4GMKA

Crystal structure of ribose 5-phosphate isomerase from the probiotic bacterium lactobacillus salivarius ucc118
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
PNQDELKQLVGTKAVEWIKDGMIVGLGTGSTVKYMVDALGKRVNEEGLDIVGVTTSIRTAEQAKSLGIVIKDIDEVDHIDLTIDGADEISSDFQGIKGGGAALLYEKIVATKSNKNMWIVDESKMVDDLGQFPLPVEVIPYGSGTVFKRFEEKGLNPEFRKNEDGSLLHTDSDNYIIDLHLGKIENPKELGDYLINQVGVVEHGLFLDIVNTVIVGRQDGPEVLEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Structure of ribose 5-phosphate isomerase from the probiotic bacterium Lactobacillus salivarius UCC118.
pubmed doi rcsb
source organism Lactobacillus salivarius
molecule tags Isomerase
total genus 75
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4gmkA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gmkA01
3O1LA 3AB4B 1U8SA 2BKVA 3L7OA 2OKGA 2RI1A 1LK7A 3K5PA 4R7TA 2PA3A 3TUIC 3E7FA 2I9SA 2JHEA 3IXQA 3TUZC 2QSWA 1PBTA 1M0SA 1FSFA 4X84A 4L50A 3ICOA 1HOTA 5HJ5A 1Y7PA 5FIIA 5T41A 2WU1A 3U7JA 2W48A 2RQMA 3OFGA 2JOQA 3MTJA 3BXGA 2R5FA 2DT9A 3DC2A 3KWMA 1FS5A 4R9NA 1SC6A 3CEDA 2H9ZA 5JJBA 2GNPA 2QRRA 3UW1A 1FRZA 2ZHOA 3HN6A 2KO1A 2F8MA 1O8BA 2RQKA 2P9CA 1XTZA 2LQJA 1CD5A 3E15A 2BKXA 4GO1A 3DDNA 3OC6A 4NMLA 4GO7X 3NRBA 1FQOA 1UJ5A 1FS6A 4M8LA 3ENVA 1ZPVA 3TUJC 2O0MA 4TM7A 3AB2B 2FGCA 2J0EA 4L4YA 1LK5A 3ENWA 2RI0A 3IBWA 3ENQA 3EB9A 4LUBA 3OBIA 1KS2A 2DTJA 3NZEA 3LOUA 1PSDA 3S1TA 1UJ6A 1Y89A 3BXEA 1YBAA 3OFHA 3EFBA 3AAWB 1HORA 2RE1A 4OQPA 1JT9A 3N0VA 2CDQA 4TM8A 3DHXA 5IS2A 4L51A 4IO1A 2NYIA 3OFFA 1UJ4A 5IT4A 3HHEA 2J0XA 1VL1A 1RWUA 3OFEA 3W7BA 4OQQA 1DEAA 3CH7A 3LUYA 1NE7A 3BXFA 3KV1A 3CSSA 3TX2A 3P96A 3DHWC 3BXHA 2P9GA 4GMKA 3LHIA 4L5JA 2MDAA 1YGYA 4PWUA 2QMWA 4L5IA 2J0WA 1LKZA 5IT0A 4L4ZA 3MWBA 4GO5X 2LVWA 3MAHA 2QMXA 3LWDA 3NWPA 2PC6A 2F1FA 2P9EA
chains in the Genus database with same CATH superfamily
3E3MA 5CABA 3THYB 4FNOA 1CE8A 1NL3A 2BJWA 4KYIB 1PBTA 3CNEA 1OD6A 1QIDA 1OQ3A 2PCLA 2GCOB 4K4WA 5DZ7A 4JL8A 4KNWA 4TROA 3KJQB 3HB1A 2QEXS 5AXLA 5JD6A 4HR2A 3GZ4A 4QE3A 3UO8B 2HHUA 1C0KA 5AHXA 3U5ZB 5JMOA 5AW7A 1O94C 2GXQA 4UUNA 3E35A 4RIFA 3IP1A 2ZEJA 5HJXA 1GVHA 1QO7A 3OJFA 4IHAA 3GZ7A 1TVEA 2HS3A 4I9HA 4WGFA 1VECA 4URQU 4MR7A 4GI5A 4ZCMA 4Y2RA 2E0IA 4R05A 4XX0B 5HKOA 3OR1B 4OP3A 2CADA 4KR6A 4XDYA 1DC6A 3DFKA 2J3LA 3L8ZA 3C8UA 3L8FA 3SS7X 1X4DA 3DDCA 1QCDA 4NZOA 2X0DA 3C8ZA 3H3JA 3GLIE 3BN4A 3HGMA 2YZ2A 5BWNA 4G8JA 4JOSA 4X66B 4Y0AA 4OGLA 3DM5A 2REQA 3KEMA 3GJQB 2X7JA 2ZT6A 2CJWA 3ETLA 3CIZA 4DA6A 4TV9F 2QRMA 2IDLA 1N36F 3VVCA 2NAPA 3B5IA 5ECWA 3JQBC 1ECJA 4YALA 4R98A 3TRDA 1X77A 1QHFA 1HFJA 1Z34A 2YY5A 3AT1B 3TOCA 3UV7A 3AM4A 4U39A 2WMNB 3GG2A 2W2KA 1D1UA 2HCBA 5LMCA 1FD8A 4XX1A 4LF2A 2HYDA 3ZZ1A 1WM1A 2Q66A 4BNKA 4P3XA 4MWGA 4ON9A 2AXQA 4YB6A 3ZNNA 5JWOA 2JH9A 1OB5A 1SUEA 4I6YA 3Q4GA 3EIWA 3FUCA 5EQDA 4UDXX 5AO9A 3PNIA 3O6VA 3DLPX 4PR0A 5LQUA 1WO8A 2QZSA 4M5HA 4MH8A 4OYWA 2XUPA 1WEXA 1ML3A 2C9BA 1YOBA 2WR8A 3A1VA 3WWCA 2IEAA 2PUJA 5EJ5A 3TCKA 5AW4A 1BWPA 1LFWA 4B3RJ 2A35A 4JIGA 4W7SA 3TLZA 1JXEA 2JB9A 3BEDA 1R4NA 2BGWA 3QPWA 2VQEJ 3K2YA 3AHDA 3U9TA 1TU4A 3JD0A 2XMRA 4JROA 2I4OA 3OIWA 4BO1A 3WL4A 2F9JA 2WVAA 2BM0A 1LWOA 1FESA 4WY2A 2QUKA 3UMMA 4Z0TA 3L6BA 1Y3JA 2RQ4A 4QHTA 2P2DA 3VZPA 2UUAF 1S76D 1UPMB 3CLHA 4C4ZA 1PL7A 2UV8A 2EAUA 3ITHA 1ZI8A 1JQGA 2WA1A 1YWXA 2FW1A 3A1CA 4HI0E 4D45A 3IBFA 4R8SA 3V42A 4OXIA 4GU5A 4XUDA 3NC0C 3D4PA 1VGYA 2A2CA 4UOFA 3K59A 1RE0A 2Q2NA 1OPRA 3BOSA 3BTSA 1F2TB 3SSQA 2DNYA 3T12A 2RGYA 1A97A 3CNBA 4A8JB 2M0GB 4V0KA 5H16A 5KO2A 4TWIA 1N2EA 2NV0A 5A5VA 2JVIA 3T3OA 4EEKA 2ZOFA 2GAJA 1M1UA 4IDOA 2QROA 2QL6A 2JD0A 3TTWA 1Z12A 3CPHA 1HBUB 4DCJA 4IRDA 2GF0A 2I54A 1JQDA 2VTVA 4WUVA 2XGPA 2OG1A 3SIWA 3TZWA 2YNMA 1GQEA 4LZOA 1RKXA 5BQOA 4PNPA 3LVBA 2JIMA 3PUYA 3BTOA 3FPFA 4M1ZA 1UXIA 4UE6A 4YMIA 3IKJA 5CT5A 5L4SA 4C0LA 1RXUA 3DGEC 3SXUA 1Z0KA 1Q19A 4HS4A 2MOKA 3CNNA 3GB9A 5ALPA 2Z3ZA 2BSXA 2G08A 2PKRA 2HBQA 1IJBA 3SZ3A 4PS1A 2C2ZB 1PFKA 1QX3A 2FPWA 4WQMA 1CR6A 5EP4A 3RW9A 2LZ0A 1I94J 4US0R 5ALLA 4PYLA 1FK9A 1S01A 3O1JC 1XDZA 4UC0A 1JQAA 1AT1A 2BGKA 4MFBB 3LPMA 3D66A 5BUCA 3WZ0A 1UZAA 3L4EA 4MMOA 2UU9B 5KX5A 3HVTB 3FTPA 2IYRA 2AOVA 2IY7A 5GAGU 1EWYA 4J0FA 2IIQA 4GI7A 5PNTA 1Z2EA 3TX2A 2WF6A 2KW5A 4HMQA 4F3MA 4RLEA 3FSYA 1HI9A 2K2QB 3QX7A 1BW9A 1C1HA 2V63A 5C2GA 1RAAB 1OYVA 2I0FA 2JLAA 5I48A 4USHA 3B3QA 4WP3A 4QEZA 3AB4B 1XP8A 3ASUA 4BNJA 5IYZA 3E9EA 4JXXA 3LVRE 1OE0A 4BP8A 1ZIPA 2XUAA 1T9UA 1NF3A 2W2NP 1FFBA 1K9SA 1VYHA 4K0RA 1G6BA 4F96A 2JFQA 1MIOB 1KAMA 3U6KA 5KDDA 4LR8A 1GKIA 1E6KA 3TLYA 3HZEA 3GJ5A 2V96A 3I56S 4HHHA 3KSRA 3PUXA 4H7FA 3THRA 2W4DA 2MY8A 3RHFA 3ZFVA 2QT9A 4F8JA 3WLSA 1HDCA 3P8BB 1QLWA 1FNXH 3O4IA 2DWUA 4FOOA 1NATA 2AGPA 3E9RA 4RKWA 1NVUQ 3GLIA 3G85A 5HVNA 4K81B 4CLKA 2YHIA 3I1FA 2G1JA 3EVCA 4NYJQ 3COYA 3EZNA 2HX1A 3VYRB 5KFLA 2V6FA 3CRQA 3ZTYA 2JLUA 1J5EJ 4RK0A 4M5NA 3OHPA 1FMLA 4UCFA 1D09B 4AZ3B 2IC3B 5KJ6A 4NJMB 2P8IA 1IPFA 5BW6B 4YECA 1CC8A 3EHEA 4C2UA 2OMOA 2QSFA 1X87A 4BN0A 1JMVA 4GBJA 4DPMA 4CCWA 5ALUA 4DRYA 1Z4NA 2JLRA 3C97A 2EI5A 3PACA 2LIPA 2ZE6A 1R8HA 1SVSA 4KQJA 2WNIA 3GI1A 3SKXA 2F59A 3A0UA 2B7CA 4UY8T 1CY7A 1YJAA 3AR4A 2H5EA 3MEGA 3R6GA 1VK8A 3ZVLA 4EB0A 2GAOA 3P5SA 1T8UA 4G5XA 3ITNA 1LFAA 3KNAA 4DR7F 4FXDA 2AK2A 1IOZA 5E2IA 2EWHA 1QSLA 4QW9A 1KOFA 3PG9A 1X8LA 4IVRA 3WKCA 3R3SA 3MELA 3QF7A 4EHDA 2YDYA 3QT6A 5HGJA 2IXEA 2DTJA 2C8LA 1HE8B 5FA6A 3I6QA 3TQRA 2R2AA 4Y30A 2HU5A 4MMYB 4K4ZA 1U0EA 1MH9A 1HYGA 3LU1A 3WBFA 2ZYSA 3BZUA 2ZQYA 4IDKA 4CRJA 2Q0SA 1Z38A 3J80A 2AEEA 3CVUA 1VQPS 2GGPB 2RKIA 3JD1A 4RR5A 1SJ4P 2CQ4A 1KJIA 4AMYA 4KFRA 3OEEA 1XZCA 3AF2A 3TQIA 1RHMB 1L3IA 3RVBA 1C1CA 2H3EB 4MAFA 2FQQA 4PX2A 1HNNA 5FHQA 4HNAB 5K14A 2Q2WA 2HCFA 3EAFA 2PMWB 1KP6A 1NN5A 3HM9A 1O5TA 3KDOA 1M1YA 2WE7A 4UOEA 4NENA 4YH1A 4WFXA 3DFFA 3BHIA 5IMSA 3CDBA 2V1UA 3EWSA 3D1LA 2O7VA 2RU3A 2Q0HA 1XD8A 4DLKA 1MA3A 2F62A 2M6SA 3UZUA 1KIFA 4Q9IA 1HD0A 4LJRA 1QDUB 4KO8A 1TQ6A 1DRUA 1M5UA 3GJXC 1RWUA 5AJTA 3PK0A 2H92A 1ZA1A 2IOQA 5A8WB 1KMMA 1U8FO 3BGOS 4CKWA 2V0GA 3FBTA 4DR4B 3D81A 2YY6A 4Q3NA 2GESA 4H7KA 3BSOA 1J97A 3V1YA 3GRPA 2YASA 5I8ZA 2G3YA 2WSYB 1OLSA 4GXNA 4QOGA 1GU1A 2BP7B 3PD0A 2WZCA 2W2MP 3NT5A 2HPHA 4NZ6A 3IN5A 4LBZA 4Q9NA 3I83A 3H4TA 2F17A 1K92A 4MS3B 4R2KA 3I55S 2GN8A 4GKJF 2MJLA 5EERA 1U7ZA 4FBGA 5DN6D 1XELA 3GUZA 1GD1O 3WOHA 5KG5A 1ARZA 1IHOA 3GFPA 2R7XA 1S3GA 1LEOA 2CUTA 3T1HJ 1AHPA 3FSXA 4A1OA 4QFCA 2HW8A 2VJYA 2ORYA 3K1ZA 3LXRA 4JFAA 4CMAA 3GK3A 3NUGA 1UDBA 2ZXEA 3LA0A 3RUDA 5EUBA 3SJCA 4JI4F 3DNPA 3SNHA 4BX0A 3RTGA 4CO4A 3CA8A 5F8JA 2QD5A 4M1SA 1PWEA 4GNKA 1IR2A 1VLJA 3ANNA 1YF3A 1UF9A 1S7CA 3DO8A 5M2UA 5TQ0A 4I50B 3TJMA 4QDOA 4FJ1A 4KIFA 1ZUHA 1NI3A 4JHLA 2HNBA 1F0NA 4CLRB 4PC7A 4ZO7A 3V6MA 2YKOA 2CJXA 5AR1A 2BH9A 5H0IA 1GMVA 1TUIA 3AOGA 3IS9B 5EOVA 2B0CA 1XVAA 1HBMB 1YHYA 5CJ2A 4EB6B 1X9GA 4A8WA 4P71A 4KYTA 3KYDA 3R7LA 2DUWA 3ICQB 1NA5A 4TS1A 1Q79A 4PX9A 3T7AA 3F56A 2XIJA 1R0KA 5LSRA 1WD5A 4X1IA 5F73A 1UJNA 1SL2A 2QDXA 4IZOA 2ZD1A 3WMEA 3TJ8A 1F8XA 3VJRA 1KVSA 2DWPA 4D9FA 1WHVA 4Q12A 1DQSA 3FVVA 1IC6A 1CUEA 3PSAA 3G2KA 4PO3X 1RT3A 4OB7A 4KQHA 3DOUA 3WLHA 3D6HA 2PMDA 2XYPA 4R2XA 4Q8EA 5KU7A 1QHYA 1R4AA 4GYWA 3W2VB 4MJ7A 1G7RA 1P9OA 3RS5A 2GFHA 2YWCA 3OIDA 2JD2A 1E3EA 2HEKA 3KB2A 4PFJA 3E5MA 1JZTA 1UUFA 1FIUA 2DVIA 5HBGA 3RG6A 4AJ2A 1FTWA 1NFQA 2FQYA 1GO2A 4ND1A 3VA7A 1A1VA 3Q7TA 1JFLA 3RSSA 5NULA 3AUUA 1NZAA 2DY9A 2JRCA 2JEOA 2OYRA 1LLFA 2PUBA 2DR8A 1ZESA 2YJ3A 5L4LA 5JO9A 1XLVA 3RH0A 1WXXA 5HX7A 4GR4A 3IV9A 2QZ4A 3K05A 5TR9A 2XW6A 4G4SO 1EDBA 4LF9J 4LJ6A 1T4CA 4WI1A 4LV5B 3N9UC 1FUKA 1PJ2A 3ROFA 2F48A 5HCIA 4KH1A 2GMJA 2OYCA 4EQ6A 1AGRA 1GZDA 1NK8A 4J76A 3KJFA 2YXPX 1LK5A 2G1HA 2XXAB 4KH0B 5K01A 3U3OA 4JMLA 4CTKA 4Q1EA 2JVJA 4RKQA 3B6JA 3VBEA 4B3HA 4A6EA 3K1TA 3ESQA 1VFNA 4HOYA 1ZHFA 4A03A 5F2EA 3WLIA 1LBTA 3MXTA 5HFJA 1RAFB 3L7DA 1UPCA 4PPFA 1SMKA 2HIAA 1U9ZA 2RHRA 4P7TA 3L4BC 1L8LA 4NLTA 3B13B 4MI9A 3RM3A 5AXDA 3NAHA 3FZYA 1GLNA 1MORA 5DGBA 5JRDS 3CN7A 2ZRNA 1NDUA 4CM7A 3PFCA 2Q5LA 2HMAA 2PXAA 3MMPA 2WA2A 1SOMA 2VTKA 2Y67A 2VNAA 4K2JA 1Y1PA 4DX6A 2OFFA 2DR6A 4XO0A 1Z18A 1AGPA 2H0QA 3FLAA 1IKWB 1XVLA 5JI3E 2EPIA 4DCVA 1SVNA 1L4YA 1QUVA 4NEGA 1IWBB 5CUQA 3B7WA 4W9RA 5T7LA 1IYZA 4NBWA 3OTEA 4NBLA 4PGMA 4NMWA 3EUEA 2AR7A 2FY8A 1NRKA 5AVQA 3PWTA 2R4TA 5E3IA 3SZOA 1T4GA 4TLBA 3GGOA 3J7ZT 5EKDA 3DL2A 5CVCA 3OL9A 3QGMA 2HH9A 4FNGA 2X4DA 5KFQA 4LIPD 5REQB 3WJ2A 5KFWA 4DV3J 1E77A 3LQ4A 1WC3A 3W2HA 4ENOA 4D9BA 4ALJA 2J6SA 2WVFA 4J91A 1MV8A 2TYSB 1YZLA 4JX9A 4JDUA 1L5GB 5EUMA 2QX6A 1EVZA 5AKXA 1H2VZ 3VHQA 4FR5A 3MAQA 1OASA 2O2DA 2J7UA 3VAYA 1NP7A 4GXQA 5IPFA 1XLUA 1AUVA 3L0DA 2X1FA 1QTNA 4NAVA 4E31A 4QU0A 4OIFA 1HQUA 4QRIA 4KY3A 2C5SA 2IHJA 4L8VA 1LLCA 1ECFA 3B6MA 4DV0F 2W9BA 5A7HA 2DTEA 2QL5B 2ZBFA 3KUKA 4L8YA 3F9IA 4J9PA 1A76A 2CJAA 4HT5A 4CO2A 4CKXA 4QVIA 1KQNA 3GLGA 4RGQA 1MGPA 5ADWA 2X3YA 1UEKA 3HCDA 3UMGA 4U9IS 3DT8A 1GMWA 5DMXA 3MEDA 5GOZA 4W5RA 4ISBA 3LGAA 2KT5A 4CU5A 4AQDA 2PGAA 3K5IA 1VGRA 1EEXB 3GDFA 2AH5A 3JQPA 1U0OC 2IYVA 3USCS 3BT7A 2OCLA 3AHJA 3C74A 4BAUA 1DCKA 1NMSA 4ICLB 1QH9A 1WVMA 2PZGA 3BGRA 5KQSA 1M5HA 4MB2A 2GEDA 5DJBA 5KX5F 3JARB 4WIAA 3T6BA 2NXNA 4WKOA 2IPOA 4UBIA 1F4PA 4JUFA 2EW9A 2G04A 3D6FA 3VVMA 2ATXA 3NHYA 4JVLA 2YNFA 1QIEA 3DFZA 4JL5A 1V8PA 4BKRA 2CMHA 2YQ0A 2V74B 3ZNQA 3LQFA 3ZBTA 5FBVB 1F0YA 5IYZF 3AD8C 3L4BA 5L3VA 2QGFA 4AF6A 3SHQA 2YVAA 4C7KA 3NUQA 4NX2A 5KNCD 4I0WB 5H68A 4FYHA 2ASYA 2JANA 4N4AA 1NI5A 1O9HA 2DPXA 3FCWA 1EFTA 5TDHA 1N7IA 3M5CA 4R2WA 3JYQA 1AHIA 3BF7A 1ZU5A 4BC0A 4GPTA 2J46A 1YI1A 1YR1A 2VG5B 1RE1A 2KFNA 2Z8YA 2BFOA 2BY4A 2EL7A 3OT1B 3ILXA 1ZSVA 4JYPA 3E3OA 1Z2DA 3UJ7A 4AB1A 2WOMB 2W22A 1DIAA 2JGAA 1I5OA 4O2AA 3I0ZA 4ZALA 4C4PA 1PL8A 2LQ9A 3LAWA 2ZDQA 5BMVA 2VUTA 4F84A 3RI3A 2GWRA 3QE4A 5A4IS 3W3AA 1T15A 3HXTA 2XPCA 1WB6A 3TPCA 3FY4A 3Q0AA 4XD7A 2E5LF 3RUCA 2E4VA 2Y71A 2JLSA 1JR3E 1K86A 1A69A 2VNIA 4OYBA 1CUIA 4DMCA 3O73A 2LBPA 1QFZA 3H5YA 3TFWA 2JJ2D 2OD4A 5H9FK 3QFHA 2RCYA 5GAEI 3L8HA 2YH0A 1KGDA 5JQGB 4ZO8A 4AWBA 2OAP1 5FH9A 4HQFA 3OE5A 3IA7A 3AVPA 4AJ9A 4OI2A 3EDRB 4G0ZA 4HGZA 2V4UA 1O97C 1WP9A 1Y10A 3HK2A 5E6UB 1N3IA 1GUBA 4FFNA 4KQEA 2WG0A 3GJ4A 5GP1A 4X4NA 5AM0A 1SXJA 2ZPAA 4LCBA 4ICIA 3AI1A 4J0EA 2ZR9A 4PS0A 5EWJB 2GH1A 5DRTA 4Q6BA 3LJKA 5P21A 1K4MA 4DMRA 2CB0A 1R3UA 1FTGA 1BOFA 5EQTA 3NORA 3C16B 4EMBA 4X64B 1FXWA 1OZFA 1APSA 1Z7GA 3JQ9C 3VR0A 4F6RB 1X0VA 2C4NA 3HB0A 4TLCA 1PYDA 4YJDA 5BYBA 5JAOA 2ORVA 5J2UA 2P1DA 3SZUA 2D7DA 2MZJA 1ZM2A 2DHXA 1XZKA 1XZGA 3GUVA 3JSXA 2U2FA 1B0UA 4NNPA 1EUYA 2IOHA 5CYQB 2IUSA 4DKXA 3NHUA 4KE7A 5BSWA 1V25A 4WXWA 1WSBA 2CKWA 2D1CA 3DXXA 5IW8A 4ZPJA 3ZHUA 3EC1A 2HFJA 2AE1A 4Q3OA 3ZOZA 5JSZA 1H7WA 1W2BR 3AESB 2MR5A 3JAWA 2DU8A 1DDOA 3G8CA 2AT1B 5L1IA 3RBVA 3VAHA 1C1DA 1M2OA 2I22A 3FRJA 2FVSA 4AC9A 4K9LA 3TYXA 4NV3A 4TKZA 1ODFA 2NU8B 5BSKA 5DNCA 3RPEA 1X8KA 2A9PA 1XZ8A 5THWA 2GKSA 2HREA 2X5JO 3VV2B 1G17A 1HNXB 4DMLA 2REOA 4LJYA 1ST2A 2I8LA 2XSZA 3P4UA 4W5HA 3A8IA 3U3RA 1JLQB 1UM9A 4OKSA 1YS7A 3G87A 2FPOA 3NHBA 3IEVA 5AWFC 2OQVA 3UGQA 1KSGA 3H20A 1U3VA 5D3QA 4LRBA 1HEIA 3BYZA 3A37A 2O0MA 4DF8A 5AKIA 3H90A 4B6SA 2RF2B 4Y0FA 1IJFA 5G53C 3QWFA 4ALLA 5HSPA 2AJCA 1CC7A 1SKWA 3X3UA 2YQ3A 3OWXA 5LBUA 4BY9E 1JJVA 3OCJA 4G1PA 3IO3A 3PZPA 2EFVA 3GV0A 3IAEA 2AZMA 3V2UC 1LRKA 1N5OX 4JENA 4IQFA 2DWOA 4WKBA 2FJ0A 5DMHA 1W8DA 3LT1A 4QOEA 3EZ9A 2DNQA 3CRRA 3HSDA 4CQNA 1DQAA 5B53A 5GJBA 4BTVA 4MITA 1QE0A 2R7QA 3SE7A 2XUZA 4ENPA 4IR7A 5EP1A 5A8RB 3ICCA 3I61A 1RWQA 4AY4A 4AURA 4UULA 1LV5A 3CXUA 4QM7A 2IAJB 3I3SR 2OD6A 1F0KA 3PIIA 2O1EA 2EZ9A 4WECA 1PCXA 2CVFA 4KV7A 2V4ZA 4WA7A 1PJBA 4ESHA 4M38A 5B0BA 1VHLA 2F1IA 4M5DB 3II6X 4RPHA 4USUA 2R7AA 1MN7A 4INJA 4YDRA 4DXHA 1JILA 5J59A 3UPDA 4I3HA 1A6LA 4AI6A 4E11A 5B55A 2WLTA 1OI2A 3JSBA 1G2PA 3E22B 4QBKA 1MROB 3RYTC 2I5PO 4JUZA 2JC3A 3HFGA 2LXUA 4LF8B 3SDZA 5EJ7A 2HR1A 1R00A 3T5PA 2V9KA 3LGNA 2CZ4A 2VOPA 1L1QA 3BK1A 3AZOA 2QMWA 5LKAA 2C2KB 3MRTA 2BZ0A 4O3PA 5IC6B 3KAKA 3E7WA 3JQ9A 1JP7A 1VMDA 4FXOA 3WA6A 5E5NA 2P65A 4BMVA 1JL3A 3I0RB 2BFBA 2I99A 2NO4A 4F9TA 4AY2A 3FOCA 1P3Y1 4BBJA 3ZCSA 4ED5A 1LFDB 1WDKA 3OSZA 1Z0IA 4FGSA 4U8VA 4IP0A 4V39A 3DFMA 4G0OA 1OQAA 3KG1A 5H59A 3WKEA 4OBBA 3S6EA 2D74B 4RW4B 2FDNA 2J4DA 2G76A 2Q9CA 3T41A 3SMQA 4TV8B 2DRAA 3VF0B 3K7RA 4H7HA 4CFZA 3OJWA 4O4LF 1TMJA 4XH9B 5IC5A 1BEEA 3X1WA 1GQOA 3NXKA 4YMWA 2WYIA 3PDWA 3EFBA 5TARA 2EJTA 4I1TA 5TV2A 3IOCA 1E1QA 4GPIB 3I4LA 4U7UK 3FQLA 4YDXA 1B3BA 1AS2A 1PN3A 3FIJA 3OL8A 3DU5A 3NWJA 2PUTA 1N56A 4QIFA 3MWFA 1EFDN 5HAOA 3A6LA 3W5CA 2KH9A 4ZK6A 1J99A 3TI9A 4RH1A 4DAOA 2H1VA 1VQ5S 2R4QA 2YKMB 2ZH9A 4CKEB 3EGEA 2D1QA 5LMUF 2EYUA 4N6NA 5BMOA 1FX0A 4LSLA 4BWFB 2DNZA 1JI0A 2VZ9A 4WEOA 3ZU5A 4DE5A 4NBSA 4I6AA 1IZ8A 1KDRA 2Q3EA 2H5JB 1NW8A 4CLSA 4QXQA 3G8SA 3BD6A 1N0VC 2J9RA 1L4FA 4FX5A 1OIXA 2I7TA 4MV5A 4ZP9A 3V2UA 4FX2A 1EHIA 1YJ9S 3REQB 1L7AA 3I92A 3EVMA 3PA8A 3T3DA 5E4JA 5L3RA 3EFOA 4U8GA 3NFYA 3RUFA 1CJMA 1Z0JA 3WV5A 4MDEA 2QL9A 1J27A 2DR9A 3SI7A 3O4VA 4X6XA 4WCEQ 4AT1B 3OQ1A 5CT6A 2G63A 2IELA 4HTFB 3M30A 3CNLA 4PU0A 3BDPA 1EXDA 4Q4DA 3W3AH 3VGUA 1PNTA 1M76A 3VOTA 1TXGA 3HVAA 1QLHA 5G4DA 3SIPB 2QI9F 3C5EA 1KFSA 3R5CA 1I6WA 2XUHA 5B3JA 3VU1A 4E33A 2XMAA 3NOCA 4TLQA 2UUOA 3VPHA 3HVUA 3T5GA 5FOVA 3Q8MA 1S5ZA 3A11A 3ZWNA 3MW8A 3H4VA 5ALIA 3G6WA 3ETCA 4R3WA 1BX3A 2E21A 1V9SA 4YWHA 4ID9A 1O03A 3JQFC 3M2UB 3Q8RB 4ZN6A 3B6IA 2HB6A 1UWLA 2CMFA 2LKDA 1XALA 1OFUA 3KHRA 1YZ3A 4J16C 4EZBA 5GM1A 2O8VA 3K1JA 5FNVB 2QN8A 2YWXA 4X45A 5DQGA 2CPJA 4S35A 3HI6A 1I3LA 1UZUA 1NYLA 1PGNA 4ZAFA 2II6A 5IH3A 5K0GA 6CHYA 4RY2A 4U8YA 3V2IA 2PS9A 5ES3A 3L0OA 5G0VA 1SR8A 3BH6A 3S40A 4CNQA 5JCPA 1VC5A 3E0QA 4MGKR 1NW4A 2GCIA 1JJFA 3UJDA 4ED6A 3D54D 1QIMA 4XOIA 4E08A 1H1LB 3PLNA 1NRJB 5EMHA 3IB6A 4KHMA 1DC4A 2A5FA 4QBHA 1DKNA 4TS4A 4HNQA 3WYNA 3LUAA 2H57A 3PHIA 6PFKA 5KC9A 5GZ6A 5KSPA 5K6RA 2A67A 5A9SB 2HLDA 1E20A 3IILA 2LD4A 4JYCA 2JEYA 4MQUA 1IN0A 3TRKA 3GFXA 2VA2A 1T35A 3OIVA 3CMES 2V68A 2XY7A 2RB5A 5AW0A 3POTB 4JI3J 3GL9A 1MA0A 1U9JA 3SYMA 2CKDA 2ERXA 2FZGB 2J4CA 4QQNA 3W9SA 1YBAA 3OUYB 3QEOA 1RZUA 1H3FA 4Y2CA 5IWAF 4Z7JA 2WVJA 3LP0A 1A2BA 2JNWA 1B7GO 2WT8A 2Q29A 4ED1A 1CQJB 1XCMA 1RZRA 3FMGA 5HM8A 2ZCJA 1RTJA 1GXSB 3R9XA 2CPYA 4NLQA 3P9KA 3T5BA 4QM6A 2R2RA 1UBLS 1Y4SA 2OBLA 5G02A 4CL2A 3TGWA 3QTTA 4BX2A 2ACEA 2RQCA 3LBYA 3DL0A 3HJGA 3QW4B 2XCLA 1UBTS 3O8QB 5CB4A 1NHGA 4YV2A 2ZWIA 3W63A 3V4MA 1N32B 2V7VA 4PKDB 4DG1B 2EQBA 3D28A 1XXHA 2OUKA 3RANA 3L4JA 4V2IA 5BSMA 1DU4A 1ZRHA 5BNIA 3DBRB 1NJWA 2CPFA 2GNPA 2M8DB 4OLOA 1LFPA 1OXMA 3TBKA 5IJZA 3LCUA 5TQ2A 2UUBF 3DS8A 1BRMA 1C4KA 4HVZA 1GRCA 3SSNA 4YJ3F 3CX3A 3DLBA 4R8RA 3G7SA 2C5HA 1YJUA 4BECA 4A0FA 2E49A 1ZNXA 5J2PA 3WO0A 1QAOA 3A8EA 3LC0A 3ZDQA 1B73A 2MMYA 3O8BA 3KPVA 3UK0A 1W0CA 1HHQA 1DQPA 4URHA 3JASB 3SXJA 2XCOA 1XQXA 4MWDA 1AN0A 1NLKL 3KK0A 1IEWA 3GGSA 3QTLA 4P83A 5DX1A 4O2AF 2ZSAA 3KLEA 4AIIA 1DRZA 5BMVF 2LVWA 4FKYA 1AQIA 2QZ8A 1S2OA 3C3AA 2C28A 1CS0B 3SS9X 3V48A 1N0UA 3E03A 3UHFA 2EP8A 1E4EB 1O58A 3UJCA 3INNA 1XRLA 3HY3A 4F0MA 3ISTA 2YMQA 1C9MA 2GDZA 1N7GA 4C88A 2WAAA 4LVNP 1EX9A 1CEQA 3IH5A 2DPLA 1WI6A 2Q3PA 4R0NA 3IXMA 4OYZA 4K4YA 4JH0A 1OA1A 2IHKA 4NLDA 3AVTA 4CLOB 1BD3A 2H7YA 4X97A 2CNWD 1ODSA 3D1QA 2ZJ7A 4QYXA 4WN9A 1TKZA 2P9QA 4FB4A 4FVMA 4AJLA 1QD1A 1L4EA 5B7GA 4O8ZA 3AR8A 4KVGA 3ZUGA 1MWZA 4PQUB 5F4ZA 4E5MA 5IXUA 3LO8A 4YEDA 3TQQA 2YN2A 4UZCA 1RLIA 1GGFA 4B34A 3MRVA 1FXWF 5T4EA 5EAIA 4DQDA 1C29B 4PINA 4QDTA 3ZHBA 2Y0SD 3G8TA 2WHOA 5EPOA 3I2GA 3ZY4A 3CM0A 3L8DA 1GHTA 4NG5A 4QELA 3VTAA 1B3RA 3FBGA 1ZSYA 4DL9A 2O2HA 5AVWA 3DC7A 1A5TA 5FPTA 4M1YA 4D8TA 1F20A 3R7DA 3OESA 4K6FA 2CAJA 1LC3A 1R7IA 4W9NC 4FEYA 3SM9A 4P5DA 5FIUA 1CRWG 2DT9A 3LG2A 4E5KA 2PRJA 1FDVA 2P3LA 1JG2A 1P81A 1GR1A 2AFVA 4W7HA 4JKOA 3CRW1 3HYTA 2HMIB 4QXPA 1JIUA 2Q8NA 2Z4PA 5A5EA 4XR9A 1ZDMA 3LSYA 3LP2A 1E1LA 4K4SA 5TGDA 1J1ZA 3W62A 2OV4A 5CLHA 3RB4A 3SM3A 3F4BA 3DN9A 2Y3YA 3CCUS 1GPKA 4ZHSA 3O47A 2IVFA 1ZOPA 2DB1A 1Y1SA 1KI7A 4UAJA 3EPLA 3N2NA 5EZYF 2CUKA 1FF2A 2C03A 3OCWA 4MA4A 3PV8A 4AXJA 3R09A 5C4IA 1D0VA 4CF4A 3I1JA 3CZQA 5J2MB 4RF5A 1Y4DE 3N86A 4V0OA 2C07A 2TMGA 5AW9A 4II7A 5D87A 3K9NA 1VJ0A 1RVV1 3H4BA 4FYYA 5HQLA 3TSYA 4QGSA 5HF8A 2FVYA 1ID8A 4LYGA 5D4NA 2BIFA 1GAOA 1ZRMA 3UMCA 4Y3UA 5GAEU 1UAWA 3N2IA 5HLFB 4TSKA 3ONFA 4Z3DA 3IERA 5JE8A 3OHMA 4KFTA 5L7YA 4H3HB 2OXTA 2YPZA 2G17A 1NQ5A 1K7CA 2PSZA 3AY7A 1ECGA 4AY5A 4KV9A 5AKYA 4DUPA 2COKA 2IOFK 2CXHA 2ZWVA 2NUAA 3VKWA 2RHBA 4FMDF 3NG8A 5C8VA 4AY6A 2HWIA 4YUYA 1X0XA 1TFUA 4LXQA 4MIWA 3JYNA 4YAUA 4JX8A 2RMLA 4KKVA 2DWQA 1H42A 1KFDA 2C77A 2ZJYA 4B3MF 4WNCA 1JPUA 3DMHA 1QZZA 1E7SA 3RYFA 2OYSA 1Y9DA 4DARA 1BFKA 1IK6A 5LQSA 4WIQA 2AWNA 2POQX 4Q1AA 3ETJA 4YHHB 3CTPA 3OCZA 4WK1A 5EHIA 4M89A 4TT3D 2DB3A 4YMSA 4U7TB 4NA1A 5JU6A 3GIKA 1WSRA 4KOEC 1IOVA 4AYTA 5L8VA 4K3VA 3EAQA 1WB9A 1AURA 2ECQA 3WLPA 2NUPB 1T94A 1E96A 3BILA 1DG1G 1ZRSA 4KJZA 5HUHA 5SZTA 1DOAA 4BFLA 4ENUA 4JSRA 2WQZA 5JCJD 3BKXA 3MEQA 3D64A 2RGEA 2XKKA 4HAOA 3MLEA 3IURA 1OX4B 5KSZA 5MN6A 4NI2B 4BDSA 4JVNA 3B9RA 1NC3A 3OPYA 1HORA 1NMZA 2NTYC 4G1VA 1DQNA 2DYKA 4D1YA 4LFCF 2C59A 2BEVA 3PC7A 1BAPA 5JS6A 2FJEB 2GCPA 1SC3B 3SFGA 3LH2S 4NZMA 4XM0A 4I9UA 3C85A 2B4UA 4PW0A 4C29A 1X1TA 3E51A 2D3O1 5MDHA 4W9NA 3IE0A 5JBNA 5TMEA 5AVZA 1WNEA 2GZSA 1YQDA 3W5VA 3AXMA 4LJKA 5B6JA 2GV1A 1EB8A 4RJJA 5EZ5A 3OTWA 1QGED 4DFKA 3TIXB 5H7XA 3LP6A 2RGBA 4PBSA 1XG5A 2AW3A 4X4TA 2J9DA 1SXPA 5LXRA 3O92A 2Q62A 2V2KA 3RGIA 2JFBA 2J3MA 4YXWA 4C7MA 2MYNA 1LNQA 1PAUA 3KQYA 4XB1A 3PYGA 1YS2X 4HLNA 3GJTA 4L3NA 2H1WA 3R20A 3PPWA 2QJFA 1GZ5A 3NBUA 7FD1A 1PR3A 4E07A 4Q0BA 1LTQA 5HVFA 1E1YA 3OZDA 2C3YA 1KE2A 2Q21A 3HA3A 4XQ9A 3T3HA 3K4HA 1FUEA 3S5UA 3W79A 2CQCA 4TGLA 1AXRA 1FJCA 1YXMA 2HF8A 2P9GA 3C6XA 4KQFA 1R1DA 3AM3A 3K5NA 2GPTA 1F51E 1DNPA 1ODCA 3RRXA 4UM9D 2HSDA 3DHYA 5HF6A 1P1HA 1WUHS 2GEFA 1OJ7A 1YITS 1E98A 4D4MA 5EG5A 1R43A 2VUSA 1ZHHA 4ZTBA 1W85A 3LT2A 3KYCB 4C0HA 1WI8A 4BX3A 3WFIA 4FF3A 4D4GA 1J0CA 3P4XA 2NT4A 2CXUA 5AKEA 3R9LA 4BAGA 4YT2A 4LDNA 3HH8A 1ULBA 2D5LA 3BIFA 2XM3A 1FA9A 1OLXA 3NYRA 4FDMA 1KD1T 3UMVA 2IY9A 3PXEA 2O4CA 2IEIA 4URFA 2VQSA 1GFZA 1I10A 1JPNA 4P3YA 1DJNA 3U3DA 1FYFA 1RAGB 1UBJS 2BUCA 3TRHA 5AXAA 3H5IA 4C97A 4E0BA 2D5BA 2CQ0A 1YIDA 4AF8A 1WC6A 3ROZA 4JBLA 3IA2A 4RIEA 4MZXA 4KO1S 3QVLA 1IDOA 1HHTP 1B6SA 4Y6PA 1U1GA 4UOZA 4ZICA 4Q39A 3MWJA 1PZXA 1JFTA 4PQGA 1CJTB 3CUEF 1OUMA 1GL9B 1JLCB 1H22A 2NO7A 3R5FA 3NGRA 2JLYA 3HP7A 1FCJA 4P58A 5HQ8A 3I39X 3TZHA 1AQUA 3EQ6A 2VHXA 5JS2A 3RAGA 2VPWB 1ZLYA 3FFBA 3QE2A 2Y0CA 4MW6A 1C9DB 3PUJA 1CFZA 4OX8A 3L0IB 3BE6A 3TO5A 1RKVA 4MKVA 3UWSA 3PW2A 3N76A 2QTWA 2FEAA 3BL6A 1N33B 5F9NA 3T4XA 2BEWB 4IPTA 2X1GA 4N3GA 5DV9A 3C3CA 5HQ3B 4GL2A 1CULC 1V7PC 1EX7A 3HN7A 1JU3A 3CWQA 5A3VA 5IJ9B 4D4IA 1FYXA 3V97A 2QLJA 3CEHA 1T9DA 4ZVRA 3TYTA 1ZEMA 1FSPA 4HO1X 3S2SA 3T3IA 1V11A 1J0EA 1T36B 5FUBA 3WADA 4ZHQB 1PYSB 4FYXB 4DR3J 1XTUA 1O4WA 4BASA 3E1SA 5F23A 1II0A 5KIAA 1ECPA 4CO5A 1IBMJ 3AUXA 3RG8A 1J5OB 2VOEA 1WPGA 4F5ZA 3V4SA 3TANA 1MLAA 2FZCB 4EABA 1U26A 2AUTA 3HTXA 2CD7A 1NN3A 4RA6B 2CLKB 3FETA 3R0VA 2JOQA 3OJCA 4IOLA 3P0FA 4IG3B 4RU1A 5COAA 4ALZA 4JYMA 4RK1A 5GWXA 4RW7A 1P2SA 2YW2A 3QVJA 1W94A 5IBPA 3BWCA 5A02A 1US8B 4LJMA 5E7OB 3HSYA 2IBOA 1BEUB 4YAKA 3NAIA 2D2FA 1SIWB 3TX8A 5AP9A 3UNXA 1R4MB 1YBTA 1TADA 4HTJA 1Z2AA 2AN3A 2GPAA 5CB4F 1Q11A 3TTSA 4L28A 3T5MA 4YRGA 5K3BA 4M36A 3PU6A 4Y7CA 3HJBA 5F8IA 5DI3B 1O94A 1S3SA 2PBZA 1E1CB 1KEEA 4TYYA 3ZTWA 4PZZA 1W36C 3I28A 4KLAA 3EYWA 4IGAA 2FJAB 4IIJB 2HA4A 3IRWP 3SFVA 3DRPB 1F5BA 1EJ6A 4BQPA 3IBCB 2ZAOA 5EYPB 3WLJA 4DN6A 3BULA 2RKOA 3LDAA 1YBHA 2R6JA 2RHTA 2X22A 1QV7A 2XNKA 5JCOC 4KR0B 3JQAD 4E12A 4JN6B 2X40A 3T5KA 3CGWA 3TQTA 4CTAB 1Y00A 2E4ZA 5JY1A 1A8QA 4QO8A 4MV3A 3IP6A 2PV0A 4JLDA 2UDPA 4BKMA 4C76A 3A9UA 1YU9A 1JI3A 3K0FA 2ZIVB 3B52X 4F93B 2QM3A 3ZNPA 1FXUA 1TZ0A 2A0KA 1T95A 3ENAA 3JQBA 3R97A 1PJQA 2VEDA 4NMHA 1NDHA 3RBEA 2HIYA 3EEYA 1MBZA 4AQYJ 3NCHA 2VH7A 2HFNA 1LWCA 4X0EA 2WPNA 5FQNA 2WYHA 1F6DA 2J9FB 2VKQA 3EF3A 5K8TA 2EDAA 2K3IA 4KAXA 5LD2C 3A4VA 3AC0A 2BGGA 3ZDAA 3GFSA 4UUAA 1N5SA 4ER8A 2IWRA 1CJVC 3BMQA 1PEDA 1NVFA 4HSGA 1S57A 4IHKA 3NTRA 1XMOB 3IKVA 1SM4A 4NS4A 3SFZA 4PC3A 1XE3A 2ILZA 4IUDS 2X7XA 2ATLA 2HC9A 1E4VA 4EO6A 1QYDA 4YT4A 5U9CA 1SQFA 2PT7A 1MPTA 1OMOA 1CULA 2VCYA 4R84A 2HQ1A 1BCRB 2M98A 1I1GA 1B4SA 1YHZA 4HL9A 3QX9A 4CIAA 2J3IA 3U1MA 4B3OA 1I32A 2WHPA 5CHYA 2F64A 4LK3A 4S12A 3T3PB 4ARZA 5IC4B 3VH1A 3AI7A 5ITVA 2VIIA 2NOAA 3G6KA 3GD5A 4NYMR 3IXLA 2I2XB 1E3LA 4IIEA 2O50A 1F4LA 3O8RA 4MRMB 4NPAA 1N34B 1WDWB 2WJ4A 3FYDA 4NL5A 1B0VA 1NVAA 3HXKA 5LBIA 1PWYE 2ZYGA 1ULSA 4B6RA 3DRRB 2XD4A 1VBZA 4J9SA 4QXOA 1ZONA 2C7RA 1V7CA 3QPVA 3RHTA 4AYBD 1PFQA 1GUAA 3PNLA 4EYKA 1L6RA 3NWOA 5J1TB 4Q3KA 1Y1RA 2QX8A 3CW2C 1KQKA 4MQFB 3W0LB 3W8FA 3KR1A 2BEKA 5J1EA 4IV8A 2H17A 3HKEA 1N5YB 2WU8A 3B8HA 3IC1A 4DV6J 2PKQO 5I7EA 4R3NA 5DHUA 5EWMB 3KAJA 5T4FA 3GFTA 3MEEA 3QU9A 4OK6A 3I5XA 1EP1B 1VBNA 3H9UA 3ANXA 4BE4A 4I9FA 3J81j 2O2CA 4DA0A 3FDSA 3GCWA 1FVFA 3VDMA 4YBZA 2CMGA 3EXEA 2WWVD 1JJ4A 4C01A 4EJMA 4Y18A 2P6NA 4OU4A 1T8SA 3ZDZB 4JT4A 4MWSA 4OQ4A 4DSFA 4QIVA 4QQ8A 1IXYA 4TTIA 1KU0A 5CLQA 5ICSA 1NTOA 1C2PA 2EKPA 1NP6A 4N5DA 4G5GA 3JD2A 3DD1A 3KS9A 1PV2A 4L5IA 1D2NA 4GE0A 4G4GA 2IHR1 1S4QA 2F1JA 1VQLS 3KUUA 4QWCA 3ILJA 4M86A 2NCKL 1EAMA 3N8IA 4LUCA 3K9BA 4LBYA 1PGOA 1E7QA 1JSRA 4YCLA 3AF1A 3PNMA 4JI6B 4JEMA 1P7YA 3FM9A 2HFZA 2ACKA 4TMVA 2QT1A 4ZJLA 3D3KA 4HS9A 1U8YA 3KYJB 1RTDB 4JI8J 3JTEA 1A5BB 4L72B 3RCBA 2WAXA 2X7HA 1V9LA 1J9EA 4IGFA 4BFZA 3RB8A 4KKOA 2RHHA 5DGDA 4OYIA 1EVKA 4K3UA 3DZFA 2FSIA 3TL2A 1LDNA 1UA1A 2JGDA 1UCFA 3RS7A 3NOQA 4XRGA 4AMGA 2ZDGA 1V16A 1DKOA 4GPAA 3PR5B 1MOPA 4CP5A 2BI8A 5JRZA 3LW8A 5CA1B 3DLGB 5BJRA 3RVDA 1P9NA 1TLFA 5HHTA 1DP4A 4HX2A 4PYOA 2UXDB 3UR3C 1JQEA 1DAFA 4MIYA 5AVOA 3C3PA 4DFPA 1EVEA 2VLIA 4NLRA 1RRFA 2KLHA 2CL0X 1BU5A 4B3TF 2BKEA 3EUFA 4EUVA 3M6AA 1VLOA 2QTTA 1U02A 4HATA 2JGLA 1P1CA 2AYXA 1ECLA 3GAAA 1W0JD 3IPAA 5FBZA 1U0RA 4IG9A 4XJVA 2ZTVA 3QVTA 3DKVA 4MWCA 4DKJA 3HO6A 3ILOA 4KWEA 4W5JA 4FBLA 1LW0B 5J47A 3QVGB 4NXNJ 1RADB 1TL7B 4PHTA 4ZVMA 4U7JA 5CCLA 4D9IA 4K8RB 2B3TB 1TL4A 4ZDKA 4U7UD 3THTA 5SZJA 5KBYA 5J58A 3C8DA 2ZBPA 2C61A 2AW5A 4RHYA 5EIFA 4B6PA 2PVSA 3MHTA 3AHHA 5ALKA 4HSEA 2CVZA 3QPAA 4AMUA 4A8QA 1XWIA 2Z4RA 3RT1A 2IC5A 5ITZA 4BVFA 3E4DA 2VG7B 1UMBA 1HWUA 2JC0A 1G20B 1XKQA 1O9BA 3S2GA 3MGJA 1NYRA 4RA9A 3CW2A 4FDFA 2ZM6J 3WGOA 4H9GA 4DPXA 5JD4A 3P49B 4KRGA 3TLGB 1Y1KE 3T5JA 2P0YA 4AZ0B 2BSQA 1FTNA 1NPYA 5LOQA 5EKTA 3AJDA 3PDUA 1NXQA 4Z49A 2CVOA 1RZVA 5FAKA 4LI3X 4DV2F 1YBMA 3HDGA 4ZJOA 1VJ5A 4F36A 2B9EA 2IXGA 2BFEB 1FU4A 4FKBA 1YK9A 4JBHA 1N7JA 2QRVA 2B82A 1RQ0A 3MM6A 2JHAA 4LZZA 2JFWA 1OYWA 4M98A 1RRGA 3V6HA 3L7BA 2GA9A 2BMFA 1T9BA 3HR4A 4O4LA 4QPPA 2VJUA 2QY6A 2VAMA 2OGWA 3PXUA 3SC4A 1KK2A 4QWAA 3Q9UA 1POWA 4O33A 2WZQA 5EE3A 4B43A 3Q98A 2WSMA 1E2LA 1J8YF 3QIAA 5ETQA 1BVRA 5J5CA 2R7SA 3QVWA 3Q8PB 1THMA 1T5IA 4IQMA 1L4GA 2FLOA 4GOXA 5BYJA 4V1CA 1C9YA 3V81B 1UEVA 4EU0A 2JHCA 3I2HA 2VJCA 4ECXA 4FFRA 2FE4A 5TPZA 2YH2A 1SUCA 3ZGXA 3M8PB 4W7IA 2GETA 2DNPA 4BMYA 1L5RA 2W6ZA 1G5PA 2WWXA 2BELA 1UXHA 3BZBA 1YAHA 3Q83A 5EJEA 3T9FA 4ANEA 4OQDA 4MLZA 4AYXA 1OU4A 3AUYA 1N1EA 4FFVA 4RZQA 4K7QA 1GNRA 2AW0A 1M5TA 2E1AA 1XROA 4MWEA 1Z5NA 3COZA 2O3UA 3AM1A 3VC2A 5TSDA 2XWYA 3QRWA 4BFCA 1RWNB 2CDRA 2BGIA 3SCKE 9MHTA 2DQSA 1X38A 1F60A 2R47A 4PNHA 1YR8A 3AUKA 4QFBA 2QAIA 4QGFA 3NNSA 4CEIA 4NH4A 3CCFA 2CFOA 5A71A 5KHLB 4UMDA 2MZ1A 4Q4HB 4DCMA 5AK4A 1FT8A 2A10A 3AB3A 4UHCA 3K71B 4LF7B 4DV4J 1YUBA 1VJRA 2RD2A 2A7XA 2GK6A 4R9SA 1QVZA 1X5OA 3OPMA 4JI5J 4Q18A 1C0UA 1YQQA 3A2NA 1SUWA 1WP4A 3N6XA 1QP7A 4UBKA 4RDHA 4R69A 3GIRA 1TK8A 5KFTA 4R8MA 3VU9A 3LIIA 1KAQA 3UOWA 4DUGD 2FWRA 1CS4B 3L43A 1FFAA 4O3NA 1HNVB 4IFVB 1SBHA 3E3LA 1L3KA 3S2IA 2IGBA 2X6QA 3C5CA 1F9AA 2VDQB 1U0FA 3M6WA 1ZXLA 4EO4A 1PAEX 2ONKA 3WIVA 1SPBP 2PL3A 2JIQA 3FSJX 4KVFA 2Q2OA 5C80A 1MW9X 3W4JA 3W5YA 1WLYA 3H9QA 8OHMA 2MB0B 1Z13A 1KL7A 1RWVB 2VV5A 4LBVA 5ADUS 4V0NA 1W35A 4H08A 4WVFA 4QOJA 5IZHA 3VU3A 2F4VB 3N2YA 1SK8A 3RFFA 1KNZA 1JT2A 1EWTA 1ZU4A 3FVTA 4G0PA 3WL7A 3TQCA 1PJ3A 3IAM9 2BHTA 4J37A 4UFOA 3FJOA 3OHAA 5AKHA 2GVDB 4D8VA 1Z8NA 3BAFA 4NE7A 3LYAA 2NSBA 4FXPA 2ATCA 2D3ZA 1P61B 1KRXA 4L50A 1NXWA 2F43A 4LSWA 1IBLF 1XMXA 3SFUA 3LYHA 3F3SA 1RWXB 1KDOA 2MINB 2XRMA 3CNQP 2MSEB 4IEEA 2JVKA 4Y2MA 3DC2A 4HL6A 4R41A 4EF5A 2JIDA 3HWRA 5BN4B 3Q3EA 3T3GA 5TT0A 3ZWVA 5KQMA 2YXDA 1D1QA 1DZIA 5AI8A 3ZX5A 3Q1KA 3ZBPA 1FP6A 4DPWA 2CDBA 1XZPA 4WOKA 1RAEA 1HNZJ 2AI3A 1UWAA 1VRTA 1QQTA 5CFNA 2LCWA 3DV0A 3EQ9A 3V4VB 2Y68A 2O8NA 1MTZA 4FYWA 3AKYA 1PGQA 3EXFB 4FEGA 3NM5A 2AKYA 1H2TZ 4P4TA 2LUOA 5JAPA 3KL4A 1QUFA 1WBJB 1J25A 1GGHA 1BMQA 1P7CA 4CODB 1DEAA 1PTKA 2Z57B 3ZD9A 1RQNA 4E51A 4PPGA 4PAGA 2FLNA 3ELYA 4K5QA 5JNTA 1J5XA 3DF9A 4Z4FA 3P2EA 3LWDA 3EYAA 3G0IA 2ZT7A 3CEAA 2VUUA 5EDWA 2XJ4A 2VJMB 4CH1A 3NIFB 3KJVB 3ZHZA 4L0CA 1GGVA 4W98A 3D7SA 2P3SA 4JXJA 4DC9A 1LZLA 1JDZA 3P45B 2JA1A 2OELA 5IHPA 2BMJA 3R5GA 4B4UA 3LWZA 3LUPA 4YA6A 1LBEA 2C4MA 2F8MA 1XJWB 2I2FA 2CLMB 2REBA 3MPUB 4O1IA 1H9AA 5KFMA 1JE1A 1RBOB 2DSTA 3QOFA 1WOYA 3IBSA 4L4RA 1QKKA 3R7WA 4MYCA 4YJ3A 3GDWA 4JB8A 1QF7A 1R0BA 3NOVA 1EFVA 4QUIA 3PO4A 1I3OB 1E6YB 4MUNA 5C5DA 3H2BA 5TPWA 2OV6A 4JI1F 3NC1C 4NOMA 5LSOA 2VBXA 4ALKA 3ZV7A 2J8ZA 4FGWA 1OAAA 3NEPX 4ZMSA 3GCGA 4CYUA 5AHOA 4P82A 5AXNA 1S10A 1NBME 1UL3A 3NIGB 3EMKA 1K1QA 4FOSA 5CH5A 4XWKA 3E2PA 1U7WA 4JQSA 1JW9B 4UXJA 1RPZA 1MVOA 2VT7A 5HDQA 1Z68A 4ZIRA 3IUNA 1M0SA 2GVZB 2AP6A 2HU2A 1ESNA 1T0TV 3F8TA 1ZRNA 3LDGA 3TMYA 1E94E 3G86A 1QVGR 4JYZA 5JAUA 5B2ZA 2M2BA 1OKKD 2YFKA 3OQPA 4RVHA 1KTIA 3V4IB 3FWNA 1Q7YT 3VR6D 4CL8A 4DIBA 1NSYA 2Q5HA 2OC9A 5D6NA 4UEQA 5KFBA 1ATZA 2XSFA 1KBQA 2HJWA 1DEKA 4GKKJ 1P7PA 2VDUE 3WBBA 3VC7A 1G4UR 2C5GA 2MKIA 3ZG6A 2KKHA 1Y6QA 2DKOB 4UJ5A 4YPOA 3B3FA 4DSEA 1S6UA 5KZMB 4PBTA 3IAFA 4B73A 1KVQA 4LBHA 3IGFA 4ZDWA 1PZGA 1ABFA 1E2IA 3VFDA 4H6VA 4G1EB 4JZYA 2A33A 4HVTA 3BREA 4OAOA 4DSTA 2XYVA 4EFAC 2ZJZA 1FFSA 5KT7A 4D3XA 4C87A 5TVKA 3O31A 4BVGA 3ZDRA 3UE2A 3ZDBA 4KKXB 1Z35A 5G0TA 1T6BY 3QGIA 4DOMA 2SECE 4TWRA 2RHCA 3CPEA 3A6FA 1PC5A 4HB0A 3NXZA 4IDFA 5DBHX 3PJRA 1FO1A 4B5LA 5HN0A 1XCOA 4M0FA 5DG7A 1UFKA 1G5HA 1QUEA 1DJQA 2B35A 5T6MA 2MGZB 4GKBA 2P6SA 2WJJA 2WTXA 3IR5A 3WTBA 4HGOA 3NP7A 1KZYC 3DTTA 3R5KA 3I2KA 4F45A 1Z0UA 5E1BA 2PU7A 5U1PA 3RW6A 3KQVA 1KJ8A 2RJOA 4ZQBA 1V5EA 3K9CA 2AV6A 5DW3A 2RGDA 4WASA 1JA0A 1PGJA 5DSTA 5BWMA 4KYVA 1F8FA 2NZUG 2HGMA 3VR2D 4BN5A 4EEZA 2WBLC 2O8CA 2A1IA 1G8MA 4MKZA 2ZYWX 3QIDA 2H5LA 2BHNA 2IJNA 5DNUA 4Z1MA 5EZYA 2BBEA 3IT1A 1M8GA 4OZJA 3L01A 1U8AA 1S4FA 2A5YB 1X7YA 9ABPA 2KBFA 3INGA 5KVCA 5DASA 4U96A 3ROTA 4MUJA 1Y80A 5BYQA 3KK1B 5KI6A 3ADBA 1E9CA 4I4BA 3RW7A 4Q1BA 3L95X 5DGIA 4C6SA 5K7SA 3EOAI 3PD1A 1ITPA 3I2IA 1NU8A 4YY3B 4GYJA 1W4AA 5JUWA 1T6YA 3RTDA 5E2QA 3V1LA 3ZTQA 3JR7A 1GFSA 4ZPWR 4WTOA 1L5KA 2Y1JA 3TPZA 4R0MA 3GZNA 4Z2YA 2BFMA 3HFKA 5BQPA 3BWDD 3THVA 5AICA 1YI2S 1MIHA 4D6XA 3TNJA 2CXTA 3HVRA 1ENZA 1T8WA 5KOHB 4NEZA 2W90A 4N41A 3FDJA 3ZQJA 4GX1A 5DM7Q 5EZSA 1JGTA 4DQXA 4R8VA 5G41A 3N5KA 3H87A 1PJSA 3SBDA 1BDHA 5B1IA 4HAVA 3IFEA 1K73T 4HLUC 3DV2A 5ULLA 1DZ3A 4ME6A 3AI2A 4KCGA 2BT4A 3O3NB 4H18A 3U7RA 4X65B 3BS4A 3HWWA 4E88A 3BHMA 1IUKA 4JLKA 1OV4A 3GJZA 4A10A 4EO9A 1ONNA 2CFXA 3CUSA 4LOIA 1HWIA 1Z22A 2XHWA 4BV8A 3QWBA 2VH1A 1XD2B 2E9RX 1Z07A 1I2AA 1YK0A 2IXTA 1F9EB 3QEKA 3Q0TA 2LDBA 1UM8A 4DS4A 1S6QA 4PLFA 3KWLA 4IOCQ 4TL8A 1YAJA 2Q1LA 2JIPA 4B3SB 4LW8A 1QAQA 2AHOB 5FORA 3X1JA 1GPUA 4IL5A 2N4CA 3DSRA 3N75A 1V5GA 1IULA 5FPHA 3U6BA 4FE4A 5J2NB 2BW7A 5K05A 2QYGA 3MPYA 3H4MA 5FUYA 4DUZJ 3KQQA 1D2HA 4PLTA 3E0XA 2RS2A 1UVNA 1UC4B 5E6RA 3D3NA 4N8NA 1LA2A 3D2LA 1YIAA 4HACB 5DEOA 3VVLA 3RIHA 3SLGA 3HT3A 2Q1SA 3GOHA 1PG5B 1Q15A 1YJ7A 1QQBA 4X94A 4OLBA 3MB8A 3B48A 3CCTA 5B7QA 1JR3A 5T3YA 2BW0A 2Q2QA 2ZBEA 2W83A 4C0KA 2MQOA 4XLTA 1JAIA 2CMDA 2VJVA 5J4HA 1M2NA 1ZL2A 3Q7IA 5KYWB 4WFJA 1N3YA 2RC5A 2JCBA 1P2DA 3QO9A 3SYLA 3A6PC 5IAAA 2HDHA 4KU4A 1H8HD 1Z3CA 3C4JA 1I80A 4DJ5X 4B2YA 1Q1NA 2HQ3A 5I7FA 3MMAA 4E03A 3VR5D 2EKZA 4ZO4A 3B82A 1ILEA 4KQXA 2YFYA 3FDZB 2QUHA 3RJMA 5BSHA 4FR0A 1IM4A 1NJ8A 1UXKA 3CUTA 3VNVA 4RJKA 4Y2UA 2GF9A 4P7JA 3MIZA 3AAWB 1R3DA 1X7HA 5DDQC 3PKJA 1OB2A 3T1YJ 3MM5B 1PGZA 2H9YA 3K9LA 4EJSB 4FNIA 2X2PA 1VSVA 4GC6A 2XMWA 1TZJA 2CZGA 1M73E 2ORED 4LF6F 1YR6A 4I6WA 3MM7B 3DB2A 4ZVQA 1TVMA 3GRAA 4ZT3A 5MFPA 4AO8A 2IYXA 5FPQA 1A04A 3AL3A 4DB4A 4OZ5A 1B0ZA 3K8VA 4Q3CA 1R0RE 3FTDA 5FBRB 2HHHF 2A78A 2PD4A 1WWHA 1WNFA 4Q48A 5KDOA 4U0KA 2ZUDA 2DFDA 1TMGE 4OHPA 4LDRA 3VTKA 3VKGA 3RVLA 1RAHB 4HWTA 1AM4D 4RZXA 2WQ7A 3W6NA 1PQYA 4RXUA 2MR6A 3L40A 1S2GA 1NP3A 4E4RA 3KOXA 1Q7EA 3VR4D 1WTCA 3COJA 1U0HB 5DNAA 3I01M 3LDUA 2JX2A 3R40A 1KEPA 1XIQA 3RR2A 3D3WA 3VVTA 4JV5B 2Q4TA 1AYEA 2A0XA 3DDWA 1X86B 3C3DA 1EBFA 1IXZA 5HILA 5IFLA 2FJWA 2AZXA 3FGPA 5HJEA 1W4LA 4KFUA 5DETA 3ZE8A 4B82A 1A4RA 2FUCA 3T7EA 4FFPA 3PQ5A 3UJ8A 3RIGA 4H6WA 2AX3A 3PHHA 1RYNA 4WFNQ 1J24A 1Y3HA 3DDIA 3T9CA 3KCNA 2K6GA 5EJ6A 4P7VA 2ZZNA 2VIHA 1TMOA 5BV2P 3IHWA 3GO4A 3KQNA 1H6AA 2JFKA 4L08A 3R4VA 4B85A 3TIVA 4LTMA 1MAVA 5KYUB 3VVUA 2J33A 1G38A 2A0UA 4G5RA 4CLUA 1ZBDA 1GPWB 2O0LA 4K4XA 5AJ3J 1V39A 3E7PA 3AVUA 4WFZA 2XDQB 2VSYA 5ALDA 2UZ1A 3CBGA 2EKNA 4I4TF 4MI1A 2CPXA 3CMQA 1XWLA 2I6WA 3I62A 3AY3A 2C84A 2RAPA 3ET6A 2B5JB 4DVJA 3A3NB 2CK3A 4WBXC 4OI0A 3KPJA 2FN9A 4G07A 5FI3A 1MSWD 2WV7A 5I47A 1YTUA 2VJBA 3DKPA 4ZP6A 3T4PA 3JW8A 1HQDA 2PAAA 2AF3C 2R8KA 2Y9PB 4PCUA 1SWWA 1L8XA 5KUTA 1NJIT 1Y1QA 5LP6B 3K8WA 1KVTA 3OX3A 1ZHOA 2R60A 4OYYA 4LIWA 1R8AA 3BSAA 1PKXA 4ZI5A 3B1KA 5F8HA 5E3CA 4D0NA 1S77D 3HPOA 1SKUB 4LJ9A 4BCCA 2P8JA 3V5RA 1EFPA 2HD4A 2DPHA 1M34E 1Y4UA 2CNLB 4ILKA 4U4AA 5DWQA 4Q16A 2FPIB 1G291 2VNJA 1I0LA 3L9WA 1NONA 4URWR 3KLPX 4QAJA 3GIJA 2P2YA 1ZC3A 3LY8A 2ZC4A 2BKAA 1XYGA 3RAEC 1XNJA 2QN6B 3AA9A 3F97A 3GB0A 4OHKA 4BS2A 1NR1A 4K6GA 3TTUA 1EVLA 1R6XA 1TJ3A 1KTQA 1XC9A 1IG0A 1JR4A 2GKOA 1GDHA 1VJQA 5JY6A 2JEJA 1F3OA 4Q5IA 1KTVA 2ZIGA 4BKPA 4O5AA 5IABA 5IEJA 4KXWA 2OHVA 8RUCA 3PWKA 2CWXA 2DBQA 5CYGA 1KMQA 5D5PA 4ARBA 3SIXA 1NLMA 1FP4A 1GUYA 2Z43A 4LFAB 4F25A 3HZZA 3I5CA 2OCYC 1S1VA 1NBOA 4BTEA 1DFDA 3ESYA 3QH4A 1GKYA 5E9WA 5FR1A 1S7HA 1UOEA 3IAHA 3KZNA 2R7OA 2H54A 4YJKA 1F2DA 3MJFA 3VOSA 3KD2A 4DV1B 3KQUA 2XRYA 2ASVA 2NO5A 3D2CA 3G1TA 2XNDA 4YV1A 3SEAA 1XN9A 5I9TA 1DX4A 3HSSA 2DVMA 3LCCA 2B7BA 3Q6IA 4KLCA 2QYCA 2IEZA 3PGMA 1BMTA 1SKYB 2B4KA 3CJTA 2X8BA 4J0DA 3QXCA 2R86A 4EGFA 4ITSA 1KMHB 4JUIA 4QREA 2OH2A 3FRHA 2XY5A 4CQJA 2DH8A 1SPXA 2JKVA 3BRWA 4CTMA 3R3VA 2I2BA 3I1YA 5G0RB 5HMXA 2K87A 3IT2A 1U0NA 4HX5A 1V1RA 2Q41A 3T99A 3LQ1A 5DM4A 4UASA 4H4OA 1Z4LA 5T4HA 2PT9A 1M9NA 1Z7EA 3GJRB 4IKEA 2OGSA 2VDOB 4WWSA 1L2TA 4J4HA 3OOSA 5ELXA 1PGPA 4JI0B 3JQFA 1EUCB 2IBSA 3NGKA 5HS6A 5F52A 1UIMA 3MSCA 4BNVA 1K1SA 4P81A 2R8PA 1L7XA 1SD5A 4UEWA 4II2A 4J16A 3PE4A 1SCNE 3R75A 1O3YA 3EEQA 2B56A 2HXSA 1XR5A 1O8CA 1BC6A 4PUOB 4BLOA 2YBEA 2J6CA 2XTNA 3GFFA 4MWTA 3P8ZA 4LMZA 4HF7A 4OK3A 4KFCA 2C4WA 4ZK2A 4R31A 3AP1A 3N3AC 2C2HA 2P2CA 1KHVA 3KLOA 1OYDA 1N2XA 4ERNA 1BHSA 3QBJA 4HVLA 1NBEB 2NWQA 1ATIA 1UINA 4UQGA 1T05A 4NA2A 3HP1A 3MUNA 1CWUA 2XCSB 4A2CA 1ZVQA 1N6OA 4YGYA 2MHCA 5D1NA 3I45A 1YRXA 2C00A 1R4ZA 1YBVA 2QQEA 4OQMA 1G3QA 3PKYA 1SNYA 2QBYA 3LK7A 2HBZA 5C7YA 2O2EA 3CG4A 2NQTA 3U7EB 4JNCA 2ERCA 3EDYA 2BC9A 1SHJA 1AMOA 2B4AA 3VPDA 4B3FX 5D0GA 1TIKA 4V2UA 3T1QA 3F6SA 1SQ6A 4KC5A 5JFTA 3OBBA 3KQTA 3DAPA 3LHKA 4MKXA 1BQ4A 2UXCJ 4DV5J 3NNHA 1UZMA 2E9SA 4G8DA 1WLSA 1XMQB 2C82A 2XDAA 4JSTA 4EPWA 3K8OE 8MHTA 1MB3A 4ARSA 1SBYA 2J0UB 3ZW8A 5HIIA 4Q44A 2PG3A 3VQSA 1NUUA 1W5BA 4ZP7A 1BHNA 2UP1A 3A3YA 3GLSA 1W0KD 5AW3A 5JVHQ 4YRDA 3EH1A 1NNDA 3OFKA 4BNYA 4WE1A 4BVEA 2ZRIA 3P2YA 2G07A 2J32A 3CX7A 3KK2B 1RKIA 1DBRA 2VBWA 3BB5A 3KVOA 4D3YA 2B0GA 3PNYA 4Q01A 2GQCA 3M7VA 3EG9A 5ICFA 5K0BA 5IN5A 2KI5A 3WL3A 4YROA 2HA3A 4EM6A 3OP1A 3AQOA 3TTVA 1LZKA 4J9RA 4KUHA 1BVHA 5J1SB 1FVOA 4Q2LA 4M0UA 4B79A 4BVAA 1WY5A 5FTWA 2B1IA 4EY5A 3U09A 2QXTA 4YR9A 4HDSA 1YX2A 4ZJPA 2GAAA 2Y77A 4I3GA 4LNUB 4LBIA 1E1DA 3G02A 3GNLA 4ZOEA 5CXSA 3DJYA 3BAZA 1Z6XA 3MB5A 2CVQA 2FZKA 1B23P 2XNHA 2P27A 5JSKA 1WXIA 2DEIA 2NSCA 1OYYA 2QRKA 2HK2A 2VJPA 4PIMA 3DL4A 5JI2E 2JFOA 3U31A 5B58T 3LCRA 4NBKA 1SKMA 1XA4A 3SDEB 1IY8A 3UVJB 4NHOA 5LXTF 1AK2A 3T6JA 3JQCA 3PNKA 2PMEA 5JAZA 3ZGZA 4JBXA 2V8HA 5T4BA 4KO3S 1DJLA 1YA6A 5DOZA 3W5XA 3U4GA 4TMZA 4DNOA 4IV0A 4DC0A 4HAUA 1E5LA 2ZSBA 1S1UA 2XZTB 2EZUA 3GV8B 1BS1A 1PJ7A 1QRSA 2CNNA 4TS3A 3QG1A 1KYZA 3BXHA 3C70A 1RCOB 5DHPA 4PLWA 2GYUA 2AXEA 1HE2A 2JW5A 3K70B 3N4WA 2JFVA 1DSSG 2C2BA 1O5JA 3B60A 1JR6A 4YQEA 3PJ9A 1RYRA 1KY2A 4OV6A 4ZOSA 5HMYA 1F4VA 3EICA 1ENOA 1TK9A 2BISA 2G4VA 1IAQA 2ZPUA 2YCLA 4ZQHA 5BVHB 3ANYB 1MMFB 4JR2A 4W8OA 3J80U 1ONOA 3AFHA 5CLJA 4NC9A 1TC1A 3O91A 3FMPB 3DMJB 4INZA 4GLBA 4HYKA 1ZMTA 2I3DA 5HUQA 3UDCA 4YJ2A 1X9SA 4F2HA 3CJ4A 4I81A 4EOGA 4BNNA 4OATA 4MJXA 3U3JA 2CJFA 3U39A 4TU9A 3DOOA 4OM8A 1VQSA 3STXA 1TJNA 1E79A 3K0HA 1WHSA 3K6SB 1Z7WA 1G4CA 3IQEA 2DKNA 1X4EA 2O5CA 2XWBF 4Y2XA 3CLTD 2QNBA 2AEMA 3OURA 1J8DA 4J3FA 4D9GA 2J7PA 4OSEA 3NH9A 1P0FA 1T7PA 3GGDA 1UDCA 3IRXB 3W1VA 4FNAA 4X62J 4EH1A 1A9TA 2VJQA 3MC1A 1BFUA 2YH1A 3RIEA 1TAGA 1PQPA 4LPKA 4IWXA 3ZD7A 3PJFA 3BGSA 1FFEA 4FYMA 1FFXA 1SHUX 4RWEA 1RTTA 4LJLA 2FETA 4UF4A 1YJTA 1E3WB 5DTJA 1M5PC 1SUQB 4C8OA 1RFGE 4D9JA 5JUMA 2CXRA 1RPJA 1PC4A 4RCVA 3TNYA 3FKJA 3I9MA 3RKSA 4AP5A 4OXYA 4TLDA 4WOBA 4USIA 2AL7A 2HJGA 1T6XA 2PWPA 1QJHA 1JPVA 1AFJA 1GUZA 4JI7J 2YXBA 4DX7A 1B76A 1W30A 3W3ZB 5ECGC 5EWLA 1ODTC 5C51B 3IR6A 2XY6A 3ETEA 1B6GA 2CCJA 2WKWA 1EMDA 1R15A 2FSHA 4E5PA 2AX1A 2JAHA 4B7UA 2Z2JA 4ED9A 2AJ2A 4CNBA 2NYIA 3SEOA 3HHEA 2V6GA 2ZYRA 4YCAA 3SXPA 2LW7A 4QZVB 3IT3A 4MR9A 4QRHA 3USZA 3MRXA 4G6ZA 1CIPA 3GGPA 5DP1A 5A0YB 1KRWA 4OQNA 2NLOA 2YV1A 1B8VA 1ZH5A 2AE2A 2RHJA 4WCFB 2H4WA 1C8LA 2OOSA 4PZ0A 4QLOA 1IY1A 3MJVA 3SZMA 4ZO9A 3MMCA 1DFHA 4Q24A 2J3JA 3TEFA 4BNMA 1DS6A 3R5DA 3SYNA 3OCUA 1MWQA 4G0YA 5LFAA 3ZO7A 1L5ZA 5JALA 1S97A 3HJHA 2HBRB 4AIRA 4C8ZA 3O5AA 1EQAA 4MCAA 4LE1A 2WM3A 4QR1A 1PG0A 3CVWA 4YLGA 3SHOA 1UPPA 4OZ0A 1PYOB 3MD9A 2AFRA 4IX1A 1G2OA 3C6TA 4QR0A 1GM5A 5FLKA 3TEJA 5CXQA 1X80A 2W6NA 5C42B 1O0PA 2HCTA 3F0TA 2YHAA 4FOPA 2C58A 3GV5B 3CIOA 3ZJUA 1SVWA 2C2YA 2GA8A 2AWOA 1PR4A 4JUCA 4NY1A 1I3CA 2OSVA 2XY4A 4RTRA 5HQMA 2J5BA 3NOXA 1YQGA 4LS3A 2WRZA 1P75A 4CT5A 2QMYA 1W76A 2IH2A 4XB6B 1ESEA 5F2KA 3HSKA 3UF0A 2AVDA 2YDXA 2XMKA 3KLFB 5FXMA 4NBNA 4QHYA 4EQZA 221PA 4OHZA 1L5OA 2ZYAA 3HCAA 3IAM6 3P26A 5D7BA 4O4IA 4O2BF 3TVZA 1CTQA 5DCUA 3RJZA 1SIBE 1AK9A 2X5OA 1H0HB 1V3SA 3WGKA 3QAUA 1NT2A 1FP1D 3BGDA 4LC0A 5I6DA 2CHUA 4DS3A 4DLUA 4DDHA 4OHRA 2MZQA 1Q57A 1O96A 4X1YB 2P4SA 1OH6A 1DBSA 2ZUUA 1SQSA 3VNAA 1OZGA 1UMCA 1GNSA 2PBLA 2VP6A 3MOSA 1CQWA 2CQ3A 3I6YA 1IN1A 1C0EA 5JATA 2FLPA 4P86A 2YC2C 1H0KA 3KR9A 3PYMA 1BE8A 3OG9A 1KYYA 4E3ZA 2CDCA 2VHUA 2E1RA 4OQFA 3KXKA 3R76A 5GGXA 2H18A 1TO1E 3F8WA 2GN1A 1TAHA 3GV7B 3AHCA 4Q4LA 5EQJB 3EVGA 3ZVKA 2XZPA 3DMRA 1ACLA 3QPDA 3SC2B 2IHVA 2XA2A 2VSOA 1ZGCA 3BB1A 2AYZA 3F67A 3FF1A 2XTJA 1DLIA 3GN1A 4QYZJ 1C2TA 5EUQB 1L5WA 3NDBB 4EW1A 4GT1A 2PHZA 3A8TA 3FMVA 2XWPA 2I0XA 4MYHA 1UKEA 2UXBJ 2P40A 4MIOA 4CUZA 1T9GS 2FF5A 1RD4A 3TVKA 2Q7OE 1KZ9A 2HQRA 1JG1A 5IAJA 1DIOB 5C32A 4RVOA 4HLCA 2PS0A 2XQJA 1MRNA 2W2VA 4FBTA 4UE2A 4GLLA 3MJHA 3ZH2A 3LAKA 3WLMA 1TQ8A 4J1TC 2DCMA 2APOA 4NRUA 3IKTA 2NVUB 1SH2A 2PV7A 2ZNZA 2PJZA 1I7NA 5TEVA 4QOFA 4CLWA 3VCDA 1U3TA 3ECCA 3LHSA 1FFGB 4Q82A 3H7HB 1I0ZA 2IE0A 1C14A 5KFRA 2GERA 2BKVA 4K6CA 3PW0A 1YS9A 2XBPA 5KVVA 4AG3A 3E1GA 1NKEA 2F8HA 1RVDA 4YAGA 4JJAA 2X13A 1KI4A 2BKLA 2CWKA 3MGGA 4O29A 1DIRA 5DWDA 2BR3A 2PL9A 3W5BA 2DFNA 1TDJA 4NCIA 1Z2ZA 1YS6A 2GJKA 2ZYDA 3S2UA 1RT7A 1JEYB 3ZC3A 1RT2B 1X92A 1CR0A 1EWRA 3UN3A 2Z5VA 4HPJB 3KKZA 4DR1J 2MSCB 4G5FA 4DR5B 4FT2A 4CV0A 4HDRA 1TO6A 4NLSA 1PJCA 3OOYA 2XITA 5HYVA 2HK9A 4QT4A 4RLQA 2YPYA 2Q3HA 1JJBA 5E7JA 2QPAA 1X5PA 1PLLA 4F5WA 2O0HA 2HN9A 2UUPA 2A9FA 4O4GA 3QT7A 1TA9A 1WZUA 2BMAA 4KRXA 4P31A 5C9ZA 3A31A 2FIUA 1C7QA 2NYUA 3A3PA 3BKFA 3MPVA 1KYTA 5DM0A 4KODA 1H5UA 1I7SB 2H29A 1GL6A 4ZJZA 5KTOA 4LR7A 3U1NA 3SK0A 4ID5B 1IQPA 2A1UA 5LZ7A 3PHLA 1UR5A 3EODA 3KJNA 3DNCA 4I2PA 1T1SA 1EIZA 2QUIA 1L5QA 4OXXA 2DSNA 1KO7A 1CZRA 4ES1A 2CBZA 3SJAA 4EY8A 4UMVA 3TNDA 3ES9A 4KXUA 5KTKA 1VPLA 5D3MB 3TZLA 3ELHA 4MH0R 3W2IA 2A2DA 2SXLA 4LTDA 3MTAA 3V8MA 4D9CA 4MKFA 3VNBA 1XZMA 1U7PA 3R7BA 3R3ZA 1KPGA 3JZAA 3DVSX 1GDTA 1EX8A 2NO6A 4LV8B 4EG0A 3DZDA 4KDEA 3N2LA 1RBYA 2O8BA 2F40A 1EHYA 1HETA 4HADA 2M8HA 3E01B 2GR9A 4O8CA 1NG9A 4M0PA 2ALYB 1S6YA 3I96A 1JDSA 3FLBA 2J7WA 3OM0A 1MJ5A 3AVVA 1UK9A 4KFBA 3HHNB 1UP6A 1YCDA 4HX9A 4ZVTB 5DKFA 2XNSA 4PAOA 1FKPA 1XNRJ 1WC4A 2QU8A 3L05A 1V5IB 2P6PA 1KJJA 2XZDB 3KB8A 5KFFA 3V8BA 3LQYA 4DSUA 1ZITA 5LMNJ 1BXRB 2RGAA 1CJCA 1VPDA 1L7NA 2Q27A 3AV3A 2ENWA 1YSCA 1HBNB 2YWKA 2JI6A 1NQUA 3PF9A 1Y7LA 2RS8A 1YB1A 4XPCA 3HRKA 1HFEL 4N48A 1YZVA 3E23A 3UMJA 5C7IO 2KB2A 4OUDB 4R6XA 4J5OA 3CS3A 4DS5A 3A2LA 3LZ6A 2GBCA 1CCWA 2IPLA 4IF6A 3BHNA 3IDSA 4N56A 4HWSA 3D9BA 4EB8A 2M2IA 5JCOA 2XNQA 4KGZB 2R9LA 4QATA 3FKSD 3UAWA 5FI5A 4JQZA 4C2AA 2BI4A 2DH6A 1AFIA 3N8DA 1GEGA 4QPZA 4J29A 4A8FA 5KT4A 3HHLC 1CY6A 4NRDA 2WIGA 4TZ6A 4Q3LA 3WMRA 2P7HA 1L1FA 2V54A 3S3TA 2ZI4A 2NNWB 1MRZA 1UQRA 1X1AA 1G4HA 5U4QA 4V24A 1WZ2A 2VHVA 2PGNA 1O4VA 1I33A 2IHNA 2D3OR 2IIPA 4PBRA 3GIMA 1KFCB 1Y8RB 5AUQA 3O3OB 4FKMA 3CWCA 3GEGA 2W2TA 3O4GA 3RIYA 2XI2A 2YKNA 4PC1A 3IOYA 3HWSA 3WRWA 3HKBB 1AKUA 3QELA 2KVIA 3EOBI 1SCJB 4YRFA 3R77A 4RPFA 4GRAA 4I19A 4K88A 1CJVA 4TXLA 4QOHA 4D4HA 1FEEA 1HNWB 2D0OB 3HJFA 3LQ2A 1Q1BA 3R0IA 4GOLD 1YR2A 4N47A 2Y1EA 3NWRA 1HG1A 1UOOA 1MQSA 3EXYA 3OQNA 4FYJA 1ZOTA 4JA2A 4ND5A 3RUPA 4U2GA 1YVDA 4DPOA 3V7WA 1WCIA 4JXKA 2XLIA 5EIHA 4C6TB 4I9NA 3S28A 1NUPA 3PTLA 4EG8A 4YJ2F 3CDWA 5ETOA 1VCTA 4FHFA 3WI7A 3QIVA 5C7OO 2BKPA 1L4MA 1SJ1A 4J2TA 1LWXA 4KR2A 2ZTHA 4KACA 3WLLA 2C3UA 2WIBA 3UBMA 1CR4A 3LSTA 1L3UA 3M9WA 5FBWB 2ZB8A 1IVYA 2P9JA 4RMIA 5TRTA 1NLFA 2Z04A 1GVNB 3NCRA 2DQKA 1NXPA 5L4NA 1R3NA 2FN4A 2FXIA 4CF3A 3P4YA 3MIIA 1ZAXA 3OPYI 1VKNA 1RJEA 2C4UA 1V35A 4HWGA 4DQVA 4DWIA 4OK5A 1WB4A 3PVSA 4RBVA 4HFRA 2QD1A 1GAEO 2X4IA 3NWBA 1KN6A 2DFTA 3VO8A 1RTIA 2A14A 4IFTA 3ROMA 3C6KA 5CFZA 4C4RA 4DQUA 3AJ1A 3RRBA 3PPYA 3IGNA 2L18A 3UMFA 4W63A 2PC6A 1IN8A 1I3NA 4Q5VA 3ILSA 1B26A 5M7EA 3PNBA 1S0OA 1U7TA 4XE5A 5BR4A 3BBPA 2OB1A 2F3RA 3UC9A 2DITA 5KFZA 1S0MA 2C5AA 2ZVSA 4I66A 3GFHA 3Q8XB 5J4KA 4LJ4A 5EMLA 1X5TA 3B9BA 1JLGA 1GCAA 3AJ2A 3ZJ5A 2PU5A 3QXHA 1P7WA 2DR2A 1T8YA 5K0EA 2JH8A 3FRIA 3ILIA 3K35A 2OCBA 3EMBA 1VRUA 3PI6A 3ZZUA 1N2SA 2X9NA 3GVCA 3OVSA 1EX6A 3M1IA 3K0KA 2NU7A 1LB1B 1Z75A 3U17A 4AJEA 1MAHA 1K06A 4WVLA 3R41A 3HMKA 2D54A 5FCDA 3NV9A 2KYRA 2YZKA 3ZD6A 1EZ4A 4JB2A 1H2UX 1I8TA 1CY8A 1S8AA 1HQEB 5DDPC 3USES 3NAGA 1DPGA 2R6FA 5GIOE 4H4MA 4LFBF 4UHKA 2L19A 2G0CA 5I4MA 2Y1OA 1M10A 1WF1A 1SVKA 1MU2B 4MW9A 4EP1A 2VWGA 4Y7DA 3S01A 3PB3A 1X94A 3NKFA 1NQWA 4IMRA 4JU8A 2RAVA 4IRCA 4ASUD 2BHRA 1RI5A 2OV8A 4MYSA 1Z8HA 1RXIA 4UPVA 4BO5A 4ILEA 1JHZA 3HR8A 1JXLA 1M0EA 4L5BA 3THXB 3HKDA 3KKNA 1POXA 1NMQA 2N9UA 4JHXA 4J6EA 3TE6A 3AODA 2JAWA 2CF6A 4WEQA 2AF4C 3F1KA 2X5KO 1OSDA 2VEOA 4FK8A 5CFPA 3V32A 3FJYA 1E2DA 5WRFA 2KB0A 1K6XA 3ZLJA 4ZVLA 1JE0A 1V47A 3ZZNA 1YJVA 4C1NA 1WW2A 2NU9B 1N5JA 1T5LA 4P72A 1FDDA 1PILA 2QM7A 1NM5C 4HJXA 3ZDYB 5CCEA 1M7HA 5SY9A 3EGNA 4O4IF 4PWUA 1PJLA 2VI5A 2HWTA 4DFMA 4RD3A 4C6RA 3K58A 4C78A 2FSVC 4M0EA 2GXAA 3GA0A 2OKCA 4D3ZA 2W25A 4GM1A 2ZUCA 2ISSD 1DBPA 2VQFF 1QJCA 3BM7A 4ZYYA 2VDNB 4BNDA 4CMIA 3EM1A 1I36A 2DECA 2QE7D 4F86A 3GELA 4JB0A 1BCSA 2H00A 4MULA 5KJCA 5EP3A 3D5TA 1MG0A 1V6SA 2WIJA 3QLHA 5ALFA 3DGPA 2CW5A 5DYWA 1BC5A 1JLLA 4I4TA 1DJOA 1QM5A 4UM5A 2ZITA 3BE8A 4D41A 5HEKA 1E2EA 2LP4Y 4NLXA 4WDRA 4MA0A 1Y6FA 1IWAA 4MIAA 3DP9A 1EGVB 3A1UA 3OPQA 1KH2A 4USWA 4X66J 1V3TA 3VV3A 4CPDA 4PEVA 4ED3A 1M2KA 1JLBB 5KVSA 4R2LA 1N9KA 4D42A 4W6ZA 3WB9A 3KSAC 2B6AA 3QMPA 2IZ0A 1IH8A 3UAXA 3HULA 5J2TA 1CRQA 1YCFA 2QE5A 3O0DA 4UHDA 4LYHA 5FL7A 3MNFA 4MS4A 4QT0A 4KXQA 2Q4DA 2FN8A 2ZWAA 1XZIA 1Y34E 3ZZPA 3ZZMA 2JFYA 3TZ6A 2BHLA 2BLNA 2E7VA 4U63A 4EECA 4OYXA 4H1TA 3VXKA 2D69A 1JG6A 2I29A 1XDBA 2NTEA 4K1XA 3D3EA 3CIMA 3AB2B 4LUBA 1B74A 2PD3A 4ZI7B 1PV1A 4X6UA 1LRLA 3NGXA 4ISCA 1W73A 1PJ5A 5IASA 3ZK8A 4TU7A 1IBKB 3DUFA 1ZQ1A 4Q9AA 4HYQA 2A5JA 1Y9OA 3NYWA 4XFDA 3H05A 2HUNA 5LYJF 2GBFA 4EA9A 4HT7A 2WJIA 3UC5A 3EARA 1WSDA 3PE3A 3H11B 5HKKA 5C1BA 3OR2B 1GDDA 4KTTE 3IAM1 1EESA 4RVSA 5C1IA 4P2GA 2P8SA 1GGMA 4NYMQ 3ZDEA 5JMNA 1HKAA 4B6GA 2YWJA 2D9PA 5ERXA 4AKHA 4Y6LA 1FQWA 3WO1A 1RA7A 4YYEA 1BEZA 3HLTA 1H5NA 4HQNA 1MO3A 5KSYA 2R8IA 3FB4A 5LZ5A 2AJQA 5KT6A 1RAIB 3DV9A 4AJOA 5MN4A 4I2QB 2I6GA 2IYYA 3UMRA 1ZMRA 2DNOA 5BY2A 5AJZA 2OBBA 4CKYA 1V6CA 1HQCA 2ADBA 5H9EK 2C57A