4GMKA

Crystal structure of ribose 5-phosphate isomerase from the probiotic bacterium lactobacillus salivarius ucc118
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
PNQDELKQLVGTKAVEWIKDGMIVGLGTGSTVKYMVDALGKRVNEEGLDIVGVTTSIRTAEQAKSLGIVIKDIDEVDHIDLTIDGADEISSDFQGIKGGGAALLYEKIVATKSNKNMWIVDESKMVDDLGQFPLPVEVIPYGSGTVFKRFEEKGLNPEFRKNEDGSLLHTDSDNYIIDLHLGKIENPKELGDYLINQVGVVEHGLFLDIVNTVIVGRQDGPEVLEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-5-phosphate isomerase A
publication title Structure of ribose 5-phosphate isomerase from the probiotic bacterium Lactobacillus salivarius UCC118.
pubmed doi rcsb
source organism Lactobacillus salivarius
molecule tags Isomerase
total genus 75
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4gmkA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gmkA01
2QMWA 2LQJA 4L51A 4OQQA 5FIIA 1SC6A 2J0EA 3IXQA 3W7BA 2P9EA 3E7FA 3BXGA 1PSDA 5IT4A 2OKGA 2DT9A 3DC2A 1LK5A 1FRZA 2BKVA 3AB4B 3CEDA 2RE1A 3S1TA 3DHWC 3E15A 3CSSA 4L5IA 4PWUA 4R9NA 3NWPA 2JHEA 1FQOA 2BKXA 1ZPVA 3EFBA 1UJ4A 2JOQA 2H9ZA 3ENVA 1DEAA 1UJ5A 3TUJC 1Y7PA 1M0SA 1FS5A 1PBTA 1JT9A 3L7OA 2PA3A 2RI0A 3TUZC 3AB2B 2R5FA 1HOTA 1XTZA 3LHIA 3UW1A 3LOUA 5HJ5A 2LVWA 2KO1A 3O1LA 3N0VA 1CD5A 4IO1A 4GO5X 3NZEA 4L4YA 1LKZA 1O8BA 2ZHOA 3ICOA 4M8LA 2QSWA 2I9SA 1FS6A 3ENWA 3HN6A 3U7JA 1HORA 4L50A 2CDQA 3OFHA 5IT0A 1VL1A 4TM7A 2DTJA 2QMXA 1YGYA 4L5JA 2RQMA 2P9GA 3CH7A 1LK7A 4LUBA 3OFFA 4NMLA 4L4ZA 4TM8A 2GNPA 1Y89A 2O0MA 3K5PA 1YBAA 4GMKA 4X84A 5T41A 2P9CA 4GO1A 4GO7X 3BXHA 2FGCA 3TX2A 3DDNA 4R7TA 2F8MA 1UJ6A 2RI1A 3KWMA 2J0WA 3IBWA 2J0XA 3HHEA 3BXFA 2PC6A 1NE7A 1KS2A 2WU1A 4OQPA 3DHXA 3NRBA 3ENQA 3AAWB 3MTJA 3TUIC 3EB9A 2F1FA 3OFEA 1FSFA 3MAHA 3P96A 3OFGA 3LUYA 2W48A 3OBIA 1U8SA 2QRRA 2NYIA 3LWDA 3OC6A 3BXEA 2RQKA 2MDAA 3KV1A 3MWBA 1RWUA 5JJBA 5IS2A
chains in the Genus database with same CATH superfamily
4XGNA 5DM70 1RI7A 4QUKA 5MDHA 4Y2VA 2FPWA 4OHPA 4M2LA 1FA0A 2OEJA 5C2CA 3D31A 2P40A 4UAVA 2ZBPA 3OZCA 1GNRA 4RM2A 3NP7A 1UL3A 4UQGA 1OXVA 3ZZZA 3ULHA 2CW5A 2NXUA 2ZTHA 2DLDA 3MK31 2XSZD 2HHCA 2EL9A 4H1WA 4JI7J 4H7JA 3H0PA 5JYEA 4CXMA 5KJFA 4FE7A 4KWEA 4REMA 2JLFA 4L3NA 1HOXA 2PZLA 3WLRA 3AQPA 3IE2A 3HVUA 5JO0A 5BP7A 4X4VA 1G7CA 3S7TA 1IWPB 4G23A 3FYCA 3A13A 2VKRA 3LUGA 2EBEA 1X3SA 3W0LB 4AW9A 3L46A 3IVXA 1YONA 2AZXA 4QZVA 1Z0JA 2HWUA 1ZQ9A 2QR5A 4EMDA 5UKDA 4U7UK 4G89A 3GCDA 4B3SJ 3W5AA 4DIBA 4EO7A 2YV4A 3R41A 5IU6A 3D1HA 3K2YA 4ARZB 4DR5J 1FFEA 4KOEC 3TIFA 1YHNA 2F9MA 1WF0A 2E6UX 2CDCA 5D0HA 1H42A 4R0VA 3QE9Y 2BMWA 2OZEA 4CWAA 3UN3A 1DC3A 4P2XA 1XCMA 1P60A 3B89A 4LF9B 4L0DA 3ED1A 2HSDA 2OD9A 3P27A 4FQ8A 1N56A 3TQSA 5HUQA 1R0RE 1CE8B 2X6RA 3LMKA 4Q37A 3MMZA 2IY7A 1FVSA 2CMHA 3QIPA 3VAZA 1K8RA 4NX9A 2IZ1A 3TXYA 4ZVOA 1JNZB 2KM8C 1QLWA 3NHPA 4L02A 4BLWA 4L8YA 4E15A 5KPJA 1ZZFA 2D2EA 1J9GA 2NS1B 2V7UA 3G4SS 1VIAA 1J8YF 2GBLA 1Y7IA 2VTBB 2GMWA 4RSMA 1TR0A 3QXGA 1XTZA 2PFGA 3QBJA 1AZLA 2HHJA 3KSUA 3WWPA 3CC4S 2RBEA 5C24B 1TM3E 3SIPB 1L7BA 4FFVA 4E2WA 4LSGA 2VBZA 1L1RA 1JEJA 2ZTMA 4CDGA 4B2IA 3GW8A 3OTEA 1Y8AA 3Q8PB 1GPYA 4RPLA 3GVCA 1S4MA 5FULA 4I2PA 1U7XA 1L3IA 5C8ZA 4RTLA 2PQMA 4WEQA 2CZCA 4ED3A 1UXOA 4J0DA 3LPCA 3NBYC 4IHJA 2OE2A 3T9CA 1WKLA 4EW1A 4FYWA 4U8YA 2GZ3A 3T5GA 4PFQA 4F5WA 4DNQA 4MRNA 4JXXA 3GDGA 2DIVA 5HWSA 2IMOA 5JJ5A 5CCLA 2CV2A 2EJUA 3WQSB 1UFQA 3KSDO 1JEOA 3BB3A 4FDVA 1KRHA 3U44A 2GJAA 5EYPB 3HN2A 2A2CA 2GM4A 1JSRA 1V43A 4M9UA 1IOLA 2ZBQA 1FDWA 1LZLA 2OZLB 4DQKA 5AVUA 1B42A 1MHPA 3SC2B 1PWZA 1PUIA 2Q4EA 1SL2A 1MIOA 4KFTA 3W9JA 3KQOA 4LRFA 2OM6A 2ZSIA 2IVFA 2N4CA 3BIFA 1Y63A 2R7UA 2IUTA 3EQ2A 1DQSA 5GOTA 4RK1A 4DA7A 1P7CA 2F3QA 1DJMA 2YX7A 2CXTA 3GPBA 1KP3A 1GX6A 5CYOA 2G9NA 3T1OA 3NAGA 3AK4A 3K71B 4ECWA 4KXFB 5KFPA 3OSPA 8LDHA 4UUMA 5DYNA 3R7SA 2GIFA 5F0UA 3W7AA 4DPYA 4J1TC 1XWWA 4AUMA 3KPUA 1Q7LB 2ZSHA 2B3TA 1ULZA 4WH0A 4MKYA 1ORWA 4UNSA 3ZE0B 2XKKA 3DM9B 1JR3A 3QG1A 2ZUSA 2UVPB 2A0UA 3UWPA 4I7FB 4QTYA 3GT3A 3RTGA 3DKVA 2W7PA 4LSMA 3VTFA 4MCAA 1MBZA 1E32A 1YDLA 5JSYA 1JVSA 1HNXF 1OBVA 3P5TL 1D1QA 4ZT2A 3G23A 4Q16A 2DEUA 5K8PA 3AF0A 3QGHA 3OTGA 3RAJA 2D5BA 2O2JA 4F3NA 4R1SA 1WKCA 3LOPA 2YHUA 4C8NA 3FMOB 2ANCA 2Z8YM 1ST3A 1EX1A 1WWHA 3TXXA 5JSKA 1I6WA 5AKZA 4ZO9A 2I4MA 3I0SB 1PIWA 4D0NA 4B5KA 1WACA 4INOA 4I50B 4QUIA 5LMUJ 4WWHA 1LWFB 1KO1A 4F04B 3LW7A 4CEHA 1Y1RA 4ALKA 2B98A 2PKRA 2FQWA 3MA0A 1NK5A 1U1FA 1Q7RA 8OHMA 4CT8A 1MV8A 2P9BA 5TQVA 4UY85 2G1KA 4EG6A 1U5CA 2RH4A 1NI4A 4P98A 3AR2A 3O4HA 3LX4A 5IWAF 3BDPA 1XVVA 3HP7A 5KQPA 4LYAA 3BYPA 4KIUA 3BMQB 1U26A 3FVRA 4RVNA 1HM5A 1ZA2A 3T5PA 3U7IA 4QOTA 2YMPA 3CTMA 1IONA 3ZQ6A 2KJWA 1PGJA 3PXUA 4PYRA 2X5KO 2ZKTA 2RGXA 2P5YA 4FNHA 4UMDA 4W98A 4YS6A 2UUTA 4MVJH 4MUKA 2NO6A 3A6PC 1PEYA 3EVEA 1I6JA 3RJTA 2AX4A 2UV8A 3HA5A 5DNDA 1T5HX 2ZXFA 1SIWB 4NOMA 3IG1A 4CLUA 4OQJA 4F0HA 3VISA 4BOYA 2DSNA 5C5JA 5ITVA 2W9AA 1JKMA 2GJKA 4ZEVA 3L8HA 4KFCA 1OHHA 4NJMA 2B99A 4K86A 5KINB 1V4VA 5REQB 1S8NA 5FNVA 1GZVA 3KM0A 3A1VA 5HATA 4YK7A 1X80B 1KQGA 4S04A 3PDIA 3WQHA 1BWSA 1Y33E 2EX1A 2P9EA 3M1VA 3EOZA 3RZAA 3RD5A 1I4TD 3BE6A 4G36A 1Y4AE 3AHGA 1IN0A 3D6TB 4I0WB 2OORA 3CPSA 3ZHOA 3CMES 3GFHA 1R37A 1VIMA 4CM8B 3QT8A 3ELBA 3IUPA 2C1EA 3JASB 1YACA 2PM8A 1E58A 2OPSB 1QVFR 3LP5A 4QR1A 3W66A 3MXHP 2J32A 4LDAA 3F67A 1S9GA 1VM6A 3M1AA 2QYTA 4PZ0A 3NNDA 4ZQIA 3LGHA 3Q12A 1NVVR 4Q1AA 1M73E 2VKQA 2QSWA 3T34A 4YUXA 2BOPA 3PNLA 5AOVA 3HJUA 1Q3HA 2PH3A 3AFNA 5J59A 4D96A 4C43A 4X95A 3VHLB 3NNHA 4F60A 1AQUA 4JI6B 1F8GA 5CAEB 3VGVA 3FR8A 4ABTA 1PYSB 5K9FA 5BOSA 2D7DA 1ZNZA 1KO8A 2X23A 1NHWA 4EAAA 1NTOA 1QLHA 4K4YA 3IBWA 2O5CA 4B75A 4RNMA 3HWSA 1WZNA 3ENKA 1CEZA 4Q02A 1JHOA 1NP7A 2H07A 1FRFS 3K2QA 2L19A 3B8EA 2I6UA 5DP1A 3ELDA 2VH7A 2K3KA 4DMUB 3DLEB 2VJAA 1SCDA 3EH1A 3K2IA 1F0YA 2C3OA 1FRNA 1TC1A 4HDSB 4HWSA 1SVDA 2NLWA 3CTRA 1E9DA 3JZMA 3E5RA 5I9SA 2C4MA 3VNAA 3R2JA 1L4UA 4JL5A 3ZS8A 1YZQA 2A18A 4R71A 1FO1A 1FFXA 4XVQA 3QAUA 4ED2A 2POKA 1H0HA 5CX1A 4V19J 4S24A 1LX7A 4YQEA 1IULA 2HNKA 1SVLA 1FJHA 3K16A 3W60A 1U2DA 4BAGA 4BY9E 2IUUA 1HXHA 1KVUA 2X0IA 3E9RA 4N3AA 1NK0A 2AN3A 2YWXA 1K6JA 4AMYA 4ZP7A 1WLSA 1L4FA 1MG7A 2B94A 1NDLA 3AUJB 3CCUS 4GPAA 4D4KA 1FJGF 1EFCA 1YDFA 3ZU3A 1UTAA 1R0SA 5KWVA 4MYUA 8AT1B 2ONCA 4NBTA 2VR1A 2G2ZA 5TRTA 2F59A 1S3FA 4G56A 3FKJA 5DMXA 3H2BA 1NW4A 3FNIA 2GPYA 4GZ5A 1N8KA 1DMRA 4IOKA 4RKEA 4JI1J 1M72A 5KBYA 3UH1A 4KH1B 5AKKA 5G1PA 4QYSA 2VOOA 5F5NA 1MJGA 1CS0A 1E1QA 2PR2A 1UUFA 3U4HA 1WSRA 2XLJA 4M76B 3LW5C 3ZXYA 4YAGA 2PUWA 3VHRA 4ZXFA 4BQIA 1CP3A 5HROA 4E14A 1P7WA 2M5YA 4O5OA 4OKIA 3ZZMA 2WR8A 3GNTA 4HDGA 4O2AB 3R5CA 3V8PA 5ADUS 4LHWA 4PSCA 1PV2A 4P4TA 1KQNA 2OYRA 1AKQA 4S05A 2F5GA 1ZRMA 2COKA 1P0IA 4NULA 2LDBA 3CO5A 2XXJA 1AGPA 1ZI6A 4CJXA 2VCHA 3MCSA 2GEKA 3IV6A 3BE8A 1C9JA 1O9GA 2X3YA 5TVKA 4D02A 3NMAA 3VU9B 2NUHA 4HXFB 4EVRA 1J5EJ 3M7VA 2AR7A 4ZHSA 3WX4A 3E5MA 5E2IA 4BAUA 4NRDA 4A0GA 3T1YF 3DLGA 1SRRA 2CXXA 2X8JB 4K0KB 4O4HF 1XTIA 1II8B 4MQ6A 4TZ0A 2J7WA 1NN3A 4MW6A 1TPZA 2GMLA 2GGPA 2HAFA 3PQ2A 3HYCA 1Q7TA 5K8LA 3OQIB 4M0LA 2JHGA 1XR3A 5TQ0A 4Z3KA 3AY3A 1RAHB 2BYTA 4AVYA 4BQSA 3R3TA 3G89A 5EWMB 4LFAB 1ND5A 4Q9AA 4PCQA 1HE3A 2FPIA 4O0LA 5CDFA 2BR4A 5CFZA 1XAHA 3O8OA 3PDJA 1UT6A 3U5TA 4FN5A 1N32F 5FTLA 3KFLA 4GI2A 3DU6A 3RU0A 4OQYA 3I9LA 1DJOA 5I3QA 2Q8PA 4BFVA 4N5IX 3FNEA 3Q8UA 3T0FA 1V39A 3RHSA 1T9CA 1L3CA 1C7EA 3E70C 4MIEA 2EGUA 3N07A 3HACA 3TQCA 3F73A 1FSPA 3DR3A 2JFDA 3M5DA 2CA9A 3JRNA 4DR4B 2WTAA 2XUDA 5DNUA 1KYVA 5LXTA 2BMVA 2XE8A 5KQSA 3X44A 3KETA 2IODA 1OW3B 4AU1A 3O0TA 3TLJA 1ZK0A 4JEHA 2V3WA 2R7LA 3WDOA 5AE3A 2CFSA 4C4ZA 2ZT6A 1RWPB 1RT4A 2R8JA 4X20A 2OY0A 2ATXA 3PEVA 5IOLA 4U5QA 2XS5A 4YXFA 3B5EA 3A9UA 5EWLB 3ZIDA 5HZHA 2LZ0A 2ZCJA 1O5OA 2JAHA 2KO1A 5C35A 1SU7A 4ESVA 3HUDA 2XMBA 3K0AB 3CRMA 1IB0A 4KPFC 4YT4A 1VQ6S 1HIYA 1IVZA 4JV5B 1G5PA 3IPLA 2ZJ0A 4AO6A 4AY3A 4NASA 4M0UA 4C6AA 1HPZA 3SEOA 3WLMA 5CFRA 2OMKA 3F3SA 2J0XA 3ER6A 1XPOA 5DOZA 3A31A 5K5MA 4ISBA 1CULA 3BH7B 1MEJA 2D3ZA 1NLKL 2R6AA 4Y6OA 3R3WA 2OPQB 3LQ4A 4YR3A 2ZH5A 2ZSAA 4FYXA 4YCNA 4DIEA 3NORA 4JKOA 3OKPA 3RF7A 1ZAXA 3UBTA 2VPXB 3LECA 3FTFA 4YMLA 1EK5A 3K0KA 4RVFA 1XDZA 2PMWB 4XM0A 4N7MA 4J91A 5HMYA 3LYHA 1DCMA 3PHGA 1YASA 1M0WA 4OAPA 5JQGB 3GVHA 2JF0A 2F1RA 5H9WA 1XRPA 3HCNA 3HZEA 3DAGA 3JSYA 4DEYA 3ZU4A 2KVQE 2OQRA 4UNRA 1UXJA 1YOVA 3ZHXA 5CH8A 3QEAZ 3K2EA 2JGJA 5T4HA 4RULA 4DR2J 5ILOA 2D2IA 1MAVA 2JJ4D 3GWZA 2EKQA 1GQ2A 4A0FA 5EE5B 4MV1A 1QFXA 2V8GA 3MM4A 4ZYTA 3AJ1A 4B09A 2XR1A 1CS4A 4M5MA 4E33A 1M33A 1RHQA 5B30A 3RS7A 4RCZA 2CNOA 3ZZPA 3FAZA 1H2TZ 2ZE2B 2GETA 4OHBA 4CMHA 1PJ3A 4BJ3A 2IU3A 2IPAB 3DG9A 1R4NB 2BRUA 4BZPA 4QYRA 3MHPA 7MHTA 4CODB 4IOCQ 3IQEA 3REGA 4YMVA 2OAQ1 5CFOA 3T0GA 4ZV9A 4JYAB 5L6MB 2F3UA 3PACA 1Q4RA 5CA1B 1KD1T 2DR2A 1E1LA 4TKVA 1UCFA 1T2EA 1KEZA 5EXEA 4AJJA 4L22A 3E23A 1U0HC 4K9LA 4B81A 2DMRA 2W2PP 4KNYA 4U7HA 4JQOA 3IR5B 1YDGA 3IR6A 2QTZA 1TZBA 1GG8A 4X62J 5TEVA 2J8AA 2WHYA 1H7WA 2IP2A 4QO7A 5A8KA 5KG1A 5IVPA 1WF3A 3ZHCA 4AY4A 4K88A 4LXHA 1GAOA 5GAGU 4LA4A 3IBSA 3A0UA 4X66J 4P7GA 4C1NA 2XITA 5F41A 4OXYA 2G8LA 2EJTA 3BPSA 1FDTA 1LPSA 2O1PA 4D74A 2J08A 1MC5A 4XLTA 3P1JA 2M32A 1OFUX 3ZE8A 4XGKA 3LVRE 3U7FB 2UXBJ 4CKYA 4C0SA 2FRXA 1DEXA 1OV6A 1J97A 2RHDA 1C0UA 1B0UA 4BDPA 2VJCA 4I9NA 1C2TA 3AUXA 7AT1B 1SPBS 3NRJA 1IXSB 4FDTA 3G2PA 1RM5A 2R8OA 3PD7A 3D0GE 3BD6A 3I2GA 3CEMA 4ZVTB 1YQQA 2RRNA 2JLVA 3BRQA 2IZ0A 4N8SA 1LXNA 4CTNA 4I2QA 3I9V1 4Q8FA 3CPJB 2YYAA 2I22A 2QN9A 5CURA 1KEKA 4Q3DA 3QSYA 2MCFA 4KYTA 5K03A 2CJPA 4IXMA 4Q9LA 1CJTB 2Z08A 1VYAA 3LCUA 3RVQA 2P91A 3RRYA 3TL2A 3RRHA 3LHFA 3KJHA 3CUSA 3RVJA 1AKEA 2XXBA 2BQ3A 4DPOA 2CXSA 2GVDA 2CVOA 3ZDFA 2GO9A 2NV2B 4H9GA 5MN6A 1QRUA 3ZZTA 2Z57A 4AMBA 3NOGA 1Z8NA 3D7RA 3F56A 1P9WA 2HMVA 3LUYA 4D98A 1W26A 1AUQA 2EZTA 4OZ0A 2YQ0A 2OMEA 3OZGA 4NG4A 4AROA 3BGDA 1K98A 1H8ED 1YJ7A 1KRXA 4IOMA 3Q0EA 4CGYA 2ODPA 2HAEA 4XASA 1GTMA 2BDEA 2PX0A 3E3AA 1DOHA 3ESAA 4NABA 3NCQA 3L7BA 2FDNA 2OBYA 2R84A 5EMNA 3MTBA 1OSNA 3J81Y 4GC7A 3LLVA 1QAQA 2NUAB 4GDFA 3HZZA 5IYZB 4V0ME 5FJ4A 3MMCA 4N3GA 2MQLA 4DX5A 1GG5A 3UGQA 4YLEA 2OQ2A 3UA3A 1IJEB 4AJ9A 2JKZA 4EYSA 4GP6A 3CIOA 4WFIA 1EGMB 3GNLA 3PZBA 4TTRA 3GV5B 4Q43A 1O8CA 4K26A 3DGPB 2HHQA 1JT2A 1U8UA 2A0WA 2UU9B 3NHKA 3OJXA 4OVKA 1MO3A 1B8VA 3VR5D 5EZYF 2P7HA 1EJ7L 3TSYA 2XMKA 1UP6A 1BGVA 3KUGA 3V8QA 1THMA 2ECKA 2HK7A 3UF0A 3UWTA 2ZDOA 4UOFA 2HPAA 4NA2A 4OCZA 4BKQA 1F20A 3SYRA 1OC4A 1E5LA 1Z6AA 3T1VA 4V1CA 1ZISA 2DNQA 1BHO1 3VTZA 3E0XA 1HHQA 1IPEA 3T1AA 4MTCA 4GZ6A 2A3NA 4Q8EA 4ODIA 3DWEX 5DI3B 3HT0A 2H59A 4F12A 4OUDA 4C21A 4DJ5X 1PYTA 1CIVA 2VDWA 5ABPA 5KMGB 4KAJA 1IBLF 2OAGA 4UDNA 2MDTA 1E7WA 4EX7A 3G0DA 1U2SA 1EHCA 3KEOA 3VX3A 2X1AA 3CZ9A 4DUPA 5D8HB 2A30A 3AJ2A 1ULRA 3VU0A 2HYIC 1W75A 4F93B 2WP8J 4JWKA 2RC5A 1DTEA 2Q6BA 4USKA 3Q7IA 4NU8X 2JGNA 3BWXA 2GILA 4DBVO 1N2EA 1EIZA 3TGLA 2RAQA 2NMVA 4ECUA 4QXPA 1ZYQA 3C4QA 1IR2A 1TELA 1WTCA 3TR0A 4KGVA 5JBIA 4MWOA 1JVNA 1GPWB 5EPUA 3KD2A 4R5PB 2Z04A 4H59A 4AS1A 1J5OB 1ENZA 2R00A 1Z2CA 4BQQA 4UTGA 3LF2A 5KYUB 5EVCA 1ZBDA 1B26A 2EW8A 3CCJS 3ZS9A 2G13A 3ULKA 4HVCA 1IKWB 1HF3A 1WHTA 4PAWA 2NZJA 3LP8A 2F2TA 1CHDA 3DUFB 3H11B 1R1DA 2CJWB 5COAA 3EPIA 1X15A 2WILA 1JHRA 5CFLA 4U6QA 2MKJA 1R0WA 1U0SY 3HVAA 2GVZC 3RKSA 3ICPA 2VT2A 3KOZA 1TAQA 1QGOA 3VALA 1ZGHA 4RGBA 1YC5A 4HNTA 4YLYA 3VVMA 3MWBA 3D54A 5FOVA 5DRTA 1Q3TA 4NYOA 5DXAA 2FW0A 4BTEA 3ICEA 2G1UA 4TV9A 1EKSA 4RF5A 2AG8A 1DI0A 2UZ4A 4F4HA 2PGJA 4KE8A 3AO0B 2NG1A 3RWBA 4MKBA 1M0TA 1A5AB 3FNQA 3MR2A 3LBNA 1SOAA 3Q89A 2XD4A 2QMQA 3MD3A 2VSYA 3NFYA 5AHWA 3C6MA 2H7CA 1QVVA 2NZUG 3FPEA 1XVIA 3B6BA 1EVKA 4EGJA 3X1WA 4Y1RA 4MW5A 2D1QA 5JISA 1QTRA 4ZDKA 3KYBA 1ABFA 4HACB 1XTKA 5BORA 4CLZA 5C8YA 1IBSA 4F9EA 3KFXA 1BWEA 3KOWA 2GM5A 2VPYB 1AKRA 3IGFA 5C7IO 2V6IA 2NXNA 1RHMA 2I2XB 1QTNB 1RT5A 4BWGA 2H4YB 7REQB 1LV8A 1MHTA 1AROP 4M0FA 1VPTA 5ALLA 4M1QA 1RVV1 2C99A 5FT9A 2DXIA 3OLXA 2QP9X 3ELUA 1HT1E 3DLTA 1QAMA 3H6GA 5F8GA 2IPXA 2AVDA 4UVHA 1FP6A 1X1RA 1QOQB 4MZDA 2X9NA 3PFFA 3V80A 3CGGA 4X64B 5AD1A 2J9GA 2EC5A 1XV5A 1YV9A 4F3TA 3DRPA 3NATA 3LRTA 3L79A 2FNAA 3T9BA 2PUGA 2PCLA 1T2CA 1ADJA 2UUPA 2XQJA 1AA6A 4D9BA 2F43B 3WC4A 1S6PB 1G64A 1K8ZB 2ODWA 1MVOA 3C6ZA 4PLCA 1UKYA 3AU8A 2O3UA 1QK3A 1ISIA 3M8KA 1YZGA 3A1WA 1SXJE 1LH0A 4I4BA 1G7SA 3EXEA 2HL6A 2BP7B 2VKZG 1GVHA 2G4LA 1ZJ6A 3A1NA 1PCAA 1OX4B 4I1VA 1O6BA 2C77A 2QLTA 1XMVA 4IFTA 2OSVA 1SH3A 4WJZA 3D1OA 4NYJQ 4NICA 4B0PA 1JLSA 5AVYA 1NUQA 3ZLBA 3KPWA 4U3JA 5DCWA 4RW9B 1G5HA 2ZI9A 1QGYA 4BCDA 2FHSA 2ZIWB 4PXCA 4H1TA 4XVCA 3VC1A 1SG9A 3EASA 2PKYX 1J1UA 4PHTA 2BHLA 4ETIA 3PX6A 4LVCA 4R0JA 3CEAA 3OIYA 5LKRA 3TAMB 3J7YI 1K1SA 1VFPA 3PI6A 3PRHA 2VHTA 2VHGA 3LNTA 4KV9A 5GIPE 2EP8A 1CFJA 1M1HA 3THPA 2QLFA 3CLSC 5CVUA 3O93A 3LM8A 5HG0A 2AR0A 5EWEA 3HU3A 2P2CA 2KFZA 3AJRA 3HHLC 5B12A 2ZHOA 3P45B 3M3PA 3C4JA 5H9FK 3KU1A 1X4GA 4HDNA 1YK1A 5D1NA 1OQ6A 4O4RA 3GT0A 2QAIA 1U1EA 4HUTA 2Q66A 4ZKAA 3GSIA 2XF8A 3K0SA 3BHMA 3AIKA 3FFIA 1A3CA 4CM3A 1VQSA 3KE8A 1RP5A 3KEGA 4DDFA 1H3EA 1T3HA 2X5OA 4MRMA 1FVFA 3HHPA 3I9OA 3V8MA 1XZPA 4EPVA 1QS0B 3WNVA 3N6NA 5ALWA 2GAJA 1U4OA 5JPIA 1Z2AA 2IUSA 4QE3A 1MFZA 2P30A 1X5SA 4BO2A 2CBGA 3B1VA 1EE9A 1S59A 1NBIA 1U6KA 1NBHA 3ZIAA 1KU6A 4MKAA 4CUZA 1XZDA 2EG5A 3C3KA 5FWAA 1QR2A 1WMAA 2XV1A 2BGJA 1UJCA 2G71A 4DYHA 2QV0A 1VQMS 3V3KA 4CIAA 3U1VA 2ZNYA 3BH0A 2QPAA 3WI7A 3AEYA 4FYIA 2YYZA 3AOCA 3SSRA 2C29D 4NCJA 2H3EB 4U8GA 1IQPA 1KI3A 3ZNUA 2XE7A 2B9WA 4DOMA 3QBDA 3GJTA 4CKWA 3TZLA 2BE7D 2ZSKA 4W8HA 2W2TA 1K5DA 3FZGA 4CEJA 2QTVA 2ROPA 4ZMSA 1U9IC 5JVDB 1WTAA 2FYTA 2CQ3A 2JGDB 2OWDA 4LQ4A 4DNPA 5JFOA 3D6JA 1FFBA 1S2LA 1PFVA 3QWIA 1FBTA 3E8OA 3I42A 1FVQA 2ZRLA 1EHYA 3I2JA 3HY3A 1WM1A 4CG1A 2GFFA 3HKCB 2EVWX 4TWRA 2YN2A 4LR8A 1ECCA 4ZARA 4V0RA 3GXOA 2DNMA 4JI4J 5IHXA 4Z4IA 3AB4B 2GCOB 1I7QB 2E5IA 2AOTA 2HNYA 3LSYA 3M6VA 2AVNA 3HULA 2GPBA 1NBEA 1RT3A 3GIKA 2OXIA 1IKVB 2ZT8A 2X8LA 3BIJA 4P4UA 1T9KA 1WHSA 1LWOA 4LOAA 2PBZA 1A7AA 5TARA 2W6IA 4TYYA 1FDDA 4KV7A 1INLA 4L3OA 3CGIA 4YJFA 4HVTA 4QR0A 3SR4A 3KKPA 1RK8A 2IEAA 2FRDA 3LYLA 2I3ZA 1LI7A 4GOJA 1YUNA 3V7YA 4D9HA 2GSDA 4K03A 4NLGA 2NO0A 1YI1A 4ZCMA 2M9KA 1SUAA 5JATA 1JJFA 4U8VA 3WGKA 3QGGA 3BN3A 3L4BA 3IAAA 5ADHA 3AR3A 2LA4A 1QHXA 1O3YA 4CV1A 2ZPAA 3DOJA 3V2IA 3CDUA 3V4IA 1H2FA 2IC3A 2VA3A 1HQKA 4CIBA 1H65A 3LKVA 3QATA 1R6UA 1JU4A 1L8XA 4JV0A 1ODJA 4LRYA 3T7RA 5HCUA 3TTYA 1CJKC 1XD8A 1MOPA 2XOEA 4MS4B 2WJAA 5FDLB 4IIDA 2ZYSA 2D69A 1KEPA 3LOUA 2X1VA 1SC4A 4Z8XA 3UMMA 4MI1A 1T2UA 5T4FA 4Y0VA 1J99A 4Y9SA 5CYMB 2RHMA 4HNQA 5CA1F 1S8AA 5ALDA 1VIYA 1AUOA 4ZT6A 4KHPF 4KQXA 4PLPA 3PNMA 2QM3A 2PMEA 1OSCA 1GT91 1T0JB 4O1IA 2RMLA 4FXPA 3VYSB 2KHDA 2DGXA 3MWEB 1WAMA 2LXIA 3T61A 1NBOA 1TT5B 2PYDA 1Y6FA 5SY6A 3OZWA 2QVYX 2HNDB 7FDRA 3PUHA 1C0IA 4C0QC 5LM3A 4QTXA 1KFBB 4BQPA 1ZXXA 4EUSA 1F8YA 5D6NA 4IW3B 4WXRA 1APSA 1RTJA 3VNSA 2DRIA 2AOUB 4IFVB 5KQLA 1XMBA 3IDOA 1R0CA 4IFYB 1KA9H 5JAUA 5C5DA 4DXLA 1F3LA 1ZRNA 3AV0B 3C7AA 1TVRB 2VP9A 3SDZA 4XAKA 3B13B 1D9AA 3DOIA 4LSNB 4H7KA 1NW6A 1FNBA 2FH5B 4IGKA 3UZUA 2ZAIA 2FPGA 1QONA 2CWDA 9RUBA 2WT9A 1Q0RA 3LO3A 1K47A 2V4JA 4UHFA 3EPJA 3DNMA 1KSGA 1VPVA 1TLTA 1X0PA 1UXIA 3OFHA 3L2OB 3ZLUA 4FSXA 3L7KA 5KNBH 4WIIA 2B36A 1CUYA 1VJQA 4XXHA 1EHWA 2CJYB 2PRYA 4KTTE 4IWYA 2FETA 3M8ZA 1QDUA 1R6DA 1NRKA 3EY9A 1PV4A 2JFHA 3ZNPA 2DH5A 1WC5A 3KLIA 3GRAA 1Y4ZB 1L5YA 1Z28A 1WS6A 4CG3A 1LQTA 3O3MB 5JAMA 2MZSA 1E6WA 2FPPA 4EYEA 1GFSA 5FIIA 2ZH3A 3AT1B 4HSEA 1L3VA 1PJ6A 2XRYA 2EK6A 1E92A 3PEWA 1J56A 4ASUA 1H0SA 2C2NA 3O21A 2AZ3A 1UPAA 2JEGA 5CCMA 2AT1A 2VNAA 2YFKA 4ME6A 5ALSA 4JC0A 3BJZA 2DFDA 3K5WA 1GQEA 4UOCA 3IUMA 2VL7A 2FG7C 4OF4A 4W6QA 3MMBA 1E4EA 2NVUA 3FEXB 3DLKB 2VJOA 2A1BA 1VLZA 4HH3C 3RTVA 4GT1A 4A2PA 4PC1A 4BVLA 2EL7A 4OYHA 4X65F 5A02A 5MHTA 1DE0A 4U9RA 3NYIA 3LF1A 3FOAA 4P6QA 5DYIA 3KJGA 3ZDQA 1RA7A 3ET5A 5FB3A 1EK1A 2IV2X 4AURA 1Y3IA 4CEIA 1N5TA 5HEKA 4HEA1 3D6VA 2QP4A 3T3DA 2UUCF 3NTQA 4LBYA 1FDSA 3RG8A 2A0FB 4D8TA 4DQUA 2YKNA 1QJ4A 2OV2A 4JJ6A 5B0BA 2PKWA 3ZG6A 1R4MB 4X1YB 1QNLA 4IXWA 2HHTA 1F2DA 4R1OA 5FBLB 4N0EA 2FWBA 1DBVO 1E2HA 3VO2A 2QAGC 3HDHA 2KHCA 1SBNE 1RADB 1CNMA 2BJ3A 3A6HA 1XCPA 1SQFA 2NTNA 3MEQA 5IBCA 1AU9A 4QLOA 4I7EA 2QTGA 3DE4X 2ZDQA 1DC5A 4EELA 1SGWA 2YWDA 4GWKA 4NJEA 3R5DA 4YRIA 2FDXA 1TO1E 4F67A 3HCAA 2HU8A 4WXOA 4KXWA 2DBYA 1C0TA 1BE6A 1JI0A 1GD1O 2J45A 3F0TA 2QSZA 1M2FA 1T11A 2LXUA 1IY9A 3UK7A 2H2WA 3RAXA 4AULA 4REQA 1RWVB 3OL6A 3UJ6A 5LL6P 3GJZA 5DEOA 2KM1A 1H05A 4TU9A 1SBZA 2FZGB 4C0JA 3MRVA 3JQ9A 3SFGA 1WA5A 4HAYA 3VYVA 2NU8A 1P1RA 2DWQA 3GD5A 2I99A 3OFEA 2MLYA 1PYOB 5C80A 1AA1B 1VBXA 3DHYA 2A84A 5DNAA 3TA0A 3IVRA 3PJFA 3AR6A 4PS1A 1E1NA 3G82B 4G8JA 2QT9A 4ZVHA 1HFWA 3O5AA 4U1RA 3W8EA 1HRDA 3A28A 1X42A 3IE1A 3OJOA 4DM4A 2UUAJ 1RQPA 3OIUA 1IKXA 4OV6B 1UJMA 2DYAA 1N5VA 2CZVC 4Z2AA 4BECA 1V71A 2GUWA 4G24A 4P2SA 1VE7A 2VPZA 3ZGZA 4M7WA 4AT1B 3VH1A 3D6MB 2YIMA 3PYXA 3F5SA 3DO6A 4X41A 2YZKA 4XGQA 1JJBA 3RW7A 5E7MA 3NPMA 1EAYA 1XB2A 2Q3DA 1WVGA 5FL3A 3WIEA 4YUVA 3D3BJ 5AE1A 3MD0A 3GFRA 4RD6A 3KUEA 2HFOA 3FUWA 2PA8D 4P84A 2QRNA 4V0KA 5DTEA 3IHTA 4FKYA 1U6BA 3KLPX 5A2QU 1U4SA 4OFXA 1ZUNB 2HJHA 1QUVA 4OJYA 4WP8A 3PW0A 4ZT5A 1KORA 5E3CA 5F1KA 1Z2PX 1K0FA 1TZ0A 4F7VA 1ZG3A 4AP5A 4UTPA 2J7PA 1Q0NA 4DR7J 2YNMA 3S8MA 4DOZA 3OM1A 4KE6A 1B2RA 1L1QA 3F5DA 4QWCA 3JAKB 2QWXA 3NGUA 2H7VA 2HLNA 1FUUA 4OYLA 2PZBA 4NENB 1TZ2A 1E7YA 3E35A 2XZDB 3T54A 5C1DA 4UEJA 1E3MA 1ZGAA 4RD1A 4M6WA 2Y3IA 1RAOA 1NXPA 2X5XA 3E3LA 4RA6A 1L5ZA 2QZPA 2BAGA 1S1WA 4HZGA 2W71A 5LA6B 3HUFA 2LIVA 4NLYA 2J0QD 2LKZA 1P9OA 4IR7A 2XI2A 3B2QA 1ND6A 3KWLA 4MWDA 5HMWA 2G1HA 3PQ3A 2Y0CA 2OMLA 1CC7A 3U56A 1MPXA 4NF2A 5BV7A 3EEIA 3CJ3A 3VYWA 3CE9A 1EFDN 3HN7A 2O7SA 3L1IA 5L3RA 4RY8A 3OEHA 1ZIYA 5JZVA 1NKBA 4OZJA 4RESA 3AUKA 2Y1JA 3MAHA 3V6DA 2R6ZA 1BHQ1 3HA3A 1SXJB 3LC2O 5AJTA 3S81A 4LJ7A 3T94A 1HBNB 3W3ZB 1Q21A 13PKA 2H2GA 1QX4A 3AVOA 3ZTTA 3KLVA 2JHPA 4S2UA 1NOKA 1FRJA 1VOMA 3EXYA 5JNWA 4DG8A 1M1NB 2J3IA 1BH2A 3QVXA 1CVJA 5K01A 3PW2A 2QY6A 3M2VB 5K0NA 1S6QB 4FEEA 1SVKA 2R2UA 4H1VA 1CBKA 1BXKA 5K51A 3VSBA 1OX6A 4KNVA 4HK4A 2IV3A 1MG0A 2H48A 3K96A 2B2XA 3CWCA 3BMXA 3LDGA 2P9JA 2Y2VA 4NBSA 1BQ3A 2BTEA 1OQAA 2HGNA 4MJ3A 3U3JA 2OGTA 4RMJA 3IDFA 3QV2A 3WO0A 4LOJA 1YQUA 4YHHF 1USGA 2IGBA 4HDOB 1NPTO 2BC9A 2WVEA 1TKAA 1XAIA 4R7TA 1E3IA 2PMCA 3DXYA 3MTGA 5GV7A 2PD4A 2J0WA 3FMWA 3BR8A 2JLSA 1Y3HA 2FLLA 1X7YA 3RT9A 1RWQA 2HK2A 4BP8A 3BQ2A 2C96A 2RQKA 5K0BA 2XOKA 1H9AA 4ID5B 4Y6PA 4HF7A 1P4RA 3M30A 3JTEA 2COLA 4JKIA 5ARCA 2CXRA 5HQ8A 4UCQA 4XOIA 3OOEA 1JWBB 4P4NA 3RUCA 1PFUA 3N2ZB 1Y5NB 4EI9A 2I5PO 4ZO7A 3MXTA 3GC6A 4J0CA 2PUBA 1FTCA 1SCQA 4MCJA 2QMUB 2AHRA 4LUCA 3VO1A 4QECA 3DKDA 1H1LA 1NK6A 2ADBA 4PX2A 1GJRA 3KLHB 2ODAA 1OROA 1RPNA 5DK4A 1TMMA 1WCIB 3FBTA 4OMCA 3PNIA 1HDGO 5F9LA 3B1FA 1TMGE 4YRGA 4USJC 4Q3NA 1PG2A 2O2ZA 4RVSA 1EZZA 5EJ6A 1Q79A 3R8XA 5KKNB 2PEZA 4LFCF 3PKMA 1ZL0A 2QQ0A 3R6WA 4IS3A 3TJZA 2GA9A 3ZCRA 4ES6A 3GDWA 1PR9A 5DDOC 1GPUA 2RQCA 4BNTA 3ZLTA 1RWWB 1P7ZA 1VBFA 1HLGA 4QPZA 4MI3A 1S7IA 1HFKA 3I52A 3OFJA 3TJ8A 1EM8A 1LXCA 3UYLA 3EIHA 1TT7A 4LEIA 2A9VA 5KFFA 4LDZA 1TA0A 3FNBA 3KZXA 1E3WB 5KDDA 5FUYA 5KTKA 5ALJA 5EP3A 4W5NA 4IX1A 4PSUA 3H17A 2BEWB 4PTYA 2KT2A 1ZTWA 1YQXA 1XLTA 2P4UA 2VHXA 3DW3X 2DHGA 4HZUA 1HE5A 2GYUA 4A03A 2YWHA 3T1HF 1GZ7A 2A5YB 3EMTA 3AMVA 2HCTA 2R3SA 3NYQA 4CFYA 1VCOA 3PCRB 3GDHA 2FZVA 1H5NA 1E9SA 2YNHB 1PT7A 1IN1A 3BVPA 4YHBA 2QTFA 3TKAA 5GGYA 3NOVA 3K1AA 1AQJA 2HQDA 2KTQA 1XRJA 3B20A 3ACCA 5M5BA 2H2FA 1GZHB 4A26A 2HJRA 4RTMA 2WWRA 2VSXA 4GC5A 4PO3X 3R7NA 1GAJA 1P7VA 3STYA 2GK3A 1KI1A 1O4WA 3ISND 2ZAOA 1HT0A 3RS4A 4YASA 2ILVA 3CMQA 2JBAB 4WU2A 4TYMA 5JCPA 2UZ0A 3N3BC 1WXEA 4ZVSB 4QNNA 3DB1A 4B3RB 2WF8A 5HE8A 3SMZA 4UY8T 1SH2A 2INGX 1TQDA 3CQ9A 3E84A 3FDFA 4IYRA 3DFFA 1H22A 2HMTA 1HQ2A 4JP1A 3CN7A 2L42A 4P2FA 4C4SA 2AB0A 4J3FA 2VC0A 1R9JA 4TM7A 3GFTA 2C5HA 4IMIB 1FRQA 3MINA 2XWQA 3TCKA 2EKZA 4M94A 4I5IA 4LAFA 3EC2A 4L73A 3KQVA 1G5QA 3L7UA 4LXGA 4DUZF 4WNAA 3BGLA 2RDDA 1H73A 4N41A 1E9CA 3QRWA 4Z7CA 4YB1P 2X8BA 2XSZA 3IXLA 2O1WA 4ED0A 2QNIA 5D5QA 4JGGA 3TGWA 1JECA 4GHWA 1RT1A 2AMLA 2MPUA 3BGSA 4IQFA 5F2NA 4DL9A 2CNWD 3KJVA 2L3MA 2QENA 2QE7A 3RIHA 2PV0A 5K3OA 3JD0A 4LRTB 1VQKS 1WF1A 2VCYA 3H9BA 3K4PA 5CLJA 1RWKB 1ADGA 2CPFA 5F12A 4WKNA 5BRNA 2I91A 2PEYA 4DV1F 4WN3A 3W6PA 3OIWA 3INGA 4DW8A 5BYAA 1KLMA 5HW0A 2XGQA 2ZC4A 1Y0HA 1HR0J 4KUHA 2PGLA 2AJQA 2JZOA 2R7XA 2VG5B 3G0OA 3LFUA 3MMJA 4OSPA 3SV3A 2OR3A 3ISJA 2XNRA 2RNEA 3L84A 3N8HA 4WXMA 1YL7A 2W6OA 4ZP9A 3W9UA 3VH3A 4MLCA 5T41A 1FUIA 2XULA 2H1RA 5A0YA 1VI5A 1KR5A 1Y9OA 4ZQBA 2CPJA 3BKFA 1B0ZA 3ENQA 1P31A 3VOSA 1SV5A 4S2EA 4QOSA 4MP8A 1WELA 4CN9A 1OKKA 2II6A 1E8DA 4L2IA 3ZW8A 1PR1A 3F7OA 4URWR 5BVHA 1CUIA 1S2OA 1NKEA 1JB9A 1M1ZA 1NLYA 3K70C 1BE8A 3K6SA 1IHOA 3OOJA 4GVBA 2Y0DA 4G3IA 3QA3E 3A1DA 4XFJA 1LTHR 2I6XA 3SC3A 5KYVA 5J2UF 3DI6A 3RT1A 4B4WA 3MJTA 4C8OA 1K86A 2E4WA 1YJCA 2JH8A 3AGPA 3EXHA 4M7PA 3ZNNA 3AM1A 1EFVA 3I45A 1WDLA 3M8PB 2CVFA 4UD6A 1GLVA 3VYUB 3FTPA 1HI0P 1TTQB 3AETB 3TOSA 5IKOA 3FDZA 3DT9A 4EHJA 3GVXA 3P20A 4L5JA 4CM2A 3GHHA 4IV8A 4DCMA 1JV2B 2Q8NA 5SZIA 5FPQA 3OPMA 1DT5A 1YCGA 5L45A 4ILEA 1W9HA 3FCVA 4XOUA 1RXUA 4FHDA 5DDQC 3OG9A 3ESQA 1DCFA 4DQ0A 3AVYA 3TDNA 3FPAA 1ZUWA 2OHVA 5FR1A 4ANDA 2QBYA 2MSEB 2Y1GA 3BBFA 5FFFA 9GPBA 3HYLA 4TSKA 3IMEA 3SZRA 1N6QB 4RTSA 3T9DA 4MWBA 3SQGB 2FW1A 1VE3A 6AT1A 4UTVA 1ZKDA 2VWGA 3GL9A 2IELA 4TZTA 4RA9A 4ZIVA 1WIWA 4Y6IA 3RUPA 2HX1A 3TLGB 2BL4A 1YBTA 3H5WA 3JQ7B 4V0QA 1Z7GA 1EXVA 2QXUA 1E63A 1PK8A 3PE3A 3EY4A 3LUPA 2B4YA 3ZWWA 4XKJA 2AFHE 3AL2A 2QTHA 1L8AA 1NQWA 3WAGA 2DX7A 1GGMA 4ALMA 4URXR 4LVOP 3MPDA 4PRKA 2W0SA 4LG1A 2MZJA 5EP4A 3IFEA 3PUVA 1I0LA 1DKRA 4I9HA 5G3YA 1DRZA 4R68A 2R751 4C22A 1BD4A 1SXGA 5SYNA 3QWFA 4QPNA 5IH3A 5HJEA 1C8KA 2WM2A 2IXGA 2W8BB 2HS3A 1OFVA 3M83A 3MT9A 5DLGA 4HRXA 2HEIA 5DM0A 2WUFA 1M1YA 2YHSA 2XVXA 3EYZA 3PDHA 1XMJA 1T3LA 2QU8A 2YZGA 4A3SA 4EFMA 4UEKA 2Q7OE 4UU0A 3RWMB 4BU0A 3VU3A 5BR4A 1DHMA 3BZBA 2O6HA 3RRXA 4DA6A 5KG6A 2IX9A 3ISVA 1O7JA 3U17A 1TJ3A 1NMXA 2OD2A 1PL6A 1B00A 1XLUA 3WKAA 1C2YA 4BEBA 1JFLA 2V1UA 3W78A 3LCJA 5BT8A 4NLPA 2YIVX 4AXIA 1JG4A 5ULLA 9LDTA 4EARA 1LK7A 2ZC3A 1TK5A 4R3WA 6FDRA 4UVEA 5LDHA 2VA9A 3TNVA 2HU5A 3AEQA 4FFNA 3REQA 5FA5A 1FXWF 3U3DA 2QTRA 2PN6A 4AJ2A 4QW8A 3EXFA 1WI8A 3HY4A 1GUDA 1MB2A 1Y6RA 4N03A 1F6DA 4GM0A 5CMLA 4QULA 4QOIA 4KSEB 4Q0BB 5LNK1 4DV4F 4ZVOB 2QM7A 1N2XA 3AEKA 1DDGA 2YHAA 4RNCA 3UMVA 1Q1AA 4C2TA 4ITSA 2ZJ2A 2R86A 4MP6A 4S3MA 3GLKA 1JKFA 4AYWA 1HI1A 2OWEA 5JCXA 3Q7PA 1VKOA 3DOLA 1I3OA 2GKGA 1QF9A 3D6FA 1BHNA 4DEXA 1JA1A 1Z12A 5KAPA 3H18A 3OE1A 5A6PA 2RU9A 3BWVA 3K0FB 4JT8A 3SVTA 1XBWA 2DTEA 1G60A 3E9QA 4J3JA 1P4AA 4IRUB 4KQHA 3Q3EA 2ZVQX 3L1UA 4MGKR 5CT4A 4JBLA 5KI6A 2GYVA 5K6TA 3OVMA 1YMUA 3NVDA 2V3CC 2Y93A 1J9EA 3KYCB 4GYJA 1OPIA 1COWD 1Q16A 1OY8A 1GRNA 3EGWA 2VONA 3TIVA 5D1HA 2OAP1 2Z9BA 3U44B 2XGGA 5AW7A 3Q8YA 1UEIA 4MGIR 2BFBB 2N75A 4L0MA 2I38A 5F33A 4AYTA 2R3VA 3PGVA 4BHQA 1REQB 1V4BA 1HLWA 1AHIA 2W93A 1R8XA 4M5NA 3RI3A 1N6LA 3GR0A 2BV3A 2CHGA 1WEZA 4HD8A 4D3YA 1WDMA 4M1MA 3MM5B 3K09C 3R3UA 2IVFB 1ZK4A 3EMVA 1CUUA 3PVSA 2QL9A 5A7GA 2NP6A 3C2PA 4Q1VA 1A76A 5ADZA 4AZSA 4DV0F 521PA 2XNJA 4IKEA 1RHUB 3VF0B 4H4EA 2N3LA 4CQJA 4JSTA 3OHMA 1ZPDA 3R7SB 2XF2A 3R76A 3FZQA 4C20A 3TRDA 5JAOA 5K2OA 4W7IA 3NWJA 2FWPA 4PZAA 3VR3D 2W6NA 2PFSA 1T8RA 3PU6A 2B3TB 3KWMA 4NBRA 1A8HA 5SYAA 1ZJ4A 4P9SA 2RD5C 4DDHA 3U7QA 4X4QA 3BCHA 3H3XA 4JR1A 5DYWA 3T1NA 3MAAC 5DG8A 1VMIA 4NZYA 1KC3A 2IZ7A 2WZDA 1E1DA 3TKLA 3SSSA 3K9BA 1VQYA 1YHYA 2C8LA 3ELWA 1D03A 3Q15C 4J7CA 1WC4A 5TMBA 4ZOAA 1YU9A 2ZTSA 1AURA 3UJ7A 2BKXA 4MWZA 1CYDA 2F3JA 4XTTA 2APOA 3EXG2 5H16A 5AXNA 3CCCA 5IJZA 2X0KA 2ZVSA 3K8YA 3D7SB 3RB4A 1X7WB 4Y9TA 4HDKA 1NUHA 2W2NP 1W30A 2O2HA 2DITA 1A0OB 2MINA 3KJIA 3ONEA 4DCCA 3GEEA 4ZVNA 3W9YA 8MHTA 3ZHYA 3OQMA 3FPSA 1LW0A 5GP1A 1U0TA 3EGVA 4I8DA 5BSWA 4I6AA 4NCNA 4ECZA 4CEHB 4D3SA 3LNCA 4YJGA 3TL6A 4NMXA 5AM0A 5DTQA 3THWA 3WGQA 4BMNA 4AF6A 3ZU5A 4E1VA 1RLCL 1V3RA 1N3YA 3ELYA 3DFMA 2G8NA 1JXAA 2NNWB 1IIBA 1KKMA 2C5FA 2QXYA 1VSBA 2XVMA 3JR7A 2R2GA 3ZNOA 1TTPB 2HBQA 2OBFA 4LRCA 2PX5A 2ZDHA 3RC1A 3JQPA 1DCKA 4UNPA 2H51A 4LF9F 1NQVA 5EJ9A 2H0AA 1N4DA 2BFPA 4Y2JA 2XAUA 4ZEWA 2ATCB 5FOSA 1NKCA 2WMDA 3JQBA 2MYFA 4BX0A 1YZTA 3QT5A 4FEGA 3TX0A 2BTQA 5IVIA 4M1OA 4JI0B 3K17A 2H4WA 3MERA 5IKEA 2XYVA 3C3BA 5F73A 3HRIA 1TL3B 4UCFA 2EFHB 1PJLA 4I36A 3J7Z5 1TL7C 4RXUA 3HXOA 3QU7A 2QMZA 5TR9A 1BDMA 5LYYA 4WV3A 1RQXA 1VLVA 3I04A 5J5CA 3O8QB 2Z1MA 3ANSA 3TOCA 2EX4A 3UV6A 4J9VA 1TK0A 4LF6J 4WESB 3G02A 3KEFA 2R6HA 1QVGR 4IG9A 1X5OA 3BGUA 2GF2A 1JEYA 4RADA 3A1SA 4R1QA 3O75A 1CJUA 1PDVA 1KYWA 1ZNWA 2V4UA 1IBKJ 2EJWA 2CPHA 4EUHA 3RU3A 4WA7A 1HQUA 2EXXA 2ZOGA 2DGTA 2FMFA 4YRLA 2C1EB 2LQJA 4NLUA 2GI4A 4NY1A 2POQX 4BKUA 4EUEA 1AVTA 1HMYA 2JSXA 4FF2A 1S9GB 4B9MA 4JJ8A 5F5XA 5KFKA 4Q00A 1K1QA 1PFGA 1ZPVA 2CQ2A 2MTLA 2YQ4A 5HQ3B 2O2DA 2VPWA 3Q41A 2CNNA 5B3JC 1GA1A 2V6BA 1SH7A 2O5VA 4EX6A 1QG4A 5DLPA 1ONPA 4HHEA 4BASA 3CX8A 3EBLA 4EJSB 1TK9A 1N5SA 2FY8A 3KELA 4WN9A 4OXXA 5KOHB 1LSOA 1P2DA 4E21A 3PRBA 3K5IA 4EQ6B 1P9RA 4YRCA 1JPNA 2BEFA 1KJ9A 2IUEA 1EX9A 4KNWA 1ZTTA 4HFMA 2FVRA 5F3TA 1E9AA 4G4JA 1UPPA 4MGHA 1NM5A 2X1FA 2RGNA 1ZSNA 2CJKA 3VZHA 2YUIA 4Q18A 3SFTA 4HWKA 2MZRA 2DHRA 3PQ6A 3TKYA 4Q39A 3ANYB 1YHQS 3EHDA 4K9SA 5E6RA 5KO2A 3HZOA 4PYOA 4JHLA 2X51A 5IZ4A 4G4IA 5A6VA 3LBYA 4O2LA 4BFLA 2GDJA 5T3UA 2WIKA 3GBSA 3C1TA 2YQ5A 4GM1A 4R7ZA 3A8EA 1TFYA 3OQNA 3E15A 4BC0A 5T7BA 4V39A 1D8AA 3I8XA 2ZEJA 4IQGA 1REGX 3NGMA 1SOMA 3UFCX 3OUYA 5HCNA 5JVHQ 1VE9A 4X6YA 4KRFA 3MB8A 4ENOA 4XUCA 1QHHA 3ZK9A 4IZ6A 4BNVA 1VCMA 4AZ0B 3M2RB 5L38A 3GI1A 2ZSJA 4M1SA 2JVKA 1R8QA 2HS4A 1UKEA 4CQMA 3SQNA 3QNMA 1FSZA 1D09B 1P2UA 1USUA 3C1UA 4ER5A 3E18A 4F3QA 4OTZA 1X31C 3ZXIA 4Y2UA 3LC7O 3WHLA 4ZPCA 1GGVA 2O9JA 2JIDA 5IAJA 2VDPB 3OBBA 2HF8A 4BIIA 3FMPB 4I50F 4BKOA 1A4XA 4BTLA 1YRBA 4UAJA 5KJ1A 1T9TA 5AI8A 1EFAA 2GLUA 5KHAA 5PGMA 4LF1A 2F3SA 1H6BA 3M8QA 3PI7A 4OK5A 3TANA 3IQZA 2BXJA 3U27A 4AQYB 3L3CA 2IBMA 3ORQA 5B3AA 5JFGA 3G5AA 3MVEA 5AJUA 2ROGA 3H84A 2XMPA 3UUFA 2OBBA 1ZCZA 2W2OP 5CBPB 4QKQA 5AVRA 2W70A 3AUYA 3R9XA 1LRJA 2YNFB 4F7WA 4PYJA 2BJ7A 1JMYA 4FLFA 4M5HA 1KK2A 1JTEA 2WB2A 4YDXA 3JWGA 1Q84A 3MXOA 1XDWA 1J8DA 2FGJA 3TLYA 4BBAA 4W7SA 3DLGB 2JD1A 1P5FA 3C98A 4NBKA 3P6YC 4A2WA 4MVJP 3KEMA 2G3YA 4DR3J 3P96A 3IRXA 4HAWA 5LQJA 3Q9LA 4OJ1A 2BM1A 2OBXA 1E7SA 1G2IA 2W0MA 3I0ZA 5M2UA 2QLMA 4TXNA 4WKCA 3FKBA 4C14A 3ZPXA 3IYLW 4DNOA 1IWAA 2IDMA 4OYZA 3GY0A 3MELA 4C04A 2H2IA 1M5TA 5JAZA 2FPIB 5C8DA 2OSBA 5B1EA 5LD2B 2JVOA 3ZX4A 2O2YA 3BN4A 3FBBA 2I7TA 3HEBA 5CJJA 3FROA 5J2TA 3N79A 4LCJA 2O6LA 4YRFA 2WP0A 3KK0A 2FZKB 2P41A 4GLLA 1B3BA 4BO3A 1TYBE 1Y48E 2PUHA 1XRMA 5F52A 2RH8A 2ST1A 1K7EB 3PYMA 2W4QA 3R2DJ 1HORA 4OQ4A 1AZWA 3DAYA 1Y9ZA 3CO9A 4X4UA 4L78A 1H1TA 5AW6A 3BILA 5KYWA 3MM7A 3MBKA 4EFKA 5TF0A 3JQAA 2RKOA 1VYHA 4JI6F 1TZMA 5K0CA 4Y1GA 5BSHA 1U65A 4UNQA 3OWOA 2AFHB 4CYUB 1JLEB 1MA3A 5LZ4A 3FCSB 2LRHA 5D3QA 3JYTB 1U2GC 3I92A 3R8YA 3ILVA 2BF7A 1N3BA 4BYGA 1JPUA 3PFIA 1RT4B 1JNRB 3VI4B 5LCXA 3U09A 5CT6A 4DQVA 4ZOQI 3RSGA 2CJBA 1P0PA 2IYXA 4AG3A 5H4GA 1Y4UA 4ZMBA 2GCGA 4TMVA 2IRXA 2VJQA 1D8ZA 5H5JA 2XUHA 1C7RA 2Y9MB 1OFHA 1E9VA 2WKQA 1E3LA 3Q7QA 2EZ4A 3PJEA 2VH1A 4FS3A 2J0UA 4NXNJ 1HPZB 3KLNA 1H8EA 3HU1A 5ALUA 4ECQA 3F98A 2HTFA 1S9FA 3GIMA 4LI3X 5GMKa 3T9EA 3NGTA 2MJLA 3BE5A 2AEFA 3C8HA 4A8MP 1XQIA 4CIYA 4YP9A 2XY7A 1LK0A 3EXIB 3BBBA 2HIYA 1OJLA 2HWYA 4LSLB 1RWOB 4BX8A 1A96A 3W5IA 4FYXB 4JLOA 3T9AA 4HI1A 4B83A 1I32A 2W2KB 4BWFB 3E7PA 3GG0A 4D45A 1LDBA 3OQ6A 3H2YA 1NLFA 3NHBA 1N36B 4OZ1A 2PSFA 1ST2A 5EFZA 1RZRA 1PKUA 3EGIA 2OG1A 4LFBJ 1S1XB 3MM8A 1RM4A 4WE1A 2IHVA 1XDDA 1NBME 4BMVA 3X1MA 3UQZA 3JQGA 5C5IA 4FYYB 3P9QA 5DP2A 5J2NA 2TSYB 4LR9A 3BMOA 3W06A 1L5GB 4OH7A 1JIQA 4W9NA 5EIWA 1UZDA 3PX7A 4FOLA 1ZAYA 3VR5A 4QQKA 2I8CA 5ES4B 5F4ZA 4GKBA 1BMFD 2CSUA 3A12A 3NWOA 4HI2A 4O2AF 2C7BA 4P4GA 2F1KA 4DDKA 1MVLA 4GLOA 2MEWA 5JQWA 5D3KA 4Q3OA 4YMHA 1RT6A 3NTXA 4HXYA 3MM6B 2AF4C 3WQPA 1MTOA 1M2KA 3KT6A 2OPBA 4UXJA 5JMWA 4YFUA 2FEOA 4OHVA 1RE0A 2P6UA 1RJ9A 2W2LD 1KZ9A 2MWMA 4P5DA 1E2LA 1IY1A 2EBFX 1XFDA 1DT3A 4B7CA 2ZM5A 1VJ0A 3QRQA 1ZWLA 2EW1A 4EVIA 1JHAA 3GJ5A 3Q5EA 1Z0FA 3R9LA 3CZPA 2VC1A 4V38A 4K0KF 3NIWA 1GAQA 1L5FA 1MOQA 1CQXA 3OP4A 3KZOA 4FXWA 4FYVB 1C9NA 2R7KA 5CX4A 1ORTA 3HFVA 4KKOB 2P65A 4JLVA 1U81A 2FTKE 3GOQA 3CCSS 1PG5A 5F5LA 2ZYVX 3E22A 2BMJA 1RSCA 1SEPA 4DMKA 4IFIA 2D5AA 3H1AA 2GPNA 3CSKA 1KWKA 4DWWA 4WCFB 3AW8A 1E79D 3AB2B 2XKBA 4LFAF 2V68A 4IEFB 1CLUA 2CCKA 1R18A 4DWOA 4M8LA 1FSGA 1RRPA 3QF4B 3I1JA 4L15A 2DBQA 3GCXP 4TXHA 1CKEA 4PZUA 2IOHA 2P0EA 4AWBA 4R4JA 2CNKB 2YY6A 4ZK2A 1WHWA 1PHPA 4DYVA 2DXDA 3DOCA 2YRXA 2OIHA 3H0EA 1GQOA 3WK5A 5G3ZA 3X0DA 1R0LA 2WF5A 1TJPB 2WT8A 4AZ3A 1SA0B 2O3QA 2XNDD 3QF7A 2WSMA 1E5DA 1F0KA 3LY9A 3V8NA 1XRSB 3G8YA 3PTLA 2LU1A 3ER9A 4CCSA 1XU7A 4DR4F 4DLEA 3ZE1B 4NAUA 2G9UA 3RTCA 2PJUA 4IDNA 1QCZA 2VJMB 4QD3A 1KI8A 3OMLA 1FU7A 4ZPXA 4I2QB 2FXIA 3GDFA 1A04A 4NEYA 4CTAA 3GJQA 4GBJA 3VDXA 4ZGGA 3S5JA 4XWAA 4OHZA 5A2QA 5EKUA 4M63A 3QKSA 2DHQA 5F7XA 5HJXA 4D9EA 3LH5A 2AJLI 3LT4A 1Y81A 2XDYA 2Q5LA 3DQZA 4G6ZA 1QH8B 1IWGA 2VFSA 2Z57B 4JV5F 5HX7A 2LCWA 2NP7A 3SBXA 1UC5B 5CT9A 1ACMB 2CHFA 5HZMA 5DLFA 4I8IA 2C4HA 5A71A 3SI8A 1G8KA 2R7MA 3IDZA 5EXPA 4TL9A 4F6CA 4U6PA 5EMMA 3FVQA 1VA5A 3JB9k 4AG5A 3RFCA 4M0EA 1ZI9A 2R5NA 1F6TA 2QN7A 2QX0A 4YMGA 1DX9A 5E6SB 2BFCB 4US1R 4YJHA 1I1GA 1JYEA 4FXOA 4N8NA 2EZ8A 4RV9A 1W4ZA 1ZK1A 3MMCB 3TI9A 3CX4A 4DCUA 3DBIA 3BS9A 3HP1A 2NU6B 2NVWA 3HSKA 4PQUB 4FHZA 3QKRB 3TUJC 4CBVA 1EDEA 4CDIA 1C1XA 4O4JB 3J7A1 4QDUA 2MKHA 1UW9A 2ISCA 2AX3A 1UK7A 2OFWA 3EMBA 5JQGF 4DV6B 3GIJA 3MEGA 1YWXA 2BHRA 2PZ8A 2Q5OA 1JDBC 3R77A 1TYDE 5B6IA 4CLWA 3O1HB 3BWEA 3MMNA 4EY6A 1E64A 3QE4A 3FPFA 3QLUC 4HTJA 2VBXA 4FILA 1L5KA 2V9PA 4ICIA 1QIJA 1C4AA 2I33A 3UD3P 1SVWA 2DG2A 1ZYUA 1NDCA 5FEMA 4PYIA 1IY2A 1M8FA 5F64A 4DILA 1NXTA 4MKHA 2J8ZA 1I7LA 5DYYA 2XB2D 3OFKA 1U1OA 3HSZA 2DY9A 1GSIA 2JFVA 4HGRA 2UXDB 1YRUA 2QTLA 3FFAA 4V1CB 1QPZA 2Q6IA 3T7CA 2EGHA 1HWLA 1KR4A 1U99A 3Q9NA 4E30A 2SKEA 5CDGA 2FFQA 3UGKA 1P5ZB 3C6TB 4KRWA 2A10A 2AN9A 4QU6A 4N0MA 5DU2A 2IEDA 1M8PA 3PGLA 4HGYA 5U4XA 1GCAA 2WIJA 1HYEA 4LKOA 3U61B 1U8FO 3OR1A 3UV7A 5CDTA 4JYAF 3NO4A 1X5TA 4A8KA 2VDWB 1PNQA 1Y6JA 2X0DA 3RTDA 4DC1A 4ZVPA 2E7XA 1JQBA 4LJSA 1AK2A 4DUTA 3QIDA 1W7AA 5IJAA 5EXXA 1PGZA 5G1NA 5I9IA 1UBOS 1QC5B 2AKYA 2YV2A 4ZYUA 3IRUA 4KFSA 2HA5A 3EEBA 4S1PA 2WLTA 3NAMA 4DLGA 1RE1A 2KW5A 4GMKA 1UF9A 1ICEA 2KT3A 4HPJB 4YAOA 3O4FA 2FWMX 2V67A 1S97A 3TZXA 3FRZA 3ZZOA 3JRXA 4Q5VA 2WTMA 2QFJA 1FOEB 3NOCA 3Q88A 4U63A 1OMOA 3M6IA 1XKQA 4RJIA 5J1SB 4NU5A 4O33A 3G8AA 3UMSA 3JSAA 3Q0IA 3U4GA 3OTQA 3T3HA 1TOAA 1JIJA 5JPDA 1UWVA 1IWOA 3EF1A 2EYUA 3IAHA 3EQ9A 5A4JA 1YQWA 5CPFA 4XR4A 2JVRA 2PJZA 3HCEA 3HVJA 1ADBA 1NK4A 4DLUA 4ZYLA 4C4TA 3TOXA 1P81A 2O2IA 5H59A 3VH4A 1YR3A 4DUYB 5CG2A 2X9VA 2YS7A 3FBFA 2B8JA 3AM5A 1T6NA 4Y67A 2GB4A 1UWBA 1JFSA 4DXHA 1Y3DE 5ALMA 2MYTA 1OU0A 3N3AC 2LQBA 4D4MA 1JPVA 4LZJA 4IZHA 3RSQA 3VO9A 2JVJA 4WBSA 3W8FA 2XHZA 2P27A 1N57A 5FAKA 1NC1A 5BO5A 4KWCA 2ZYTX 3PDNA 4HAIA 3F7NA 2GZHA 3SZ2A 2V5UA 3IBFA 2AJ2A 2J6UA 2V4RA 1RAGB 2V8HA 3JZDA 4YB8A 3IIIA 4ZYWA 3ZWCA 3WXMA 4URUR 3R7FA 4E6EA 5A04A 2OBNA 2Q1SA 5ETRA 2BYCA 1AE1A 4GBED 2QRMA 4Y1RB 4LY0A 2L2QA 4MV8A 1ENOA 3UBMA 2CQIA 5JUWA 2PS1A 3OY7A 3BSFA 4H17A 1P6TA 5I7EA 2IPOA 5C8YB 4ANEA 2C5GA 5IYZF 4CO3A 2IDEA 1TX4B 4NFHA 3U5ZB 1YVUA 2DGDA 1RT5B 3GLIA 3JYQA 2O57A 2VATA 1WRBA 2HRYA 4NU6A 5JNTA 1T34A 2JLYA 4U7JA 3RYHB 4KLRA 2C9ZA 3P9ZA 4PQFA 4AY6A 4L76A 1M67A 1NX6A 4N0QA 3CCBA 3TAHA 2NYVA 4L95C 1J2TA 5C52B 3TNYA 2JHCA 1ONSA 3EUEA 2EAUA 4Y8VA 3ZGXA 2UU9F 2Q6TA 3LUAA 3KHSA 3CLTC 2YPYA 2WZCA 3BICA 4INAA 2DZDA 2WTUA 3A9VA 3FVVA 3KOOA 4WZAE 1NW3A 2JGFA 2REBA 2W42A 1W36B 3PR1A 5EIAA 1OBHA 1TL5A 4ZN1A 3WLLA 3TEFA 2ZBEA 4Z7QB 2Y6VA 1QHNA 4TS4A 2YHIB 1WULS 1UBGA 1ETUA 4BGDA 2GHRA 3CRZA 2BKOA 2RKWA 3P0JA 1XEZA 3EXEB 5CD4H 1SUEA 2C04A 4MTPA 1P0QA 1W85A 4M60A 4N6NA 5A4IS 3LC1O 1EAMA 2WOMA 1LTQA 2CLHB 4DR1B 4NSNA 3D0KA 2AXPA 1TCVA 5DK6A 5HFAA 1JH9A 4X60A 3DXFA 1KIFA 5BQPA 2XQFA 1JEQB 3CT9A 2A92A 1R74A 1DXQA 1U63A 1F6WA 3EPPA 4BJ1A 3ECAA 3B3FA 3WNZA 3T0IA 2CPZA 3PLAE 4OJTA 1NZ8A 5AT1B 2HQBA 3KOUA 5B1IA 1AGRA 1TJ5A 2RKIA 2NXJA 3VQTA 3R09A 2W4MA 4TT3D 2M6RA 3ROZA 3GJRB 3L1KA 5AOAA 2BGNA 5M3BA 4QWDA 3JU3A 1FQOA 2XLCA 1XEWX 3K5MA 1UBCA 4B3DA 3LL7A 5BVGA 2HW3A 3ZOKA 1R9NA 1A9PA 3QPBA 1Z22A 4K4ZA 1OYWA 2M6KA 2QMOA 1M5KC 5GADI 4I08A 1A7KA 2WFLA 2AC4A 3DVRX 3P5BP 5CJPA 3CMCO 4J49A 1HKHA 3WFIA 4CT5A 5FOXA 3GGPA 1N5LA 1ZNYA 4MV7A 3AY7A 3FUUA 1Z7YA 1A7JA 1CUEA 1XRQA 2FCRA 3ORFA 2BZSA 2PUJA 3V1TC 3K92A 2E89A 4X45A 2XB6A 1S2GA 2C9OA 3RGWS 3IS3A 1H2EA 3MSCA 2Q1UA 3BHJA 2D3UA 2QT0A 3DMJA 2ECQA 1L7PA 1U2QA 4PAMA 4UD2A 4ROTA 3Q3IA 1E6VA 4WK1A 4R1TA 3ZY4A 4ITRC 1GKKA 3G0IA 3SQOP 1NY6A 3MJDA 3LYUA 4W6ZA 3C3LA 5B0DA 1EGAA 4PANA 2BZ0A 3L4KA 2I8LA 2H1SA 3IMCA 3GJTB 4N0DA 4R0MA 2Q9BA 4CKWB 1H85A 4P3PA 2C83A 4H1UA 4BVAA 2LQ9A 4QLBA 2LVWA 1T2FA 5CXUA 1GMWA 3FPJA 3PLNA 1L7VC 2GXAA 2O8EB 4O8CA 1BGXT 2DNOA 4JBWA 2G2OA 5K0JA 3HBNA 5JD4A 2V1XA 3NKLA 2XZLA 5B1DA 1B70B 3CXUA 2AE1A 3BV8A 4PXAA 5KHLB 1I36A 4OAQA 4ER3A 3QVSA 2WAYA 2ZUGA 5JNSA 1QQ6A 3OZRA 4HDMB 3SHFA 1F2TB 3R74A 3OEEA 2WVFA 3NRBA 5AJHA 3CURA 4PYQA 4ISCA 3BIOA 2ASEA 2V7TA 1I24A 2AOTB 1DWPA 2DR9A 4JEMA 1N6KA 4KQ6A 1RT3B 1XJWA 2I7DA 1YS2X 5F8JA 5BYRA 4TQRA 3B82A 5DVZA 1CY4A 5JV5A 3ZDAA 2YKQA 3DAFA 1WHSB 3EA5A 1GXSB 3MF4A 1WUIS 5HBMB 2XWYA 3QFRA 4BRZA 4YJFB 1KVIA 4F8JA 4O4GA 1MZVA 4UTZA 1B0AA 4GKJB 3H5AA 1JR3E 2JEOA 4X64F 2C3PA 1UKUA 2ZFHA 4RE6A 4D3GA 3KO8A 4DV3J 2OGZA 1MV5A 3W5HA 4DR6J 1RXCA 4HWPA 3RQSA 4E98A 1MOSA 4MGZR 4U0KA 4DSLA 4UVIA 2FKAA 2PE5A 4Y65A 4F92B 4KGDA 3HU2A 3NDPA 2GHPA 3MTQA 2K7ZA 3KHLA 4WZMA 2ISQA 3IAEA 2XGPA 3UA4A 5GAHU 4IVPA 4HDRA 1RKUA 1IZ8A 5IQQA 1N5YB 1ZCAA 4F4CA 2O3TA 5FPYA 3CW9A 3NNNA 3LP1A 1KFJB 4KL8S 5HDBB 5LM7E 1M7GA 3V3TA 4DKJA 2BLLA 2ECPA 2X2OA 1IHDA 4ALJA 3IC5A 5ALZA 2V54A 2OB1A 1A9QA 2HIGA 4NDAA 4ZU3A 3I6YA 4B33A 1JLHA 1NWCA 1C7JA 1B74A 1UJ4A 3GLGA 2H9YA 5JAQA 1X8DA 1JALA 4ZN3A 3P52A 2VT7A 4HATA 3WKEA 4B6FA 2RKBA 2NO9A 2DHSA 5EZ5A 2O8BA 1BY9A 4A5OA 1ZMRA 1VZ3A 5A7HA 4V3BA 2AI3A 4WFJA 1G8AA 2VBGA 4YDQA 4X94A 1BDHA 3L7IA 3BDVA 3HHKA 1YOBA 4PUOA 2C5BA 5ERGB 3TRHA 4RELA 1M83A 1FUYB 3C6YA 1KDYA 2JIBA 3NIBA 1RTJB 1DXYA 2CQ1A 1OWMA 2MQPA 2V2QA 1OLUA 5BMVB 2VBYA 2EBHX 1S6YA 1C9EA 3HKBA 5SUHA 4HI0E 1QO9A 2VDUE 4XIYA 1I2CA 1T2VA 4DLYA 4BJHB 4UNIA 5B2FA 4TVBA 1U47A 1D9DA 4FJ1A 3FGZA 2O52A 2KSQA 4GPIB 3C3WA 2P6RA 2FPGB 2VNSA 1XNRJ 4IILA 2BMBA 3OLCX 1FTYA 2V4JB 1OIAA 1KAOA 3D2AA 2QX7A 3PXAA 3W1EA 1PLKA 2FZCA 4UTXA 3V4MA 4OATA 5AJXA 3UCZP 1WW3A 1CNFA 2PYZA 2Q6OA 1S10A 3ANNA 3PQEA 1LVGA 1RHRA 1R27A 4EPRA 1KVRA 5AR1A 2Z8XA 1G41A 1SC9A 1GV1A 2PO4A 4LY9A 3BSSA 1QDUB 1H3FA 2QRQA 1CZHA 3GRZA 4FIDA 1CUHA 4F86A 4MK8A 3LUFA 3AQOA 3BKWA 3GPLA 2HJVA 4FFDA 1H6CA 3DEIA 4C3ZA 4JWTA 3SV4A 2FPPB 4N7JA 3A6ZA 3DZBA 2A2DA 5DX8A 3GJSA 4G0NA 1ZR2A 5JH7A 3FZBA 5JVDF 2OPRA 1T1EA 2PIDA 1YRAA 4HNHA 3GVPA 4P3OA 3SSAA 4QPPA 1O0BA 5DM60 4DDMA 2J67A 2AT1B 3PUXA 3A7EA 3SICE 1HYHA 1X74A 4NAHA 2AMVA 3TLCA 4DCPB 2E7WA 4F2SA 4FYDA 3VR6H 4JOQA 3TD9A 4K9DA 2HEGA 3VOTA 4ND8B 2I03A 4OK3A 1STOA 3MMBB 4ITVA 1O6CA 1Q1QA 3DMTC 1T1GA 1WEHA 2XPCA 3OIVA 1RT7A 2CGEA 4MJ7A 3BD9A 3RS2A 4F4WA 3LP0B 4B2YA 4MQUA 4GLJA 1IKYA 1HDEA 3NJRA 3P4UA 3UJ8A 3CD6S 2IHZA 4TWIA 1E3SA 2B1IA 1MN6A 3GAFA 1DHRA 1RU1A 2X4GA 1DKNA 2QRVB 2E7VA 1LS6A 5A3VA 5F0WA 4U95A 3K59A 5F8IA 2RS8A 3JQFA 2ORIA 3A9TA 5F7OA 1IIRA 4B3JA 1H4TA 3A3KA 1I6KA 1HE4A 4XWWA 10MHA 5HN0A 4L3VA 1TU0A 3ETNA 1I14A 1R31A 5BSUA 4DSFA 2AW3A 1WG4A 3CCWA 4M87A 4TKTA 3D4JA 3NRCA 3OM0A 4I3GA 2EJBA 4HPWA 2ZRBA 5IJ0A 1NHUA 3BO4A 3WGOA 4B7ZA 1G4HA 3IAS1 4QJIA 3F71A 4O59O 4IIGA 4Q7MB 4PVDA 5I7AA 1EP4A 3W9IA 1FCAA 5B2ZA 3WBJA 4P7TA 4UW9A 1NOIA 4MIAA 3PRJA 1AGNA 1RNLA 2W2NA 5L9NA 5LZ9A 1U5BB 4FS8A 1OO0B 4PGGA 2WF9A 4F1WA 4DCGA 4M5JA 4Z4HA 2QQFA 5A0TA 1PT9A 4BLOA 1NJYA 2H52A 3IP7A 4Z37A 1TJYA 5FLEX 3LP2B 3ZYZA 1CC8A 1MQAA 2XMWA 1ZH4A 4CO0A 3OD1A 5FD8A 3PG9A 3EGXB 3J80U 4R2XA 1WABA 2OGWA 3KG4A 3EF0A 4WP9A 4C0LA 1P6XA 5CLLA 3KLEA 2XVZA 4FB4A 2IITA 5A5DA 4TV8A 3ZLVA 1USIA 1IUKA 4MVJD 4AJPA 1SCJA 2W2PA 2AMCB 1FJ7A 1SU4A 4YRDA 4JASB 2DO4A 1AB5A 3CLSD 2RSQA 3FC9A 2OCXA 3W6ZA 2VPZB 2C78A 1NW8A 3DHEA 2B1QA 5EEHA 2HK8A 3HHLD 2RG1A 2WIGA 3DMHA 1VJ1A 4ECVA 4ZHRB 1M9NA 4Z51A 3RTEA 4RZRA 1DO0A 2LQ8A 4FDMA 1FDOA 3IJPA 3S2SA 1UFWA 2NNLD 5FXMA 4O08A 5LUAA 4A15A 1RABA 2Q21A 4BPRA 2C7PA 1H8HD 5BWCA 1BFUA 2RSLA 2WSIA 1D4FA 5AVJA 2FN7A 4Z0HO 4KVZA 1WKVA 1JAXA 3C5EA 4YONB 4NNOA 3OTDA 2HIQA 1AUDA 4XPCA 3CEJA 2ZTLA 5C25A 2R7VA 4LF7B 1OGIA 3CVUA 1TKZA 3ZDXB 5LMNB 4KXQA 1ZD8A 1IZYA 4IDHA 2GJ2A 1XVTA 1UXHA 4UMFA 5CDFE 1TQ6A 1EVLA 3UM9A 5ELLA 2G0NA 4KQMA 3H16A 2NSYA 4Y2MA 2LTAA 3DRRB 1BD6A 1GNVA 1E6YB 3QSGA 3IVAA 4C0XA 5JY6A 4AS2A 3LHSA 2FUG9 2JLRA 3LGXA 4K6CA 1HSOA 1Q83A 2R7NA 1QHEA 4QRIA 3S0JA 2EU8A 3TARA 2PY6A 5IS2A 4DANA 4DSEA 4EENA 5I7UA 2YWKA 1PD1A 3E1GA 1U45A 3BFPA 3ESBA 1OJ4A 4N7RA 1AV7A 3K9CA 1VJGA 5G53C 4BCAA 1S8FA 2JFFA 5HTKA 1S1WB 1G59A 2A86A 1Q0QA 2JHEA 3T7AA 4D57A 4RD0A 2DCUB 1KP6A 3KLGB 4CRWB 4EOGA 3SDEA 4WZAB 2V8PA 5HI7A 3RSZA 5KQRA 2UVWA 4YQYA 2BGLA 3FNGA 3SIXA 3ZXWA 1E0AA 1I2BA 2Z3ZA 4K6OA 1N9KA 2PYIA 3DJYA 3V6DB 1FJ2A 2O19A 4PFSA 1QPGA 1C4WA 1RPZA 4Q12A 3BFXA 4CIOA 1ILEA 3I6MA 4JI3B 1KFDA 2GD1O 1Z7EA 2I7CA 4EY8A 4XPEA 4GSLA 3WLNA 1MFPA 3EHEA 4OFWA 2DR5A 2UVQA 2NYUA 2KXFA 4Q7EA 1G7CB 1EJ0A 2BVNA 1FU8A 4G0VA 3BRSA 1KOLA 2YMLA 5DQIA 2CXNA 1IOWA 3WDLA 4DSNA 1MLAA 1P8JA 1OWXA 3O8WA 1F3FA 4QZVB 1SXPA 3NEYA 1XL1A 4N8EA 2WB4A 1SD1A 5BSTA 2OFOA 2PL3A 4P7JA 4WECA 3TZKA 1QO0D 3EF3A 2HWWA 1FB5A 3N5BA 2VJPA 5K8JB 3FHJA 4HNUA 3RRBA 2R42A 3FOFC 1ODFA 4J9SA 3NG1A 4G2NA 3S2EA 2QA1A 1AKYA 5KG3A 3FYSA 3D1LA 3QIPB 3WYEA 1X7YB 4TKLA 4RW7A 3V2UC 2W6CX 2AJDA 2K2PA 3LSTA 1B7FA 4QQRA 3DZKA 4M9SA 3L5KA 4ZK6A 2F48A 2FEXA 4Q2MA 2NAFA 4PC7A 2HSZA 4LQCA 5IKPA 5CFQA 4LV5B 4EIWA 1SZPA 3PFHA 3JQEA 4G5RA 2GCPA 1M6VA 4KR3A 4A47A 3EEQA 4GC9A 5FJIA 1Q7YT 4C7BA 2YZ2A 3W2VA 3OCYA 2HYDA 4BBJA 2QDXA 2DT9A 3GGJA 1DFHA 4P82A 3H2IA 2EHJA 4DUGD 1ZLXA 2IYYA 5AICA 4FWTA 5JD5A 1XPRA 4I2PB 3W2WA 1VKHA 2AYMA 4USTA 2YFHA 4C88A 3E4DA 4IHJB 3DFEA 1DWOA 5A3QA 1NI5A 3O9VA 4F3RA 6GPBA 4FYWB 1W44A 3OWXA 1VLMA 5LBIA 1XDGA 2PCJA 3GPIA 4B3XA 3P9SA 2VQSA 1VJWA 2K7KA 3UMYA 3M8RA 4KITB 4DF8A 3VO8A 1KKHA 3T3NA 2F90A 4WBFA 5E8RA 3QMVA 4PLZA 1YR7A 1HD0A 1EUDA 4ZTZB 1TDJA 2VBFA 4IDPA 2G36A 4F6RA 2KI2A 3DHXA 4H35A 4XGRA 2BJWA 3LPYA 3HKEA 1BN7A 1VRVA 1U0FA 4Q3EA 5FOWA 1MIOB 3ZBUA 2Y1LA 3QUQA 4KTQA 4CL3A 1HNZB 5KSYA 1UMKA 5F3ZA 4HZUB 3RH0A 3N7TA 3M2UA 3ZZUA 1KYTA 1VKNA 2OV3A 4LK2A 2SXLA 5ELMA 3KVNA 3BO2A 2ZJ7A 5AESA 5E9JA 2YY5A 3NHRA 3P8BB 3PCTA 4K40A 3RYTC 3K3PA 2GEBA 3K1AB 3VGJA 3V4RA 1G66A 4MKRA 3BEGB 5LA6F 4ALLA 5F9FA 1WR8A 2WKSA 5B2EA 3HD2A 4A10A 2F4FA 4OD0A 3R7NB 1T8YA 3GYNA 4QUJA 4G37A 2ATEA 1P80A 1T8SA 3UT0A 1UZNA 1RKJA 2F1HA 3OY2A 2VWQA 2X42A 1H2HA 4HYTA 4QXAA 4RHFA 1KQSR 1YBHA 2OUGA 1V3ZA 4FIZA 3AFHA 3FGVA 4QGSA 2PTGA 1IZZA 2CZ4A 3TNFA 1KY3A 4J6FA 4KCGA 4RTNA 2D7SA 2B1GA 1J09A 3KUCA 1A8SA 2RDMA 2PGCA 2AR9A 4F9GA 4ZEOA 4LF4J 1YVRA 5LQUA 4DAEA 2J3QA 3SJAA 4CIVA 3S1TA 1S6UA 2YWBA 1I94B 4I1TA 2B5VA 4R9SA 3MINB 4OXNA 1N6HA 2H9ZA 1EQAA 4XJTA 3C16A 1PR5A 3AB3A 4L1KA 4WNAB 5KNDH 3J7ZT 1D2HA 1DRVA 1GEHA 5HKBA 1ULAA 3HBMA 3AJ8A 5F8NA 3B3GA 5JBQA 3P2IA 2WM9B 3V97A 1AHNA 1W5AA 3CUYA 1NI4B 3CD5A 1J8QA 3GLUA 4IVRA 1JDUA 5F2KA 3BEDA 1P8AA 4ARSA 1DQYA 2I1WA 3TYXA 1TKTA 1B1CA 2UKDA 3DYBA 1ZA2B 4EYQA 4A8QA 1J23A 2RGEA 2NOAA 1J6UA 1XZEA 3F97A 3H5IA 1PQYA 4UDOA 1KTIA 2HI0A 2A88A 1APBA 3F49S 2C2XA 3NL0A 2O5RA 2BOVA 1A82A 2FSPA 1SJ1A 1Q1NA 3ZV5A 1FRZA 5G4LA 3EDMA 4A16A 2DRBA 3KLMX 3S2ZA 3IG1B 1PR6A 4QDXA 2ZJ5A 1FX4A 3FBWA 2Q9CA 2YKPA 3EZ2A 2JEZA 3NB0A 2JOQA 4NJMB 2G5TA 4A6DA 2YW2A 3PKJA 1Q7EA 2XUAA 5FNVB 1I5RA 3UWMA 1KQGB 2IYPA 3PDIB 5KFBA 4ZU1X 5KREA 3M1VB 2XBLA 3JAMU 2QC3A 1B64A 4QFMA 1HBMA 4HR7A 3LVFO 4Q4DA 3L1VA 4L2IB 4WP3A 1ZY2A 3BZWA 4XRRA 4RKFA 1LC3A 2ZJRQ 4LJLA 4JEUA 1NVKA 5TMEA 3GJ0A 3G71S 5THKA 3AXMA 1N0WA 3FCYA 3LT2A 4RNNA 1IATA 1GPJA 3A1UA 3JQRA 1C3EA 3HX9A 4Y0FA 4Q7JB 3QU9A 1PQWA 3BXEA 3I09A 3OAAD 4KU4A 1KZYC 4G4SO 2DB3A 1DLIA 4BKMA 1JAYA 3L4EA 1FUEA 3VDMA 4EMSA 1P4GA 4D92A 1WMSA 2QL7A 3W8DA 5KFVA 3MB5A 4AQ7A 4WCDA 3NWGA 2I2CA 2ZRFA 2PFDA 1KVQA 1DRUA 2QUIA 3PRDA 5D7BA 5BOSB 2R65A 3IP1A 3BULA 1SCNE 2CC2A 1PJQA 3ZHSA 4NOLA 4OGWA 2DQKA 3NC1C 4G26A 4D1YA 2ZWVA 3RVSA 1Y0BA 3E53A 4TLRA 3KG1A 4PABA 3HB1A 2KFNA 1JHPA 2J6TA 3QFFA 1F9HA 1FU4A 4FINA 1MX9A 4NZZA 1TM2A 4MWTA 3M7IA 4LF5J 5ALTA 4EECA 3QQPA 2C84A 5L4NA 4YPOA 1M7HA 4A6PA 2IYAA 3PPIA 1FFXB 3RSFA 3I2IA 2HB6A 5JR3A 2PAAA 1H0HB 1ZSVA 3I61A 4B0OA 3N8NA 4IEIA 3OPXA 5CX1B 4K6FA 3NCRA 1QCYA 2BUCA 2VJUA 3ZBQA