4GMKA

Crystal structure of ribose 5-phosphate isomerase from the probiotic bacterium lactobacillus salivarius ucc118
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
b'PNQDELKQLVGTKAVEWIKDGMIVGLGTGSTVKYMVDALGKRVNEEGLDIVGVTTSIRTAEQAKSLGIVIKDIDEVDHIDLTIDGADEISSDFQGIKGGGAALLYEKIVATKSNKNMWIVDESKMVDDLGQFPLPVEVIPYGSGTVFKRFEEKGLNPEFRKNEDGSLLHTDSDNYIIDLHLGKIENPKELGDYLINQVGVVEHGLFLDIVNTVIVGRQDGPEVLEAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Structure of ribose 5-phosphate isomerase from the probiotic bacterium Lactobacillus salivarius UCC118.
pubmed doi rcsb
source organism Lactobacillus salivarius
molecule tags Isomerase
total genus 75
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4gmkA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gmkA01
1UJ5A 1UJ6A 1DEAA 3U7JA 1SC6A 4TM7A 2RQMA 3TUIC 2RI1A 3AB2B 4GO1A 2RQKA 1YGYA 3KWMA 3TUJC 3ICOA 3BXEA 3TX2A 4OQPA 3CEDA 1FRZA 2LQJA 3NWPA 5IS2A 1ZPVA 3W7BA 2KO1A 3TUZC 3BXHA 3DHWC 2QMXA 3S1TA 3E15A 4IO1A 5HJ5A 1O8BA 1U8SA 3MTJA 1LK5A 2NYIA 1XTZA 3LOUA 2CDQA 2BKVA 3E7FA 2I9SA 2P9GA 4GMKA 1FS6A 4L4YA 3HN6A 2DTJA 4OQQA 2OKGA 5IT0A 2J0XA 2O0MA 2WU1A 3OC6A 4TM8A 3AB4B 1CD5A 1LKZA 4L4ZA 3AAWB 3IBWA 4GO5X 3EFBA 2BKXA 3L7OA 1FQOA 3NZEA 2P9EA 2ZHOA 3ENWA 1UJ4A 2PA3A 4M8LA 3KV1A 2PC6A 2RI0A 5IT4A 3OFGA 1JT9A 1YBAA 3LUYA 4PWUA 3N0VA 1KS2A 2JHEA 2F1FA 1VL1A 4L51A 3IXQA 3CSSA 1NE7A 1PSDA 2JOQA 3ENVA 3ENQA 5T41A 3UW1A 3K5PA 2W48A 2GNPA 4NMLA 2QMWA 3OBIA 2QRRA 2DT9A 3MWBA 3MAHA 3HHEA 2R5FA 2LVWA 1Y7PA 3DDNA 3O1LA 1HORA 1Y89A 2H9ZA 5FIIA 3BXGA 4R9NA 1PBTA 3OFEA 2RE1A 3DC2A 4LUBA 2J0WA 4L5IA 3BXFA 2FGCA 2MDAA 2J0EA 3OFFA 3NRBA 5JJBA 3P96A 3DHXA 1FSFA 3OFHA 4L5JA 2QSWA 4R7TA 3EB9A 3LWDA 4GO7X 1FS5A 4L50A 1RWUA 1M0SA 2F8MA 2P9CA 1LK7A 1HOTA 3LHIA 3CH7A 4X84A
chains in the Genus database with same CATH superfamily
3F56A 3WNCA 1I6JA 3QQPA 1H2WA 4DS3A 1N52B 1XD2B 3NGRA 1X7XB 2XA9A 3FX2A 3EPKA 1KH2A 4HHUA 1JKJA 3PQFA 4XR4A 3O83A 2V03A 2M6LA 1CTQA 1W5FA 3UMMA 1NHVA 3GCXA 1EBBA 3GPAA 5AXCA 1HKAA 1JAHA 3NFRA 2GHIA 2QT1A 3PKZA 1A2OA 1VDMA 1JTVA 2G07A 2YZKA 2B5JB 4F4ZA 4JBLA 1CY4A 2M6KA 4QYIA 5DQIA 1ZD8A 1R0ZA 3DPSA 4MWBA 5HQ8A 1OLSB 1H9CA 4AN0A 1E6KA 1DX4A 5J9FA 4NEGA 3NHFA 3T61A 5MDHA 2G6TA 3W2VB 4HEHA 2RB7A 1WBJB 4UC0A 1ZVKA 2KSQA 4HRXA 5IFKA 3TM4A 3OTHA 6REQA 3CDAA 2MEWA 1ZVQA 1SUQB 3G2JA 1WEZA 4HMOA 4CEJB 2D5IA 3W2FA 3HPQA 3U4HA 1GUDA 3AVTA 4MCIA 3WP0A 2JA1A 3QX3A 4IJ6A 4TPKA 2EKYA 4RZ3A 4HWTA 1NQXA 1TYDE 2EJTA 4CTNA 3ZDXB 4PC1A 3LLCA 5BNWA 5FLXU 3ITDA 1DKNA 4PSUA 1DV2A 4YUDA 2UYGA 2Z08A 4O3NA 2P90A 2AOTB 3GELA 2OVBA 1MEEA 3LP2A 2BM9A 1XWLA 3KVVA 1XALA 1L5MA 1OYYA 3K96A 1OXUA 3G96A 4Q01A 1OMOA 2C94A 2MCFA 1NC3A 4JFAA 3BGOP 3HVTA 2D3WA 1SV5A 3PXEA 4Q47A 4ZVKA 1CY8A 2Q45A 1KTVA 4TRMA 1D3WA 3RC2A 3LTNC 2YFQA 2C8VA 3OESA 5FJJA 1E69A 2XTJA 4WTOA 5KYYA 3BICA 3EZ2A 2IS6A 1Q81T 2JIOA 3C5EA 1DAXA 1NBHA 4WGFA 4B33A 4J4BA 1N3YA 2Z5GA 1HZJA 1MAAA 3FTFA 1C4AA 5E4TA 4HRVA 3AM3A 1AV7A 5JSUA 1NLKL 1AZSA 3IEKA 4JITA 3ECAA 1CY7A 2VK1A 3B9PA 4XVUA 1VJ0A 1ZLYA 2GEBA 4K26A 2BEKA 4O2BA 2IHJA 1SB8A 2CPEA 2I8LA 3BIJA 3ZTQA 1SA0A 1Z28A 3L4EA 5HRAA 3HFVA 4C0BA 3M70A 3C3DA 2X7IA 3E7DA 4Q4CA 3IPCA 3AF5A 2Z0MA 2CSXA 5HEKA 3IUMA 1XRPA 1RWXA 4P4NA 4DV3F 2QLFA 4EYHB 1WC5A 5FADA 3UDCA 3SR4A 4J16A 3EVBA 2VBCA 1KI3A 4ZT4A 2ISQA 2I9PA 4QU9A 1TTPB 4IDAA 4G1MB 2QAGB 1JTFA 2XWBF 3RRXA 3C8MA 1T1JA 4UNIA 2FWRA 4XWYA 4GVPA 1L1EA 4XFKA 4LVOA 2DNLA 1JA9A 5CTJA 2GEFA 5JFGA 3T3PB 1ZVMA 1ADGA 4Q82A 3R5HA 1V8FA 4U2EA 2X51A 3PHJA 3VSBA 3UYLA 5AYVA 5AVJA 1SD5A 2XLCA 4NZOA 1ATIA 1QH9A 3L84A 3VV2A 4DHEA 2I67A 1CNMA 2PGXA 2XRYA 4WASA 4YMWA 2HWWA 1D0EA 4CF4A 4PSCA 3OZGA 1MV5A 3K4HA 4O8ZA 1WZUA 4U7GA 5LZ8A 2IOQA 2MSSA 2UUCJ 4EJSC 2NP7A 2OHXA 5C8XA 1J0DA 1Q5VA 1K6IA 4PHHA 5HKKD 3P45A 1K2VN 3IILA 1CV2A 1GQ2A 2YWDA 4D3HA 2DXIA 1E1MA 2QW1A 3OXFA 1I30A 3BZUA 1O08A 2QLNA 3QF4A 4ZPDA 2PZFA 1B7FA 3EW7A 3I87A 1XCMA 4KHZA 1JEQA 1EGAA 1IUJA 2XDQB 3GIDA 1WUJS 3RR7A 3SVLA 2G1KA 1W5EA 1YULA 4LY3A 2FQ1A 2Z1MA 1IKVB 4Q4AB 2IXTA 3E01B 4N9WA 4YRKA 1P0FA 3CLKA 4XQEA 1I1QB 3KXLA 3WIOA 1L4LA 1JL3A 2AYZA 3QVOA 2HNAA 2Q43A 3MNFA 3QE3A 2OTCA 3IQDB 3FZGA 1D2EA 1Z75A 1NMYA 2PI4A 4NJEA 5AICA 2O2DA 4R1PA 1U1KA 5TF4A 3ONEA 3F97A 2PMEA 1VQ7S 3TJ9A 2JJ1D 3KT0A 2PS1A 2A88A 1K3FA 3LD9A 1XD2A 3R7NB 1X7XA 2VKZG 4J0QA 4DABA 1GLGA 3EQ9A 3V4RA 4NFHA 1WCV1 3CDBA 3ZWYA 1KI1A 1ZIDA 3KQUA 3GJXC 4FMCF 1OH7A 1CHNA 5I6DA 1Z7EA 1MC5A 3R5CA 2QTVB 3O47A 2BANB 1TMOA 1XZAA 2DHCA 5CGQB 2QPTA 2B5JA 3X2SA 4HVCA 1J5XA 2GMLA 2Q5EA 3I2HA 2DF8A 2W2QP 2P67A 3LU1A 4KR6A 3K0AB 1OLSA 2ZAIA 2F63A 2WNIA 1Q1AA 1KZ9A 5E3IA 4CL0A 3AHFA 3NVDA 4QOHA 2XZOA 5ALWA 1IL0A 5KG4A 2H85A 4ND2A 3C1UA 4EAQA 1CQIB 2B8QA 2C54A 1SUQA 2OGUA 4CEJA 4LF7F 1GGKA 3TUZC 1KAGA 1CDEA 2W6PA 3GEGA 3OOJA 3T9NA 4DPLA 4QW9A 3BA6A 3R5BA 1THZA 4G89A 2OHFA 5DNUA 1B15A 1XO1A 2RUGA 3P2OA 1L3SA 5JD3A 3KZ1E 3U4QB 3FOCA 1HE4A 3H2YA 4NA1A 2AOTA 3R7WB 2XNQA 3M4ZA 2C2HA 2GPJA 3I37X 5AUQA 3AIOA 3U60B 1FMCA 9ABPA 1W88A 2WR8A 3IDAA 4AL7A 4JD5A 3T1YJ 2Z6VA 4PYMA 1U2CA 4MSUA 1DJLA 1SURA 3QSYB 1VCHA 4FI3C 4B45A 9ATCA 2A3JA 3MR2A 3HVKA 4B4WA 1DJNA 4LJ7A 2XOEA 1CT9A 3K5HA 1XTVA 4LDPA 4NI2B 3L01A 4ZU1X 4L9SA 1QQ5A 2AHOB 1O77A 3UDVA 3DCJA 2V68A 2JAUA 4IGFA 1C14A 3SK0A 1HFEL 3ZY6A 1BU5A 4TROA 3RIGA 3AJ1A 3O3CA 2V94A 4BKOA 1P9YA 3NBZC 1N5DA 2P40A 3VGUA 3H1GA 3R74A 1V1MB 3AKCA 1R64A 3PC3A 1HLPA 3DAYA 1P7YA 3PEYA 5KG0A 4DV4J 4XIYA 1B6TA 5ADWA 1O94D 5IN4A 8OHMA 3Q8KA 1S99A 3ZBPA 1FS4A 4OB6A 3RTBA 1UBUS 3M2TA 2C92A 2LCQA 3CSSA 3HX9A 3DP9A 3WLAA 5B6IA 3EXG2 4IX1A 3JRWA 2YXDA 1IZZA 5I42B 3IBGA 1PJ2A 3EUAA 1F1BB 4Z7JA 3NS6A 1XLTC 1KIFA 2L69A 5BWLA 2VRCD 4RBVA 1ZPWX 2QAGA 2P9TA 2OQRA 4DQXA 4K3UA 3PXAA 3DLIA 3KDPA 2C84A 2ZJQQ 1T0UA 4WKBA 3KBOA 3MUVP 3ILIA 4JP2A 4Z7NB 5DNYB 1R00A 2H54B 2ZT7A 4HVLA 4MWTA 2J33A 2YUTA 4JY7A 4BC9A 4OHUA 1R7IA 3SF0A 4Z3KA 5FPHA 2CLLB 3HYSA 4WXWA 1RLOA 4C7XA 4IJMA 5HZKA 3TINA 3CO0P 1UFQA 2FGJA 4GNKA 3HK2A 1CZOA 5SUHA 3M8ZA 5G3YA 5BQ3A 1NO8A 4RPLA 2QPAA 1XTJA 4CP5A 2O2YA 3UDEA 1DG3A 4USWA 4QGGA 3U1VA 3TM5A 1V9SA 1HLWA 1UOOA 3W2HA 5CFPA 1O94C 1TCBA 2PLFA 2VP9A 2YJ6A 2YXPX 4Y0AA 4FZRA 4AZ0B 3P9YA 4JA2A 3UMYA 2R2UA 5JBQA 3IHLA 5FF9A 1VYUA 1NQ5A 1DBPA 2AEMA 5TSDA 2XDQA 5L1LA 2Z4TA 4NNOA 2HN9A 2R751 3BKWA 1VM6A 3LQ1A 4LYJA 4F4IA 3MTAA 3FOBA 1RZMA 2CUZA 3EZGA 3LNCA 3AJ2A 1F2VA 1IKVA 3K58A 1U6BA 2R8BA 4Q4AA 2NSDA 3E01A 1OO0B 1YDEA 1UK7A 2CGEA 2NXCA 5DM2A 1JJIA 4Q34A 3ZW9A 3GV8B 3RWBA 1K0UA 1ZJ6A 1YQXA 1IEXA 1UPBA 2GM3A 2CJ9A 3R6GB 3N2ZB 3TW8B 2BP7A 4XM2A 1G2PA 1QFYA 2WILA 2Q9AA 1HLFA 3ZO7A 3SC4A 5HUHA 4JGIA 1BCSB 3R7NA 3SYZA 3R5TA 4IGEA 3TIIA 2RH3A 1BDIA 2R7OA 4QYSA 1SIOA 4GMGA 4KWIA 3RC1A 2P2DA 3E7WA 3RUEA 2X1HA 4PNPA 2QTVA 2VT3A 1Q1BA 2A78A 2XECA 4H7IA 5L46A 1JHYA 1FP2A 2F40A 5ITZB 3CNEA 1T5LA 3D1OA 3HMJG 4MVCA 1B76A 4JJ6A 1FRHA 2PUBA 2P2GA 1F8UA 4LHWA 3EGNA 1VRTB 3TDMA 2R6AA 1XYGA 1NLMA 3VR4A 2XIQA 1BCRB 2FK7A 1EQ2A 3DZGA 1BN7A 2HFNA 1N8SA 4PAGA 3U7FB 4F4CA 3VTKA 3L6DA 2E89A 2V8DA 4WYWA 2ZRNA 4I8XA 1U2ZA 5F9NA 2ZT6A 5DM1A 3RBDA 4NFLA 5C5IA 5DCWA 1JDSA 2AG0A 2ODNA 3PC7A 4JGGA 5EHHA 3OC6A 5GJVC 3WBBA 3KCQA 1F9EB 4DJ5X 4H3KB 2P65A 2QD2A 2Q3PA 3IMEA 4N12A 4CODB 4W5WA 1EE1A 2JOQA 2W83A 2W00A 3U4QA 3PDCA 2YZNA 4R8SA 4CMIB 1A9TA 1U5BB 1FJCA 3R7WA 2ENUA 1W2IA 3D8NA 2CVPA 2I38A 1E2KA 2EBGA 1IOZA 4IVQA 5I7EA 2EVWX 2DXDA 2C9BA 2HU8A 1GO2A 1WW2A 5M2QA 4JYBA 4AS2A 1QG2A 1Y6GA 1G8GA 3QSYA 2FN3A 2ZIVB 4IXWA 1GEEA 2YR0A 4WBXC 4ABYA 4EVIA 1SOAA 1CC8A 1GX6A 3PR1A 1U31A 3SBMA 5JDCC 3FPCA 3L6EA 1K8XB 4PQYA 2I65A 1THTA 2AHOA 3VKUA 2QGZA 4Q3DA 4V38A 3RYHA 4P9SA 2QZPA 2YIJA 3QQ5A 3BIWA 3FC9A 1RMYA 3WI7A 3W2WA 2D2XA 4RNCA 3FSIA 4LREA 5CCXA 1UEXC 2BTQB 1DWOA 5FKJA 3OPQA 5DLYA 3GIKA 3MUOA 3LI2A 1IVNA 4TRJA 2IIQA 3HJGA 1QH1B 5F2KA 4LSLB 3KYCB 5FX2A 4HHEA 2PA8D 3PS9A 3BPDA 1WMFA 4KK3A 4RULA 1KYIA 4Y2RA 2J9DA 1KYWA 3K1YA 2YNHB 3W5SA 1QD1A 1M8GA 1UBNA 2I0FA 5I42A 4YUXA 1CQWA 2HEIA 4IIXA 2IV2X 1F1BA 3JVDA 4LV5B 3FDZB 4IOJA 1C3LA 5ADZA 4X1YA 4ES2A 4WXRA 1I80A 2QUAA 4GYWA 1SJFA 2ZRIA 2RRAA 1MRZA 1X7HA 4P0TA 2V2VA 1MDFA 1WG1A 1D09B 4N41A 2H0AA 2JLSA 5K51A 1Z2PX 2H54A 4X8HA 4DV6F 4OI4A 1QU3A 3B1WA 3BN4A 5DYYA 4W5OA 3TBKA 1SKSA 2VNSA 4Y28C 2PR7A 4II7A 1SH2A 1NVTA 4N7JA 1B70B 2PRJA 3G7UA 3NWOA 3T3GA 3GA7A 2OHDA 3H0EA 3NDRA 1D2HA 1OZGA 4CEHA 4N76A 2WB4A 5LB4A 3LRXA 1K7FB 3T15A 4B08A 2P5UA 4KHPJ 3H5AA 4Y18A 3QK7A 4A2QA 2XZPA 4YH1A 1TCUA 3OFSA 1X14A 3WSWA 1SZJG 3KQVA 2ZM6J 1W36D 2VTVA 4YCAA 4AZ0A 1UMDA 5AKXA 4LF8F 1GZ6A 4EEKA 4AL4A 1CUBA 3LO5A 3AH6A 5IXUA 3CISA 4DA6A 1EFRD 4YRNA 4Y2TA 3UT6A 4QAQA 2FSPA 1JPJA 2GAAA 2VBWA 3QFFA 2CNWD 2DKOB 1FJGF 3OR2B 1GUAA 2Z83A 4GW3A 2QDXA 4W63A 4B71A 5FNVB 4TVAB 1WSVA 3OPYI 3HWWA 4LOAA 3SOZA 2UYHA 2B92A 3UNYA 3AKDA 5FOWA 4CR7A 1DQ9A 4KGVB 5HS6A 5CA1B 1PNRA 2UUBF 5BW5A 5AXAA 2HK7A 4GXQA 1VBXA 1SNYA 3DJFA 3R6GA 4PSDA 1FVXA 3OIYA 3TW8A 2H4JA 4CM9A 3BXXA 1L3TA 4KACA 3IMCA 4H17A 5HIMA 3C8HA 2XCOA 4QICA 5JFOA 3OX3A 1K2WA 2E37A 3M8PB 4P7KA 5ENDA 1W36C 4FI3F 4RUKA 3C19A 4AY3A 4RD1A 4ABTA 1BHSA 1M0SA 2UUBB 4EKDA 4NWBA 3S2FA 3M8RA 2R60A 5ITZA 1CE8B 4ZP9A 4FILA 3QOXA 2GPAA 1NNEA 1XK6A 5ETQA 2XMSA 2CVQA 1J9ZA 5F8GA 2C03A 2O20A 1DQRA 2WOJA 2HREA 1BCRA 2CY0A 4PAAA 4NAHA 3MEGA 3PQ5A 3DMJB 3KAJA 2ZAMA 3WNBA 1EUQA 1AM4D 3B1JA 4OYRA 1RA7A 1J33A 1RNLA 3RS5A 1HTBA 3UPDA 4EG8A 3RVDA 2WW8A 4AJJA 3WL3A 1AQJA 1K5GA 3MJ4A 2V8OA 4B3CA 1F9EA 1XV5A 3C0KA 2Q8QA 2YKQA 4HQRA 2BFEB 2QZ8A 1WZEA 4UCQA 3RFUA 4BWMA 4WKRA 1DPFA 2X2EA 3BT7A 3H2HA 5LWHA 2R66A 5FR1A 3TI0A 3TLGB 3LCCA 1PZXA 4IKPA 1AN0A 4XYBA 4CMIA 2O7NA 1U5BA 3TSOA 2WFMA 3VKFA 2RHTA 2ARKA 4JUAA 3EPPA 1I3LA 3CVVA 3S5UA 3N05A 3TZ6A 2WSSD 5A9RA 1CUAA 4BWJA 3PX3A 1ATZA 3VR4H 3JVVA 3DLEA 5CHCB 5IEBA 1R0RE 4RS4A 3I01A 1YX2A 3OIDA 4UTGA 2IYUA 2EWWA 5TMBA 3V3KA 1D1SA 1J2TA 1SBZA 2BBEA 4QL3A 3QJ5A 1XQ6A 2ZC4A 1P29A 2OY0A 1RADA 1CEXA 3GIWA 4KIWA 5AVZA 2WPNA 2JGFA 5DX1A 5BN4B 4EJ6A 2XSJA 1Y48E 3NTLA 2FPHX 4NIMA 5F5LA 2CPYA 1JG6A 2Y05A 1WABA 2ZHOA 4RCYA 2DKNA 1TC1A 2AQIA 2F9JA 1DKMA 2FMIA 5CT8A 2QL7B 4EW3A 4V1Ak 3EG5A 2Q6VA 5HBRA 4P08A 4FR5A 3EEQA 4H6XA 3H1AA 1JG1A 4OV6A 4B4UA 3MYYA 3A12A 1CX9B 3BDVA 4OV1A 1BC6A 1R5BA 4DQLA 3V7NA 3DE3X 3T12A 4QJ5A 3LVFO 3OFFA 3MURP 1ZMBA 1YFZA 4LSLA 3KYCA 1JWLA 2LEAA 4DL6A 1MLDA 3QU2A 2EC2A 4C6AA 3DXXA 4RWZA 3D64A 4W5HA 3M9LA 4IFIA 3LYUA 2F8MA 4QTZA 4AYWA 1JLLB 1RPTA 3RJ5A 1JYSA 2ZRBA 5DB4A 4EJSA 1NHUA 1SWWA 4TYWA 3FDZA 4QGFA 2DGTA 9MHTA 5JD4A 4P98A 3ZGZA 3WX8A 4OMCA 2B3TB 1KI6B 2CLHB 3ZWDA 3MGKA 2AOVA 1D09A 5H1SV 2BDPA 2A94A 4JAVC 4TV9B 3U3OA 1P19A 1X4EA 1UODA 2G5GX 1Z17A 4GVBB 1SN7A 4J9KA 1P5JA 5BW6B 4E5PA 5GV7A 3OMXA 4RM2A 1XIQA 1PEYA 5CVCA 1I3KA 2A2ZA 4RCZA 1M1XB 1D0VA 3HJBA 2Y66A 3SQGB 1U2GA 2CFTA 1FP6A 2AZ1A 2Q3MA 5SY9A 5A6PA 4P5DA 4YQEA 5IVPA 4DV2F 3I4LA 1VC0A 4R8VA 3DVRX 4I5FA 5A0YA 4IDGA 4NCBA 3HUEA 3ICQB 3WO0A 3T7IA 4QUJA 4PINA 1LVHA 3ZV4A 1RT3B 3HXLA 4IQXA 4LJYA 4DLEA 2FHJD 2EC0A 3U7GA 1WRBA 3B8EA 5K99A 3U16A 4ZLNA 4P1ZA 3OHSX 1KDRA 1KQPA 4X8OA 5HKKA 3TB4A 3DE5X 3ZCRA 4C2AA 2G4BA 2WF6A 4BHQA 1X8DA 4ZLJA 3DFEA 4ZS6A 4DV2B 3OR2A 1HIYA 4R2MA 5FNVA 1CP3A 3WGYA 3DO6A 3VBCA 3VDNB 1ICIA 4TXJA 3A1NA 4TVBA 4MVWA 4KGVA 3HVWA 121PA 3L7UA 4GI7A 2HWYA 3Q3CA 1BLUA 1QCZA 3G0CA 4QT4A 1Y7PA 3KWLA 3BKUA 4OIXA 2GVDC 2GPYA 4R8LA 2BUBA 2PWBA 4MPJA 4QLBA 1B0TA 4Q9JA 1XC7A 1PJRA 4PZLA 3O4GA 2WJAA 4LVCA 3PPIA 1OX6A 5JNRA 3H4IA 4RVUA 2FZ5A 3NBFA 4RVCA 2E5HA 2OSRA 3CZQA 3S3TA 4BO3A 3TJ8A 2GA8A 4IINA 3BORA 3M8PA 5AI6A 1N6PA 3L3CA 5HR5A 1WPQA 1ZHHA 4J5OA 4UMDA 2DR9A 2JJ1A 4K7QA 3L82B 4TSRA 4KJXA 3JTEA 2ZBPA 4R1TA 1GPLA 1OX5A 5TT1A 1JMYA 3TGWA 1CE8A 4L4SA 3OXGA 1SVMA 3TDNA 2OBYA 4ZZ0A 3DZFA 4BKQA 2VRNA 4WDRA 3IL2A 2NMVA 3DOKB 4ZPTR 2YKOA 4OYZA 1L5HB 1W0KA 2ZATA 4TSKA 4POOA 3DMJA 2FQQA 4MA0A 3D3NA 5CCMA 4LOJA 1F20A 2OBLA 2QTAA 4XWKA 1YQDA 3I4CA 3BG5A 1MVLA 2EI5A 3JD4A 1SKMA 1ZK2A 4YACA 4EPTA 2CJWB 2B51A 5TPWB 4C0OC 1T02A 2DITA 2WUFA 5IDYA 5AVSA 2BFEA 4A8KA 4UUPA 3RC7A 4WERA 1XGKA 3H84A 1ZXBA 2A0KA 4ZKDA 2Z04A 4DMGA 1VA5A 3TLGA 2CPDA 5EMNA 4FFMA 4YMUA 4X64F 3W5DA 4V0ME 3IJRA 3QHQA 1HO3A 4Q4JB 4DAOA 4HGZA 3L7MA 1DI0A 5EJ8A 1R4MA 1O87A 1B8PA 4TSFD 1H38A 1FRXA 3PPWA 1C1DB 2XG8A 4GSYA 2HSWA 5GAGI 2MZJA 1GU7A 3KK1B 4K0KB 2XJ9A 4DJEC 1UK8A 1HGXA 5E2BA 4F3RA 3QBTA 1H4TA 4PAMA 1WIWA 3QHPA 4DR2J 2CC2A 1MG5A 3GAZA 4X64B 5KFHA 2VJCA 1EUDB 5BN4A 2GIQA 2IYAA 5TARA 1MJHA 1DQ8A 4IF4A 3UCGA 2AEFA 3A6GA 3GEIA 1UFOA 4OHWA 3KOWA 4DL9A 4EA9A 1NU4A 4XKJA 2OB1A 3BZBA 4AZVA 2QL7A 5FOUA 2XBLA 2JX2A 1MA3A 1N1EA 4WAUA 4LOLA 1V0JA 2QRNA 3CBQA 4JP5A 3THPA 2XY5A 3MMPA 1NJFA 2IYFA 1ULAA 1QVZA 1DOHA 3RARA 4IRDA 1XD8A 1C8KA 1TELA 2W5UA 1JDTA 4EI9A 1W76A 3MSXA 5B2EA 4IOKA 2X4DA 3E2MA 3ESXA 2I76A 4E8UA 4XYLA 2RGRA 3MM7A 4DEXA 3T19A 2VR1A 3W4KA 3C7AA 3DLJA 4DM4A 5EZ6B 1CVIA 4HR2A 2H4XA 3IBTA 5JJ5A 4P2MA 5D8HB 2B7CA 1O94A 2WE8A 2Z8XA 3A1TA 2VAWA 1HLDA 4PN3A 4MR9B 1KI6A 3BO4A 2LPMA 1K0VA 4JI4F 3WLEA 3FBFA 1X9WA 1OZAA 4TV9A 3ZY2A 2EYUA 4JC4A 4WINA 4GVBA 4FE3A 3N6VA 3ER8A 1RE1B 1ULUA 2HH9A 1T6YA 5LMNF 1OQ6A 3HP4A 1P4GA 3PJRA 3IALA 1SUBA 4E08A 4JI2F 3QRRA 2B78A 1YRWA 1VIDA 1RQPA 2FE4A 1B3BA 1NVVQ 2F1HA 1L4EA 5A2QA 4JVNA 5IFMA 3ADDA 2DJ5A 4TZ6A 3S40A 3AG6A 4PHGA 4D3DA 4KVGA 4YB7A 2FKAA 2X3UA 2X9GA 2XLJA 2FJBB 1FW6A 4DL5A 4JI4B 2HO5A 1RTZA 3M2UA 7ABPA 4F4DA 2GJ4A 1YKSA 2OHJA 1OIXA 1Z4OA 4UBIA 1RT3A 2W58A 4Z9YA 1A9XB 5JAIA 2PJRA 3S8MA 3MPDA 4NZPA 1W5BA 2YN2A 4X60A 3WLLA 1DKUA 2IS2A 3NHSA 1H1TA 3T7CA 2DNNA 3D6NB 1NIJA 3GEPA 2A0YA 4BTEA 1QKIA 2QVBA 3AUTA 1ETUA 4PZ9A 2RHJA 4USMA 2X9NA 1T1RA 1W36B 1G8KA 1YKGA 2WHOA 3NIWA 4JI8B 2ZUGA 1UP6A 2FUNB 1Q21A 3D68A 1T2NA 4UQPA 2H92A 4OJYA 2J09A 2IVMA 3CF0A 1C1HA 3BFPA 1XNRF 3EAGA 1NMSA 4FMBB 5GJCA 2PBFA 4UFPA 3UGQA 4XJSA 2IRWA 2CXOA 4B48A 4ZT3A 3N01A 1RQGA 3M1LA 2GD2A 1YK9A 4MGKR 1ZGZA 4J49A 4F3CA 4EMBA 2A4KA 2PUTA 4LJ8A 1Q1EA 2HPZA 4C0WA 4HRAA 2WZQA 4NLPA 5J2NB 2HRZA 4WBNF 3AL3A 3U3RA 3OTEA 2CPIA 2BE7A 1YRLA 1RWNB 1WMSA 5K0JA 5DCYA 4Q7EA 4X41A 3QEMA 3C5VA 2BYTA 1U1QA 1TXGA 3MOGA 1YIOA 3BGSA 1IOVA 3DOKA 1JLCA 5ELXA 5KFPA 4IVPA 5I7FA 2HIQA 2O4CA 5AUPB 3C3KA 1A5TA 4U5QA 3I1FA 1CLUA 4W6ZA 3BMNB 1XMJA 4LF9J 1TD9A 3EEIA 5FPTA 1K88A 2IXFA 3NYQA 3GAFA 2R62A 4P22A 2X76A 3Q8SB 1U3GA 2H1SA 5TPWA 5CDSA 5JDCA 1U8TA 2G9RA 3I28A 2E1MC 5TT0A 1JIHA 2XWJI 3UAZA 4V0KA 1IBMJ 3LWMA 3S4YA 3GC6A 1E6EA 4A23A 2IYEA 3IWLA 3H59A 4N5SA 4ELVA 3NI2A 3PG5A 4CKBB 2DPYA 2XVYA 5DYNA 5DHQA 4ZOCA 3P49B 1Z4LA 3HG7A 4Q4JA 4KE5A 1KR2A 2X1BA 1CR1A 4F3OA 2DHXA 4PZ0A 3D4IA 4YHBA 1JDJA 2H7YA 2JATA 4W7HA 1OU0A 4K88A 4JMLA 2HLNA 3GWZA 3IT0A 3F8TA 5K2OA 3DRXA 3CCES 1KXZA 2OCYC 5EZ5A 4INJA 1JR4A 2ZBDA 2W2PP 2VJLA 3KK1A 4JJFA 2EYQA 2DJWA 2W6IA 1N2SA 4JXJA 2C7RA 4DR7B 4B0OA 5LZ9A 4OXQA 1WV1A 3ND5A 2BVNA 4X00A 1HWKA 1EUDA 1U3WA 4RTPA 3K0KA 4YRTA 2SKCA 2ZWIA 3LT1A 2VYND 2XUGA 3QWAA 4AJ1A 4HYYA 2OUKA 3R5FA 3OQMA 3TFWA 2XB2D 3SQLA 2VHVA 2XQGA 2W6MA 4FYJA 1A8UA 4ZAWA 1E6YB 3GJZA 5EZYF 2E48A 3PEHA 1CVJA 5E4YA 1CLFA 3PIOQ 2JZ5A 3K8OE 3SOPA 2VG5B 2JBHA 5CM2Z 6Q21A 1OA1A 2J6CA 3DHWC 3VV3A 4Y6SA 5M3BA 4DX8H 2AW3A 2B4PA 2C57A 1CEZA 3ENAA 5ALIA 1RLDA 4F4WA 1AQLA 2V8VA 5J5VA 5A7HA 1RKIA 2J6TA 3FH0A 1NG1A 3SJBA 3GG0A 5FUXA 4ZTBA 4GG1A 1TU0B 4GPTA 1GCGA 2XWSA 1Z0FA 4MUJA 2WMNB 1PAUB 4QRIA 3Q3VA 2JCBA 3QYFA 4CKEB 1VLQA 3QE9Y 4MR9A 4G1VA 2RAPA 1U4BA 3I9V9 2J1LA 2H29A 4YYEA 3MUTP 3GZJA 2FKNA 2VFTA 1G8PA 1ODFA 2ZIEA 2Y1JA 1OFHA 2I6XA 3BQMB 3T38A 3ZWVA 4IH7A 4WXYB 2PEBA 1D0IA 3MWGA 5JNWA 4ZICA 3REQB 2HHLA 3TMYA 2IUUA 2UYCA 2WIKA 2UYYA 2V50A 4QYMA 2PCLA 4O2BF 5FBWB 4MGHA 3GPLA 2G71A 4F1JA 2GVDB 2HHHF 1SKUB 4YV0A 4DXLA 1ZD3A 4OYPA 2NUBA 4FU0A 1EUCB 1HQCA 2GQ0A 4PQGA 5CYGA 3IVGA 3D2CA 4K4ZA 1XB2A 3H5IA 5A6SB 4RTNA 1MOZA 3EY9A 3Q2IA 1KIAA 3AM5A 3CRQA 2QMWA 3UV7A 1WXFA 3VU3A 1P6UA 3MGAA 5J59A 1E2LA 1VMDA 3POTB 2ADCA 3WGUA 4JLUA 2AJCA 5FLKA 2VJDA 1CPYA 4UXIA 2BOPA 1C8BA 4JI1J 3EPRA 2BLNA 2DLDA 2ZTMA 1QIJA 2G1PA 2W70A 3B78A 3UFBA 1KEVA 4XAKA 3QI7A 3SXUB 1XNJA 2CNWA 4ECVA 5J1SB 3RB0A 4E2YA 5I7RA 2K3KA 1B23P 1N75A 1CJKB 4CVNA 3MQFA 4OHVA 5JRZA 4M2LA 2NSLA 4E15A 3HLUA 1XKLA 1E2PA 3NG8A 2VJBA 2HDOA 4WL0A 5GM1A 2MY7A 3RGWS 5J2NA 4FFRA 3Q85A 3FRHA 3D2BA 3R5KA 1KJWA 3P5BA 1TB4A 4A8FA 3DKPA 2HLTA 3HJFA 1U4OA 1CZUA 2JLEA 2JIPA 1RWNA 4AO7A 2ZWMA 2VSNA 3ULHA 4X71A 2V4ZA 2ZKLA 3G9QA 1OE0A 4LFAB 2NGRA 4CTMA 1BH6A 2FJVA 2BSXA 2QM8A 4LRUA 3P2IA 3LUFA 3QPIA 4LAFA 2XCTB 1N33F 2O5CA 1ECPA 3BMNA 3QPDA 2X9LA 1NRXA 1R5JA 4WBNA 2QRMA 1CR0A 3RD5A 3NV9A 2ZB3A 1TE2A 3ACCA 3NLLA 4EVQA 5BXYA 5LC1A 3W6NA 1DQPA 4ED1A 3LX8A 1LFAA 1Z16A 3OC0A 1DAPA 4FSHA 1KEPA 1QFZA 2WJGA 4BUZA 3H05A 4ASUA 1QG4A 4CKBA 4JK3A 3M4JA 5DTQA 2HQIA 3S99A 4DM3A 4ITSA 1ZSYA 1N33B 1NBOA 3AB7A 1J8DA 4OMUA 3TZCA 1ZM4A 4LJ6A 1IQTA 3RC8A 4FZ5A 2Y1RI 1ROFA 4DEYA 2X8WA 2ZFUA 5ADUS 3V1KA 1EJ6A 1RT5B 1NF3A 4CIAA 3MG9A 4H0FA 2WSYB 4BHTA 1KGDA 2PS3A 2QUIA 1PBAA 2F8HA 1FNBA 2PO7A 4EYQA 4F06A 3TKYA 2X5NA 3VVCA 1DX9A 3STTA 2PJDA 1E2BA 1WELA 2ECOA 4MKRA 3SV3A 2D0OB 3NPAA 4IG9A 2HL6A 2WSSA 5J2PB 2BQRA 4BU0A 2PX2A 1GFWB 4L50A 4OFZA 2BJ3A 1TYZA 4E6PA 4RJKA 2ZPTX 4L2IA 4RIFA 2HU2A 3GFGA 4LRXA 4NYMQ 1E1KA 4MGEA 3DDWA 4BP3A 4HG2A 1E6YA 5JNVA 2UVPB 4IGKA 2ANBA 2MTBA 1S1VB 2GS9A 3S70A 2YZ7A 5JI2E 1JH8A 1WTCA 1E98A 1OGJA 5LBTA 3LPMA 5AJXA 4A2WA 3BGWA 5H81A 5EXTA 1PWEA 3H4BA 4IY1A 2MINB 2AIRB 5FD8A 4DLTA 3WBKA 3RSSA 4PYOA 1SXGA 4PXBA 5CIYA 1E0AA 1FJHA 5L8VA 5IVDA 1K3TA 5GV8A 4ND5A 1TU0A 3OFJA 5EZYA 3PDIB 1PAUA 1IVZA 1AOXA 4O3PA 5KOHB 4L6IA 5HKAA 1FE0A 5FBVB 2RDDA 3I9V6 3GYNA 4TYPA 3ZDZB 3QXSA 2PYDA 1J1IA 3UANA 3KOOA 1LFPA 3GWGA 4ENRA 2YWJA 1A4XA 4AG5A 3B85A 2OOKA 3K1ZA 3L8CA 1ZS6A 2EX0A 2RVJA 2LFVA 2FPMA 3SU8A 2ZB7A 1OJLA 3WHPA 4D92A 1E9DA 1HNNA 2OBNA 3R3TA 3LPCA 1X13A 3CULA 4X91A 3V8MA 2JRSA 4OSEA 4DV1J 3REQA 4F2DA 3NYWA 4HYKA 2QX8A 2P6OA 1WUKS 1KERA 1T10A 2X5OA 1RTIB 2GYVA 2RGBA 1MX5A 5G0SA 5CG2A 1ZZNA 5KAMA 1XMIA 5FHQA 3JWJA 3PWTA 4MV4A 2JLWA 1K06A 3EYWA 1U0BB 1OPIA 3O7MA 2Z8YM 5B7GA 3PGA1 4GD3Q 1MMFB 3VZIA 4Z9FA 1WHWA 1LLCA 3WSTA 2GVDA 2E4ZA 4DOZA 1SKUA 2TSYB 5K6TA 4QG7A 4FMPA 2QNIA 2OAEA 2ZNYA 4YHHF 4PIMA 1Y34E 4EBFA 3O1LA 2JL9A 3DYBA 1L7BA 5A6SA 3PEFA 1X9HA 2WJVA 3PXGA 3V4OA 3G86A 5B1DA 1Y1LA 3CG0A 3L7PA 2VF4X 3GRCA 4KPCA 1D6SA 1JXQA 3M7IA 4ALIA 3BM5A 1Y3CE 2YASA 2B6NA 2O8VA 4J0CA 3TJMA 3AY0A 2FHJA 2BH9A 4JR1A 5K8NA 3GJ0A 5EE9A 3HJAA 4EFAC 1C0TB 4Q7AA 4BAUA 3OQ6A 1ZL2A 1QK5A 4AFFA 2QVXX 4YHHB 2H2DA 1SXPA 1RXWA 1Q7CA 1T36A 1YZ7A 2JLXA 4IZIA 3QZ7A 3SXUA 1GPWB 3JARB 4R2HA 5ALJA 5LZ7A 4O5OA 1P1TA 2G70A 1VPTA 1ISMA 2CXEA 2MLYA 1TKDA 4MHTA 1SC1B 1CJKA 4M1QA 4RFVA 2F7VA 4OQZA 1OA0A 2Q66A 3DEYX 4RHXA 4DS4A 3DOHA 4HQFA 1WKVA 5KQSA 1OSDA 3ZUGA 1TVRB 5CK5A 4RDXA 1DAIA 2HJRA 4RZHA 2COUA 3VYVA 1BVYF 2E9ZA 1CRPA 4I3FA 1TUBB 6AT1B 3L7YA 4GRDA 2PKWA 3G2QA 3IBYA 4XARA 2Z2MA 3UC5A 2HRYA 3PQ7A 4D7AA 4GKVA 4P93A 1NASA 3DQZA 4B2PA 3OT1A 2RGEA 4ZVRB 2VPIA 4O3RA 3OO0A 2WD9A 4CM0A 2BGTA 4E3WA 3FMVA 2FTRA 4ILLA 2HIYA 1Z7GA 2EKNA 3EMTA 3BPSA 4UTZA 3ADPA 4Q3KA 2VIHA 1KO7A 3HXTA 1SCJB 2H6EA 1IUKA 2ACEA 3EUEA 4EG4A 1YZKA 1G55A 3VJRA 5J47A 2IEZA 1ZGGA 1RSCA 1KDZA 1AC5A 3NXKA 3TI7A 1T26A 2I2BA 2CLDX 5NLLA 4G1UC 3FTEA 1AKEA 3CUYA 2WQZA 3TTXA 3FTQA 5BYSA 1U2GC 2WTAA 4ZPJA 1YVFA 5FAXA 5CH5A 4D4IA 1RT5A 2WMYA 3QM1A 2O2ZA 5ETOA 4GPD1 1HYSB 3F46A 1P5RA 2EGGA 4Q8FA 3NW9A 1TQDA 2H7XA 2QG4A 3G88A 3GD7A 1TVMA 3BMXA 4O2AB 1P9LA 4OM8A 2ZRHA 3K5NA 4E6EA 1EZ4A 2DPJA 1Q12A 2LQ8A 4HR7A 4P74A 4Y2XA 3G89A 2WWYA 4ZMMA 4TSFA 1GFWA 5I7SA 3SDSA 2V0NA 2Y2UA 2CB0A 4HDHA 4DN9A 4PZDA 2DBRA 1W0KD 2WOMB 4LBVA 1CULB 2V9PA 4D46A 3R7SB 4E32A 3K5MA 1NCLA 4J37A 1FJXA 2VB6A 1JR6A 4WFQA 5GQSA 4AW9A 3OTGA 3ICLA 1ODIA 5MHTA 2N46A 2OZLB 2UVPA 4LDQA 4EGJA 3SQOP 5HL7Q 1SJQA 4X6XA 4OGWA 4MV6A 1IUNA 2Z8YA 5FTLA 3GZ7A 1PG0A 4Z3DA 4AULA 1ZONA 3NP5A 2BLLA 4JJ8A 2X6RA 3A3OB 1UBFA 2MHNA 1HG1A 4LQCA 2JLFA 5T41A 1FD8A 1D0SA 2Q4BA 3W2VA 4FNHA 1VCNA 5J40A 2MINA 1CB0A 2WCXA 1MROB 3I1IA 3LWZA 1CS4B 2X1AA 2UDPA 1UM9B 1TK9A 1X8XA 1XTQA 1D1PA 2NTVA 1JBEA 5FA6A 1NYRA 4CLXA 3ANXA 4YI5A 2HVHA 2AVNA 5GADI 4RV5A 4IP0A 1YT5A 2CNKB 2P91A 2ZCVA 3DZHA 2GJFA 4KGMA 1F2UB 1SC6A 3E27A 1T1EA 4BCDA 1Q0RA 3DLBA 1L4NA 2BKAA 3PLRA 2DNPA 5DBOA 1C4KA 3D5EA 4ZI3A 2QTRA 3I2GA 2NAFA 3NWEA 4ND7A 3ZU6A 4KGZB 1TC2A 4RPHA 4I19A 5JS8A 1RTIA 4PWUA 4KO3S 2J4FA 2POKA 3ITNA 4ZVGA 5AW9A 3IUQA 3ET5A 1D3AA 1VOMA 3PENA 4TMTA 4DPUA 3SSSA 5SYMA 4DZZA 4RMHA 3VYRB 3I9LA 4LHYA 5DNWA 2AV6A 1VZ3A 4M22A 4MDHA 2IRXA 2IPMA 4LI0A 2OBMA 1V95A 1IAVA 3MGGA 1OTHA 3P0HA 3B8HA 4IPTA 4YREA 1W25A 3E9DA 1FESA 5I9MA 2OXFA 3EZXA 4OCZA 1MZVA 3TQEA 1KC8T 5DYGA 2ZPUA 4UEKA 4D0GA 5IU6A 2VBYA 3PG9A 5D4OA 3TLCA 4XIFA 4NLVA 2AOUB 1T35A 4MQUA 3KSMA 3BSOA 4H4CA 3MECB 2ZQ5A 2IV3A 4LXQA 5MFZA 2MR6A 1XRRA 4GT1A 2VRWA 5FWXB 1C0TA 1U7UA 4AZSA 5BSHA 1WP9A 3UCUP 1YRAA 1Y8CA 3ZK7A 3PEJA 3MMCB 5A5EA 2VKTA 4E0BA 3WGNA 3IVAA 2PFGA 3ZC3A 3HVRA 1SBTA 3OW2R 4NS4A 3JARA 3OX1A 4BX2A 2AI3A 3QKIA 5CH7B 5AOVA 1YJTA 1H3NA 3K05A 2OV3A 4PPDA 1NVFA 4HNVA 3QPWA 4BFVA 3K5PA 2GCPA 4DC0A 2DFVA 4O0NA 3G59A 4OHPA 4IH9A 4DQDA 4H7FA 1S8NA 1PCXA 2VUIB 2B1IA 4RXMA 1YZTA 1TVRA 2GQQA 3K9HA 4US2R 1WC6A 3HXQA 3UJDA 3FROA 4BGEA 4JV2A 1TUBA 6AT1A 5JBIA 1NKTA 3ENZA 1NFRA 4YR7A 2HVDA 1NN5A 5DGAA 3PF9A 5DM60 2DYAA 2YC4C 2CYBA 3ADKA 3CIFA 2H11A 4PXCA 3TW4A 1G1AA 4ZVRA 2QFIA 5F0UA 1GX5A 5HFNA 4YEAA 2GPNA 2PL5A 4IRMA 3V55A 4TLQA 4OYAA 2IU3A 2JVIA 3QXGA 4O23A 4OGKA 3HY6A 2Q1YA 4YLYA 4LSMA 1BC5A 1LRJA 3DI6B 3H5LA 3SSOA 1N32J 5CVTA 4RPGA 4HLDA 2O8CB 1U98A 2PGIA 2VDPB 2HF7A 1WEHA 4DTIA 4J4TA 3F6PA 4D6PA 2HBRB 4PC6A 4W98A 1W9MA 3EARA 4YRRA 3CJ8A 2EJVA 2AMYA 2Y1FA 3DDNA 3ZHUA 2POCA 4RLHA 5BQFA 2BJ9A 4KE6A 2C5FA 4CH7A 1H2XA 3BM7A 2SECE 1E0JA 3AUXA 2UVUA 1NAQA 1JA1A 4NMWA 3V1UA 4N56A 1ODLA 3FZNA 3G0DA 2EDAA 3DE1X 4F84A 1Q6YA 1EP4B 3EZ5A 1HYSA 4ZRMA 1CRZA 3RHTA 5IBPA 2BE7D 3UMRA 5CLJA 2DGQA 3ZDQA 5KQRA 4O2AA 1RHKB 3GJ7A 3W5JA 3K1TA 4LXYA 4RU9A 1Q4RA 2O05A 4MYSA 1T9DA 3H4TA 1N4LA 3TAQA 5D78A 2B3DA 2ZYSA 4DT1B 4OI3A 3DOCA 4D8XA 2WOMA 3BGRB 3CD0A 4R2LA 1CULA 2BGKA 3R7SA 4K9QA 3TL6A 4JYAF 2UZ0A 2C9DA 1EPUA 3M1IA 2PH1A 2BANA 2OZLA 4IYQA 1QSGA 2OCIA 2QW0X 2ZOFA 1LFDB 4KYVA 1AYEA 2NR0A 1OF1A 4ZA1A 3LQKA 3QJGA 1EGHA 1KTIA 2AI2A 3TGLA 3K0AA 4QASA 4X8MA 2VYNA 1KTQA 3A3OA 3URMA 5GONB 1YWXA 3PHCA 1M0EA 2XB2A 2VN8A 1RYHA 4UATA 4OU5A 3J7YI 1GCOA 2O50A 4G0OA 4TQGA 5EUHA 1MROA 4AJ9A 4R1QA 5CDFE 3L92A 1UM9A 4EMTA 1PS0A 2F43B 1R66A 2I34A 2LCFA 3LFTA 1CQIA 4BKUA 4JYAB 1BQXA 2QROA 3GFBA 3ZS9A 3RAEC 4BNJA 2CNKA 3OJUA 4PRYA 1Y6FA 4LZZA 1QPZA 1BWVA 3F6EX 4N3GA 4Q9HA 4QXPA 2CVEA 3OECA 4DSKA 2LDXA 1KK3A 3LECA 4KN5A 1IXSB 3FPHA 9LDBA 2W6ID 2QUKA 1WTFA 4GE0A 2JNJA 5EE3A 4G9GA 4PO1A 5E7MA 4F0KA 1SZCA 4JV0A 4OP3A 2DTXA 3UCXA 2JHAA 4I46A 1M5SA 4M0KA 3ENVA 5JMTA 4KGZA 1HMYA 2G5PA 1C7JA 1G4AE 2HMVA 1PCAA 2BQUA 4UUBA 4J3NA 3PUKA 4OM7A 2ABWA 2QWXA 2I1LA 4IMRA 3LPEA 3GCWA 3H1BA 1X15A 3A13A 1C0KA 3CQ9A 1VKZA 4NI2A 2CL7X 3G5TA 3LSYA 1Z25A 1I9GA 5M29A 1PFQA 4Z54A 3HXPA 3LX6A 5DZSA 2GA9A 4CZCA 4UXHA 1QHSA 4FIDA 4H18A 1Y3FE 4RWWA 5IAKA 5FD1A 3N2LA 4YPOA 3MMBB 1NP7A 3D5TA 3GDFA 2LKZA 4TN5A 3EOBI 4K5SA 1T7PA 1KK0A 1NXXA 5M2RA 4QGSA 4MMOA 2SKEA 4CTKA 3K09C 1XMBA 1E5LA 1V1MA 1NMXA 3D4NA 2AOUA 1UZMA 4JI7B 3DCNA 3BTOA 4ZYVA 3ZVKA 4Q6WA 2WTNA 2OC9A 3II6X 2Y6UA 1OUMA 1EWVA 4MRMB 3HR7A 2GOYA 2J07A 5KFJA 5E3RA 1KZYC 4OAOA 1WXQA 1N5MA 4UQOA 2C8KA 3CF2A 3LLUA 4AG3A 5AJYA 8AT1B 3R0QA 3ZVNA 2JAHA 2P3SA 2G0IA 2YDXA 4L4XA 1ITZA 1XK7A 2Q2QA 1UEVA 3AC0A 1AQIA 5AH0A 1ZOLA 4UY8T 1YONA 1I51B 2QN8A 2C0CA 3CX4A 3TPZA 1RAJA 3MTQA 3FPGA 3DS8A 4PPQA 3RVLA 1Z56C 3I01M 1CU1A 5K3DA 4PX2A 3TRJA 1QGAA 1XZPA 5IABA 2Z2LA 3L7DA 3UTCA 5EXPA 5CTAA 4G4SP 3L0YA 5CRIA 5B2FA 3AOBA 2CL5A 2X7HA 2B8JA 2CZ4A 3NM5A 2GTHA 4N0EA 1PV4A 3HU2A 4BVFA 4MYCA 3WBZA 2E9RX 2ZJ0A 3ZDRA 2JLVA 2HK8A 4J6FA 3D7NA 1E94E 5FNVF 5KHLB 4GXRA 3A3YA 3BK7A 2L41A 3J81A 3RC9A 3WLQA 1L1QA 3ONWA 3DI6A 1KYTA 1EFDN 1XAIA 3A6EA 5CA1F 1NQUA 1GZHB 2E1AA 1O6CA 5C32A 3GLIE 2GJ9A 1ZH0A 2HBRA 4KLNA 2N3LA 1APSA 4Y2SA 4HFMA 1GUYA 4BGIA 1OGYA 1I14A 3Q5EA 5EHIA 4JSRA 1NN3A 4Q3LA 2ZRLA 3H1PA 2J48A 1SBQA 1U0GA 2O5RA 5DBHX 3BJMA 1CUDA 2G9UA 4EZEA 1QGOA 2Q5QA 1VHFA 4A47A 1D6NA 1A8QA 1MTOA 3I6YA 1P6XA 5EIBD 3W04A 1EP4A 4AS3A 1TTQB 4TYMA 2AX3A 1QVRA 1FKPB 3FUYA 1YZNA 4C8OA 2XQFA 1W46A 1M72A 3T5KA 4BB5A 5KU7A 4LBPA 2ZI4A 4EG7A 1M5HA 4X4QA 1HM5A 2GA7A 1R6TA 1RHKA 5TIIA 3SYMA 1SRQA 3LX4A 1BCSA 2DTDA 2PMWB 3VGPA 1UA0A 1S8FA 4EUVA 1A5SB 3IXQA 3OSZA 4M0FA 4R8UB 4OA8A 2TYSB 4C3VA 1XZNA 4DT1A 2WHEA 3DE2X 5G41A 3B6BA 3BGRA 3B4MA 3WLFA 3HP1A 2YNIB 4BNWA 3RBZA 3L2OB 4EG5A 4QWEA 4U02A 2VH7A 3AKZA 2B34A 4UVEA 4E5NA 4RMGA 3BJYA 2R8XA 4NYJR 5EQTA 3NUQA 4C48A 1P1BA 2DNGA 4Z2YA 2PKQP 3WG9A 1E60A 3S2YA 5A3VA 2HFOA 4J0FA 1VRTA 3E18A 3VU0A 4PZPA 1EDBA 5GONA 4MWCA 2W6OA 1IG3A 4D0LB 3A0UA 3VR6D 1F60B 3STXA 3HA2A 5LKAA 1IZYA 5HBMB 1VJRA 4ASUD 3ED5A 3UWKA 4D96A 2OSQA 3AXMA 1U8YA 4Q3BA 2BKLA 2X6TA 1TUEA 2F43A 1F6DA 4XX0B 3CJQA 1GILA 3KR2A 4Y2CA 5KJFA 5HJYA 4WCDA 4XJTA 1GTHA 4KFCA 2A92A 4CTAB 1G3UA 5EIBC 3SNKA 4CNYA 4NC9A 3F9IA 4ZVSB 4K59A 2ZBVA 5F7JA 3RU0A 2G28A 4WWSA 4P31A 3R27A 2QYGA 5D86A 4LTDA 1ULSA 2BGIA 4O33A 2ACKA 2IHUA 3CUUA 1NB7A 3PX2A 1KQGB 1S0MA 4JNCA 4F4KA 1RTHB 3RRFA 4N5HX 1UXJA 3EPHA 3GQCA 3BL8A 3VNSA 2J6SA 4G4SO 2EFQA 3INYA 4QPNA 2QTMA 3R2CJ 2VP3A 2CF5A 5TGDA 1LV7A 3RS7A 5GMEA 2OCKA 4I5GA 4JIMA 2WWGA 4P3OA 5A4KA 5KOJB 2MSWA 2HAFA 5JVDF 4QQKA 2EFGA 4RK5A 4NTZA 1GZ4A 2CE7A 4GBMA 2PUAA 1VQMS 4F85A 1CC7A 4IFVB 1HUQA 2C3PA 2F4NA 5AW4A 4ENSA 4YAJA 1YF3A 4JEUA 1FK9B 4X66J 4B8WA 1NM2A 3ADBA 1WL8A 3ANSA 3QOFA 3RNLA 3WMGA 4TYBA 3PKJA 3HDGA 4QBFA 4C0QC 3E7XA 4HAWA 5KEIA 1WNEA 2Y1LB 4AP6A 3DBVO 3K0SA 1W29A 3TPFA 4IG3B 2NG1A 1G1XA 3PNYA 3T1TA 1J25A 1NVWQ 3ZXXA 1IPFA 3ER9A 2R0QC 1P1RA 3MMBA 2PXHA 2NPIA 5CIWA 3RYLA 2SKDA 1BOOA 5JVDB 4B6FA 2BTQA 4BIMA 3M82A 1Q77A 3YASA 5LQAA 2BGMA 5C81A 2X3FA 3IUEA 1QH1A 4V03A 2M70A 4TV9F 3H5RA 4B3MB 4LRSB 2HGZA 5D6NA 3KOMA 2B43A 2YNHA 1I2CA 3AVPA 1K5HA 2Z5LA 1M75A 4C3UA 3GI1A 1EJ7L 2YYZA 4K4UA 1NHKL 8AT1A 4WOJA 4ZDJA 4NRDA 1AUOA 1VIAA 1KJNA 2B98A 4XOUA 2NO4A 1I51A 1Z7YA 2IS4A 3PSHA 3NR2A 1XRMA 1QTRA 3L40A 4KC0A 1N36B 2CLSA 4E22A 5LZ5A 4J7CA 4P92A 3H5SA 2C4VA 2QTLA 4TU7A 2E6UX 4BZZA 1T0PA 4LFCJ 4N5MA 3NTQA 2MQOA 4Q12A 1ONBA 1RYRA 3CVKA 3KWFA 5I51A 2BCGY 4RJJA 3IMQJ 3Q23A 3VALA 2J4DA 3L77A 5F52A 5KPJA 1GTVA 2V98A 2JKVA 3GHYA 2PKQO 2DETA 1S3IA 4ZVPB 4FFBB 3AVWA 3A1VA 4CWBA 5KBYA 3KJZA 5J4VA 2AXQA 4EK2A 3IRXB 4H1UA 4FFSA 5LNK1 2W42A 2ZH3A 1QGED 4RTRA 3UOGA 1R27B 1DC7A 4I2NA 3TRDA 2Z57B 5M04A 3OPVA 3NHBA 3DULA 1A95A 5AJ3J 1CZNA 4MEJA 3WHKA 3KHRA 1B1AA 2W22A 2VPPA 1X4FA 1OBCA 2MKHA 1MAUA 4YCLA 1PUIA 3P9QA 3EGDB 5FPPA 2DKOA 4YS2A 2B0JA 3HBMA 2OD6A 2DYKA 3WHLA 4P2BA 4MRVA 3TYTA 5HKOA 5EYPB 4P36A 4NBKA 1UWAA 1Q7GA 3QV2A 5DASA 4AK9A 4ZVLA 2L9DA 4LJ4A 5CA1A 3S0JA 1X3LA 3HB4X 3QWPA 3A6JA 3RZAA 1EX8A 4C0AC 1L5ZA 3IA7A 3RAXA 1FKPA 5C31A 2DJIA 1WV0A 5CJPA 4QYWA 5FO0A 2Y9MB 2XY4A 3WDLA 1F6BA 2RIRA 3H2IA 1WWHA 4N54A 1JHAA 3DMNA 2A0XA 3ZCVA 2PMWA 3B6EA 3GPIA 4PIPA 4FX5A 1HE3A 1H42A 2BTOA 5I9SA 4R8UA 4PWDB 2AB0A 1XZDA 5SYAA 3D5QA 2CUYA 4ZEWA 2I2FA 2UXCB 2AT1B 1QP8A 2VP2A 2R9VA 4NECA 4BUJA 2WKSA 4EARA 1ZU4A 3AV3A 4J8PA 1N34J 2J6HA 1QAMA 4HEQA 1EVZA 5HJEA 3T54A 4JOUA 4WV3A 3PQ6A 4N3AA 1XRLA 1B74A 5E1OA 1TKAA 5F33A 3IESA 4BBAA 1G5RA 5ICSA 5FLXY 4O4IB 2HZ7A 4OYWA 4UF4A 2GC8A 1EP9A 3F7OA 5FI5A 2IKSA 4PXYA 1F60A 3U3DA 2P11A 3K6JA 1SB9A 5HBMA 3TH5A 4WXOA 3E58A 2N42A 1J1UA 1L7EA 4RJLA 4EUEA 4BPRA 1CJKC 2O0MA 1YO6A 2V9ZA 4UU0A 5FQOA 3VPCA 1X7VA 3L18A 5EFZA 5HIKA 1PDOA 3R20A 2NXWA 1FDIA 4RADA 4Y9DA 2ONJA 4CTAA 2J3LA 2ZR7A 1N54B 3E9CA 1N2JA 4M8SA 3GLFB 4ZVSA 4K0KF 4PZZA 3WMFA 1GRNA 1JZTA 3H2SA 1KZ4A 2KXFA 5C9ZA 4YDXA 4WLNA 1YQHA 3HCFA 2PLAA 1IVSA 4OG2A 2G2ZA 5IQ6A 1KQGA 1IJFB 2LYVA 2WZDA 2W4CA 3Q40A 1RTHA 4OHCA 3QIVA 4KGDA 3FZ2A 3ZIAD 4HUQB 4ETNA 2W7OA 5D4LA 2DPIA 2ZSBA 3PBKA 5JECA 4LGYA 2FNAA 1H0RA 3AI7A 4EFDA 2FJAB 4EA6A 3CJKB 5KOJA 1C4OA 5C1DA 1EXNA 2PFFB 1XDUA 4U7HA 1EWKA 1T9VA 4IFVA 2O14A 3D3EA 5EIXA 2KE5A 1FK9A 4A91A 2JKYA 3UIEA 1H1DA 1DAFA 2R8PA 1XF9A 4LXXA 3OCWA 3Q7SA 4K9RA 1I7SB 2H4FA 2Y1LA 1F51E 3NHKA 1B0UA 4IG3A 1U7HA 2OUIA 3ISZA 2IU0A 2E29A 2IF0A 1YE5A 1XZFA 1IEQA 2O2XA 4N7TA 1XA0A 2P4HX 1JK9B 4JU8A 3PF8A 1VJCA 2JCXA 5BPFA 4RHFA 2ZSIA 1HWIA 4GOOD 2VZLA 5JVDA 3LW7A 3CJ2A 2A0FB 5EIOA 3ZXYA 3U4IA 1NQAO 3OM1A 1FERA 5B6PA 5IAJA 1GXUA 4X1OA 2YW2A 1E3JA 4J9PA 4Y6PA 4U8VA 4F11A 1XMQJ 4A1FA 4ER0A 1K08A 1TA4A 2HHQA 3COPA 3JPWA 5C7IO 1N6KA 1HYGA 2F3JA 4LZNA 4WK3A 2ZW9A 3N8IA 1JLLA 3SFGA 4EGAA 5K09A 1G3RA 2P75A 4N7RA 3U7JA 2QR2A 3OL9A 1G2QA 3TTSA 2YOGA 3H9GA 2O3DA 5DDRC 4BTVA 3G8QA 5AFSA 2H1RA 1YKWA 2MQQA 1FLAA 2B3TA 1WD5A 1KYXA 2YN4A 2VASA 2FZVA 4S35A 3OXLA 3FN4A 2DUNA 5EWEA 1VHTA 4RVHA 3WTBA 1E5TA 2CWKA 4ILEA 3BCHA 2HRUA 2CMGA 4GLBA 3GE9A 2XPCA 4CLEA 4CM4B 4AKSA 4N1AA 2DHDA 4GF5A 3GLFE 1NQOA 2WRMA 1W52X 3U17A 5ILOA 2XGOA 3ED1A 4L51A 4MCJA 1IM2A 2X4IA 2G0CA 3A4TA 2MQMA 3ZZNA 2Q4TA 3NXSA 2CQCA 3SQGA 2BR0A 1S6UA 4FOSA 3PVXA 3D5MA 4JI8F 2B5WA 4B3JA 4ZVPA 4FFBA 4R9NA 2PSSA 3U7HB 5FUWA 1LC3A 1GCAA 2XMGA 3CCWA 1U1LA 3IRXA 4FWIB 4ZEOA 4ZK2A 1BROA 1V7CA 4MB0A 4BAZA 4WIAA 1CBUA 2J5BA 4V0MA 2JLCA 3R5JB 4OI6A 3QAUA 1J6UA 2CQDA 1NOJA 5B1YA 3N76A 2Z57A 4HUJA 4DVGA 2I7CA 1N0VC 1N3BA 5ER6A 2XGQA 4BU1A 3ZE9A 2PIAA 5KYVA 4BX9A 1P1LA 3LBIA 1YWGO 1W4CA 1Z2EA 1FD2A 5DBIA 3I52A 1YG0A 4AIRA 4PLYA 2Q2OA 1W8IA 3U0VA 4I9GA 3R3HA 3VI3B 1F2TB 2XRFA 9LDTA 3L8MA 3P20A 4CU5A 3QJYA 1TVKB 3P7MA 2GQ2A 3TIGA 2KJQA 3SF8B 2KU7A 1VLVA 1P2SA 2IA0A 1UT8A 3EZ7A 3MM5B 2YQZA 3KZVA 4HVZA 6NULA 3SZOA 3ZOZA 3GCDA 4O6VA 2EZ8A 2EFDB 3PV0A 1OZ0A 1O7JA 1KO1A 1XCGB 4EKEA 4PWDA 2W2TA 5FI0B 3MF5A 3ZZ1A 2QYOA 3A6HA 2FPWA 2AT1A 3QUQA 3PZBA 4D4JA 4WK1A 1FXDA 3IIJA 2ZXFA 1WKJA 3E05A 3F9RA 4DV7J 1MAVA 4DA4A 5AVQA 1MO3A 2DQ4A 4AQDA 5FA8A 3FZEA 1VRWA 1VL8A 2H08A 2C98A 3KTDA 1YE8A 2J3HA 1LVGA 4O4IA 2NZUG 1L5HA 3B5JA 4K3VA 5CFOA 1UJBA 5CLLA 2GLXA 2ACWA 2C58A 3GV7B 2AZ4A 4BB0A 4DCSA 3WQRA 3G0IA 3OLWA 1DX6A 3EWGA 3FSRA 2GFFA 3LDGA 2Z95A 3A1FA 1BSVA 2CJWA 5U1PA 1U2PA 3FDSA 4L75A 3DWIA 4TTPA 1ZI6A 4Q0MA 3QGIA 4OGGA 1CYEA 3EWAA 4DR7F 1AQUA 4BZPA 2XNSA 4LHSA 3BDAA 1Y82A 1XBTA 1L3KA 2Z2KA 1L5LA 4WH0A 5EUBA 1IJFA 4P7VA 2XCQA 1JEDA 1BRTA 3A3NB 4QATA 5A8RB 4QELA 1POXA 4HUQA 3OETA 3FCUB 3K09A 4MEAA 4M1EA 4GX5A 2KFYA 3PU6A 1UR5A 4MW4A 4HPXB 1C1DA 3CJKA 1WUTA 3MFQA 2MKKA 1BA3A 1PGQA 4Z4GA 1WG8A 1NZ8A 2DUWA 4FBLA 1XFDA 3P2EA 2HMAA 3KR1A 1JNRB 2R5WA 5K45A 5FFFA 3ORYA 1KKLA 4PABA 3DEAA 3SHFA 3OIWA 5IJ0B 3WIUA 5F73A 4B7CA 2OGTA 2H1FA 1P7WA 1UPFA 4NL4H 5DTRA 3HU1A 1RQXA 2Q8PA 3EK2A 2RGGA 2FVRA 1NDLA 3RTAA 1V7PC 2B94A 4IRCA 3M8QB 4YRIA 1AW0A 4EA7A 2F67A 3FKBA 4DC1A 3NORA 1V45E 1EA5A 2A0FA 4B3TB 1ID1A 2AK2A 3D7KA 4RSRA 4BQQA 3A4IA 5HA5A 2DUMA 5ARCA 4DL0C 4XCVA 4QM7A 4AJEA 2JS7A 1WOPA 2ZROA 3CN9A 2EWHA 3ZHBA 3IUPA 3U2QA 2IC3B 2VDMB 4YASA 3GVPA 3CS3A 4WK0B 1OXVA 1YJ9S 5LQJA 3UTDA 3X43A 3QU5A 1U8SA 4A48A 2EW9A 4KQHA 5AKEA 4OH1A 5C24B 3IAM9 4K6OA 2NXNA 1GAEO 1QAJA 3X1XA 1OXSC 3TANA 1QIKA 4LZPA 1CULC 4HH1A 3OPNA 3AUAA 3SC6A 3SZLA 3BCUA 1HX7A 3PT9A 2Q6OA 2M88A 2VZ9A 1TVEA 2MSNA 1PSDA 1YQWA 3NH6A 1RE1A 4MUKA 1A76A 2W2MP 4FYMA 4L57A 4CM4A 1VOTA 3IP9A 2RAFA 1K86A 4P7BA 5K4AA 3G23A 3H5XA 3TZQA 2GD6A 2XCSB 3IAS9 5K4HA 5HANA 3KSDO 5IC5A 3DLKB 1GA4A 4OKIA 1UEJA 1CS4C 2XQCA 1I9CA 5HMLA 4MFBB 2CDRB 2RAVA 3UAYA 1PL8A 4MKZA 2XTJP 2RKBA 1NMQA 1JRLA 1HETA 5FOTA 2RKIB 1XJCA 1ZSNA 4CO3A 3G2HA 5EUCA 4GSKA 1A9XA 2DZDA 3C7CB 2ZWVA 1C4XA 4C21A 5BMVB 2YY7A 3SIRA 3BR9A 1USWA 5KT7A 3WRXA 2QJ3A 3NBYC 2D59A 2LEBA 3IE2A 3D81A 3QF7A 2GZSA 3ND7A 5D6GA 3P9CA 1SIBE 3IRUA 1T4MA 1G6HA 4QJ3A 3R0VA 3H87A 1KFDA 4ZIVA 3AU9A 2VHUA 4HAVA 2EP8A 1P45A 1F2TA 3JSXA 2IM0A 3QXHA 3QVSA 3BGFA 2R7QA 2OAUA 1TVKA 2H7CA 1ISRA 2VI5A 3SF8A 3KPUA 5A71A 3K71B 5LXYA 4L72B 1RKQA 3EISA 4LFAF 3KUXA 3MM5A 2YIDA 1A7JA 2I99A 3KKOA 2WYVA 4ZYLA 3PX6A 4IR9A 1J0AA 2DCUB 4LXHA 3WGVA 3RAPR 3QT5A 3I34X 2WIBA 4XJVA 1NDUA 1LLDA 1LQ2A 1NR7A 3AF0A 3BE8A 3EXEB 5EKUA 1XU4A 3M6VA 3T5PA 4GC6A 3HB5X 4AJNA 1Q0NA 1ZAXA 5AVKA 3NHYA 3EMBA 2RHSB 4XH9B 1CRLA 1ZOIA 4ZYXA 2RMLA 3S6JA 5DW3A 1Z2ZA 3L0BA 4J03A 4E31A 2OHHA 1M2FA 4DA8A 4QG3A 1JKFA 1UF9A 4OIFA 3NVMB 2ZUFA 2CMFA 4EIWA 2J3DA 3H2GA 4AO8A 5JTUA 3AU8A 4LJRA 1QQ7A 2AYBA 5B53A 2D5BA 4JYCA 1SJ1A 2CBXA 3DU5A 1BFUA 3C8UA 5JATA 1INLA 4JKIA 1M73E 2D06A 3A1WA 5IANA 5H9WA 1RYZA 1MKYA 3ZY3A 3MLBA 3PIDA 1D1UA 1XVIA 4BBPA 4DCGA 4ENOA 3CVUA 5GZ6A 4G5RA 3GEMA 4MQEB 3BKXA 3PYXA 1K9MT 1MQAA 4I1IA 2J0WA 1P9RA 2OT3B 3AY6A 3EJWA 4K0RA 4PV7A 1T4BA 2RILA 2K2PA 4NARA 3SJUA 4HDSB 2OPHA 3VR6A 5H02A 1X86B 1BEEA 1YQUA 1SELA 3T9AA 3UVEA 4NRTA 1ZD2P 2V7WA 3A3NA 5A8RA 1A8PA 4UJ5A 4LCJA 2R4UA 4XDGA 4UBKA 4L73A 2G40A 3LUAA 1TUVA 1YZGA 3VNVA 2ZAGA 1E7YA 1XR3A 5CFLA 3KOAA 5FH9A 1CVLA 4EY4A 2CB9A 4NDZA 1NLZA 1XDGA 5DG8A 4J9RA 1NAIA 4ZIRB 2HBQB 3CX7A 4LWOA 3OSUA 4M7OA 5FNZA 2A1TS 2GK4A 2GFIA 4OQNA 1IBKJ 1F2HA 2HIAA 4BQOA 1HNZJ 3GGJA 1QLJA 3COJA 4LYAA 4AKHA 1GHTA 2DGDA 4HDQB 4TYNA 3MJDA 5FOXA 3PA6A 4NNJA 3CE8A 1QGZA 4OHFA 4F7DA 2WU0A 1B43A 4JUZA 5HO4A 2ZBQA 2OFWA 3P27A 2HZAA 3M8QA 2B1QA 3HO8A 4DREA 2CDAA 1DB3A 2VG5A 1SHLA 4U2DA 2IHTA 2C7QA 3W5UA 1I4DD 3Q9UA 5F21A 4AMZA 1KDNA 1ZZEA 5COQA 4XDCA 1P4JA 2IC3A 1TYEB 5LU8A 5ISMA 1IOLA 4ZDKA 5BWOA 2OH2A 1RCUA 3CEAA 4LHZA 3V2HA 4QOGA 4JOSA 1C9JA 3MUEA 2OP1A 2CJYB 4L0DA 3TNLA 1SUIA 3HU5A 3IAM6 2FVQA 1FYVA 3EXHB 3R7FA 5C24A 3D6HB 3RS9A 3WL6A 2MYPA 4G26A 5A5DA 2AKAB 2MXYA 4D0RA 5ALFA 2GK7A 4CKEA 2ILYA 1VG0B 3ZDAA 3P4XA 1GL3A 1TDJA 3JAMA 2PMBA 5DGCA 2D1SA 3NNAA 4K1LA 2AJTA 1MOSA 1EGQA 4G2TA 3HHNB 2OCPA 3UCEA 1XTUA 1FC0A 1TKZB 1V5IB 4DZRA 3ZNJ1 4ITRC 4JSYA 4CT8A 2EWMA 1SH0A 1QR6A 2IBKA 2K5UA 3IPAA 4I50B 3IURA 3H83A 3E4CA 3DLKA 1S1CA 4FUQA 2FDXA 3M32B 2ZS7A 1VLYA 4HVAA 1YR2A 4MFBA 2CDRA 1FRZA 5AM0A 3ZEIA 3OTOB 1Y0BA 4QT0A 3X1KA 3HO1A 4F2GA 4DR6J 3A9UA 1YK1A 4QVGA 2CPJA 3LBFA 3I5YA 1H2YA 4U2BA 2J31A 1M2WA 1B6GA 3GARA 2WJWA 2QVZX 1EUCA 2JHGA 2N4CA 2RQ4A 5BMVA 2V59A 2R68A 1Q5YA 4Q2MA 1DC6A 4ME6A 5JG7A 1KS2A 3TLBA 2WUVA 2FZGB 3C4QA 2ZR9A 5DV9A 4ZCPA 3CMQA 3UA4A 2AD1A 1YV9A 5FBZA 4ARCA 1D5CA 3ZWWA 2GDZA 3LVRE 5ALQA 3ONQA 3OV7A 4P71A 1QP7A 4IIDA 1YLXA 2ADBA 3POTA 1AD2A 2Y3IA 3KUHA 2NPFA 1C3VA 1U11A 3ABQB 4MRRA 3I96A 1NI3A 2GZDA 1AFIA 4BV8A 5H9EK 5DLEA 1HQUB 1NK9A 1Y9ZA 5H9VA 2PS9A 3B6KA 1G16A 1LV8A 5IVHA 5JCZA 3AB8A 3BB1A 5FTWA 5DOZA 4L72A 2WVEA 1C9DB 3FNGA 4K6CA 4QGBA 2PUGA 3G82B 4G24A 2FSSA 5BSEA 1R6VA 1OFUX 4PCQA 5AOAA 5G1NA 1ZCBA 2SICE 4RIHA 1JN0A 3K73O 2VA9A 2PGLA 3EXEA 3AHDA 2P4UA 4QXOA 4LE1A 5EMJA 3E5MA 3VZQA 2NUUG 4H0NA 1ZH5A 3QXCA 5F41A 3OF2A 3KJNB 4M8LA 1XZIA 3BGVA 3DKRA 1HT0A 3UK2A 3IV9A 1NDKA 3AHPA 4PZYA 3LMKA 4LRCA 2CLCX 4PBRA 2KVIA 3UAVA 2CLFB 4ZO4A 3DF9A 1O8CA 4KO0B 3ROMA 5E7JA 3CN7A 4U63A 4IMIB 2VYQA 5CYOA 3T3NA 4JCCA 2YVAA 1LLUA 4ZPCA 1J2JA 2X5JO 3T8YA 3VRHA 3SX0A 4O4GB 3DAGA 5GTDA 4XB6B 5EKTA 2HFVA 4RUBA 5K0GA 2QSWA 4FBMA 3DKDA 3KYJB 4MQEA 1NNI1 3HA5A 3TX6A 5D3ZA 4BBZA 1E2MA 1K8QA 1LVUA 5M2UA 1Q2XA 4JBXA 3SPXA 1SCIA 3ILYA 4B3FX 6ABPA 1GPNA 3M34A 4HDSA 3IA2A 5KFWA 2FOIA 4O2AF 3KG1A 2B0GA 4G1BA 3DRSB 4NA3A 1MP0A 4DPXA 4UARA 4G07A 1EK6A 1IYZA 1E3MA 1E1LA 1C4WA 2QY9A 5C2CA 3ZZOA 4FNOA 3SKVA 1EJ0A 3KZXA 3OWHA 3NBQA 2PAFA 1JILA 2XMCA 5BR8B 1MW8X 1KP3A 4FVCA 3FVQA 2F1FA 3IC5A 2KFNA 4H59A 4UXJA 4MYTA 4BRSA 1V6HA 3W64A 4ZIRA 2HBQA 2ZUBA 2IE8A 2XI2A 3B4DA 2F1OA 4CM2A 3R41A 1FMJA 2OLKA 5B5SA 2A6MA 3ZIAA 2DVIA 3ZCPA 1ZN8A 4D3ZA 5J2PA 1EKXA 5D15A 1DLJA 1I6MA 3QBDA 4Y1GA 4ZDNA 5J2QB 2EIXA 2XLIA 4AY2A 3VR6H 5BYBA 2DNRA 1EVQA 1QE0A 3HHKA 5ETLA 4JLSA 4B9TA 4NXNJ 2HPVA 3LQVA 1EB9A 3SM3A 1CUHA 1S1VA 3AOAA 4MMYB 1FRFS 4DDVA 3UENA 3D6AA 1RP7A 2ZCJA 3GH3A 3EDCA 1BVRA 3CF5Q 4N0QA 1WW8A 3IS9B 1FLDA 4OPMA 2AIRA 1AK2A 3PYDA 3PA8A 4KR2A 1IQUA 1GH8A 4LFBF 4FXWA 4FX2A 2PI5A 4M7WA 4IJQA 2Z2ZA 1P7PA 4KE7A 4MV7A 4OAPA 2CJYA 5JYBA 4W5QA 1LWFB 2FJXA 3V7YA 1SC3B 3EA4A 3BH0A 3PDIA 1V26A 4G9BA 4HNGA 3DLCA 3AIKA 5KOHA 1Y89A 1ZM2A 3JQGB 4OXRA 3PIPQ 3ZWMA 1T9UA 2CYAA 2ZYDA 2O9JA 4KRWA 1SVLA 1FQWA 4BNUA 4E09A 2M6SA 3A7EA 5HMZA 2QM0A 2RI6A 1TKZA 1V5IA 4DR4B 3K9CA 5BURA 2XUAA 3O4FA 3OZ7A 2B4YA 4CM8B 4ROTA 3R3WA 4LFBB 4NV0A 2UZAA 1XEWX 3UM9A 2NSYA 2DWCA 4GOXA 1O4WA 4ZYWA 3EQ7A 3JZAA 1X4CA 3DAPA 2CRLA 1FSPA 3NS5A 4RDCA 3FRJA 3AFGA 3GV0A 4A6DA 1MC1A 3EODA 4USKA 1A5AB 3DLHA 2VTBB 2QRGA 3QX8A 1RRGA 1OLXB 1RWOB 3KJIA 3OJ0A 2R3SA 1KNQA 1IE3A 1Z08A 3E5NA 1H6KX 2EQAA 2ZLBA 4D3GA 3MTBA 3LCMA 4RQBA 4HMQA 3UR3C 3HCBA 4V1CB 3WLJA 4RDHA 2VFVA 2FZGA 3LT2A 1OB2A 1FJEB 3H1FA 1TF7A 4UNPA 1P8AA 1VG8A 2QXTA 1KVKA 1HHSA 4J4HA 1KKHA 4ARBA 1AHHA 5CYJA 2TECE 3ZDFA 4Z0TA 1GKUB 1N5SA 3PUIA 1NA5A 3BDEA 1U7LA 5A03A 2FC9A 1HQUA 5F5XA 2RU3A 1JJVA 1XZEA 3IPXA 4KREA 3GGDA 3S1TA 1XDDA 4ZOAA 1TM2A 3M9OB 3NGTA 3R9WA 2NZ4A 1S8OA 2G9NA 4OP2A 3G82A 3LQFA 3K9GA 1SC1A 2P8SA 2WYWA 1LKZA 3S8EA 4UDNA 3B7GA 2RD2A 1P3DA 1R88A 5F1PA 1F0XA 4DIUA 1N6HA 1ZICA 5GM2A 2F4VB 1S6PB 2XA2A 5CJJA 4F7VA 4EZ6A 4XYMA 5AW5A 3HC7A 4EF4A 1RRFA 1EA7A 4B83A 2DQYA 4DLAA 3VZSA 4EOGA 3FCCA 1KOJA 4Z99A 4J7UA 4KOAA 3FMIA 2NYHA 3TI9A 1YI0A 2O0JA 3A8IA 2Q3FA 2C7PA 2YIVX 4KO0A 4ZP1A 3D8HA 1Q7LB 5H70A 2HF8A 4EFMA 1UZDA 2MJLA 3GBVA 1UXKA 3WGLA 3I9FA 3QVUA 4O4GA 2GCEA 1SFRA 2YIMA 2HS0A 2MDTA 1KO8A 3FYUC 4ZAZA 4XB2A 3KQNA 1D9ZA 1YNSA 3VNUA 4LOKA 2NU8B 4E46A 3ONVA 3E9ZA 1Z0JA 5K0TA 1W5AA 3IQZA 2UVVA 1PFVA 3HGQA 3TP2A 1F48A 1XDZA 4CDRA 1SCJA 3NBAA 5ALZA 1RZ3A 4R8MA 5IT0A 3H90A 2R65A 3T0FA 5ESXA 3FGPA 1Y9JA 4CU2A 3AR9A 4X7MA 3IO1A 1YE3A 3DRSA 5T3UA 4F12A 1KEZA 4B76A 3KLGB 3IKTA 4KXWA 3SHQA 3H0PA 3GRUA 3I2FA 3KZKA 2BEFA 2RKOA 4LIRA 1T9BA 4G1FA 5SZJA 4Q9DA 3ZTYA 2ZKUA 1KOGA 4F4YA 3VC1A 1OI3A 2GAOA 5CX1B 1UEKA 5CCLA 2NO0A 1FTCA 2CKWA 3H8VA 3F6RA 3EAQA 5GONF 2PZMA 3P52A 4I1RA 2ZJ8A 1QGYA 3IR6B 2HK9A 4HFRA 2GBGA 1Y1QA 4C7BA 2WKWA 4CN8A 5B7PA 5J2QA 4WI1A 1NSQA 1A9PA 4TT3D 5EIFA 3IE0A 4HWSA 3OLVA 1JU9A 1UJ2A 2NYRA 2GUGA 3GUVA 2HDWA 2NU9B 4UREA 4A46A 4A03A 3UZUA 3MRXA 4PNZA 4EHNA 4G5YA 4RM3A 3IP8A 2W25A 1HARA 4CQLB 3WIEA 3W1EA 1OI2A 2VC1A 4RNHA 1R0AB 3MB5A 3IS9A 4LXIA 4UNQA 3L8HA 1TYAE 4NI5A 1CBKA 1RGVA 3LS2A 1CS4A 5TPZA 4L3VA 4MQFB 2W9CB 3JSBA 4DX5A 4XD7D 2VXBA 1Z2LA 1Q11A 1EM8B 1SC3A 1TM5E 2PUVA 1Y9OA 1WCYA 3OJFA 1YI2S 2Y1CA 3PKIA 2R2TA 4YY3B 5IT5A 3HFRA 1F2UA 4NENB 3JQGA 3UMSA 1DRUA 4TKUB 1KDYA 1U8FO 1IFXA 4J3JA 3F6SA 1UFVA 2IZOA 2NQ8A 3JQQA 1VPWA 3QKRB 5DWQA 2HXGA 3DD1A 4CM8A 1KEUA 4HADA 2DAPA 2QZ9A 1WBBA 3GFHA 2BI7A 2BF4A 1K73T 3I6IA 3LAWA 2HO4A 4INZA 2ZYGA 5E9WA 1HHTP 4ZI2A 3WLSA 4JZKA 4QPZA 3GLIB 3F47A 5ER9A 1OGIA 4JI7F 1OXKB 3CVJA 2VTBA 4E88A 2F4FA 2PT6A 1OLXA 1ZBQA 3GFOA 3OZFA 3D6FB 1GPMA 2X23A 1Z2DA 1PG5B 4Q7LA 4QHYA 3A11A 1QOQB 5KFRA 3MWBA 1QAOA 3SHVA 3ST7A 5CQGA 5ILGA 1G60A 4I7FB 3AD9C 1W6UA 2B4OA 2ZUTA 4HBZA 2VH5R 1PF7E 5HVGA 4NU5A 3LWDA 4PWYA 4I66A 2FJWA 1W93A 2DCMA 3EA5A 3GJ4A 2QRVB 4TMFA 3E2EA 4JR2A 3HCRA 1LJLA 3U02A 2OILA 4WKGA 3C16C 3IVRA 2D8AA 3MECA 2YCLA 4LF4B 2G8LA 4DV3J 2ZDOA 2O06A 1YJ7A 3C46A 5FWXA 3BUSA 5AKLA 3G49A 2P0AA 4IO9Q 1ST3A 4CL8A 1YZUA 4U9IS 3MMCA 1PFGA 5SZHB 3A1DA 5GOTA 5AIBA 2Y6VA 4LSGA 2J32A 4ND3A 2G4VA 1TZJA 3TLEA 2W8KA 1IG0A 3MR5A 3ZD7A 5D4NA 1BX0A 4YECA 3NHRA 5GMOA 5T8KC 1AUVA 2G1JA 2VJYA 5HMXA 1AKQA 3KKLA 1KMHB 2DFKB 2GSWA 3BCRA 2R7UA 3GP5A 2CNBA 5AXDA 1VIMA 2WNSA 4OBEA 3ZIDA 1PQPA 1H73A 2ISSD 4XYGA 4QBTA 2ROQA 1JZQA 2X1FA 1ZU5A 1C7RA 3AUUA 2AF4C 5CDFA 1E3LA 1Q1ZA 1FDRA 2VVTA 1E92A 2JANA 2OFFA 3UQZA 3FR8A 5DP2A 3FLMA 2HR1A 4DL4A 4TWZA 4PYDA 2IZ0A 2JVJA 2DXFA 1QRDA 4DUGA 5ETMA 2C96A 4FDMA 3N1UA 3GBSA 1R0BA 3WY9A 1ECBA 4K40A 1GR1A 3VF0B 4MMXB 3CD6S 1G8SA 3ND6A 3C14B 3GFFA 5JPIA 3LP8A 1SHZA 4L0MA 2XQKA 5JT1A 1WSBA 2G9ZA 3E35A 3LLMA 1K1SA 3ZWQA 3T3IA 3PUVA 5LSAA 1CUUA 3EDQB 1PGJA 1PJLA 2NU8A 4HTAA 4RWXA 2X2OA 3IEIA 3EZUA 5AM4A 3NHPA 2Y68A 2O8CA 3C24A 5AKYA 2R3VA 4N5NA 5JXSA 1M2EA 1M1KT 5LQSA 2Z2JA 4FXDA 1SAYA 5K8TA 1M5OC 1VKNA 3HEBA 3AXSA 4KQGA 1N7GA 4N8EA 1VQLS 5CLIA 1CIJA 2AJDA 2ZSAA 4UZCA 4O4LB 4DR1F 3F7TA 3KLGA 1O5IA 3TXYA 5ES3A 2G1AA 1NK8A 3H9JA 3HKBB 4RY0A 3I30X 3N9UC 4R7TA 5D51S 4F2WA 4E5KA 3K4PA 4FWBA 3ZX5A 3S7TA 5TNXA 1TR0A 2KVQE 3N4WA 1WQ4A 3KSBC 2APOA 4MGIR 2I4TA 4WN9B 2IQIA 2FPLA 1PJQA 1DTEA 1X80B 4K6GA 3SXPA 4D9FA 2G17A 1KJYA 5F64A 1HURA 4DLUA 3IR6A 2JFYA 4LNAA 4UQLA 3WRXC 4NPHA 1R4NB 4P9NA 4UTNA 1CUWA 5BOVA 3RK0A 1FOEB 1L5SA 3C8ZA 5EJ2A 4DR1B 2OC4A 3UWTA 5B1HA 3VKWA 3D0IE 2CWWA 3OLQA 3NJRA 2EW1A 1ZMTA 1I3NA 4IDQA 5TS3A 3G1UA 4QYXA 5D2CA 3IQFA 1AA1B 4B9EA 2GEDA 2B2NA 1YC5A 1DBVO 2JDID 5EHGA 3OX4A 1IIBA 1RJWA 4Z4CA 3RJ9A 3N0XA 1Z7WA 4CQLA 4IJWA 3B9QA 4KXYA 2NCKL 4JQSA 4G37A 1R0AA 1ZZGA 621PA 2P62A 3W8PA 4LSZB 3R9XB 4WN3A 4Z51A 4KR0B 4MQFA 2W9CA 3KS9A 4LF7J 3SR3A 4U7FA 4DZTA 5K5MA 2MMYA 2P9CA 4PQUB 1YDMA 3MXHP 1EM8A 5L4NA 4LDRA 4ZZ3A 2VD3A 3BHJA 4BFTA 4KQKA 1JT2A 3RAFC