JXKA 4RVHA 1EQUA 4GSKA 2AA3A 3OETA 3W4JA 1HE3A 2Z95A 4DIFA 1GCOA 4NK4A 5A1TA 1U28A 3KYCB 2PFGA 3H9JA 1Z7EA 4FBGA 2DU8A 4Y6PA 4YT4A 4MVJI 3GEDA 1HDGO 1PS0A 1UP4A 1DIBA 4ITUA 4CLRB 1I3KA 2C7VA 1U4SA 3UGKA 3EUWA 2FZWA 2EERA 4M8SA 4WNCA 4UUNA 2PK3A 2PGDA 5J9GA 4TVOA 5DCUA 1G0NA 3P19A 4LISA 1X7GA 4WCFA 3LC7O 5L45A 5L9AA 2EGHA 1LDNA 5A3VA 1C0PA 4BNKA 3LK7A 1AHHA 3WWYA 2X7HA 4YJGA 2VT2A 4DL9A 2J5KA 4ALLA 3LSYA 1YQGA 3DBLB 4F45A 3IP3A 4NBTA 5T5QA 5I7VA 1JW9B 2NVBA 3AU8A 1JA9A 4U0KA 1ZJZA 3RKUA 3OBBA 1LDYA 5DOVA 3IOYA 1N7GA 4Y98A 5CPFA 1QMGA 4U0JA 1E3LA 2H9IA 4E0BA 3ITKA 1SZJG 3W8DA 3WTCA 3QWBA 3RSHA 3WBFA 5DBIA 4G81A 2JCYA 1LQTA 1H94A 1R4NB 4O6VA 4CQMB 5JAQA 4IMRA 2Y1DA 2JFGA 4J4HA 4PCVA 2NWQA 3LLVA 2GNAA 2V7PA 1R16A 4A2CA 1LDEA 1ZBQA 4IPTA 4J0FA 5L7WA 3LC1O 3H7AA 4DQVA 1WWKA 3MZ0A 3GPDG 4MPDA 4BNXA 3I9OA 3AW9A 3WS7A 4BNZA 4IXTA 4XYLA 3D4NA 5I9MA 5KJ1A 1KERA 1K5HA 1V35A 2QRJA 2DTEA 3BTVA 4YCAA 5KTKA 1O9BA 1UZMA 1AXGA 1PJCA 4RVFA 4CM9D 3JQ7B 3GGPA 1K89A 3GHHA 3F5QA 1HLPA 2X5OA 1R15A 3AUSA 2I3AA 4E12A 3ROMA 3VH4A 2ILTA 2OP0A 1FXSA 4HBGA 4ZQEA 4UULA 3P2OA 1E1MA 5G0WA 5HS6A 5IDQA 1NPDA 1YXMA 4ZGWA 2Y0EA 4ZJUA 5DULA 1GAEO 2VRCD 4A5OA 1VKNA 1SC6A 4J9UE 1VKOA 1TT5A 1X1EA 5G2OA 3JD4A 1XSEA 1LNQA 1GD1O 3F5SA 3QA9A 1MFPA 3V2GA 4RCVA 3QE3A 1XA0A 2CZCA 4XJSA 1HDYA 2OZPA 4XGKA 3E03A 4DIOA 3L0DA 4FS3A 4PG4A 3AY3A 3GLQA 3AI3A 3G79A 3AUTA 2EW2A 5M6DA 3K92A 4I5EA 3WFJA 5K6AA 1XYGA 3D4OA 2OBYA 5DF1A 3KHUA 2AQ8A 1MX3A 1IHYA 1E7YA 3JYNA 4R68A 4CM9A 5CG1A 4RPLA 1EVYA 2G0TA 1GTMA 4L4XA 5TSDA 3IKVA 3ZWAA 1I5RA 3RJ9A 1NX6A 2DAPA 1R37A 2BLLA 2PD3A 3DTTA 3RI3A 1FMCA 4W7IA 2JAPA 2AG8A 2AEJA 4WK6A 3DZIA 2NVWA 3OJ0A 1KVSA 4I9NA 3WYBA 2I5PO 4U8GA 2DKNA 3G1TA 2XOXA 3GGGA 1NQAO 3H9QA 4J7CA 5BNIA 4GMGA 5DN9A 3K2BA 4CV0A 3BYZA 4RVUA 4D3DA 3RVDA 1LLQA 3DZFA 2J3IA 5EERA 1EFLA 1HDRA 2VOJA 1NQ5A 1P1JA 4MKZA 1JWAB 3EZLA 1XCBA 2PR2A 2BH9A 4S1VA 2RBEA 2GZ1A 1PU2A 5IF3A 1NWCA 3DXFA 1P1FA 1KY4A 2P91A 3ZNQA 5EPOA 4RORA 2PGJA 4YAKA 4LCJA 1VI2A 1PJLA 1PZHA 1A4IA 1RWBA 2ZKLA 4IIVA 5TRTA 3IS3A 2FSVA 3KRTA 1PJQA 3BHIA 3WOHA 3UXYA 4L75A 3CXRA 4XB2A 3ADOA 1L1FA 1H93A 4BKOA 3IJPA 1CYDA 2WD8A 3CE6A 4M1QA 1XWFA 5HM8A 2IYOA 4R3NA 4FB5A 5JY1A 4GMFA 3DWFA 5KVCA 1VSUA 2C5AA 3ABIA 3GR6A 4ZVVA 3WICA 2P4HX 3JD2A 3NTRA 2NUAA 3RKRA 2BGKA 3B20A 4E31A 1G6KA 3H2ZA 1GEGA 1BW9A 4P4NA 3ZWOA 1EBUA 4MVJD 3ITDA 5EESA 3INTA 2WM3A 4PLPA 2Q45A 4CUKA 1LSJA 3RJ5A 5FI3A 1R6DA 2GPTA 3ZWPA 4NG5A 4EYEA 4NJMB 5I8WA 2B4TO 2JD2A 5JCJA 4MIEA 3LT0A 1P74A 2IEDA 1P45A 2Q50A 3BTSA 2QW8A 4MKXA 1P31A 3R0IA 4PLVA 5DCYA 3E9MA 3QV1A 3VKVA 3HB4X 4LSWA 3G17A 5EQFA 2E82A 3ETEA 4H16A 1ZNQO 2OGUA 1T25A 3T4XA 3JQEA 4RLHA 1DAOA 2TMDA 4LVCA 3DDNA 5EJ2A 1J49A 3KTDA 4IM7A 4W9NC 1E3WA 4NQZA 4B3IA 1X1TA 1U3TA 5FI5A 4EZBA 4PFJA 4ZA2A 2UV8A 1V9LA 4LGVA 1YQXA 5EMHA 3H65A 3NKLA 2AEFA 5KOIA 1LA2A 2C5EA 4BHTA 1JKIA 2Y1CA 2Y1EA 1CQJA 4NJMA 3PZRA 1Y5RA 2Q1UA 4HWKA 3TZKA 5C37A 3DMYA 2H6EA 3OICA 1P1IA 5L4NA 2HMTA 1I01A 5K9ZA 1IZ0A 2UDPA 5ES3A 3QVWA 4B8ZA 1KETA 2ZYDA 3ZGYA 4KWHA 1JKFA 2B4RO 2ZATA 3AY6A 3D5TA 3NAQA 5COAA 1Q7CA 3RUIA 4NU6A 3U09A 4R54A 1ZEJA 2DBVO 1VJTA 3E5MA 4PG6A 3GZ4A 1DOHA 4D42A 4BKUA 5A04A 1ULSA 4DYVA 2A92A 2J3KA 2X0JA 4D44A 3RC1A 1T2CA 2FR0A 3H9GA 4I5GA 4UUMA 3NTOA 1AGNA 3UCFA 4AJOA 3S55A 2C82A 3O03A 3AU9A 5KVSA 2QZZA 1H6DA 1GQ2A 3LT2A 1Q1NA 1HF3A 1HZZA 4Z3DA 1HEUA 4CR8A 3QP9A 2EW8A 4EUEA 3RBZA 1MGOA 3I5MA 2P9CA 4RGBA 5DBGA 4IS2A 3K73O 2WD7B 3ZV3A 4ZD6A 3BMOA 1V3VA 1P77A 4MP3A 3FNEA 3PI7A 4GSLA 3SX2A 4OO3A 3MJ4A 1YJ8A 4BNTA 2VZ9A 4B3JA 1NP3A 4CUJA 4RPKA 1SOVA 4FFNA 1PS8A 3GGOA 2EWMA 4C7JA 5IDYA 4BKRA 3RBXA 5KNLA 3M1LA 3VTFA 4AJ1A 5JSFA 4W6ZA 3INRA 2EJVA 4BOYA 3FR8A 4JK3A 5JDIA 5HTOA 1B0AA 3ROKA 1ZH8A 1LJ8A 2BGMA 1OI7A 4XX0A 5MDHA 3QWIA 5C5IA 3ZWXA 1HE2A 5L95A 3F3SA 1YBMA 5TC4A 3WR5A 4GQAA 1HYGA 4CLXA 2X0IA 3D5QA 3DHEA 4HKTA 1ISMA 2UUOA 1Z7BA 2D4AA 4NZ9A 1N5DA 2PNFA 4YT5A 3IP1A 5B4UA 3KM0A 5HWSA 5ENVA 1K0UA 5B4VA 4JQCA 1HYHA 4E13A 4ZICA 4G65A 2GD1O 1JDJA 2A35A 3DHNA 3ONFA 3R3JA 4XYMA 5JMWA 2BMAA 2C29D 2CDCA 2CVZA 4YJFB 4CLDA 3ZV6A 1SOWA 1U2GA 4GLOA 1PJTA 2CSUA 1TI7A 2HQ1A 4KTVE 3ASUA 2OP1A 4S3MA 2O3RA 5FYDA 2CFCA 2POQX 2J3JA 4MO2A 1IHXA 1E77A 2X22A 3OHSX 4OM8A 2TMGA 3FWZA 2HAEA 1H2HA 4HNHA 3DOCA 3RBVA 3VZPA 4EW6A 1DSSG 1M2WA 1PL6A 1PJ4A 1EUDA 1T2AA 5U9CA 4BNYA 3Q9NA 1QSGA 3RU7A 2ZB7A 1JWBB 3F6YA 5AXDA 2PH3A 5ILOA 3K96A 3KBOA 1K6XA 4WE3A 3TSCA 4G5HA 4Z0TA 5A03A 3EC7A 1SB8A 5G4KB 4KTTE 4L0QA 2B5VA 4XWYA 5JXWA 1ZCJA 2J5QA 4OQYA 3GNTA 2P68A 4IBOA 4DA9A 2ZJ0A 5COBA 2OFPA 4MOWA 4FFPA 3DTYA 3GEMA 1N92A 3GK3A 2YDYA 1EQ2A 4Q3NA 4MKRA 3M1AA 2YJZA 3VTZA 1YL7A 3GAZA 1I3MA 4GAEA 4F6CA 4LCEA 5THKA 1E0DA 3K5PA 2Y67A 3PHIA 4AJKA 5JS6A 1KVUA 2B0JA 3HHPA 3Q11A 2EIHA 1ZK1A 3I9LA 2WWRA 3MJCA 3B6ZA 4Z9FA 5JYFA 4A03A 3DMTA 3A4VA 4QT0A 3V1UA 3IUPA 3NT2A 4HX5A 2P5UA 5CAEA 2GLXA 3OEWA 5FFFA 4WGGA 2WSBA 3GN1A 3M2TA 4R9SA 2HK9A 2I6TA 3N7UA 4M87A 1NM5A 4TZTA 4RPJA 3UOGA 5AYVA 1NFQA 4A0SA 2VCYA 1RYDA 5U4QA 1RYEA 1W4ZA 2CNBA 3AJRA 4J1SA 4YJGB 3X2EA 2AQHA 1KVTA 2PTGA 1EEHA 2QYTA 4YR9A 2JCXA 4E6PA 4CMHA 3C1AA 3GUYA 4RPHA 3DAGA 4WCFB 2O2SA 1T1SA 5BNTA 5JO0A 4HFJA 1ONOA 3JSAA 4OOFA 4WECA 4YAJA 4CM4B 2OOSA 3ZH2A 1P0CA 1T4DA 1DXYA 3I23A 1R4NA 1JKJA 4DQUA 5KWEA 2BELA 3C85A 4MVJA 5DZSA 1LSUA 3COSA 5TS3A 4DGSA 5KJCA 3SJ7A 4BQRA 4XR9A 1MG0A 1V8BA 1P1HA 3L07A 3CZMA 1UAGA 2I65A 4C7KA 5TIIA 3IIEA 3GVCA 4OL9A 2Q2QA 4C4OA 4R4JA 4XB1A 2OORA 3ZU5A 3JQ8B 4JLWA 4AL4A 3ONEA 5BNFA 2YYYA 1CDOA 2ZYGA 1GV1A 3ROQA 4CQLB 1K6IA 4Z3KA 1GQYA 1QYCA 1DJQA 1YL6A 1DLJA 1TLTA 3WXBA 4KUEA 4P4GA 2C0CA 1GFSA 4O63O 3GFGA 3T7CA 1PS9A 3KYDA 3M2PA 3PJFA 3KEOA 3NX4A 1NQTA 3FBTA 3WSVA 4YQZA 4OJNA 2O4UX 3FPCA 4FQ8A 1NNUA 1HDOA 3O26A 5ER9A 3ON5A 1GY8A 3P7MA 1GCUA 4JROA 2VHVA 3GA0A 2VOEA 3ZHXA 1XG5A 3JV7A 3ZV4A 3HFGA 4FW8A 4EUHA 4IQ0A 4IDFA 2OUIA 3QVSA 2O3SA 3K30A 1ZMOA 3HN7A 3BTUA 5CFZA 2VWQA 3C7CB 2O4CA 4RDIA 2FR8A 2JFHA 2UVDA 1IE3A 3WGQA 3C7AA 1FJHA 5KJEA 2WE8A 1V3TA 3VOSA 4XQ9A 2AQIA 4IDCA 3TNLA 2ZTUA 2PWZA 2YV1A 4K26A 4INAA 2C2XA 3IJRA 1A9YA 3QJ5A 5T8KA 2DBQA 5TF4A 3QRWA 1ZUD1 2BRUA 2X4GA 2FPGA 4UAGA 2WTBA 2Q49A 3A14A 3EY4A 1FDUA 4HUJA 3CINA 3IKTA 2Y0DA 1EZ4A 4FDAA 5H83A 1ZKMA 1UR5A 1I30A 2J6IA 3LF2A 4KUGA 5TJ9A 3WMWA 4CR7A 3HDJA 1QP8A 2JFFA 3AY7A 2X0RA 1PGOA 2Q1WA 2O48X 3FTNA 2IE0A 1YDWA 3H9EO 3N74A 1VL0A 1R4MA 2BKAA 1U7TA 1VL8A 4E30A 2DFVA 2HMSA 2QIOA 1BGVA 3NUGA 3SBOA 1LEHA 1SO8A 1DC5A 2OO5A 3JQFA 1DRUA 3SC4A 2UYYA 1QXSA 2HLPA 1NPYA 2WDZA 4OH1A 4HFNA 3QW2A 3ROPA 4BO2A 4ND3A 4BNVA 3KVOA 2BFAA 1TEHA 4NFHA 3JQ6A 1BVUA 1RKXA 4XYEA 4R5MA 1A4UA 1ENYA 2I9PA 2ZIZA 3WX0A 4TRMA 3NGLA 1QKIA 4ALKA 1EE2A 4ID9A 4CM4A 1FK8A 2PA3A 1N8KA 2AG5A 4R3WA 2D2IA 5B4TA 4A7PA 1BW9B 2JCVA 2ZYAA 2X6TA 3EGOA 1J0XO 1QYWA 1IPFA 2NQTA 4WPGA 1PQUA 4UUOA 4WKGA 4E2WA 3PVZA 5GZ6A 4BO6A 2RH4A 4DLAA 5JC1A 1PZGA 3U4IA 3JYPA 1ZJYA 4Q3CA 1CIVA 1NR7A 2OHXA 4BB5A 4IDGA 3UKOA 3HZZA 4ZN6A 4OHUA 4J1TA 5F1OA 4YXFA 3TJRA 3WWZA 4CMEA 1HDXA 3G0OA 2O3UA 4I8XA 3GPIA 2PY6A 4E5YA 4QTZA 4CLRA 4IDBA 4OSOA 1DDOA 1OC4A 3TOXA 3TRIA 2GN4A 1ZW1A 3LT4A 3T7EA 3ULKA 1T2DA 2VT3A 4L76A 4EBFA 4RF4A 2NADA 4FFLA 2HCTA 1UXKA 1Y9EA 3E5RA 2V6BA 1Q7BA 3JQ8A 3QVTA 4EJ0A 4XGNA 4BV9A 4ZQFA 1VJ1A 4UUPA 1IPEA 3TZHA 1E6WA 1KEPA 2RAFA 3IQDB 4CR6A 4CJXA 1GZ3A 1JU9A 4KP7A 1B26A 4II2A 5DOZA 2VHYA 5L4SA 3PHGA 1YBVA 4J1QA 1NFFA 2D1YA 5G4LA 3JQ9C 4A10A 3KSZO 4HV4A 1Q7GA 2DC1A 4N5MA 1NHWA 5EL0A 4FFRA 3K31A 4ZRNA 2JJYA 1JVBA 4ZU3A 1AUPA 1KC3A 3PPIA 4AICA 2H5LA 1ZK4A 1W6UA 3OIGA 4XQEA 1T2EA 3G49A 4ZQGA 1ISHA 3DZGA 3GUCA 4CLHA 1LLUA 4GKBA 2HSDA 3DBVO 1P33A 1ZMTA 5CDYA 2BFOA 2Y05A 3DZBA 1YONA 3RFVA 2Y0CA 3PWZA 1HKUA 1LLDA 4UEJA 1I0ZA 3RU9A 1QV7A 5L51A 2NLOA 1Y1PA 1E1KA 5T57A 3MOGA 2AEMA 1ISFA 3RUHA 3U0BA 5C7LO 5A9SA 2R00A 1NHGA 2ZCUA 1B3BA 3GF4A 4Y6SA 2IXAA 3SEFA 1LDBA 2GCGA 3ZWCA 5ITWA 4BO0A 1E7RA 2P9EA 4KDFA 2VYVD 1U5AA 2FPIA 4GI2A 4PLTA 4BGVA 3NT5A 1BDBA 1ZK0A 2FOIA 3RQSA 2DTDA 2ZB4A 4E2YA 2VHZA 4AJHA 4A73A 5B1YA 1U9JA 1LC3A 3HDYA 4JBGA 1H9BA 4RQUA 3WGGA 1UXJA 1I32A 3H5RA 5TGDA 4J4TA 5F3RA 3FNGA 1X14A 1V6AA 4E5PA 4OKNA 1DIGA 1UAYA 3NDJA 5DDIP 3L9XA 1YS4A 1LSOA 3W8FA 1NAIA 4NU5A 4JCOA 4J0EA 3WNVA 5C7OO 5IFLA 1SNYA 2VZ8A 3ZW8A 1NAHA 5BQFA 2Q4EA 4JN6B 2R00C 1C1XA 2ET6A 4XGIA 5JDIC 2DUUA 3I52A 4QUKA 2W2LA 3ZHBA 4WEQA 3Q1LA 4B7CA 4M89A 3NRCA 5EINA 1ZK3A 4BMNA 1AN9A 3PZBA 4DWVA 5T67A 3AOEC 1EUZA 4GWKA 4WLFA 5G0UA 2P9GA 4UVIA 1N9GB 4NBUA 3GY0A 3K9QO 4OIMA 4Z0PA 3RAJA 2G5CA 1WDMA 3FBGA 5L7TA 2LDXA 2DQ4A 1DC3A 3AM5A 1L7EA 1FDVA 4XYBA 3KUXA 3O38A 4Q3DA 3EK2A 2E48A 1BVRA 4IUYA 2X58A 1U3UA 1ARZA 2R2GA 2QRKA 1M75A 3OP4A 4BUCA 3ZHZA 1FF9A 3EVTA 3KYDB 5IZCA 4WCFC 1P44A 3PGJA 3WJAA 3KB6A 5TX7A 4TMFA 1R12A 1LI4A 3HWRA 5AXBA 2C54A 2IZ0A 1C1XB 4XYGA 5ER6A 3U4DA 1RPNA 4CV2A 1DBVO 3F9IA 4IY1A 4JJFA 3QIVA 3ZZNA 2WD7A 4UVEA 6LDHA 3TOZA 2WJPA 2B69A 4NBRA 2X5JO 4WLNA 2Y93A 2JAHA 4KUHA 3ETDA 4BKPA 1PJSA 3JQGB 1H6AA 2NU6A 3B1FA 1SEPA 3ETGA 3F1KA 4FR5A 2PKQP 3GVIA 2EXXA 3VPFA 2HU2A 5ENDA 2PD4A 2HDHA 1DFIA 2HKIA 5KVVA 1C1DB 1U8XX 4AFNA 2B83A 1U3WA 2EJWA 2EHDA 1R0LA 1P3DA 3ZNNA 3FHLA 2Y1FA 4K1LA 2ZQYA 4WCDA 2WMDA 1Y8RA 4FFMA 4NDNE 1I3NA 1BWSA 2GERA 3S2GA 3UICA 3WJ7A 1E7QA 1CF2O 3A1NA 3DBHB 3K8ZA 1IULA 3CKYA 4Q9NA 4W9NA 3B1JA 1K3TA 1ZEMA 3EZYA 3CUKA 2QX7A 1BSVA 1Y8QB 1BTOA 3C7DB 1HE5A 3TQHA 4YRBA 1MXHA 1VPDA 4E5KA 1XDWA 3H9UA 5DBFA 3ZCXA 1AHIA 2VYVA 1E1LA 1SAYA 4GX2A 4XKJA 5T8KC 3O9ZA 4RVSA 4MJLA 4D3SA 1LU9A 3WGZA 1YKFA 3PJEA 4ESOA 1O89A 1J4AA 4DPLA 1E7SA 1PZEA 3E82A 1EDZA 4WLUA 1O0SA 1EK6A 1KY5A 1E3WB 4EGFA 3OECA 4YB8A 4W7HA 5JCJD 1U4OA 2X9VA 1UXGA 1XHLA 1UXHA 4GWGA 2RCYA 3WIDA 1X0XA 4Z0HO 1QYVA 4GX0A 2QZ9A 4LK3A 3LQFA 5JAMA 5DP2A 1XLTA 3CH6A 3OJOA 4IQGA 2ZQZA 3JQFC 4BMVA 5DP1A 3F1LA 1WAMA 4MVJF 4L73A 1Y8QA 3ZNOA 2Z1NA 2O50A 3V1TC 1KBZA 1KVRA 1LUAA 3JQ9A 4AJEA 4CLOB 2VUSA 2AMFA 3DFZA 4KMSA 3A06A 4KDEA 4J43A 5GZ3A 2NU9A 5G4KA 3GT0A 3TFOA 4NBVA 4XZ3A 4F3YA 3TZQA 1VM6A 1GZ6A 2W8ZA 2A4KA 4B7XA 4AJLA 2Q22A 2NTNA 1F0YA 1MV8A 1EUCA 1E3EA 5JYEA 3VPXA 2BI8A 1D7OA 2PD6A 2YZ7A 4GBJA 1YB4A 1DC6A 3KV3O 4CQMA 4CV1A 3WYCA 4GPD1 1ADFA 3UCXA 3GRKA 4XA8A 2ZCVA 4B4WA 3MJSA 1GPDG 1MLDA 3HADA 3WGHA 1YO6A 3WGTA 4YDRA 1KEVA 3QWAA 3HDQA 3OSUA 4YWJA 5L4LA 1HETA 1MC4A 1DHTA 2HJRA 1TVEA 4BNFA 3GQVA 6ADHA 4E32A 1GUYA 2WEKA 3AK4A 5TLSA 1A7KA 5KKCA 4YPOA 2FPPA 1PSDA 4BNLA 2O7SA 3PRJA 3IMFA 4BO1A 1NVGA 2EV9A 2YHUA 3L6DA 3OJLA 1IY8A 1DFHA 2IZ1A 1EBFA 5CEJA 4BGEA 1L7DA 1QYDA 4IIUA 2LDBA 3CMMA 2DPGA 4D7AA 2HK8A 2C20A 4TKLA 1T4BA 3PP8A 1XIVA 1XEAA 2NSDA 4GX5A 3CTMA 1E7MA 4BNMA 3UUWA 1JAXA 4DBVO 3UAGA 1MFZA 2Q1TA 5HBRA 2D59A 4RF3A 3WGIA 4JIGA 5CDTA 3O4RA 3GVPA 3I9NA 4D41A 4XD2A 4RV9A 2VYND 5EIOA 1ADCA 2WYUA 3N58A 4R1SA 2G1UA 4MDHA 3ASVA 1RM3A 1M76A 2NV6A 2W98A 2Y1GA 4QO8A 4CM8B 4TROA 1O8CA 2IDZA 2GZ2A 4BS9A 3RCBA 1EVIA 2AW5A 3MJEA 3QWHA 3BMNB 1B3RA 3D3WB 4BNIA 3PIIA 4XEHA 1ONNA 1YRLA 3MWDB 3EHEA 4CM8A 1QR6A 3PQFA 4YA6A 4BO9A 1DIHA 4L9RA 3M6IA 1LTHR 1X15A 1IOLA 3CEAA 2NU8A 1MC5A 1X13A 4BNHA 2UAGA 4BIIA 3BHJA 3WNQA 3WG9A 5A9RA 2F00A 1H5QA 1YWGO 3NDIA 2HO5A 3PXXA 5CEFA 1GYPA 5JC8A 2B5WA 1SBYA 3PQEA 4Y9DA 4CMAA 4GVLA 4DC0A 3EW7A 3ANMA 4NFSA 1PGNA 1ZXLA 4CM3A 4UVGA 3HNPA 4BO4A 2VTEA 3E6AA 4R01A 1U1IA 1NBOA 3H5AA 4A26A 4PGFA 5A9SB 1E6EA 2CMDA 2FMUA 1HYEA 1UDBA 1YL5A 2Q99A 1KC1A 1A7AA 4YJHA 1NVMB 2VWPA 1H6CA 1BXGB 1VSVA 1VL6A 3VZQA 4K28A 1DRVA 1ADGA 4XIYA 1UP7A 1P0FA 1JTVA 1Z73A 4U6QA 4RDHA 4EI2A 3G1UA 1HL3A 3ENKA 3LT1A 4IXWA 3GG9A 3OMLA 4J49A 4OGWA 1I2BA 3V2UA 4WOKA 1TXGA 4PRLA 4AJ2A 4P8RA 1GDHA 3VH2A 4NNJA 4IDDA 4CMEC 1SCUA 4N18A 4MIYA 4BNWA 5JMPA 2PZKA 1MB4A 5T64A 5LDHA 3Q0EA 4BB6A 2O3JA 4R1UA 4TQGA 1QLJA 2VHXA 4HNGA 4D79A 1B8VA 5A02A 1JVSA 2IYPA 3LZ6A 2GN6A 1M67A 1BMDA 4ROSA 4YYZA 4HFRA 4PN3A 1DO8A 1BXKA 1F12A 3R1IA 3RFXA 3UCEA 2PKRA 2O7QA 3TL2A 3W8EA 3WLEA 4E3ZA 3EYWA 1KYQA 4WJZA 3EVNA 2EG9A 2JKVA 2HMWA 4WOJA 3MCVA 3GDOA 3DFUA 4CMJA 3SLKA 2Y1OA 3FF4A 3I9MA 1RM5A 4XIJA 1WVGA 1JN0A 3DZJA 3KOUA 1HDZA 4BKQA 4DXHA 1B15A 2QG4A 5IZCC 4J16A 1B2LA 3AUUA 1P1RA 4IDAA 4WEOA 5AXCA 3QHAA 1F8FA 3I1JA 4AJNA 1OMOA 4J1NA 2X0NA 4IJVA 1MXFA 5L3ZA 3JQCA 3BMCB 1D1TA 2P2SA 1FDTA 4WASA 3CZRA 4I08A 4AJPA 4K6FA 5JO9A 3W4IA 4BO3A 1ENPA 4KQXA 3KEQA 5A9TA 3GRPA 4I9HA 3UVEA 5LCXA 4LRTB 2B4QA 1PIWA 1J6UA 4GLLA 4PLWA 4ONEA 3NJ8A 3GDFA 4NK5A 1YOVA 5IDXA 4CMGA 4QECA 3VVCA 4FGWA 3AI2A 3GN2A 2YV3A 4XQGA 1UZLA 1YH3A 3AFNA 1KOLA 2FZEA 4NIMA 3MOIA 4PZCA 1Q0LA 5J23A 3W6ZA 4BO7A 4E33A 5TT0A 4MINA 2D8AA 4AJ4A 4GKVA 1P9LA 1Z75A 3I6QA 4OXYA 3IC5A 5JAIA 1XQ6A 3MTJA 1ZSYA 5LC1A 4M54A 3BTOA 1ISIA 4TWRA 3HSKA 3AOGA 2V65A 5CDSA 5AOVA 1U2DA 2WYVA 4IJUA 4RVGA 2C2YA 1PGQA 3GNQA 3ZU4A 1DC4A 3PLRA 5MGBA 4MIOA 3FD8A 3DOOA 4Q39A 5FWNA 3RUCA 1GZ4A 2F1KA 2GSDA 4MVJP 5DT9A 3ZU3A 3U5TA 1PQPA 1GU7A 2FR1A 3GNSA 3JQ7A 2Q46A 4H15A 3ZWNA 5CEEA 5JE8A 2NACA 3JQDA 1BRMA 1D3AA 1PGJA 2BF7A 4XDYA 1CQIA 4XCVA 4LVUA 1NASA 2WYWA 3ZWWA 1IB6A 2CVQA 1NTOA 1GL3A 2VRCA 4KWIA 3U4CA 4EITA 1LRLA 2JL1A 3H3FA 1F14A 3NT4A 2OXIA 4YJFA 3INGA 2W4QA 1ULUA 3JYOA 3LYLA 2UUPA 3HJAA 2GYYA 3GZNB 1NR1A 1U3VA 3NJ4A 4XRRA 5L40A 2B36A 3PYMA 8ADHA 4PG7A 4PLZA 2OBNA 4FJ0A 3RC9A 1NXQA 2AXQA 3DR3A 2ZTLA 1XU7A 3FWNA 1UDCA 3ZV5A 4CV3A 5JY6A 3FR7A 5JYDA 1ZO8A 3Q9UA 3ZWYA 3VDQA 5F1KA 3UH1A 4I5DA 1H9AA 5G0VA 3ADPA 3VVBA 2Y66A 3QVXA 4PZDA 3BA1A 4PVDA 4HFMA 4ZHSA 4N5NA 4FN4A 1E1NA 2EKQA 4HP8A 4WLOA 5BR7A 3ZI0A 4U6SA 3NYWA 5F1PA 5EN4A 4ILKA 4CLEA 1PZFA 3GOHA 5G0SA 4B79A 1A72A 3OEYA 2DFDA 3TZCA 1VC2A 2BD0A 1O6ZA 3B70A 4JBHA 3ANNA 4XRGA 5ITVA 5JDCC 3ZWBA 3STHA 4XR4A 3JQAB 2I67A 1MA0A 3W4KA 3K2EA 3RWBA 1GPJA 3DOJA 2NU7A 2PZLA
chains in the Genus database with same CATH superfamily
1Z45A 1QPBA 1R8XA 3L7CA 4Q7JB 4Q66C 1MMFB 1N2CB 1VJDA 3OPYA 3QX7A 4KAJA 4HYTA 5DXFA 5FNVB 1A3CA 3W1VA 3DBRA 1Y3FE 3TEJA 2P4SA 2Q2WA 1PUJA 2XNKA 3OM0A 1MBZA 3PJDA 1JZTA 3G8BA 3QXSA 1NG1A 5JRDS 3I01A 5BT9A 3ZZ1A 2ZIFA 1M6WA 1HRDA 1GZVA 1V2HE 1YB1A 1NPTO 4H7IA 5D51S 3RYFB 4DRXA 1E2GA 1KA9H 3UWKA 2WZDA 1QORA 4R41A 2MIIA 3LCUA 4QBGB 4CIDA 2YFHA 3D3QA 3CBQA 1I10A 2Q5CA 5E38A 2GRAA 3UMVA 2C57A 5ARCA 5EHIA 3L4SO 2YHIA 3KYIB 3RIHA 5J4VA 3KQNA 4IIJF 2DT5A 2O0LA 5GV7A 1UBHS 4G0VA 3OLVA 5C7IO 4FLMA 5K99A 4EG4A 4TS9A 5ALVA 1ZHFA 2J4CA 4C5CA 1LWOA 2YXPX 5AQ1A 4UNNA 3H8VA 2WVHA 5C46F 1HNNA 1GLNA 2C42A 4OAPA 3DC2A 4G85A 1V8DA 1E92A 1LS1A 1DAKA 2I3BA 5AWFC 4PLYA 3UGQA 5T7BA 3PWTA 4Z7JA 1H4TA 1G59A 1M2FA 2R8EA 5GQSA 1C7QA 2BZ0A 4Q01A 5FF9A 1CDDA 2IYQA 3AVYA 1YE3A 3G9XA 1JDSA 4MA4A 2GR9A 4GRAA 3G59A 1R4AA 2AMJA 2C4WA 1P4JA 4R9UC 5BSEA 3V8BA 1ILWA 1MRNA 4LJ9A 3SE7A 5DM2A 1TE2A 1OI4A 2YWFA 3PGMA 4OHXA 4L22A 4O4IA 4U2EA 4COOA 4DTCA 821PA 1WNTA 1UMDB 2IS6A 1FLDA 4YEDA 3C70A 3SEQA 1GNQA 3OKAA 3T34A 2RGEA 4LWPA 3NB0A 4ZTBA 2RK6A 3SXPA 3VHRA 4X6XA 4HTFA 4ZAZA 5IJZA 1A5TA 1IY2A 3TJZA 2EARA 2W6IA 3IUQA 5EXPA 3DZKA 4O4HA 5E4TA 4E51A 4F1JA 3LX6A 5EKDA 2XAAA 4TKMA 4Y6RA 3KQWA 1UWCA 2RAPA 1UPAA 2WG0A 2ZIAA 1DCKA 3ANTA 3BIJA 3B1ZA 4ND2A 4CUZA 3ICEA 2I1QA 3L6UA 2VDJA 4U7GA 3KZ1E 2V7WA 1SOAA 2C99A 3MAGA 5BSUA 2H0QA 3TXYA 3S2UA 1LTKA 2FP3A 3OCCA 1V41E 3ER6A 1XZDA 1FS4A 3IOMA 3SR3A 5BV7A 1X39A 2QAGB 1R5OA 2LTAA 1ZS9A 1VHJA 4B83A 1OT3A 1FA9A 3BBLA 1MQ8B 3R3SA 5F9FA 2QNIA 2C3OA 2W8BB 4BQIA 1SKQA 1T1RA 1DHRA 1V45E 2K2QB 5T41A 3N0TA 2HJSA 4IIYA 2ZCJA 4QFMA 1TW3A 4OYLA 1D09A 5L53A 5AM2A 1TUEA 1ORVA 2VHTA 4QU5A 3ZS9A 4BYMA 2BYTA 1ZSVA 4KO3S 1OXMA 1U2DC 2GVNA 4RCZA 1OI2A 2CJFA 5T3YA 2MCFA 1KI1A 5C9ZA 3K70D 4GMXA 4UARA 4Z4CA 4ZP1A 3STUA 4D99A 5IS2A 2YV2A 3AZOA 1U81A 2FSSA 5AW5A 1S89A 4F85A 2QORA 1GNTA 1FVOA 2N47A 3IBGA 5TR9A 4YAGA 3DA8A 1R0CA 4LRWA 3HUFA 4CIVA 5ALNA 4LGCA 4NAVA 1YIDA 3OPYB 1MEEA 1YB5A 1I2MA 1U4NA 2PQ0A 4MI1A 5IJXA 4AMUA 2QV7A 4ENTA 3FAKA 3IMGA 2G9ZA 1X7XB 2AYXA 3PHJA 4FWIB 3DZ5B 4HWGA 5BWBA 4CCAA 4FCCA 1IY0A 3UV6A 3OA2A 3D1LA 1XLTC 4U7PB 1N33B 4KHPB 3F9CA 4DBLE 1VRVA 3TDMA 4FX5A 1CQWA 4AS3A 2H51A 4AY6A 3BZWA 4KV7A 3M6MD 4YBZA 4BNJA 1IY9A 4UMEA 4AYWA 1V39A 3NFRA 5KKAA 3THYA 1WLYA 4R2WA 2WQ6A 1L5ZA 1QPGA 1I36A 4Z4HA 1OOEA 3T7IA 4EG1A 2IIQA 1IBKB 2VN8A 2H2DA 1OZAA 4QNMA 4YV7A 2PLFA 3QKRB 2XGOA 5IASA 2NV2B 3C3PA 3X1YA 1Z74A 4PS0A 2ZRIA 3MPUA 3ABZA 2MHCA 4Y2RA 1YFJA 3E4DA 3QY9A 1RC1A 4F56A 4PRYA 5JWHA 2ZJ3A 4S05A 3HJNA 4KR9A 1EAYA 3WGOA 2C59A 4FOSA 3BMOB 2ZWMA 1OFVA 3ET4A 2A14A 4WLVA 1U5CA 4JB0A 3WLQA 1OU4A 4CKCB 4RULA 3L8EA 4YCCA 1TT7A 2IXDA 2WBLC 4IHQA 4RADA 1AGXA 2WWVD 2IZZA 3CX6A 3L4EA 3MQ4A 2OMKA 1L5GB 2FPIB 2AMLA 1K8QA 1NVEA 4HAXA 3UF0A 5KNBD 4RVDA 4LHSA 2PWPA 4BRUA 5EZYB 5AM3A 1VHTA 1AE1A 2VKTA 2QQ5A 4J90A 1Z5ZA 3K0HA 3DZ6B 1W96A 3GCWA 2ZR8A 4QQKA 3WYEA 5K8IA 5IN4A 2BMWA 2G6BA 3PIDA 1V8ZA 3T7AA 1SC9A 1U2QA 4TMYA 3C0KA 4LY9A 1A5SB 4ZO7A 3R7BA 3MMNA 4I99A 2PANA 3E1KA 2QMQA 4NFLA 4AKTA 4J6FA 4G9GA 2VPYA 2VP6A 2VWHA 3MEQA 5JSYA 4ARZB 4Z53A 3L92A 2QDKA 3N8NA 1KHHA 1P9OA 5D6NA 1KARA 1WPGA 3G5AA 4O2AF 1C4OA 2ANBA 1BXRB 1WQ1R 4YQEA 2KQUA 2W48A 5K0EA 1EINA 1BS2A 2B2NA 2I2CA 5AKXA 2ZSDA 4M1OA 1UWVA 5F5NA 3CZ5A 2UXDB 1Z5VA 2CXUA 3HJRA 1CUDA 1QK5A 1VLLA 2CDAA 2CNKA 3DL2A 4KXYA 5DHUA 3U13A 2HTFA 3OI7A 1Q0HA 4Q21A 2R6GA 3T5GA 4XASA 1V8FA 2I99A 3D0QA 2FN7A 4WRRA 2RE8A 4B33A 4C87A 3I34X 3A6DA 3AWDA 3V46A 5A5EA 3NBMA 1XQWA 4KWCA 2W0MA 3K0EA 4OX9B 2J9FB 5K0FA 4YX9A 3CEPB 1IH8A 5BSRA 2W2KB 4GI3A 3KELA 1XC7A 4NAUA 3WAJA 3E48A 2O8VA 5G1OA 1E3DA 2Z09A 3C3EA 4I55B 5BWCA 4XPIB 1HXHA 3HN2A 3O7WA 3TRDA 3NHBA 3TBHA 2V9PA 4ZT2A 4A5SA 3U80A 4GGMX 1ZRSA 3QMVA 2Q3CA 4RH0A 1P9NA 1C7EA 2VHUA 3HUDA 4JZKA 1KDVA 1C81A 1QAOA 3WL6A 5F98A 3MJTA 4BAZA 1K75A 1XPJA 4V0KA 2SICE 3FVWA 2WTUA 10MHA 4C0SA 1L4GA 2H2IA 2RG7A 1L5LA 5KI6A 1YVEI 1PR9A 5SZKB 5I4KA 1E4EB 2WHPA 4DRYA 3CUYA 1RWNA 3T7DA 5JD4A 4PNEA 1HZJA 1UBRS 2OKCA 4CM1A 2XITA 2Q6OA 3V8RA 2J5RA 1JLHA 2J6BA 4Y1FA 4GO1A 4BQPA 1Z5NA 4DLBA 3QPDA 1NW9B 3HR8A 1VE9A 1V0JA 1R10A 3L6EA 1Y8AA 1R64A 2O57A 3BH0A 3SJZA 4EB6A 2PS3A 5A05A 3PWSA 2W90A 1A50B 3WMFA 4CE6A 1M1ZA 1N5JA 1JFTA 1UCFA 4HWRA 2VDLB 2P5YA 1BXGA 1D6JA 2YDXA 3DZHA 4DPKA 2ALJA 2IJGX 4TRNA 3WGYA 3D8NA 5EIFA 5FKJA 3TL3A 4D97A 4H7KA 4B40A 1N3IA 3U9LA 5EJGA 4ZALA 4E5NA 1EKXA 2EP5A 3IUSA 3HY6A 3IMCA 3KKNA 2AGVA 3OZRA 4MCIA 3SJUA 3MTDA 3T5TA 1LJLA 4L6CA 1A9TA 2KBFA 2MYUA 4PAGA 5CHEA 4MB2A 2R6ZA 3WLOA 1V5FA 1D8AA 3U3XA 2G6TA 3SLGA 4EJMA 1N6OA 3EIEA 1KSGA 4DT1A 3OHMA 4E03A 5AW3A 4FGSA 3GP5A 2R66A 3MA0A 4PBRA 1Q44A 2QUAA 1YQ9A 1Z22A 3FPKA 5HQ3B 1STOA 2JHPA 3K9HA 4DMHA 5MFPA 1KAHA 4YJHB 4HWPA 4NS4A 4P5PA 2Z58A 3LMKA 3DKKA 2JAQA 3TIFA 1GKYA 2VG8A 4B4VA 1WSAA 3I9V6 1ZA2A 2BVNA 2VATA 4D81A 3TIIA 4I3FA 5EWJA 4FD3A 1SY7A 2QUZA 4DLXA 4E1BA 4R83A 1X1CA 2V6MA 5C4IA 3LF1A 4HN4B 4TVBA 2PKXA 1FSZA 4L0CA 3TUTA 1OXTA 1JEEA 2PN1A 1PJ2A 2HYDA 2PX3A 4WA8A 1N1EA 3OZWA 5AJYA 5EYPA 3U2QA 1ZRNA 5JVDB 3FIUA 1Q5PA 2VNAA 2ENWA 1I9GA 1NI3A 1T6ZA 1U28C 3FI9A 4GBMA 4C88A 1IZ7A 2DJIA 4OBXA 1H23A 4B32A 2PV7A 2C8KA 1J23A 2GHIA 2H4YA 4GPTA 4NDAA 5CK4A 3UFXA 4DGQA 3EAGA 1QB8A 3RC3A 2VF8A 3N2EA 1DJPA 1HPLA 2F64A 2G06A 3FPLA 5JRJA 1G3RA 3OESA 5LP6A 1LCIA 2GK7A 3W1EA 1SOMA 4OATA 3RADC 1I1NA 1SURA 2DM6A 4LCBA 3TLKA 2XUQA 3KPJA 1WMBA 3PJGA 4QUJA 1YQQA 1POXA 1JJIA 3H86A 3AUAA 3DQPA 3ASZA 3WC4A 9ABPA 3RT7A 4BP9A 4KXNA 3P0HA 5TEWA 4ARUA 4QL3A 1XPOA 4AM8A 5DBOA 3BMXA 2QY9A 1QLHA 3PFWO 5JSUA 2AX4A 4J7XA 2O2YA 3QSYA 1RWKA 5BW4A 1M6YA 1JQ5A 2YOFA 5K2MA 1MOQA 3P9QA 1FX0A 1LB1B 2G1KA 4L8GA 1CS0B 5A7GA 3WL7A 1XZLA 3TZLA 3QX9A 1TC1A 5EKTA 2L82A 3PC8A 1FZTA 2C1ZA 1I0IA 4O4HF 4CU5A 3D4BA 4EY4A 1QK3A 5EAIA 1BMTA 4TWIA 1NIJA 3O94A 4V0RA 1XZNA 4MH0R 4Q9AA 4QWMA 5CG2A 1EFDN 1OF1A 1CRWG 3EZ7A 4P2GA 2R4TA 3RRZA 1N8TA 4H18A 3V4VB 4QX6A 2GZSA 4UBLA 4I50A 4HH4A 4JJ7A 1BCRA 3E8MA 1OWMA 2B8EA 2CCJA 3WL8A 4F2GA 5E7QA 1TT5B 1PJ3A 2B25A 3T1QA 5KQGA 3CZ4A 2IKQA 1BMFA 4WN3A 5JPIA 2D74A 1EZZA 4DMMA 3ADKA 2QPLA 4KNWA 1JMVA 4N3GA 2QD1A 1LV7A 2VDNB 2C88A 2OCXA 3AUKA 3CF6R 5F21A 3WLFA 2X0EA 2MSDB 1F4VA 3DMHA 3FOAA 4LC1A 2CDBA 3BPSA 4M7WA 3RD5A 4OFZA 4BQQA 3U19A 2JFOA 1D0IA 1QVZA 1YR7A 1SHLA 3EZ9A 3I3OA 2ONJA 2E6UX 1Z2OX 1ZN7A 3RRYA 4XUDA 2CW5A 5DCLA 2P75A 1NLZA 3RU3A 3HZOA 3V5NA 1JLSA 4G4IA 4OGGA 3B5EA 5AVJA 2IH4A 3NM5A 1VYHA 3A31A 1T0BA 4Q16A 2G9UA 4IIEA 5REQA 1SZPA 2WKSA 3A4MA 2AOVA 3D2LA 1XOIA 2E4ZA 5FHRA 4Z99A 1ZK2A 3R7WB 4Z9YA 4H3VA 3SJAA 4IYJA 4V0NA 1DADA 4YBRA 5H9VA 4DBZA 4ZI7A 2CL0X 2JATA 2JIDA 3H1AA 1KFJB 4BEBA 1NL3A 3BJEA 4NEQA 5SZJA 5BN1A 2VSNA 4AIIA 1YOBA 2JEZA 4PU0A 3I61A 3OO1A 1DAPA 4KKXB 3ZVNA 5EWMB 1XMPA 3TAHA 3LC2O 1OTHA 2FE1A 4BL5A 4RLSA 3VHXA 2ZUEA 3Q2KA 3FVRA 4AN4A 1Z7GA 2E4UA 3TW3A 1JBQA 4P58A 2FU5C 4IMIB 4NYMR 5CA1F 4QBHA 3MT8A 1K2WA 1FUUA 3EG9B 3CWCA 5JSHA 4ND4A 1BVYF 4QDTA 1WUJS 3DGEC 1RE0A 1Y6ZA 3VPSA 3LCVB 1IJEA 2AI2A 2PQ2A 3N2IA 1DRWA 1FCJA 2HJWA 5FOVA 2PKQO 4I1OA 1QR2A 2VDMB 3BXPA 2GPYA 2IHKA 3WGNA 4IGFA 4O8ZA 3RUFA 1HG1A 1A8SA 1W59A 1YZQA 1PFGA 2WI8A 4O2RA 1JSXA 3HCFA 2HIGA 3PV0A 4JC0A 5GONA 3UK0A 5K4AA 2WJJA 4O8CA 5FUYA 4C14A 4YV1A 5FORA 1MZPA 1EGAA 1ZESA 2DUMA 1FMJA 4P54A 2QTRA 4WXYB 5JJCA 2XB2A 4JV5B 5D87A 1I9CA 2HFJA 2ZRCA 1X0VA 3NAMA 3EPPA 3NIDB 2BHLA 4LZOA 1T8WA 3E1SA 4K40A 4XCXA 4QGSA 2MMGA 1IQRA 1G66A 4OLBA 3N8DA 1CNMA 3GLHB 1Y4SA 4HLCA 3TNJA 4A27A 2E4WA 4D0GA 1E4EA 4LXTA 4I81A 1GKKA 4PRKA 2BTEA 4ALJA 3L8ZA 4LDAA 1O95C 4OP1A 1AKRA 2FHSA 3IBSA 2HQOA 4RZIA 2ONZA 3M5DA 1TJNA 4CIXA 1HLDA 3AZQA 4M9RA 3UM9A 4KK4A 1OBOA 1E69A 4LMPA 2AE2A 2OAQ1 2GI4A 1TJ4A 4FMCB 3L7JA 2OTCA 2LD4A 1CIPA 2V6FA 1SXIA 1ZM4A 2K2WA 4FW9A 2E49A 2OKGA 4PLHA 3A9WA 4B7AA 4ACAA 4YMVA 1E9BA 3QV2A 1Y63A 8GPBA 1WV1A 3I30X 4JD5A 1M1NB 4E70A 4UEOA 5KTNA 1XZFA 2Z2IA 1U02A 2JH9A 3NASA 2OUKA 4UAVA 4X41A 4KVAA 5FWDA 1MAAA 2VDOB 3A6HA 2J31A 2VYNA 4EFMA 3ZE0B 2BMFA 4R7ZA 1NW7A 3GJRA 2Q2NA 4UCWA 1FDWA 4G8BA 1U7XA 2EKPA 2WABA 4KE9A 3WP1B 2CEKA 4QA9A 1PTJA 3TMYA 1JJVA 1J8FA 4IVQA 3X2SA 5HDQA 2GNOA 3EFHA 1HBJA 1Q17A 2QD4A 1JAIA 1W75A 3W5JA 4HX9A 2C9OA 1XGKA 3TINA 4LOAA 3ZHYA 1Z0SA 1ZA1A 1E1QD 4F3KA 1I33A 1Y1QA 1GUAA 3EODA 5JNTA 2OLJA 3ZN2A 1TX4B 4BASA 1SQSA 3FFTA 1AN0A 4WY2A 2IUTA 1MB3A 2B35A 1OV6A 3AP3A 3RRXA 4A3SA 4ER7A 2J8ZA 1J8DA 2ZRQA 1FSGA 2YRFA 4HNQA 3HHEA 4ZYLA 4DG9A 5IWCA 5J4KA 1LXCA 1EK2A 3LU1A 3T54A 3DS8A 5HZMA 3IT2A 3PFKA 4CM6A 1J9EA 1LBEA 2KM1A 4HADA 1P7YA 3KJGA 1DBQA 1G4UR 4HGZA 1SUDA 4AF7A 3IOBA 4FMCF 4YO7A 3FMPB 3EC2A 4X9XA 5EP1A 4D8TA 4FYPA 6YASA 5T73A 1QBKC 3U7JA 1V1MA 3JQBA 5DFAA 3KT6A 3WIBA 2HT1A 2XYQA 3JQAA 1T2FA 1ZJ6A 4FZJA 2GD6A 4GFDA 1VL1A 2PZ8A 3KOWA 3NHSA 4XFJA 3HXPA 5HFNA 4G07A 1C1DA 3INYA 1H5UA 3S6JA 4FUTA 4PX9A 3KEFA 1ZZEA 4LHYA 2I3ZA 2EBUA 2EOAA 2VWGA 2VZLA 4NVRA 3FZGA 1U65A 3OZFA 3PHLA 4ALMA 3OA0A 1ZIXA 3TVYA 1SG9A 2OCIA 4MYUA 4HGQA 2VPTA 5L3RA 1DVRA 4LJRA 2GEKA 1CQXA 2EZ9A 2Y99A 3A7EA 5AKGA 2NXWA 1KDZA 4GP9A 2EGGA 3TLAA 3DCYA 3KLPX 2KE5A 4IV0A 5GGYA 1NIPA 5HIIA 5NULA 5TT1A 3KZVA 3D4PA 3TQCA 1G7SA 4Q1CA 1QFMA 3TCNA 3ZY6A 5CD9A 2Z6AA 3KKKA 2EX1A 1MGPA 3EQ9A 4RFLA 1QS0B 3VAYA 1HOTA 1RCUA 3EQ6A 4QDJA 1U7WA 3UC9A 4CTMA 5JCZA 2OL4A 4GH5A 4PZLA 3EZFA 5AKYA 4DCNA 3FCOA 4QQRA 1YR3A 3R3YA 1PNVA 3VHLB 1PW7A 3R0VA 4RF2A 1KJNA 4KRXA 2HMUA 4L4SA 3NG1A 1XYVA 1L5SA 2PUJA 2VZ0A 2ZXFA 3I5AA 5K2OA 1JTEA 3O90A 1E9RA 2QRLA 3SLRA 1HSOA 1O4VA 2E4XA 5ILGA 5HKBA 1SUCA 1Y9AA 4J4BA 1H6BA 1I4OA 1TF5A 1Z0KA 3V4FA 1VCIA 2WFZA 3NBZC 1RLOA 4PF1A 1ODCA 1THGA 3D8RA 1OFGA 4AG3A 1ZGZA 5F35A 1KEKA 1BMFD 4EJSC 5I8ZA 2PT5A 5FA8A 3E18A 1UZUA 4MSUA 4WV3A 2P4QA 4X6YA 4AMBA 2C4TA 4IGKA 1SEVA 2Q4RA 1IHDA 1UMBA 4IQ8A 4ZYVA 1P1KA 2G4LA 2GN9A 5IMSA 4F7WA 3PT5A 3RHFA 5KYVA 3ZWKA 3PKZA 3RS0A 4ZQBA 1CETA 1PWZA 1RHRA 3TE6A 3ZTWA 4R1TA 5HQTA 2GHTA 1KMHB 4ZCLA 3OEHD 5HRUA 2O2GA 2AOUB 3P9RA 1EP2B 2JD1A 3PHHA 3NTXA 2GYWA 3R7LA 5J5CA 2PX2A 2XZOA 3V4RA 3DGFC 3OLWA 4URZR 3IDSA 1D5CA 3N1UA 5A0FA 4BV3A 4L5CA 3SY8A 4X1OA 2BDTA 5E6SA 1I8TA 1FXUA 1WO8A 2CXRA 4RVNA 1X70A 1QE0A 2CXNA 4ZPXA 4X92A 2HRQA 5ELMA 1ZISA 3AC0A 3S2EA 1N4DA 3CPSA 1PJBA 2FSPA 2HJHA 3F46A 3TM5A 3K7EA 2RGCA 1G20B 2JDIA 3FYSA 4IJ5A 1FNMA 4P08A 3CIFA 1WE2A 2CF5A 2ZSBA 1MEOA 2BBSA 3IPRA 3CT6A 2XCIA 3DEYX 3TR0A 2A5FA 2XKBA 1BGWA 3OETA 1G6Q1 3QEJA 4K6HA 4OLHA 1QAMA 2QT0A 3IFSA 1K7FB 1I4WA 3EIQA 3O3NB 5LIPA 4LE2A 1IVSA 5A1TA 4C0WA 1WTCA 4Y7CA 4DG5A 3PJRA 1SKAA 2VDQB 4LJ8A 4YT4A 4BWVA 1PUIA 1PS0A 1UP4A 2ZVDA 4DLKA 2C7VA 1U4SA 2GCIA 2OLKA 1OIWA 4LBVA 3BSSA 1JP7A 3TSYA 3IALA 3Q8MA 4M8SA 4EQ6B 1ZUWA 5IM4A 4HQFA 1EDBA 1RAGA 3GEPA 4WNCA 1BWRA 4HQLA 4H27A 2X13A 2ZJ2A 2PGDA 2W6JA 4QLBA 1AZLA 2G1JA 3CGWA 3D8SA 4NDZA 1RWXA 1RP7A 4WCFA 5L45A 4MDEA 1H3EA 5JVDF 3ZDDA 1C0PA 4BNKA 1GPH1 3AF4A 4PICA 1AS3A 4JQSA 5CFNA 1AHHA 3SSAA 3OQNA 3EEYA 3IPXA 1NJSA 3B1XA 2PJUA 4FYYA 3DBLB 3K4HA 5DLEA 3V7YA 4F45A 1PV4A 2W71A 3P5BA 3OE4A 1NN5A 5I7VA 2H1HA 4ZU1X 4BB9A 3IP7A 3RR2A 5CB8A 1K86A 1KU0A 5A4MS 1XJCA 1JA9A 3DEJA 3DVQX 2WJIA 3QK7A 4BJHB 5KYKA 4S04A 2O1WA 1KJQA 3GLKA 4ZAFA 1XRQA 4LQDA 3GX1A 2H5IA 1XXHE 3NNNA 2AH5A 2V7QA 2XHZA 3T7SA 3W9YA 1QMGA 3TNDA 4JU9A 5EQTA 4EL0A 3GRAA 3GMTA 4WK2B 5FJIA 4ZZ3A 2JCYA 4OJMX 2J5XA 3ELUA 1NYRA 1U7UA 1OGIA 3OPYI 3QOWA 2Z43A 2VA9A 3QVVA 1BQ4A 4V1CI 4B09A 1B8NA 1JDUA 4IMRA 4G9EA 2Y1DA 4QU9A 4V03A 1IPHA 5ARBA 4IH9A 1ANKA 4J4HA 5CXQA 3MYRA 1MDFA 4A2CA 3VSDA 4EF5A 3CJQA 3VX3A 2BCJQ 3QX3A 4IV8A 4J0FA 3MVEA 1ILEA 2JVIA 4DQVA 3W78A 1WWKA 4TT3A 4MGIR 5FJJA 2WKPA 2Z3VA 2Q5OA 3WS7A 4UOQA 4BNZA 4ETNA 1P8AA 4PYJA 4XYLA 2P2YA 5KJ1A 5FCDA 4F72A 3T35A 2CFTA 4PXAA 4LDJA 2WHRA 1O9BA 4Y0VA 3G2HA 4ZCMA 3BX1A 1Q6YA 3WBJA 3RPEA 1V5EA 1P5JA 4G0QA 1P5HA 2FQ1A 1P8JA 2FPGB 1K89A 3F8WA 2N42A 3GHHA 1NQVA 2Y6UA 3AUSA 3VNAA 1YDMA 5I47A 1WD7A 1N25A 1OKKA 2BMVA 2IZ6A 4A92A 3ROMA 2BJHA 4UTZA 4E12A 1UBMS 4HBGA 3C8DA 3HNOA 1AK9A 2HXYA 4GXNA 4YP9A 1TUBA 3G2OA 1J7KA 3BRSA 3T7RA 2ZJAA 1M34E 1IRXA 4RZ3A 1YCHA 2CGEA 2J9RA 2VRCD 3FNQA 2KBEA 3OKCA 3C8HA 2FEWB 3C3KA 2FOLA 4O29A 1KMCA 1VKNA 1E5DA 1OXUA 3EARA 1N2IA 3ND6A 5AVRA 4NTZA 2NXJA 1F2DA 5TARA 4AKEA 4RU1A 4MQUA 3SJCA 1HK7A 4AP5A 4QU0A 4DWWA 5E6UA 3DLBA 3PQVA 2IXTA 4BVKA 1GD1O 3QA9A 2WHQA 1MFPA 4HVTA 4I14A 3NPMA 4IO1A 2ST1A 4MUKA 4RCVA 4LZZA 4UNIA 4F5DA 1QCYA 2JJ1A 1XA0A 2MINB 1N2CE 1N57A 1R27A 2SCUB 2DECA 4TL9A 4XJSA 4XGKA 3E03A 4HS9A 3L0DA 4FS3A 3TB6A 5LU9A 4AK9A 3L5OA 3G79A 1AKTA 1UJ4A 3EWNA 2ZLBA 4I5EA 4FFDA 3QUQA 1QYRA 4YRJA 1W8IA 4IJQA 4FKBA 4KPUB 3ND5A 3D4OA 1DO2A 2C2MA 2UZ1A 4JXJA 3KHUA 5DF1A 2XQFA 4RETA 2AQ8A 1EQAA 2XUIA 2ZRHA 3H1BA 2B6HA 1WP9A 5L3QA 1BNCA 4RPLA 4CGZA 2G0TA 4Y2YA 5BQPA 3MTIA 1AH2A 4FDLA 2VYQA 3VGJA 2PZGA 5DNWA 3A1WA 2JAPA 1EUDB 2J33A 3TB4A 2BKXA 3ZLTA 5KQMA 1M73E 5CLQA 1NM5C 2PLRA 2OCYC 4WMLA 5JNRA 4J7CA 3H9QA 5BNIA 5C1DA 1TCCA 2FEOA 1PG2A 4Q82A 3DV0A 4X93A 3H17A 4Q4CA 2PX0A 4IV5A 3VZBA 3LUDA 3CO5A 3EZGA 3N6RA 1QVAA 1VE7A 1XK6A 2YMPA 5FBHA 4AP6A 3DOUA 4BY9E 1JAHA 2VOJA 3NATA 3Q3VA 4LDNA 3LQKA 3Q8LA 1JWAB 3EZLA 5DWVA 1XCBA 3OC0A 2BH9A 4LRYA 1S2DA 2RBEA 1WOYA 2R7AA 3HKCA 1IWPB 2NPIA 1WCV1 1A82A 4B87A 2J9YB 3ZNQA 1JQDA 4RORA 4ZCPA 4EY7A 1YTUA 4QWWA 1E1RD 1GG8A 1IB0A 1PZHA 3AF5A 1A4IA 2TRSB 3NQ41 4IIVA 3ZY4A 4DJJA 5LQJA 4NECA 3LFTA 5M7EA 2FSVA 1J8QA 3FHOA 3KRTA 2WDPA 5EZQA 3BHIA 2YXLA 3BQ9A 3L8YA 3WOHA 4C78A 5A5GA 1JYSA 3ADOA 4ZHQB 3DC7A 3Q12A 1Z16A 1TEVA 2XOKA 3V9PA 4J8PA 1GT6A 2B7BA 3ABRB 3MWFA 4M1QA 3SEAA 5C8ZA 2QBYA 5AVYA 1ECFA 2VF7A 1RQRA 2QLLA 4FB5A 1PKEA 4GMFA 2O2EA 2RMKA 3DWFA 1VSUA 2QTBA 2BMEA 2ZBDA 1XJ5A 2QJWA 3D6JA 3ABIA 4IIDA 4QGAA 3GR6A 3U7QB 4IAOA 3WICA 1RTKA 2I54A 1O9GA 1D4ZA 2QUKA 3NTRA 2NUAA 2BGKA 4J29A 1YVUA 1OROA 2SKDA 1FU8A 1TQ2A 4S0XA 4CW7A 4E31A 3DEKA 3KR2A 1AB6A 1O5OA 4RKRA 3RJ9A 4P4NA 3N2ZB 3ZWOA 1T3HA 1EBUA 4KL8S 2H9AA 1UBEA 1NMQA 2HBZA 3INTA 4PLPA 2Q45A 1SXQA 4X24A 4TYYA 3AERA 3GA5A 3KVNA 1OYYA 3M33A 4L1KA 4MKIA 1T15A 2CNWD 4NG5A 7MHTA 3B13B 1ZH2A 2B4TO 1K8YB 2JD2A 2F7SA 1ID8A 2QJOA 2CL6X 2B8TA 1P74A 2ZPTX 4DCUA 4O4LB 1P45A 1X7WA 2BCGY 2RB4A 3A3PA 1O96A 2QW8A 3MFQA 4UW9A 3UC5A 4PLVA 4TX1A 2NUBA 4X20B 2Y1WA 3WNDA 4HMPA 4HTFB 2VDVE 5DN6A 1G5RA 1HM5A 1TJ3A 2IYYA 2QF7A 4G9BA 5EQFA 5CVDA 5F7ZA 1RYHA 3ETEA 4UHHA 4JYZA 1WSWA 3BGDA 3UBTA 4H4EA 4C03A 1U0GA 2PIAA 4TKZA 3QKIA 1EUCB 3AIOA 1TO6A 3AL2A 3LGAA 3DQZA 4CF5A 1T25A 3BWEA 4LG1A 1XHFA 3JQEA 3RK0A 1DAOA 1UFQA 1ZD3A 3DDNA 1NW3A 3KVYA 2W6ID 1J49A 4IM7A 4W9NC 1XDZA 4QPNA 4PZPA 1U6JA 5DRTA 1ESMA 4PFJA 1Z4IA 3WK8A 4ZA2A 3VYSB 2QP9X 3GRYA 4MTLA 4F0JA 2UV8A 3RFCA 4LGVA 3NVMB 1VIDA 1JKIA 1E5XA 5FTJA 3KETA 2EZTA 3UFBA 5FDFA 1GGFA 3T9BA 1AURA 4MW5A 4QBKA 5EUBA 3H8JA 5H8WA 2Q8NA 2QXTA 5JS2A 1UPTA 2GRJA 1M8PA 1RXEA 4KGVA 4QIHA 1AXRA 2KLBA 2CZQA 1X8LA 2HUPA 4P3KA 4KWHA 2XTZA 4ADSG 1JKFA 1F8YA 2BHRA 4G24A 2M6KA 3RUIA 3CNOA 4LVNA 4W5WA 1K4MA 4HAZA 3AEXA 4OJYA 1M2OB 1BX1A 1VJTA 1YS1X 2EAUA 3MLAA 2C7PA 3LNCA 3AB3A 4C08A 4TYQA 1XZAA 2Y76A 5CITA 4R3UC 4CKBB 4BKUA 2R6HA 5FOUA 4GR9A 1G8JA 1AU9A 4UQLA 1TEZA 2GX6A 3H2IA 4TTQA 2OHOA 1THTA 5FL3A 1BKDR 3BILA 1SJ9A 3PUIA 1MZVA 2ODTX 4JLDA 5TVKA 1NZFA 2C82A 4PR0A 4ZVNA 4BRWA 1JSLA 2QZZA 4Y2TA 3EOBI 2IL1A 3RS9A 2C7BA 2ODAA 4BE7B 5BWMA 1ESDA 4CR8A 4HXEB 4MR8A 5F1YA 3RBZA 1MGOA 4RGBA 1ECCA 1T3ZA 1T9GS 3K73O 3ZV3A 1Q16A 1A77A 1M83A 1NI5A 1P77A 3C2QA 3V48A 3HJHA 3UENA 3IVRA 4GSLA 5KTPA 4INOA 4QASA 3DT8A 4MGKR 3NEAA 3GFQA 3G8AA 4LK2A 4O3FA 4BNTA 4X95A 5AVVA 2GBLA 1U8YA 2I6FA 5E2IA 4WFJA 1LBSA 1AQNA 2HPAA 5CX1B 4KMMA 1AKMA 4PTZA 4ME6A 3DE7X 3TTXA 3QU4A 1E1RA 4INJA 1JILA 1YCGA 3TI7A 5AJUA 5JDIA 3ZJXA 4BOYA 2JZNA 3LOQA 2BFEB 1L7RA 4B82A 2C9ZA 2BAGA 4XVCA 1IAQA 4PSDA 3CJTA 1SHUX 3CR8A 1G5QA 3HCRA 1OI7A 3UTCA 1U8EA 5FL7D 3P45A 1R8SA 4UBKA 1BEEA 1P9WA 3ABSB 3EVGA 5TC4A 3UJPA 3WR5A 5L95A 4GQAA 1HYGA 1LFAA 2OYCA 1DE0A 3IBTA 1CHDA 4MEBA 4YNBA 2EJCA 3DHEA 3WYAA 3GQBA 5HW0A 4ID3A 3QPVA 3ZDCA 1FP2A 1E59A 4YT5A 3N75A 4YAWA 3SQOA 5HWSA 1H42A 4YRMA 1J1ZA 5LB4A 3FUVA 3VBCA 3ZBTA 4G65A 2A35A 2R8YA 4Y6OA 1UK8A 3D6AA 1U2GA 4QYWA 1PJTA 4K9KA 4E1AA 4H6WA 4MI3A 1TI7A 2HQ1A 2B1RA 4BATA 4KTVE 2PKYX 3ASUA 2IHBA 4RD2A 5AKEA 2RG1A 2CFCA 2Z6QA 2POQX 4MO2A 2SECE 2X22A 1Q7TA 3LY9A 4PC7A 4MAAA 5TQ2B 5T3UA 3RBVA 1J9GA 1YSCA 3HKEB 4QOHA 1KJZA 4F04A 4Y6GB 1EUDA 4BNYA 5KTYA 1LVGA 1TUIA 2AMVA 2EDCA 3GZTB 3IOCA 3Q9NA 4RTOA 4EW2A 3L46A 1JWBB 3F6YA 4KZKA 2HHJA 1CRLA 1OAOC 4XGRA 3H97A 5AXDA 5A6SB 3U37A 3C5VA 5ILOA 2JS7A 1XQ9A 3FOCA 4UU8A 5L3QB 3VU0A 2A0WA 4F8EA 5JJ5A 2UZ1B 2NP6A 1KEZA 1QQ6A 1RADA 3NLLA 1Q57A 2B5VA 2ES4A 3Q5EA 5CHYA 3FRIA 5AK3A 1IVYA 3T7TA 4QT4A 4UM9B 5KQPA 1II0A 3G9UA 3OCUA 3ZDXB 5HX7A 1Z15A 5J2TF 4IBOA 2YBEA 3UMJA 4RD1A 2C77A 3V7UA 2FCRA 2ZJ0A 1QRSA 1K9SA 4DLYA 1TTTA 2IY9A 3DTYA 4FFPA 2XY4A 2IW1A 3T3GA 3V4ZA 1EQ2A 3NHWA 2B92A 4MKRA 2X4DA 2YJZA 1YL7A 3DJYA 3K4PA 4RC9A 4TWAA 5KNCA 2AJLI 1SUAA 1QIMA 2YMLA 3PXAA 3KXIA 4H31A 4LCEA 4QYMA 4BQFA 3FKJA 1N77A 1MX1A 2OXEA 1JEOA 1DL5A 3K5PA 3ZJVA 3D7MA 1JPJA 3GXBA 3KQUA 4NF2A 4TT3D 2ZS9A 5AJWA 5G02A 3PXGA 1WKBA 3GLRA 3GW8A 3OOSA 3QLVC 3WKAA 5A2QA 2XE7A 4E5SA 1II8A 5EHZA 1KYYA 1U8CB 2VT6A 4QT0A 1A76A 4X62B 3NT2A 2JI9A 1BJTA 3BXOA 2FZKA 4P7KA 5I7RA 3JASA 2I78A 4I4TF 1R74A 3FPEA 3IAEA 4PYKA 3VJRA 4G56A 3UHJA 2Q6IA 4TZTA 3WNZA 1EXMA 2VDWA 3AF3A 1E2LA 4UPEA 3VDXA 2B8JA 3P94A 4A0SA 4AG6A 3KQMA 4CF7A 5EUCA 4FHZA 3CLUD 3HABA 1KVTA 1QHGA 1QVVA 4E6PA 4G8DA 2FFAA 3GCZA 4Q0MA 1IN4A 3O4IA 4V0LA 4CMHA 2Y4OA 4ZOCA 1D2AA 1MEJA 2R2AA 4WCFB 1GQRA 3C3MA 1EJBA 3DF9A 2FGKA 2P35A 4DSTA 3DKIA 1UJ5A 1XEWY 1JG1A 1Z5UA 1U6IA 3KJNA 4W1SA 2WU8A 4OOFA 3QOXA 1S4QA 2HSGA 3ZEIA 4QE3A 5FIUA 3ZH2A 2IKSA 2OECA 3HM9A 1DXYA 1I4EB 3CW9A 5CLFA 5KWEA 4P7JA 3VR6H 1LW7A 1BN7A 5IJ9B 1ZVVA 1PW5A 5DZSA 4OM7A 1XA3A 2B3TA 2NW6A 5DRYA 4EMSA 1NN0A 4O1IA 3CZMA 1J0BA 5FOQA 5KWJA 3LUCA 4J94A 3M6LA 2NO5A 4C7KA 5TIIA 3VYVA 1JB1A 4B3RB 2Q2QA 4XJVA 4Q4HB 4WJKB 5P21A 1AVTA 1H65A 4B7ZA 3JQ8B 3Q41A 4J76A 3AESB 2GCNA 2XUZA 3LSTA 2EFCB 5K01A 4MAFA 1Y9DA 2ZYGA 3HNRA 4ZO4A 3FKQA 3WXMA 1I5OA 3BORA 5E2BA 4CQLB 4Z3KA 2IQ5A 1I0LA 2XTNA 1QYCA 1Y6QA 4KUEA 1MIOB 4XLLA 2Q9UA 4FM9A 4EGCB 2GLTA 1NLUA 3VR4H 1GSOA 1PS9A 4JB2A 3L04A 1CG6A 4RDCA 3WSVA 3Q6NA 1M7HA 4OJNA 4M0MA 1P5ZB 4YMLA 1UC5B 4FQ8A 1NNUA 1YJ5A 3C6ZA 5IVDA 1FSPA 3SGLA 5AKHA 5FBZA 1KO4A 1KORA 5CYOA 4CT0A 1KEEB 2F3UA 1HUQA 1NNI1 3ZY5A 1NZJA 3SQDA 3ORRA 3JV7A 3HFGA 5KOJB 1H2FA 4OG2A 2B94A 4B3CA 2PH7A 4FW8A 4Y2SA 4IDFA 3QVSA 4PWYA 4RZQA 2O3SA 4H6XA 2O1XA 4YP5A 5HE8A 5LOVA 3HN7A 3UJCA 3HB9A 5CFZA 1ESEA 1RWOA 2KI5A 4F38A 1DZIA 3LPCA 4GLBA 2VWQA 1EXDA 1QKKA 2O4CA 5K0BA 2UVDA 1BKYA 2JFHA 3G68A 3G2JA 3PNSA 4UEQA 3V8EA 4RNCA 1C4WA 1NP7A 1TL7C 1WABA 2WE8A 4QM7A 1V3TA 2I4LA 2R85A 2IZOA 3JW8A 4XQ9A 1KYVA 2I1WA 1D4AA 3M6AA 3LQ2A 3NBQA 5ALRA 2O2HA 5HMLA 5IAJA 2PWZA 3WMGA 4K26A 2C2XA 3C43A 5EMNA 2P9QA 4JC5A 4EHKA 1N9ZA 4NEGA 4HRVA 4UAGA 2JJMA 3O2SB 1MKYA 3D54D 3LOUA 3PUKA 3OLYA 2RGGA 1PR6A 3EY4A 4LXYA 1JHPA 2ATVA 5E9WA 3ZHOA 1KIMA 2P2ZA 4UZEA 2L17A 1TEXA 2NZ8A 1JBKA 1TAGA 2H48A 1ZKMA 3KR1A 4R2XA 4BDTA 1XKLA 1LBTA 2J6IA 3LV8A 4KUGA 1TVKB 3AKDA 5I9IA 3HDJA 2XWPA 1R3UA 4M1SA 3SC2B 1QP8A 1KQOA 2JFFA 1PGOA 2Q1WA 3DH0A 1Z4LA 3IO3A