4GMKA

Crystal structure of ribose 5-phosphate isomerase from the probiotic bacterium lactobacillus salivarius ucc118
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
PNQDELKQLVGTKAVEWIKDGMIVGLGTGSTVKYMVDALGKRVNEEGLDIVGVTTSIRTAEQAKSLGIVIKDIDEVDHIDLTIDGADEISSDFQGIKGGGAALLYEKIVATKSNKNMWIVDESKMVDDLGQFPLPVEVIPYGSGTVFKRFEEKGLNPEFRKNEDGSLLHTDSDNYIIDLHLGKIENPKELGDYLINQVGVVEHGLFLDIVNTVIVGRQDGPEVLEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ribose 5-phosphate isomerase from the probiotic bacterium Lactobacillus salivarius UCC118.
pubmed doi rcsb
source organism Lactobacillus salivarius
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 75
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4gmkA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gmkA01
3EFBA 3W7BA 3LWDA 3MAHA 4LUBA 5IS2A 1XTZA 3BXHA 3CSSA 4TM8A 5FIIA 2QMWA 2KO1A 2RI0A 1LK7A 1FRZA 3LHIA 3MWBA 2F1FA 1YGYA 3N0VA 3OBIA 2DTJA 2RQMA 3ENVA 1JT9A 4TM7A 1SC6A 4X84A 5HJ5A 3P96A 4OQPA 2J0WA 3CEDA 1M0SA 1KS2A 2H9ZA 3OFFA 1UJ6A 1U8SA 2RI1A 2R5FA 1UJ4A 3LUYA 3AAWB 3AB2B 2QSWA 3DDNA 3IBWA 1CD5A 3DHWC 3TUJC 3OFHA 2MDAA 4L5IA 2O0MA 2DT9A 4R9NA 2J0EA 1VL1A 2OKGA 4GMKA 2J0XA 5T41A 2W48A 2CDQA 1LKZA 3HN6A 3O1LA 4GO5X 2F8MA 3U7JA 5IT4A 2JOQA 2P9GA 3EB9A 3AB4B 4IO1A 4GO7X 2ZHOA 3OC6A 3S1TA 3BXFA 4PWUA 3CH7A 4M8LA 2BKVA 4L50A 1UJ5A 3DHXA 2PC6A 1FS5A 1FQOA 3K5PA 1FS6A 1NE7A 3LOUA 1HOTA 1DEAA 3KWMA 5IT0A 2P9CA 1Y7PA 3TX2A 2LQJA 3HHEA 3NZEA 4L4YA 1ZPVA 3NWPA 2I9SA 1RWUA 1O8BA 3IXQA 3TUIC 1YBAA 4L5JA 2BKXA 4L51A 2FGCA 4NMLA 2PA3A 1LK5A 3OFGA 5JJBA 3BXEA 3E7FA 3DC2A 3NRBA 2JHEA 3ENWA 1Y89A 4OQQA 2P9EA 1FSFA 1PSDA 3ICOA 2NYIA 2LVWA 2QRRA 3ENQA 4R7TA 2RQKA 3UW1A 2GNPA 1HORA 3L7OA 3E15A 3TUZC 2QMXA 4GO1A 1PBTA 2RE1A 3BXGA 3MTJA 2WU1A 4L4ZA 3OFEA 3KV1A
chains in the Genus database with same CATH superfamily
4CM4A 1BG6A 3UKDA 2G70A 5FIIA 2WLSA 3GSDA 4NAVA 2C9DA 4ZARA 1SU8A 2MQNA 2QM3A 4KE5A 3ZJUA 4K46A 3HKWA 4OYAA 4XDCA 3MPOA 4RSGA 1Q84A 3C48A 4FHFA 1Y6ZA 4P2SA 2V2QA 1P7PA 1VKOA 1MDFA 2I9PA 2EWHA 3KG1A 3U1VA 1H6DA 3CGIA 3F46A 3SF8B 3WKDA 1GL9B 1OFHA 4GICA 4MZXA 4DSTA 2VUUA 3M9WA 4CT5A 1C8VB 2XWJI 3U16A 1UJ5A 4DX8H 1CF9A 1EE2A 1C7FA 4R1SA 2OV8A 2VDMB 3QA3E 1I7QB 2XBPA 3UV6A 5IUKC 3ZV5A 1QMGA 1TKBA 5AKIA 2C1EB 1BQ4A 2NSLA 6REQB 2P2NA 4DDHA 5CT8A 2XSZA 2BCGY 4PNPA 4PPDA 1LNZA 4N5HX 1U9JA 1N56A 3NHWA 2ZLBA 2DFVA 4E5DA 3DKDA 3LW5C 3RSFA 2ODQA 2RI0A 4PU0A 1ANKA 1Z5WA 3OX2A 3TGLA 2NV0A 3BQ1A 5EHXA 4W98A 3FN4A 3ZW7A 1WZCA 3GU3A 1G3RA 4JIMA 5LQDA 1Q7RA 4IG9A 4PYOA 2ZXUA 1YRXA 5DM60 1XBTA 2F4NA 3F44A 1M0TA 3GHYA 4EB3A 1P3Y1 2PX0A 1B4DA 4LW8A 3PYFA 1NZJA 1WCIA 2PJUA 3O8NA 4FDMA 4DV0F 4OHFA 4UOEA 4LJ6A 5JWOA 2R9LA 2HQSA 2L42A 5DASA 4Q9DA 1E6KA 1EFRA 1M10A 3KLVA 5ELMA 2BR0A 3JSMB 1KO8A 3WK4A 2J41A 3RSGA 1QY7A 3G9XA 3BGWA 7REQB 4GRDA 1MT3A 2XGJA 4D26A 1H22A 4QTYA 4GFDA 3RRBA 1GNVA 3IS3A 2TRSB 2XWYA 5K0JA 1IPEA 1Z4OA 3JZAA 1YVRA 4D79A 2XB6A 3HYSA 3AA8A 1JFFB 1R4NB 4QQBA 3K35A 5G0TA 3WIOA 4R2XA 1I4DD 2AD9A 5A71A 2HHHF 3HHLC 2RQ4A 3VHXB 1G8HA 5DIFA 3FOAA 3BYZA 1RXOB 2IEAA 2ZE6A 5IYZF 5HJ7A 2ESRA 1Z0UA 1TW2A 3RSSA 1HFJA 2DFTA 2DLNA 3OIVA 3WMGA 2IPOB 1IY2A 2IM2A 3VU1A 4ND6A 5KOHA 4ND8B 3OFFA 2XMQA 4H4KC 4HAVA 1RHMA 2R7MA 3MUEA 4FGUA 5LZ8A 3OPNA 4EVSA 3INYA 3EAGA 1TUWA 2RC6A 2I0XA 3TX8A 1UOQA 2NVBA 3QOXA 1H38A 2OFFA 4U2CA 5EMHA 3NR2A 3WY9A 3QLEA 2WPDA 2QNBA 2PAAA 3GJRB 2MZ1A 5KTRA 2OGWA 1MHPA 1KSFX 1GZHB 3T7KA 1YUMA 3KJEA 4IG0A 4ARSA 3GV8B 1YJQA 2AOXA 3JQ9C 1WUIS 2YHUA 1RBLA 1LUAA 2VH1A 4JNKA 4EUSA 4I3HA 4HG2A 4ZJQA 4O4LF 1F4VA 1YNSA 3EBLA 1GAWA 1B00A 2QGZA 5ED0A 4RW7B 5AW5A 2B69A 3Q72A 3LCJA 1T5DX 2BHTA 1OSDA 4IHJB 2CUYA 1N3LA 2F9DA 3SCIE 2NGRA 4RNFA 5JXIA 2GOYA 2WAQD 5CYFA 4GP6A 3ENVA 2VJUA 4GR4A 2XT9A 4Z4CA 2XQVA 4BU1A 1UP6A 2ZWOA 1E64A 4UD6A 2XVYA 4JL6A 1T2UA 4NA1A 2BLNA 1QGZA 3HJGA 1O5OA 2ZWIA 4Z99A 3LQKA 1U2TA 5KSPA 2A1IA 2YPZA 1NW7A 4A10A 4NZYA 2DBBA 3VU8A 3P26A 4Q43A 4JJ8A 1Z3CA 5J58A 1TK5A 1TZ2A 4N8NA 4RTRA 3EYAA 3WGGA 3PA8A 5FB3A 4K26A 1XAHA 3LP1A 4TXJA 2HV9A 4JI0J 1MEOA 2AHRA 3EDYA 2OG2A 5L3QA 2FVRA 2CY0A 4B79A 3ETCA 1KEEA 4IJ6A 3ILXA 3K1TA 5CDTA 2ZIUB 2C5FA 1RI1A 3BD7A 3SJBA 2IF0A 2MZJA 3ZGVA 1PBTA 3U48A 1RYFA 4Y65A 3W2WB 3BVPA 1X3SA 4JIGA 1N4AA 2CK3A 3SYLA 4M63A 2WJIA 4YB6A 1GGEA 1L9XA 5FLEX 3WADA 2V4RA 4MTPA 4C07A 5GINE 1EFVB 3ZV6A 2FPUA 1U1NA 3NBUA 2GN2A 3PFIA 1SKUB 4I67A 2FPLA 2BE2B 4H18A 3QWPA 4AWXA 3PVSA 4ZEWA 1VP3A 1NBIA 1KI6A 4A7PA 4QKQA 4R71A 1LS1A 1S9GB 3JQ6A 2TS1A 3CGWA 1HNIB 1ZBQA 1XAGA 1JLCB 1TL7B 4BP8A 2BZ2A 5CQGA 2QVCA 5E4FA 5L9AA 5F64A 2A7XA 3FMOB 4DN0A 2IPOA 4H7DA 3HSKA 3ZGYA 4BBPA 1JLRA 4MUEA 1XNQJ 4MA5A 1S5PA 2IYXA 3GFYA 1KZ9A 5EMKA 4BWMA 4B3RF 4IM7A 1DWPA 1YS7A 1E1RA 2M70A 3TTUA 3MAGA 2C2DA 1H2WA 2C03A 4M0CA 1HNVB 1B8NA 3EWGA 2GDZA 1B99A 2BOVA 3OMXA 1NXSA 5HRCA 1KYVA 2OV6A 4P4SB 1KYZA 1LK7A 3PQDA 5JC1A 1ZOSA 3NBPA 5KO2A 5HJ5A 3BQ2A 3ETMA 1WHSB 2D7CA 3NDPA 2XSFA 3S3TA 5CT5A 4X66J 1DLJA 3NIDB 3UN5A 1Z6QA 4DJEC 2WJ4A 5JYBA 4Q1VA 4IFIA 4OX9Y 4IICA 5H9WA 4UBJA 4RW4B 2L0XA 5GVRA 2D9OA 2RGCA 4NNJA 2JPDA 3DAFA 5LZ2A 1V3RA 2V94A 5TVKA 3DTTA 4G0PA 4YB5A 3NGSA 1O51A 3T1AA 4QWAA 4XVRA 5F1KA 4BV8A 1KDOA 2DITA 3MPWA 2L08A 1LI7A 2HEKA 2QTHA 1BKSB 3AVWA 1RWUA 2PA8D 1N7GA 3L46A 1SXJC 5EJFA 3UH1A 5NLLA 2VUSA 4ENUA 4MYUA 3EVTA 3QVWA 2FEAA 4LHZA 5J47A 2QPTA 1O9GA 3A1FA 3TRHA 2CZ9A 2XUIA 3PL5A 4D3DA 1ECJA 4CDMA 2HVEA 1MG0A 1SZCA 4IVRA 4YBRA 1VRTB 3CC8A 4ARUA 1XMOJ 2OGUA 4ZN1A 4JLSA 2V6IA 1KKHA 3ZGLA 1NFRA 4F11A 3VTZA 1FVOA 1KXZA 3UJPA 3UN3A 1GGMA 4ILLA 2EK6A 2V97A 1G5RA 3HLTA 3PHCA 1IXKA 5DYYA 1UWCA 5FFNA 4YQYA 3TSOA 1TT5A 5T6BA 2XGOA 2KXNB 3OFVA 2XUFA 1FEEA 1J2VA 5H9FJ 3V4IB 4HNHA 5K0TA 1P1KA 1ZTWA 4G1QA 4KLCA 4FGWA 1RTTA 5FLXU 4R1OA 3L06A 2FZLA 2V54A 2J6CA 4OCZA 4DQUA 4HQNA 2YNMD 4KVFA 2PA3A 2R8KA 1LV7A 3PWSA 1CEQA 4DBLC 3L07A 4PRYA 5D51S 3B82A 4AUKA 1BGWA 1M2VB 1CDZA 4AL5A 1SB8A 4F9TA 4F4HA 3UK6A 4YY3B 4CLRB 2W6ZA 1RC8A 2OL4A 2CXHA 5AJWA 2FVCA 2P79A 3HUUA 2OT3B 2ZQ5A 1GTL1 3IMGA 1AUPA 1WB6A 1FX1A 1OYYA 2NUBA 3PJEA 2GZHA 1GAXA 1MUUA 5TT1A 3EQ9A 2Q43A 4L72A 4MRSA 3OEHA 5C1BA 4DL6A 5DNUA 3DEHA 2ZJ0A 5DHAA 3B9PA 2VQDA 3KYLA 1C1DB 3LBNA 1JB9A 4FWIB 5F1YA 2TMYA 3LWZA 4ZVPA 2KT2A 4Q4LA 1YR7A 4TUYB 1G17A 1M5PC 2WONA 3C70A 1KOGA 1MGOA 1BXKA 2Q2NA 4WZAA 2FSPA 2PUGA 1IHDA 4DPXA 2JGLA 2AG6A 2YHSA 1E5TA 1M8PA 2W6IA 3KLBA 1MRSA 4Q93A 1G4CA 3UXEA 4WPGA 5FL3A 4J0FA 3OCWA 4XR4A 2OHDA 1QCZA 2F43A 5FWXA 4JBCA 3GPAA 1N54B 2YTCA 3I6IA 1NPPA 2P8JA 3PGMA 1YR9A 4FEGA 1C1HA 2WKQA 3KTAA 4AMUA 4GX0A 1NULA 1XEWX 4P98A 3GJRA 4G1CA 1BZYA 3ICWA 3L0DA 4QATA 3G0IA 1KFJB 4IIXA 1FKPA 4AKEA 3PHHA 4ALZA 1M1YB 3W6NA 2IMWP 3MDFA 3RJMA 2HK9A 4GKVA 3QEMB 4C87A 2XUOA 3FR7A 2N1MA 1Z0KA 2G9UA 2RMKA 5KG3A 4KWTA 2DNGA 4G5OA 3KSDO 4FT2A 3KBOA 3KIPA 4LI3X 2BEVB 4CLOA 5L4LA 1UZMA 1R3NA 5B3JA 5C18A 5IVHA 1LSSA 3SC2A 1B26A 3DZJA 1VGVA 2L48A 3LA0A 3RUPA 2YY3A 4M95A 4JLOA 5G0RB 4DNOA 2BUAA 1N5YA 1U0HC 5BJRA 3D68A 4AL7A 1JQEA 1EK1A 2AKEA 2ALYB 5EIHA 4YGYA 2FGJA 4NBVA 1KZYC 2QTVA 4KO1S 1ZM3A 2G3YA 3P0FA 1HMVA 1WC5A 3OJLA 3V1MA 2RMLA 2E4YA 4AD6A 2JVRA 3OQ2A 5JSYA 2EW1A 3E27A 1M5KC 2B25A 1V8DA 3GAFA 5BV1A 5L53A 5JPIA 3DV9A 4ZS6A 2UZ3A 5FEUA 6YASA 4NESA 4OA5A 4X62B 4U4AA 2ZBFA 3CS3A 4IJQA 1EWYA 4FDUA 1KDVA 1M76A 3NPMA 4PQUA 1HWIA 4YUYA 2X9GA 1UPFA 1EAMA 3IAUA 5KDLA 3LP6A 4CKYA 4U7JA 1CPZA 4MAKA 4OY3A 4CEJB 1HDCA 5B5SA 3ZXWA 2FJDB 4KQWA 2JDIA 4B9EA 1J5EJ 1XPUA 3WX8A 3D3QA 3N07A 3QY0A 3G6VA 5CEJA 3EFOA 3KQWA 5KOIA 3SZUA 1GMUA 2CJWA 4NLLA 5KG6A 4Q7EA 4TTPA 4IZ6A 4W92B 2RHDA 1IN8A 1B2LA 4FYPA 2P9EA 1DAGA 2OMKA 1HQDA 3HP7A 4HPJB 3A9CA 4JVMA 4ZQCB 9LDBA 1FRHA 2A2ZA 3WXMA 4XYBA 4Y18A 2DHSA 1Q0RA 4YQWA 2VUIB 4LN1A 4TSFA 4O23A 4NXNJ 4FFNA 1RI2A 3P45A 3FTDA 2V4QA 1BQXA 2HHHB 1XJCA 2XRFA 2QUIA 3U1TA 4EGSA 1L4BA 2WU0A 3KFLA 1E3IA 3GHHA 1M8GA 3OCCA 1V8BA 4L2IB 1N36B 4DLBA 1TB4A 2XO6A 5DGTA 2QKYA 3WRYA 3O3NB 5AJXA 3OLZA 4LNHA 3HD1A 2X40A 2EG2A 1T4CB 2ABWA 5A3RA 2E7ZA 1I4OA 3L4SO 1J2UA 1LB1B 4LKOA 4DQKA 3TQQA 2LKCA 1Z4QA 5IQ6A 3MCTA 2MSCB 3ZWYA 1RM4A 3PPXA 4NU8X 3AXSA 4N82A 3INRA 4LISA 4DJTA 3IERA 3SQXA 5AKGA 3UAVA 2VBZA 1AK1A 3GLKA 3RYCA 8OHMA 1FWKA 4H0CA 4X4VA 2E18A 1Z16A 3VO2A 2HK3A 3SC4A 1RISA 2E4XA 1W8IA 1NLMA 1MO2A 3CRZA 4YV2A 4QWMA 4S05A 5KTYA 2B6AB 2XZTB 3BB5A 3V2GA 3DRXA 3OPQA 5D8DA 1LTQA 1VJGA 1VFPA 4EB8A 4XIUA 3LGSA 4F1JA 1S72S 1LJLA 4G8DA 3H83A 1I2DA 2G82A 3WGKA 2ZJBA 1K2WA 4LKRA 4MJXA 1WZEA 3TB4A 3MXTA 2FWMX 4UVEA 3Q6MA 3LPDA 3U7GA 3CCZA 5BSKA 6AT1A 3UVEA 2VLIA 2K3KA 4IH7A 3HJBA 4UJ5A 2X7JA 4URHA 4DCJB 1FBTA 1RSCA 4DLRA 3EXEB 1F6BA 3FGZA 2K1RA 4HVTA 5I51A 7ABPA 1FSPA 1AN0A 1A96A 3MAQA 2XJ4A 3FAZA 5K9FA 3RHTA 3P97A 4LZOA 2HH9A 3PO4A 4MV1A 3TRFA 2WVFA 3AZOA 1U2QA 3TOXA 5AJYA 4V19J 5AJTA 4BJ1A 2JVIA 4MEJA 1WUTA 2IM0A 5DISB 4PG8A 1HG0A 4P7KA 3NKYA 3RANA 3CVUA 1NH7A 2IHBA 1RCFA 1ESDA 3VNBA 4LFAF 1RYEA 1OH8A 1T5LA 2P6UA 4D9FA 3A7EA 2DUJA 1ZH2A 4LEIA 3ZOKA 1NP3A 3D0KA 4J0GA 2HBZA 2D3WA 3T5MA 2ILVA 1PFWA 4U5XA 5HK9A 3DLKB 4ZRNA 5P21A 4XA8A 2BTEA 1KBOA 3K58A 3S6EA 4FFBB 3OVSA 3AR3A 5LP6B 1QH1A 3U13A 1JA0A 2HLDA 1GZ3A 2PRZA 4V3CA 3R3UA 2ENUA 3R3XA 2UUCJ 1DDGA 1LFWA 2IHKA 3H1TA 4FONA 5LL6d 3T1NA 1AKUA 1OSNA 1LV5A 3R0VA 4HTFB 2UVRA 4F36A 4DLVA 1FK8A 2YJ5A 2YVSA 2DPIA 1CVRA 1U80A 2YMMA 4AY4A 1WS6A 3I6QA 4RH3A 1X7XA 4BE4A 3N2KB 2HWKA 4WT7A 1UMDB 4JI8F 3ZD6A 4AT1A 3QKIA 2N4DA 2XHEA 2YYYA 2E21A 3KZKA 1R0CA 5P8WA 5CNMA 2ZH3A 2Z95A 1LW2B 1NBMA 4LJ8A 2G17A 4WEQA 1U1CA 1NJGA 2HFSA 5K3CA 1TKZB 4A03A 1EGVB 1LF5A 5HKLA 3EXIB 3VNUA 2P65A 1O95C 3LY5A 3PXEA 5HJ2A 4E5MA 3PJGA 3ROKA 1JPJA 1H0HA 4V38A 4KR3A 3PVXA 4DR7F 1D1SA 2OGTA 3HABA 4QR0A 5JFTA 1NXQA 2OCGA 3FZEA 3ZHSA 1XQWA 1Y1TA 4JSRA 2RDJA 3CEMA 1H42A 1DC4A 3NM6B 1IPFA 2BFBA 5D78A 1K3FA 2EP7A 5PGMA 4QDKA 2ZUUA 2EFPA 1JJBA 1GCOA 2EBGA 4EKNB 2FN3A 4EO9A 5LA6A 4WYWA 3PGLA 1L5MA 3FKQA 1W2GA 1NZ8A 3W5UA 3O4RA 3ZWCA 4D41A 4LHSA 1MJFA 4GM1A 2AR9A 3MXHP 4GOND 2VT2A 1AZWA 4M46A 4Q2LA 1KMHB 1FEHA 5FQOA 5EN1A 5CT4A 1EZZA 4FXWA 2P2CB 1VLMA 2YZKA 4FBGA 3QFCA 3JQRA 1EVZA 3EPGA 4E2FA 3M8RA 1RP7A 3F97A 2RQMA 1CUJA 1YC5A 1Q0ZA 3JQ9A 4I68A 3LX8A 4XW2A 1F0KA 5JEEA 3PEUA 3ISND 1KO7A 5FH9A 1IG0A 4CIBA 2I3DA 1ZRSA 3MHPA 4WESA 2O23A 2CUTA 2XDQA 3D8RA 2OTCA 1QGOA 3G85A 4NR0A 1R9JA 4J9SA 1H1LA 1I3MA 1MMFB 4HACA 4WFAQ 1H3NA 5D3KA 2M6KA 2Y1XA 1FX2A 1NF2A 3ACDA 3GCXP 4F4JA 2NYUA 5KU7A 4U0KA 1S96A 4OLFA 2DJIA 3GRKA 4QDOA 2ZUEA 1Z13A 3DBRA 1W6RA 2Y66A 3A8EA 3ORRA 3ULHA 3I42A 2HWWA 4L4YA 1DAOA 2C2RA 1PYOB 4MITA 5FT9A 1C30A 2PMCA 3NOGA 4UTPA 1C0UA 1SG0A 4B6GA 4CLDA 4BFZA 3FOEC 2IH5A 3ZTOA 5L3RA 4Q2MA 2FZEA 4UQOA 1V5VA 2CJPA 5CH5A 1CJVB 5LIPA 3WGNA 3W5VA 2FUG1 2WI8A 4HLQB 4HDSB 4A16A 1VLLA 2WNHA 1Z7EA 2HYIC 1ZS6A 4KLZA 1ABEA 3MTGA 3G8AA 2X58A 3JYPA 2PBZA 1K44A 4BZPA 4K9MA 4P82A 3K5MA 1W5FA 1JE1A 4A8YA 3RVDA 5CYMB 2Q2QA 2Y0BA 3OTOB 2REQA 4QPDA 3C8ZA 2NZ8A 3GR6A 1N6IA 3GFHA 1O8CA 1JECA 4MS4B 2J9ZB 1OQ3A 3FRYA 3R3VA 1RXEA 4J5OA 5E3PA 5EP2A 5FNZA 5J1EA 2B4QA 3AY3A 1NDQA 1MW9X 1PAUA 1XF9A 1ISRA 3TI7A 4MS1A 4ER3A 3CPHA 4BN0A 1UZUA 4OJGA 3P52A 2INGX 1TFUA 1TM2A 5MN6A 5BOSB 4TYBA 2DKOA 1JKJB 1QLWA 4ZMBA 4JXXA 1JQDA 4LF6B 2HTFA 3VVLA 5K09A 5BN4A 5TXGA 2V5AA 3W66A 1Q7LB 5LMNJ 4P74A 2E0IA 1MVLA 1TMYA 4X3CA 4BO2A 1Y7TA 5AKHA 3RSZA 2VXCA 4B8WA 3NHUA 3D6NB 1Y3IA 1Y10A 1DJQA 1ZSYA 4V0MA 4IFVB 2W2QA 2A5DA 1CY7A 4F0JA 3UHAA 2I78A 3D8HA 3BL5A 2YCLA 1B0VA 4XQGA 1U2DA 2APOA 3DFIA 2ZH2A 1U0EA 4NDNE 3EXHC 2PHZA 3H9QA 1JKJA 3NM5A 4G6ZA 4AJEA 1EUQA 3VZCA 3VALA 3A3PB 1O3YA 1USVA 4WKNA 2E4WA 5DN9A 4HL9A 2HVZA 3Q0TA 4KR2A 5CYMA 5FPHA 1UFWA 3IS9A 4WXMA 4RKFA 2JA2A 1TQ6A 2Y92A 3TZEA 2D1SA 3SZMA 3LX6A 3LWBA 3D1JA 4KHPJ 1DX9A 2CWKA 3CW2C 4BP9A 3TW4A 4KIFA 5JANA 4DRZA 1TQ2A 4NJOA 2OPBA 4MINA 2ZTVA 1IM2A 4IUYA 4FKXA 2EDCA 3U4AA 1X2EA 1C4AA 1NBEB 2Q5EA 1RAHB 4O2LA 4DN6A 2GGPA 1PJ6A 1CIPA 3OY2A 4HNRA 1CZRA 4PZZA 4XD7D 4DQXA 3EXG2 3LOPA 9LDTA 2BVZA 2Q3LA 3PK0A 1FX0B 3CH6A 3RZAA 2ZYWX 4OM8A 4WNAA 2ZYGA 2RBKA 3CKLA 4HQFA 2NTYC 3UMMA 4QYIB 4UHDA 1S1XA 4R7ZA 4CU5A 4BX0A 1R0WA 3W0LB 4BLRA 1OY1A 3RRFA 4PSCA 1VA4A 1UBTS 3H8WA 2Z3WA 3GLSA 5KNCD 4WDQA 1EZ4A 2ZM5A 3L7MA 3F71A 3FLAA 4J90A 1EUCB 2WLTA 2F3QA 3ZIAA 2XC9A 3JXOA 4C30A 4P31A 3QX8A 1TL3B 3IKLA 4KQEA 1V8ZA 4YYZA 3ILYA 3I5XA 4QU5A 4MHOA 4MUAA 1ZBTA 2Z8QA 3QLUC 2D1RA 2QRRA 5KFFA 4OFBA 3VO1A 3ELYA 2RH4A 2PWYA 3USCS 2FGOA 3LHSA 4YYEA 3C19A 3M8ZA 2XI4A 1TQ8A 1T8EA 2JFVA 2FK7A 4C9DA 2XULA 1F0NA 5DXAA 3ILIA 5JQWA 4B3TB 2E9TA 4ES3A 4FFDA 4X91A 1DAMA 3BF7A 1AKWA 1J0CA 1OXKB 3W8PA 3N8GA 1LX7A 1Q19A 1KP2A 2CYYA 3HWX1 4W7IA 3CZMA 4N0DA 1QV6A 3Q11A 4C0OC 2PXHA 2VLBA 4ZO6A 3ZEAA 3CISA 2O0KA 1GPWB 1W29A 1U4BA 3L7CA 1Y7LA 3C15B 3QTTA 1TV6A 3LW8A 1X14A 2B34A 5FO0A 3LOUA 2ATLA 3UR3C 2CLIB 3HVJA 4JAVC 4TMWA 2YKQA 3LKZA 3RYFA 3R4VA 4Q4HA 4IGEA 4ZVSA 3GVXA 1ZGCA 3FWNA 1QOPB 1RHRA 2JFPA 4M36A 3K0SA 1ZUNB 3GV5B 1ZN9A 4EJSA 4JX9A 4KAAA 1K1EA 1DXQA 1YZUA 4GRSA 2CEAA 3OZUA 4QLOA 4PYRA 1GMVA 3Q7IA 5HX7A 4GMHA 4FNAA 1IB0A 1NT4A 5CB6A 3SBEA 5THWA 3PXDA 4Q05A 4CCYB 2HRRA 4TM8A 4MV9A 1MENA 2GJKA 2GSDA 2BFMA 4ID9A 3T6JA 1OFUX 2AFRA 1NOIA 1TKCA 2XXAB 3CRRA 2XUDA 2QBYB 1EX1A 3GJQB 1R6DA 4P84A 1XCPA 2PH5A 3OM8A 2O0MA 5F77A 3R9XB 4BUJA 4O3MA 1PBUA 4HTFA 3WAJA 2EU8A 3HA7A 4QZVA 2KHZA 3IQXA 3UUEA 2ERRA 2I4TA 1JKMA 2IYFA 3VI4B 2V7TA 1NK8A 4BGIA 2I6XA 2HZBA 2D8MA 3JTPA 1BKYA 2Q41A 4WKPA 4KSEB 2C83A 1ZJ6A 4EQZA 2B7BA 4Z7NB 2ACKA 3NM4A 2ALJA 1MC5A 1EGAA 4RJJA 1FFSB 1HPLA 1X1DA 4DMZA 3UWDA 3QJGA 1MU2B 1KQPA 1PGJA 5KFMA 2EBFX 4DLWA 2ZDPA 4DR5B 4JA0A 2XMCA 1TO1E 5CCDA 3OURA 4NEQA 1E5VA 1WF6A 4DV2F 2JD1A 3G2QA 4DPUA 1TTHA 3ZK9A 4YO8A 3FI9A 5LIRA 1D1QA 2IDEA 2ODNA 4W5HA 4D9IA 5I3UB 1RE1A 4X4RA 1ZTTA 3NT2A 2IMOA 1CVIA 2JJ1A 4I4TB 1Y6FA 3QMMA 1VSUA 3F6YA 2XTZA 2GPSA 1ND6A 3PXGA 2JLQA 2B36A 4ZQIA 4HQKA 4BYGA 3DZKA 3RC3A 1G66A 1T9KA 1MQAA 1CYEA 1DFHA 4PFQA 2DQSA 1SVLA 1PR4A 2B5JB 4TMKA 4DQDA 1GZ6A 3TLGB 3TAPA 4NE7A 3D6JA 1KO5A 2YVQA 3C5CA 3L1JA 2PTHA 3VV2B 2GZRA 3FDZB 1QSGA 2JGNA 4N76A 3PC7A 4XDHA 2BV3A 4KHZA 2AJ2A 1N5YB 3JWEA 2IAJA 3AJ2A 4LXIA 4C98A 5EINA 5CA0B 3W6PA 4R5PB 4QYRA 3IURA 5IX8A 5KFEA 3GAMA 3IAFA 3AESA 1PGZA 2OPPB 1ZMBA 3N87A 1OU4A 1X4DA 3G71S 4YK7A 4MKVA 1AKQA 4P53A 3GXOA 3FNHA 2E1AA 2JFUA 4ECQA 4EPTA 4AQYF 3TI9A 4BBAA 3EODA 4DILA 1TJ3A 3SBMA 2QXUA 5B2EA 3U02A 4HDRA 4PXAA 2VIHA 4ED0A 1KKLA 4CWAA 2RJZA 4WFYA 3UT5A 1FFEA 3SXUA 4NMMA 4ER8A 2GXQA 4EL5A 2PEHA 4F4WA 3RADC 3W3SA 3NDJA 5BT9A 3N0XA 2GH1A 4DSNA 1RLOA 3MBOA 5HVNA 3B9BA 4KH0A 1HBJA 1U8ZA 4MUJA 4YONB 4CCSA 1OLUA 1CJTB 4HDSA 2YVAA 1SCJB 3NMRA 3STWA 1U7OA 4W8OA 4CM0A 3D66A 3BTVA 1HRKA 1H7XA 1NUHA 3QFSA 1XU4A 4MI3A 1PS9A 3MJHA 4QXRA 5JZSA 1HE4A 1J22A 4PYJA 3QSYA 1XL1A 4YRBA 4J9OA 4GF5A 3GT7A 1POWA 4C21A 1FNMA 2QLFB 4QUKA 3EZ5A 1MFZA 5EVCA 1VXOA 2RGWA 4MEBA 4GSLA 3Q87B 4M49A 2FDXA 3AHJA 4UBMA 2B0GA 5SYMA 3SWWA 4M5GA 3ONQA 4BTVA 4DCSA 3CZ9A 4RBUA 4ZCIA 1NBEA 1X13A 1PSZA 4MQEA 1TYAE 2OV4A 1BGVA 1E6WA 4FYJA 4HF7A 5KG1A 1AFJA 4HAZA 4AMBA 3PQ7A 1KOOA 2I6QA 3TW8A 3HZEA 4NMHA 3VM6A 3LM8A 2C1ZA 4D9CA 1M67A 2OAUA 3RUCA 3AEKB 2WWRA 2D74A 4N3NA 2LA4A 4QQ8A 1U3TA 2E7VA 3ZZUA 1NR5A 4IIJF 2VPTA 4GLFA 3DE0X 4R68A 5KTNA 3MN1A 2R8ZA 3WYDA 2JJYA 1Z2LA 2UXDB 4WNIA 1B76A 1QE3A 4MWEA 4RX6A 1XX6A 2GNPA 4DWOA 3GI1A 3KXLA 3CDAA 1A9OA 2ODAA 4IWNA 2YZ2A 4YAJA 4N5LA 4WK6A 4D4MA 3FBWA 1B43A 4QREA 3NDRA 4B35A 4AF7A 3ZFVA 1HNWB 3AONB 1JK9B 4NL5A 3HFZB 4HYTA 2W0SA 4UDYX 3DOEA 3ND6A 4CPDA 3GN2A 4DC9A 4DIKA 3NTXA 2WT4A 2X0RA 1M7BA 1H05A 1ICIA 1Y9JA 3A04A 2OILA 4BQSA 4URGA 4Z7OB 3UD3P 3HEBA 2QTLA 4U2BA 3ZZOA 4BIIA 3RS5A 3AHGA 3PLAE 5KQRA 5SICE 1TD1A 3SF0A 1H8EA 3H7HB 4I7EA 1VK8A 1D2GA 3EN0A 4DQSA 5KFBA 2J9GA 1XKTA 3LXMA 4OHMA 4TL7A 2OM2A 1U1LA 1JWAB 3T1YB 1XDBA 1XXHB 1G8AA 4KUEA 2O14A 1JFSA 5DBGA 3B9RA 3J7ZT 1T9AA 4LF9F 4WP9A 1ZI9A 1ORHA 2YWWA 4JI2J 2YN4A 2I9SA 3SEAA 1A82A 3QG1A 2XGMA 4C6SA 3SSQA 4WGGA 1ZM9A 5A05A 1KKMA 2OBBA 4YLEA 4AW9A 1W2IA 2KMLA 5LQJA 2IFXA 1FFBA 4OYHA 4DQ0A 1X92A 5L3QB 3WGZA 4EX6A 2FZCA 4C8OA 2LIVA 3OHBA 3K8VA 3KLEA 2V7XA 2RE8A 1PWEA 2YYZA 3DMGA 4EBCA 2ISCA 4ZT7A 4KQXA 4Q4AB 4DV2B 4K6FA 2RJ3A 3ZIAD 2XUGA 3H2UB 3CD6S 1ZJJA 2X9NA 4MGKR 1DAHA 3FZGA 4A46A 2QRNA 2VN8A 3HFSA 2IYSA 4IFYB 1R5BA 1YS9A 1E9VA 2XF2A 1NQUA 3MT7A 1NSAA 2HLTA 1E32A 1VIAA 1ZH6A 3OTEA 4CN9A 3SDBA 2EFNA 3TXAA 3MECB 2VG8A 1USWA 3M1YA 1JLLB 2UDPA 5LMUF 3EEYA 3IHKA 4QWCA 3HB0A 2ZI7A 2FE1A 121PA 3WL4A 1HY3A 3VZDA 5A8WA 2W24A 2Q46A 3UYKA 2B9XA 2CHQA 4N5SA 3K70B 1HNVA 2IS1A 3SEQA 5D1NA 1F3VA 2Q79A 1N2BA 2PXXA 3MTBA 5J5VA 4F2GA 4LF7B 3BA1A 3NVAA 1V7CA 1JA9A 3RB8A 2A6OA 3ICPA 4I64A 1FFCA 3GT0A 4EW3A 1U4NA 1BWSA 3MBKA 4Q03A 3BN3A 4O3QA 3JTNA 3BQMB 4A6XA 5JAOA 3WDOA 4BLVA 5JAPA 5TMPA 2PRYA 3I9JA 5HF8A 1C1CB 5HEKA 4KQKA 4YMVA 5JH7F 4FD2A 4E6EA 3WWEA 2B8PA 3ZKAA 2C92A 3X1WA 2V9ZA 3OTOF 3NAHA 3B6IA 3D0QA 3LVQE 1U2DC 3ELUA 2WMYA 1J06A 3WK5A 4QULA 4YMWA 4D99A 3KKQA 2BT4A 4V24A 2GCGA 3H75A 3BB3A 3B4MA 3H86A 4B2YA 5BQ3A 2FZ5A 2PANA 3LIPA 5ICFA 3ECAA 4TXSA 4WIIA 4LQ3A 4Y6OA 4RTKA 2V9PA 4J43A 3IBCA 2P67A 3OPYI 5L45A 5IDVA 3W5YA 3IP6A 4QJBA 2PCJA 2GFIA 1FHTA 2VP0A 1H7WA 3AOEC 5J59A 5CM9C 1JHYA 3JQBC 2QVZX 3LDUA 1NI4B 3HYRA 4O2BF 3DA8A 4I19A 3FQLA 1V9CA 4INJA 2HIYA 2LDYA 1DHTA 1BRMA 3W9JA 2OO5C 2QB5A 4PNHA 4FKBA 1Q7GA 5C5EA 2ZS7A 1G42A 2ZT5A 2MR5A 4F7DA 4PQEA 3UICA 1N3IA 2YVUA 2HNZB 2O2SA 2VUHB 4GEGA 1N77A 1QDEA 2Z2MA 4DI6A 2B5WA 4WLEA 1JFTA 3V55A 3PRKE 2OV2A 4ZYVA 4R8UA 3TW0A 2QJWA 1YJCA 4YEDA 4NZ9A 3PGA1 1UETA 3N7TA 3A3YA 2Z30A 4C3UA 4JBWA 4MNTA 1LZLA 1VKNA 5BWCA 1AHIA 4YI3A 1W4LA 1C30B 4F4DA 1L4UA 2OVBA 2QA4G 4OBBA 1A9RA 1WIWA 2ECOA 2HEIA 3UWTA 2FQXA 4UNIA 1BDMA 5THQA 1W85A 4G1QB 1VHIA 4ZA2A 3LDFA 2XTJA 4DWIA 3PITA 1TZBA 5B2ZA 2QW8A 5F51A 5IXYA 2DBVO 2OLJA 2ZOGA 1NQOA 2B4KA 4BHQA 2PTGA 4GZMA 2XBUA 5D8HB 4JI4J 2WJGA 3I5UA 4IOBA 3KXDA 4UM5A 5HKKD 4QU6A 3JYTA 1VE3A 5AD1A 2LYVA 2RDIA 4TKVA 2HW3A 4EI9A 4XVUA 4OZ0A 4FYKA 1V6CA 1D7AA 3H65A 4UVIA 1P6TA 1P4AA 4CQNA 4RQBA 4GPIB 2J31A 4ZZ3A 1HWKA 4LTNA 4CG2A 4DX7A 3CRNA 5C51B 1QAYA 2XA2A 4YAFA 4D6PA 2JKVA 5ADUS 1ZGBA 4TOIA 3K53A 3ADKA 3P1JA 4DCTA 3DMJB 4U9IS 4ETNA 2IRXA 2G06A 3MM9B 2JGAA 5BMOA 1KZ4A 3DE6X 2UUPA 1TZJA 2Y8EA 1H2XA 4L8FA 4L51A 2PT9A 4IG3B 1KEKA 3URMA 1AH2A 3LGXA 1YBVA 1RAOA 4HMOA 3JCZA 1OD6A 5D4NA 5HANA 3B2NA 1M1ZA 5HBMA 4BZZA 2NO7A 1GZSA 2B5VA 1ZGZA 3O75A 4KC5A 1DBDA 3IMEA 2AQKA 1Q1QA 4RMIA 1QNLA 4JP2A 3HHKA 5DJ5A 1QTRA 3R8XA 3TMAA 4BO9A 2FR0A 3EDCA 3WLSA 2IYZA 2NTNA 3TVDA 1NKVA 1BN7A 4GMGA 3NO4A 1Z5PA 1VIOA 2ZT8A 5ETOA 1NRKA 4ZTUB 3HVKA 2ICAA 1GEEA 2N1BA 3GGJA 1JBEA 5K0EA 2FN8A 2CDQA 4ZC1A 1ZK1A 4WKBA 3NS7B 5FR2A 1H9AA 3QKSA 3MWEA 3L7UA 4LBIA 3UOWA 1YULA 4OJTA 3MTQA 3D0RA 3K9GA 4WLUA 3VU0A 5AE3A 3U1NA 2DTDA 3N2GA 3ICQB 1SXJD 4DCGA 4RTNA 4DC1A 4CKZA 1KO1A 4MLZA 5F2EA 1ZZFA 2HMTA 3RNLA 1ZI6A 3S0JA 2HT6A 4NQZA 1FP1D 1YBFA 3I87A 2DAPA 3ACBA 4LTDA 4QO7A 1QDUA 4FBTA 5E6RA 3WB0A 5I9NA 3H9EO 2DHQA 3MTDA 2PRIA 1RZ3A 2WJAA 4R8RA 2O5EA 3B1XA 2PXCA 4AJLA 2X22A 1FY2A 1C4CA 1QG6A 5KDDA 4KYTA 2R96A 3D54D 2VK1A 3JQKA 3MZIA 3EJ6A 4QU8A 4B0PA 4CM8A 1IR1A 5IP5A 2Q1YA 3L8DA 3OJCA 4ENPA 1HI0P 1U1RA 2O0HA 5G4DA 2CQDA 3FKSD 2Q28A 1NO8A 3A3KA 3CKMA 1CR0A 2U2FA 3ESZA 5I9BA 3D2CA 3EZNA 3IP9A 2W70A 2GILA 2R87A 3GEHA 4QGFA 4F02A 3ESDA 5CG1A 4GX2A 2IEGA 4BKRA 2Q2OA 3HM2A 3TQTA 1KR2A 3OQBA 1SCUA 2YNMC 1YSJA 2IS2A 5E9JA 3SQOP 2CJWB 4OHKA 4JR0A 4HAXA 4O3RA 2W4IA 1I51B 2H4XA 5FUQA 4MGHA 2NWQA 5DIZA 1XLWA 1DO2A 2EYQA 2XUZA 3GDFA 3E5RA 4N7TA 1IKVA 1XVIA 1J99A 4JEUA 1GTVA 4OJHA 1Q7YT 3CO0S 3BL6A 1IBCA 1Y9AA 2Q49A 1IBKF 4ZCTA 5KFGA 1A1VA 1JLHA 1PG0A 4BVLA 1PG2A 3MLEA 2PUHA 1HFKA 1M2VA 2VTBB 2QYOA 2PZ8A 1KZ1A 1RABB 3ANYB 4JEIA 2WFLA 4RHXA 2H48A 1RYDA 3IEPA 3LC1O 2AXQA 4R5HA 2QX8A 3ORSA 2A33A 2IXFA 2OJ3A 3FNEA 4C7KA 1Q77A 2PUJA 1EETB 3GG1A 4BWJA 1CDDA 1K7XB 4ECSA 1MDBA 3MGJA 5CH7B 1SXHA 2WU3A 2HSJA 1C7EA 5KEIA 4ND5A 3KZ1E 1F2UB 5EMLA 1OLOA 1TKAA 4P22A 3AO0B 3BE6A 1HE8B 4BEWA 3Q8XB 3LKDA 1GXUA 4GO1A 5FI0B 2NQTA 4ZVNA 4V0QA 1E6CA 3E7DA 3OMWA 5DF1A 4UTVA 4QIHA 3ZDBA 4Z4GA 1NK9A 2LP4A 2RGGA 1BDBA 4NBTA 4NYZA 2X9VA 2W8KA 2YQ5A 1T9HA 2G76A 4U3JB 1UDRA 5HK8A 4F5WA 3WK6A 1VG9B 4HNAA 1PYSB 3H6HA 4AG5A 4TMFA 4OM7A 5ALHA 2R5NA 4DCPB 5B1HA 3OESA 2X86A 5AHWA 3O4HA 4MKBA 1LQ2A 1J9EA 5HM6A 2IH4A 3H2VE 3IDSA 3RFXA 3PBKA 1SKRA 1HO3A 4TU8A 1NN5A 3QT8A 3D4BA 3NBAA 1DEXA 2V9WA 2PC6A 1FQOA 1BDIA 3BZWA 4HHEA 4DEYA 2ILYA 3KWMA 1C4OA 1X70A 2W2LD 2LMIA 4KJIA 2G28A 5CM2Z 4ZYUA 3CUKA 4PZDA 4R1QA 4GVPA 5ALPA 3CF0A 2P68A 3SJUA 1I1NA 4PQYA 2OIHA 5J2NA 4OH1A 4YR7A 3EDRA 2AFIB 1PIWA 4QU0A 1KOJA 1X7WA 4NARA 3UCUP 3BFKA 3OL6A 3H4DA 2QM0A 4RORA 4O0IA 2YJ3A 4RC9A 4Z49A 1Z6GA 2XADA 3O3CA 1QG0A 4DA0A 3PENA 2MZRA 4UASA 4B3DA 3FNBA 2QXTA 4BBZA 5DOZA 3O26A 2G07A 1WTCA 3KQLA 4EGQA 4JL5A 4TKZA 3BHJA 2U1AA 3RFUA 2VJPA 2PZJA 2I0FA 1TMOA 4H4OA 3QRQA 3UG7A 4GOLD 3CDBA 1E6VB 1FFWB 2C9ZA 2RU3A 1TVCA 2UVQA 3VMMA 1VBXA 4WERA 2QO3A 1TL7A 4IXMA 2KRBA 3R7DA 3O82A 1EHYA 2ECKA 1LPAB 4OKNA 5TPZD 3WFZA 1G3MA 3ROPA 3O8DA 4D3FA 4O0LA 1V2HE 1HETA 2Q3EA 4YACA 3B1YA 4DL4A 2YNHB 1DLOB 3BPDA 4CO3A 4D56A 4QUGA 2FWBA 1K3TA 2AFVA 1FDSA 1NSPA 2QL5B 4G4JA 5HTOA 4XGRA 4HHHA 3FDSA 1Z4MA 4LF6F 4ZI3A 4RXUA 3TECE 2XQIA 1WUYA 3A27A 1V9LA 1PGPA 2VEOA 4KMSA 4US2R 5C53B 2V59A 4UQTA 3ILOA 2DR8A 5SZIA 4XPCA 3QXXA 4YRDA 5A62A 2ROQA 2GF2A 2AJ1A 2E1RA 1GZ5A 4WA7A 5JH7B 3MLAA 2I8LA 4ILKA 5DGBA 4DWWA 3MWDB 2HNBA 4O3SA 3ILSA 4ZLPA 4ZIWA 2CNNA 1B8OA 3C39A 2KVIA 1IJEB 3VH4A 5KNCA 3B12A 3UC9A 4G85A 2RGNC 2MXYA 2Y76A 3H4IA 4JODA 5HKBA 2DJ5A 1PT5A 1N32B 3BH7A 3OIFA 1MMLA 4IRKA 2WSLA 1IHXA 4AJ1A 2OFOA 4R98A 2QZSA 1YHNA 1H3EA 4ZD6A 1A7GE 2GO1A 4M0KA 3C6UA 4IYQA 2FQWA 4Q01A 5A0FA 3A1YG 1UZNA 3EQ7A 2WT9A 3KMQA 5EMMA 4GQAA 3ENKA 1G4UR 4JGIA 1P60A 3AF1A 3L7LA 3ZY3A 3H4TA 1JWLA 2ZBCA 2N3ZA 4DREA 3O91A 3P9YA 3GD5A 2XOKD 3IA0A 1BFKA 4TRJA 3JWPA 3ECSA 2O3RA 3J80A 2VHVA 1XFAA 3Q7PA 4LOKA 1FDTA 4ZVLA 1NZAA 2WDZA 5KOJB 5D3QA 5AJUA 3JQFA 1E5XA 3PQ6A 1NNDA 4KLRA 2ETVA 4F7VA 3J80U 4Z4FA 4OLAA 4RK7A 5L3VA 4NOMA 3S2EA 2DH9A 4IRCA 2A1BA 1JQJC 2VDQB 1QVZA 2BGIA 2I99A 3RC2A 3HNOA 4B83A 3F8WA 5LDDC 4F86A 2DHGA 2JZNA 2WU8A 4J1QA 5DI3A 3GYXB 3DLLQ 4DV2J 4PYQA 1L5FA 2R42A 2B4OA 1F4PA 3C46A 2DWPA 2HQBA 5K3SA 4ID8A 3FFIA 4J2OA 3PDUA 1T0IA 4NE9C 3FLEA 1FRLA 1MABA 1ULBA 1EB0A 3J81k 3NAQA 3KLMX 2X7IA 1BN6A 4AUEA 4DB4A 4TLDA 6ADHA 1VIXA 2WVGA 4JX8A 4CCWA 1M1KT 4JBYA 3CLTC 3Q98A 3M7VA 4Z54A 3L0BA 4HNSA 3V4MA 1F14A 1GH8A 4I36A 4XDYA 3KYCA 4X1OA 3DT8A 2GQ0A 1UK8A 3I6ZA 4AJ9A 1RM3A 2GWRA 1BOFA 2JGJA 1VHDA 2J7WA 1F8GA 4HLNA 3OO0A 3MMPA 2VJBA 4TT3D 1WABA 2QFIA 3RFVA 3CLKA 4CTAB 3DP7A 3DRPA 1RCXB 3RUAA 1JVNA 5KNBA 4U2KA 2H2FA 1C1XB 4KRFA 5MGNA 2DF8A 3NH6A 4DSLA 1VMEA 2IS6A 1FJEB 3EXFA 5ICEA 1YQGA 1QSYA 1RQRA 1KJ9A 1TEHA 3QUAA 4X1IA 1EJ0A 1DJMA 4DE5A 3J7YI 4RDHA 4L0QA 2UVUA 1WXGA 4BBJA 2IYPA 2Z2KA 4DJJA 4Z1MD 4PLPA 3PP8A 2GJ9A 2PL9A 1DBRA 4NMLA 4NCGB 4EFAC 2WMDA 3TR6A 5DLFA 1CVLA 5HIKA 5D7BA 5CDYA 2FX5A 1RWXA 1BXZA 3B6EA 3AG6A 4RTJA 1BC6A 4JI6J 1JILA 1NNI1 4PYDA 1SD5A 4KV9A 2CE7A 2YWXA 1I7SB 2BLLA 4XFDA 2RHGB 4MUKA 1ZUHA 1TUEA 3NYIA 1XTZA 2ACEA 4MUHA 2UXBF 1GQ2A 4C9BA 2RK3A 3OBIA 2RCYA 1NMEA 2ZZKA 3MW8A 3HB9A 2ODTX 4P6QA 3EQ8A 2NPFA 2HFVA 4URSA 4HYQA 4R51A 1RMTA 2V7PA 3H18A 1Y3HA 3H20A 5D0EA 4YR3A 3H2HA 5IBQA 3D3JA 1Z5OA 4QU9A 5EEGA 3HCXA 1Z28A 1PHRA 2FAXA 3F2IA 4X60A 1E2DA 2CJYA 1E79A 2HRCA 4RM2A 3S2YA 1X7DA 2VA9A 4YT5A 2WAYA 1PJAA 3E5HA 1R6BX 1J2RA 4ZHSA 3MAAB 1WPQA 4ARZA 4UVDA 1A5BB 3BG5A 2ZTSA 4EMDA 5GJWC 1ZL0A 1RBOB 2ZM6F 2YOHA 2IZ5A 1CLUA 2PH7A 4R16A 2FB9A 4TTQA 1S1CA 2HNAA 3HDTA 1BXGB 4UHJA 3EY4A 1GT6A 2GTHA 4AK9A 4C08A 2QN2A 2BKPA 2QEXS 3DL0A 3HRKA 4XIJA 1QS0B 1D4FA 3OH8A 1HHTP 2R7WA 4EUVA 1W5TA 1NKCA 5E3RA 5J4KA 3ZCPA 4CI0B 2YQ3A 4P34A 2VDWA 1WC3A 3S28A 3A9SA 2VSQA 2PS3A 1T1EA 2XUHA 4K9OA 2G2ZA 1H2HA 2YINC 4RD0A 1KY3A 3F41A 3ERCA 4GKAA 1QOZA 2BBSA 1U2EA 1ODCA 5BMVF 1BE4A 2R25B 1J2JA 4GMKA 4G5RA 1CRZA 2QG9A 4X66F 1GT91 4KPFC 2Q6KA 4WNYA 4ZPCA 5L40A 2NO0A 1LTKA 1NURA 4B3FX 4JUZA 3U3OA 1QHIA 2AXEA 5FL7A 3NIBA 1QD1A 2EKPA 2VDWB 2VJLA 4X6YA 2HZ7A 1DOAA 1MAHA 3R5XA 2ZVDA 5FUMA 3HJCA 3KZNA 5AK5A 2LBPA 2UUAF 5FULA 4MAFA 1FL9A 1HR0J 1NMXA 2JBWA 4EKYA 1YIOA 2VS1A 1VIYA 1QE5A 1XEXB 2FR8A 1G2EA 3AIMA 4DBVO 4PZ0A 1JAHA 2YV3A 2MCFA 3OUYB 3NHLA 2HWHA 1QLNA 4I4TF 1P7YA 3TTVA 3UDLA 1RWOB 3P45B 4W9MC 4X3PA 3D02A 3HCNA 5CA0A 4YAUA 3D67A 3NGRA 2CNBA 4AIRA 3MCZA 3C5EA 4Z7CA 4ND8A 4EG5A 1EP3B 3DKVA 1WHTA 4YB7A 4NLOA 2GAAA 5ALQA 4Q3OA 1J0BA 1FRFS 4RF2A 3LC2O 4YJ3A 1AUQA 4M94A 1E4YA 4IV8A 3NHKA 5BR7A 3BXEA 2HKIA 2HIAA 3CT9A 3IT3A 1MV8A 1B1CA 1M1HA 3QYYA 3PEJA 1U1PA 4GUDA 3GCWA 2D3TA 4ZXPA 4ZPDA 1BTOA 1GVHA 5LA6F 5LXTB 3S7TA 4BC9A 3KALA 4PZLA 2V4UA 2QL7A 1L5SA 3HCDA 5KCZA 2ZE2A 4S2UA 2HDNB 2WRMA 1JKHB 3JSMA 4UY8T 2Z2XA 3M82A 3ESRA 1DEHA 4X5OA 1TGVA 2FPPB 2X2PA 4JBIA 4M0UA 2HIHA 3K1ZA 2R2RA 4ZCLA 4MIWA 3ZHYA 2B9VA 3HDHA 3ER8A 1CY1A 1Q8BA 3UBMA 1J23A 3L7JA 1VC2A 1IK4A 2DQKA 1SOMA 1UVKA 2PGAA 1TLFA 2YHBA 1GDHA 3NVDA 4I99A 3REQA 4D5EA 3JSXA 5CEEA 1S10A 3VO9A 5TIIA 4MLDA 3BC1A 2G4CA 1ZIDA 3ZNUA 1NM5A 4F2PA 1MWYA 2OXFA 4JSYA 1NVKA 4QICA 2ZYDA 5IM4F 4HDGA 4LFBB 3HVTA 2J48A 4XQ9A 2EJUA 1FD2A 4L95C 4Y28C 4G0OA 3LBAA 1QVWA 2R0QC 2OTJS 1Q0SA 1V5EA 5LL6P 1WKLA 3IPAA 2HPZA 2FWJA 1C0LA 2P5YA 5CYGA 4K81B 3QPDA 1P19A 2NZJA 4MIOA 3VPXA 5B53A 2BC9A 3X1MA 5ADWA 1W25A 1TX4B 3D59A 2D5CA 2NOAA 3FCVA 1EFHA 4CDIA 2JIBA 4CFZA 3FHTA 4WGFA 4CMKA 1C3EA 2VBCA 3PNPA 5JDCC 1UXIA 4WCFC 1M73E 5HUHA 3MMCB 4RPFA 4TL8A 2XQCA 2YKMB 3PFGA 1W0KA 1U2PA 4ESVA 4PC3A 1TL3A 3DMRA 2DX7A 1YKFA 3DEZA 2VJYA 4KDCA 5ANRB 1EUZA 2G0IA 2ZZTA 3OIDA 1MD9A 1U1FA 2W2MA 3DEKA 4WFZA 4ZPBA 3CWQA 1E2GA 5FDLA 3WB2A 2DP4E 4J6EA 4IRMA 3EPIA 4FF3A 1U0BB 3FGOA 1W35A 3VAJA 5CAEA 4AVYA 2C7OA 3NTUA 5JZBA 4GG1A 2F3JA 1MZVA 2W22A 2AYGA 1QH8B 3STTA 1U7TA 4KXUA 5F3ZA 2HNZA 3RRHA 3IBGA 3WLFA 5DDOC 4PXDA 2AX1A 1C3VA 2AMJA 1FLNA 4B9VA 5E7QA 1U2GA 1J2YA 2HFUA 4XQ0A 2NTVA 5CDHA 1MX1A 5CCXA 1WOMA 4Z1OA 4GI7A 4EY5A 2YHAA 4ZT3A 1Z5ZA 3KV3O 4NYJQ 1G3OA 1CC7A 2AX0A 5H3HA 1Q7BA 4KE9A 4JI3F 3TQEA 1JZQA 3VVBA 3HCRA 3P0IA 4K6CA 1KO4A 5K5EA 3GTYX 3O44A 1KYYA 1SC1B 3GNSA 2B9WA 3U7JA 4DR2J 1FRNA 2QU7A 4XR9A 4ZOLA 4PXEA 2XOXA 1HUQA 3EGNA 1F1JA 1RNLA 4X44A 1XMSA 2FH5B 3LF0A 3DKPA 4Y2GA 3KPWA 3DOKA 2NU8A 2DRDA 4OX7A 3IAM6 3WXBA 5LM7E 4AJIA 1R3DA 5EN4A 4RWWA 3DUFB 4ZLNA 2DPHA 1NYLA 3F2VA 2VV5A 2F40A 5FF9A 3RI3A 1NAIA 5LBTA 3QLUA 3T12A 4ZCQA 1UH5A 4J2HA 3EVBA 3K7EA 1BA2A 3TD2A 1Z06A 1ZVQA 4CL8A 4KZKA 3QP9A 1AG9A 2GAJA 3EQZA 2DU8A 3MSXA 1GSOA 2A6MA 4BNMA 4AYBD 3KUDA 5HXAA 3IBFA 3EDOA 4UVHA 4JYZA 4WBNB 4TLBA 1I4EB 4JVSB 2J3QA 2UXDF 1QFMA 4KOEC 2G1PA 2ZRQA 3ZVKA 3KK0A 3SN6A 1JVBA 4ZCRA 1J70A 3KJZA 3PNLA 1GJRA 3HBMA 2DTXA 3L1KA 4OV6B 1RYYA 1L2TA 1RT7A 2MKIA 4DCOA 1M1XB 5LD2B 3P0JA 2XE6A 3AJ8A 1SC1A 3DHNA 1XOIA 4R9UC 4DKJA 1DCMA 1CJVA 4IQXA 3PSHA 1TJ4A 3LZCA 3NBQA 3ZJ4A 4GPEA 5FBWB 3L7IA 2XZDA 4MQFB 3LLVA 2G0TA 3CC4S 3EXFB 5JYEA 4P72A 3OG9A 5KG7A 2CXSA 4A8WA 4QDZA 4ZIVA 1RTIA 3OT5A 4N6OA 1ULSA 1XMQF 1E9FA 4DA8A 3A37A 4B2LA 3EXG1 1NKSA 4DTCA 3HFRA 4UF4A 2HJVA 2O2EA 3L6UA 4B33A 1CD5A 1AA6A 1AGPA 3P2JA 4CBVA 4CM3A 1QOQB 4H7FA 2V9CA 4DUZB 4DU7A 1ZW1A 4XSVA 1U6ZA 1BY9A 2JFQA 4M3NA 4MVWA 4AP6A 2HHHJ 5BORA 2WHXA 4A9AA 3QE0A 5FWNA 5EWMA 4E8UA 5EGSA 3W60A 3UGQA 1ZXLA 5GV8A 3PUZA 4HZIA 1KEVA 4O6VA 2DH6A 1X31C 1XEWY 2OO5A 1YQEA 2D41A 5EX0A 4DDUA 1YDEA 1KQGA 3FIUA 3PV8A 2JL9A 2D7DA 2QLJB 2CLDX 2P3OA 3AUSA 2EK1A 4NYPA 4LHXA 3FUWA 2VAWA 4PZCA 3R9IA 3KK3A 1RWWA 4G81A 1M2FA 2O8FA 2UXDJ 1M2EA 3ZW8A 1M5TA 3U7HB 3R6LB 1VPEA 2O3UA 4A8QA 2PD4A 3FYSA 4DR3F 1GRCA 1AB8A 3VR1A 4K9RA 1EETA 1J0XO 1JS1X 4DPMA 2WWTA 1VC5A 1KJIA 1TZMA 2P9ZA 4L4SA 4AY3A 3BMOA 1FTCA 3OO1A 5CA1B 2RRAA 4INPA 2XI3A 3UB3A 2XYRA 3S70A 3QOFA 4X54A 3VZIA 1KAEA 4E4RA 1X1EA 3JQMA 4JR1A 1ZCBA 3Q3EA 1KBQA 2NADA 2OR3A 3OL8A 3OJUA 1VI2A 2H85A 3FSGD 1JHDA 3WLRA 1N52B 1DC6A 1Z0SA 4BUZA 2QJRA 3QBEA 1EBFA 1Q1BA 5JE8A 2XIJA 1H85A 4X7PA 4M1YA 1YJVA 2R11A 2HYIB 2FEKA 4JS0A 1V25A 2CJ9A 1QIGA 1TW3A 1V43A 2KI2A 3EX7B 3P2IA 4FYMA 5KYUB 2DGVA 4A8MP 3PVCA 1W36D 3QPAA 4UOHA 3IRVA 5CBPA 2CVOA 1DQZA 2R6JA 1G0OA 2IH2A 4I8XA 3E9CA 1BHO1 4H59A 4A2CA 3DVQX 1NONA 4JJEA 4KFSA 5INTA 2F3SA 4P75A 1Q95A 4QUIA 3G23A 2P4QA 2QG4A 1S4EA 1SQ0A 1MJNA 4ZWNA 5HO4A 3OTHA 3R3ZA 3TJZA 1ZAVA 3DPSA 4R9NA 1O96A 5AI0A 2ID7A 5JPCA 1ESEA 3OKPA 3GEIA 4YMEA 1DE0A 1VM6A 1YB6A 1P7WA 5B58C 4QL3A 4XTTA 2EFCB 1MOSA 3HHLA 3I9KA 2XXAA 2UXCF 1W2WB 3EM1A 3WLTA 4ITRC 1I3NA 2YJGA 2FPKA 1HZZA 2GK6A 5E1OA 1QP4A 2QQ5A 2JLVA 2RKIA 5F3TA 2VJKA 1FP4B 2PFSA 1UAWA 1D0SA 3R0IA 4Y6QA 2ZUTA 1NMZA 4A4JA 2R5WA 4B7CA 1XZHA 1PJLA 1JJHA 5L1JA 5BVGB 3KLFA 2EF0A 5GGYA 1TCCA 2EARA 5F7XA 4BVAA 3CVJA 3SPXA 3G82A 3OT4A 2POQX 4YCBA 5AXLA 3BPSP 4BVFA 2OD4A 1JEAA 4E1BA 5DZSA 2C5EA 2E82A 621PA 3FKSA 3DT6A 1AMNA 2C4WA 4D81A 5CNJA 3D7MA 3DDNA 3F4LA 3JQGA 2RJNA 2O2YA 2ZROA 5AICA 1JXVA 4CDNA 4L57A 3LUPA 3G0DA 3GG0A 1RZUA 1Z74A 2WJYA 3DO6A 3D54A 4J9NA 2FOIA 2Q1LA 1N5MA 3IEIA 2DLCX 2VBFA 3VOSA 4RTQA 3R2CJ 4QGBA 1WG5A 3QMWA 4I9HA 4BNZA 4US0R 4ABYA 1RU1A 3TLAA 1K8ZB 4F8JA 1ZEMA 2RJOA 1R18A 5KFUA 3QBVA 3OPXA 5KOXA 1DUVG 1VI5A 4I55A 1S4QA 2ZJAA 1YGPA 3W63A 3U19A 3G2JA 3H17A 2DGXA 3OTGA 1WCIB 2JWNA 3SFGA 3LUHA 3SEZA 2FGKA 2I4IA 4A23A 3OQNA 1JG1A 2VKQA 1FP7A 4IF4A 3MPUB 3PHIA 1W36B 4TV8B 4DIFA 1RTZA 3VGVA 3TVTA 2B2XA 2IODA 2A1UB 1APBA 1T0JB 2H57A 2H4WB 1IDOA 5DHRA 1Q17A 1SELA 4NRTA 1F20A 1I8TA 4YLGA 4B6FA 3NATA 3T1QA 3B70A 2OVFA 2ZBPA 5A2GA 1FWLA 3QJYA 3G49A 3DUWA 1BUXA 4RF4A 2JJ1D 2OG1A 1W4ZA 1PGNA 3M6XA 4RW8A 2FSGA 5FPYA 3DDKA 2F8EX 2QUJA 3H99A 3DZFA 1ZEJA 1O0CA 4FYDA 2HDWA 5KYYA 2IYNA 1GR1A 1IXZA 1ENOA 4ZT5A 2QNRA 3E15A 3F96A 5DCLA 2Z83A 2XB4A 4ZGGA 4BB0A 3NS6A 4PC7A 2FJ0A 1G7CA 2BBEA 4Z2YA 4Z0PA 3K5LA 4QU7A 3NT5A 4LYJA 1O08A 2GF0A 3KQHA 2UUCB 4ZU1X 3TFOA 2VTKA 1KI7A 1U9CA 1JE0A 3EGWA 1WKJA 4I8IA 4OH7A 3TUJC 3LT0A 3PD7A 3QU5A 3KDOA 1FT8A 3OLQA 2H31A 4EO4A 3AOBA 2VPZB 4H3HB 5JSFA 5T4BA 5KOWA 1NLKL 3FKBA 1ZVKA 3ME5A 1YRWA 1W5BA 3HACA 2GKSA 5TVGA 4MAMA 4YY3F 3ONFA 1NAHA 1ZZGA 5MDHA 5IC6A 5KWJA 2BEKA 1XC7A 5KTKA 1EXDA 1G6BA 2D6FA 3RGIA 4YO7A 3N59A 1FLAA 3WGOA 1E1CB 3U5TA 4G36A 2BTOA 1Q12A 1XQ9A 4Y30A 3GAZA 2ZJ7A 3WMRA 5ICSA 4FSDA 1HNXB 2HXGA 1QP7A 1DI0A 4CLHA 3TR0A 5D6NA 1H1DA 1VC0A 1M34A 5DFAA 1GPUA 3UHPA 3AD9C 4KGVA 1YRQA 1BH2A 2VPZA 4B2IA 3GYBA 5IFLA 4NZMA 3QITA 1YZFA 2J59A 4QRDA 4PKDB 3DMYA 1QV7A 3DBHB 2WK1A 1EXNA 3MEEB 2H9ZA 4A47A 4CMAA 1QHFA 3SQGA 4LY3A 3KG0A 1SFRA 3GLGE 1KU0A 3G7UA 2BCEA 2GPTA 5LMNB 1Q7EA 4X65B 4PN7A 3G8SA 3H7IA 4B43A 5AHRA 2C4UA 3Q10A 1INLA 2D5LA 3L6RA 4QIVA 2IYVA 2JFWA 4K8RA 1WDWB 1XJ5A 2RGDA 3T94A 3O1HB 4W4MA 4IDAA 5AFSA 3KU4A 4LHVA 5FHQA 1TFYA 3I92A 1L5HB 4DV1F 2VBGA 1Y8ZA 4R8UB 5FTKA 3P4UB 3K70C 4JV5J 3RIEA 1G6Q1 1LC0A 3ANTA 4JB0A 1Z8DA 4L3WA 1CR6A 1Y9EA 3I5MA 3ZLBA 1HBOA 4JI5J 3S2ZA 2YFYA 2WB4A 5HVFA 1W0KD 2ZS9A 5EC8A 5I8WA 2D5BA 2AK2A 2X76A 3F7OA 3RGGA 2O66A 3ZJYA 1YJ8A 4A82A 3DWFA 2Z04A 3WK9A 3ZH2A 4HWPA 1REVA 4R9VA 4YAIA 4FFOA 1Y8CA 1E3MA 2XEDA 1Q1EA 4KBIA 7GPBA 2JRCA 2ZVQX 5HE9A 3TS1A 3W64A 2BFCA 1KP9A 2L9NA 4UE3S 4OLBA 1TFWA 4DWJA 3G2OA 1C9KA 2G4LA 2BKUA 1GRVA 3SAJA 2RARA 1RXUA 2OKGA 3GUYA 2AX3A 3KK1B 2Z8XA 3X2EA 1STOA 2YDXA 1Z2NX 3CE9A 5CPBA 1RWKB 1GARA 1KYXA 1U90A 3IUNA 4I1UA 5HIJA 2YIVX 4U00A 1ILWA 1EH5A 1LWEB 4IAOA 3W65A 1B23P 1Q0PA 4GC6A 1QYRA 3C15C 1T3SA 2HU8A 4V0KA 5DM0A 1BDJA 2BUBA 3D4IA 4KO2S 4X62F 1G9XA 1FLDA 1MROB 3RBAA 3ENQA 3GRCA 4D57A 4P3NA 3SCJE 2XCSB 1KK1A 1YO6A 5FBQB 4DLXA 1KEPA 4GWLA 2F67A 1BW9B 2IA6A 2A0YA 2GCPA 2G5GX 2VI5A 4O4IA 4GKKJ 2FJWA 5BRNA 3CO5A 3BN7A 1QZ3A 4BU0A 3ZGOA 2DGSA 2CJYB 3PQ4A 2WSEC 3DTVB 3AX6A 1XDZA 2GN0A 3DEIA 3ET4A 3ETEA 3E3MA 5GMKa 1X8XA 2VYVA 5JNLA 2BE7D 2DECA 5TGDA 2PE5A 4B3GA 3I3OA 1UWLA 4I50A 3X2SA 5C8YB 5AWFC 4QFMA 3BYRA 3WICA 4PTYA 3ZO7A 4I81A 2VG7B 1L4FA 2IK8A 3GUCA 3ZK7A 3RK1A 1JLFA 1TYBE 4WY2A 1BD6A 2WNSA 2W43A 2XNQA 1IULA 3KZVA 1U9YA 1REGX 2WAAA 1LBHA 1L7MA 2VP9A 3C7TA 3CINA 4TS1A 2PX6A 1P9WA 1XZ8A 2JGMA 2WYWA 1RD4A 3R3SA 1XZEA 3KLNA 3TG8A 4NLPA 4KE7A 4PRZA 5DEIA 4OMCA 3U3KA 2FN4A 3L6BA 1RJ9A 2BKEA 3EVNA 4UCQA 2BAGA 1MW7A 5AT1A 4F4IA 5CVJA 1VZ3A 4E94A 1UFRA 4NVRA 3DYIA 3PHBE 5SUHA 4E07A 3W5CA 4EF5A 3HV0A 5CGQB 4K9PA 4L78A 2RK6A 4NJMB 5HQLA 2J46A 3OLWA 3BR8A 3S7RA 1CE8B 1O4VA 2MMGA 1R27A 3NBPB 2NCKL 4M53A 3EHDA 2PQMA 2W2XA 2Y0PA 3R5DA 4M87A 2UYCA 3AC0A 2OAEA 4O08A 3U7RA 3ZD8A 2IBOA 2QD3A 5FR1A 1OH6A 1DEAA 3FVVA 2BR4A 2H51B 1TAUA 4CO5A 1H74A 3O1IC 2VPYB 2Q4TA 2I7TA 2FG5A 2HCJB 3G8YA 1PUXA 1Q0QA 2I6TA 3TDMA 3S40A 3PRVA 5EIXA 1G7RA 5EERA 4BBYA 3UYLA 3BRCA 2I5JA 2FY8A 1WU7A 2CJQA 2ZK7A 1FE0A 1I5OB 1J9GA 5JAUA 3CJ0A 2GIRA 5C4MA 1OLSB 4CYMA 2EIHA 2C28A 2ZVIA 1CUZA 5KJFA 2I65A 5BY2A 1VKZA 3C1TA 2QYTA 3MWKA 4J75A 1RHJB 2QN7A 4N7RA 1UJ6A 3ZXSA 4NLYA 4KYZA 1QHHB 2CXXA 1BDHA 4ZOLB 1WB5A 2NXJA 5F12A 3R7BB 4LOIA 1SC9A 2AVNA 1SKUA 3UCZP 1J8DA 2X41A 4G3IA 3KSZO 2HPHA 4BO4A 3HDSA 2J9YB 4ELVA 2A0FB 3Q1KA 5BV8A 4C03A 1IYZA 10MHA 3IT2A 2MT9A 5DBIA 4MK7A 2GAIA 1NH8A 1YQQA 4GRIA 4HR7A 2DLDA 1CE8A 2GC8A 1YKGA 3VH3A 2HIQA 3KTAB 4N9WA 1PL0A 2QNIA 1W4CA 4HUQB 3RUHA 5K0GA 3QVGA 4P3YA 1YFLA 2B0JA 2C95A 3CYFA 5DHUA 3CTRA 3R3JA 4H3VA 1QGYA 4EYOA 4KE6A 5BO5A 4NATA 5GONA 2VQ6A 1V5IA 4CJXA 1RTDA 3S68A 1CG6A 2OC4A 1Q22A 2AZDA 3H8YA 5L9XA 3EF3A 3L2OB 4YV7A 3K6KA 3ZZYA 3UPFA 5GZ6A 4C14A 1E7YA 1K68A 3N8HA 1XD2A 3L8MA 1EBUA 4X4QA 3Q6IA 3BWBA 3VNSA 2AFHA 3TAUA 4FYYB 2AOUB 3T7IA 2V4JB 3ETLA 5C34B 5H9EJ 2MGZB 5AT1B 4BGEA 4U9UA 3H98A 1XRSB 3C6TA 1IZ0A 2ZB4A 2X8AA 1QHXA 2YVLA 2RH8A 3HUFA 3GCZA 3IQIX 3KR1A 2IYWA 4LDRA 5DNAA 3QPUA 1JHXA 1UPMB 4B80A 3PHLA 4PPGA 2BHSA 2P1ZA 3CH4B 2AG8A 4Q12A 2YWKA 5C9ZA 3MEEA 4BRSA 1WTFA 3LH2S 4JLAA 4Q37A 1YF3A 4FF1A 3EE3A 3LDGA 1PK8A 4RH1A 4RJ2A 1LH0A 3HCOA 2IHR1 3CB2A 3O38A 4A0FA 5C32A 3SCLE 2EFDB 1E0DA 1YVDA 1EDDA 1S3GA 4RF3A 4GR5A 3KPYA 4Y7DA 1ODJA 2WSSA 5C3UA 1QQ5A 2QSYA 2VSOA 3H5LA 2ZH8A 3R7WA 1XZFA 1Z7YA 1EJ2A 2GIFA 4WFIA 2PYZA 4B9TA 1ZOTA 1EQ0A 4GYJA 4OYPA 3GIIA 2Q3CA 4ECVA 3FFAA 4HGRA 2ADCA 4FC7A 5CT6A 2ASLA 4RMNA 2O1XA 2VF2A 5D87A 4QT0A 3UJDA 1FXWF 5G0UA 5ALFA 3W6UA 2RAFA 3Q88A 4DR4J 4YJFB 3NV7A 4P2MA 3UK2A 5ABPA 4B87A 3T1HJ 4DV6B 2CFXA 3MVEA 2XKJE 2E2WA 1Y00A 4ZIRB 1XPRA 5CD4A 1P0MA 2BE7A 2O5RA 3UTCA 5K51A 1JI3A 4JEHA 3AP3A 4QWDA 3E6AA 5B1DA 4MIAA 3FGNA 1L5NA 3NUQA 4D4LA 3KVVA 4NASA 4J9RA 4I4LA 4TL9A 2HJ9A 3GR1A 3AHPA 1RTJA 1W4BA 3CCWA 2AYYA 2A67A 4DCMA 3I0ZA 2ORED 3GEPA 3GLHA 1MZPA 3K9WA 3MMAB 2JRSA 4RDXA 4YN3B 2IVYA 3NAIA 3DVAB 3G82B 5F9MA 4DQIA 3AM3A 2VR1A 4WASA 4US1R 2FX2A 1E3WB 1EVIA 2Y27A 2JBAB 4XWAA 4WYLA 1XO1A 2GPNA 1YFKA 1IVSA 2A84A 3CNBA 1B0PA 5SZHB 4AZSA 2WKPA 2HBRB 3BBLA 2AD1A 4X92A 2EKLA 3V97A 1G98A 3H05A 3P0RA 3IQDB 3U9SA 4CQJA 4GKKF 3DD1A 4ZC8A 4QDTA 5C1PA 4QQKA 2FMKA 4I14A 2RHMA 3WLQA 3UY4A 1NBAA 3V7UA 4BJHB 3ZG6A 1R8CA 1A77A 2OP0A 4EEKA 3UUFA 5LSOA 3NBXX 4LOLA 1U45A 1JN0A 3MHTA 1U1DA 2CE2X 2XMDA 2OP5A 1U0RA 1HZZC 4LF8B 2VL7A 2YXDA 5BWMA 2HO5A 3IDQA 1SVKA 1R2QA 4IH9A 3GZ4A 1K8YB 2OFPA 5I01A 3GLIE 4Y9SA 4U7WA 4M5DA 5I9IA 2V0CA 4O4JB 3NG8A 3MM8B 4JQYA 3EF0A 1RWXB 2GHTA 5IPFA 4X7RA 1VOMA 4TMXA 2X1GA 3I6YA 4EJSB 1U6BA 1NSTA 3EGIA 1VBMA 2NO5A 4F2DA 4YN3A 2ONYA 1OLXB 4BO6A 3R1LA 2HCRA 4DS5A 3R4CA 3LLCA 2VH7A 1EDZA 1UMBA 3LUGA 4KSCA 4O4GA 3HWWA 4FNHA 2ZH5A 2JJMA 3ROGA 1N34F 2HPVA 3K5IA 5FUBA 4TSFD 4AN4A 4RE6A 5K3OA 2EERA 1TTQB 3GIKA 1D0EA 2G9ZA 3CR7A 4Y0NA 2Q5CA 2I3GA 1W0JD 1BS9A 421PA 1S2MA 3S81A 1H4QA 2E49A 1KDPA 3WLIA 1A6LA 3O8QB 3L7NA 4CIXA 4C0KA 3WYGA 2ZBVA 2QZPA 3FPKA 2OLEA 4AYXA 4L6V3 2QTWA 2VBYA 4FLEA 4YJ3B 2QD1A 4HWOA 4JI7B 3S1TA 4ZVHA 3QJ5A 2VJCA 4RADA 4PZYA 5M04A 1MU2A 4I1OA 2HF2A 1CDEA 3DW3X 3A6PC 5JXSA 3P8BB 3HZHA 2BMJA 2REOA 3TCNA 1MAUA 4UY85 2XG8A 3INTA 5FO1A 5AM5A 3RAQA 3WNCA 4DVGA 1UFQA 3RAEC 4ZKEA 2CJKA 4Y2TA 3J81A 4YRFA 3K32A 5EPEA 4AYWA 2WE7A 3ZU3A 2Q4DA 4IIVA 1V3VA 3W2HA 1EWQA 3E8MA 3FG9A 1HFEL 2F59A 4X64B 1Q20A 1WP9A 2GB4A 4BVKA 4X2BA 5EJ5A 3LHFA 5FTNA 4OFZA 4I4IA 5CLHA 4J3JA 4Y2KA 1C3OB 4NCBA 2ZIAA 4FMPA 2WTMA 2M6LA 2O19A 2GGPB 1J2TA 1DJPA 4TTIA 2GM3A 2JIQA 1EM6A 1USGA 4PAWA 3OOJA 1W48A 2I91A 2M52A 3I12A 1UMKA 4Q00A 1Z5UA 2PGLA 3WRVA 4BNTA 3QYPA 3JQEA 4PS0A 4EJ6A 2VNAA 3PKYA 5D7NA 2W2VA 2ZYIA 3EEBA 2Q5OA 1KJJA 5B64A 3WWOA 4KTQA 4Z9BA 3ZWAA 3GLQA 4PR3A 5IDXA 3UM9A 1RWMB 4G0WA 4NZPA 3FDZA 1OH5A 4F72A 1ECBA 3X43A 3SMZA 2YN2A 4RZQA 1OX6A 2H65B 4WLNA 1AROP 2J7KA 4C4SA 2QTAA 4LF5F 2FWIA 2H16A 3UH0A 2XNDA 3HY6A 2P6RA 1KL7A 3QNWB 2MSEB 5AI9A 2DCUA 1MGPA 3LT4A 5JTTA 2UV8G 1YUNA 1MEEA 2O7QA 2JFXA 4BMXA 5LZ9A 3ABSB 2YICA 4TKLA 2QVLA 3IRUA 3CZ5A 2P3LA 4QJ3A 2DY9A 2FW1A 1W19A 1GAQA 4DV7B 1UMBB 4UZBA 4ZOBA 4PIMA 3DCJA 4LBZA 3WBJA 3EJMA 5CR9A 3UHJA 5KT2A 4FFRA 1GL6A 4R83A 3FGPA 4B45A 2ZRFA 4GC9A 3D4LA 2GEFA 3B36A 3WX0A 3PUYA 4KR9A 2NTJA 4RX1A 1KORA 3NXSA 4OQYA 4PAAA 1OGJA 3BDPA 2E4UA 1XJWB 4GI2A 3GUZA 1FE4A 4LA4A 5ALWA 4K2AA 4G1VA 4AQ7A 5JXHA 3BS4A 5BNTA 4A2WA 4BCAA 3ZWMA 3HMJG 4DR6J 1YK9A 4QDUA 1PJ2A 1UXJA 3ER6A 4CLUA 3GJZA 1FFYA 1UKYA 1XEXA 3N6LA 2YOFA 1VMKA 3O9VA 1YFZA 3G5MA 4TQGA 1H2VZ 1TL1A 5AVVA 2K6GA 5AUQA 3ETNA 3I8SA 4GKJF 4U7UK 3NMAA 3PM9A 2FC8A 2BR5A 4NABA 4IDBA 2TYSB 1JA1A 4HI1A 4X61A 4EY3A 1C8BA 4DJDC 4NXMB 3MEGB 2LIPA 3WISA 1TMJA 4YB1P 3G0CA 1T91A 3CKYA 2F1IA 4DQLA 1GY8A 1VHLA 1WOPA 3CW9A 3RFFA 1IVYA 5K8CA 4QPPA 1BMQB 2JFBA 3QAUA 3HJFA 2IYAA 3LI2A 2IYLD 4MUIA 5AK0A 5FTMA 2SBTA 3ZN2A 4ZIRA 1PJ4A 3K2YA 3W06A 5EG5A 4DSOA 4QNNA 2GCFA 5IAOA 1MNAA 1EUDB 1EFPA 3IG1B 1L5LA 4TTVA 1NJFA 3SMVA 3D0GE 1YZVA 3EBPA 1L7EA 3NMUF 5JUWA 4ZALA 4G4GA 4JR2A 2AE2A 3Q2OA 4BE9A 4PWDA 1QK5A 1G5PA 3H13A 1R89A 4S0MA 4JMPA 1KP6A 2H2AA 4ES2A 4MVJH 2BANB 3D2LA 4X20B 4IZIA 3R3WA 2A3RA 4I1IA 1ZU4A 2P11A 2AN9A 2QY6A 2GIQA 1OR8A 2JNJA 3ILVA 3MM7B 2C0CA 3N74A 1IHPA 4RIHA 3MLBA 1G5HA 5HQ3B 2O3SA 2GEJA 2QLJA 1CSEE 1H2YA 1X5OA 4EA7A 3WJ7A 5G0RA 4URVR 3TAHA 5LNK6 4GI5A 5K8MA 1YJWS 3BR9A 1XV5A 2N0SA 3W34A 2WF9A 5MAOA 1XF1A 4DSFA 2JGIA 5FI5A 2EKZA 2J33A 2AJ4A 2AN5A 3KDAA 2L9WA 5E3IA 3N0WA 4LRDA 3HXQA 4QJ4A 5A6WA 1HNNA 3SHVA 3HKCB 4ND2A 3E70C 1CDOA 3R27A 5FJ4A 4OGGA 4LHWA 2P78A 2E5FA 3R5KA 3RYHA 1VBKA 2M4MA 3GC6A 2AOTA 1OILA 4TV9F 3KQSA 3DFZA 4H4EA 4O5OA 3DM2A 2RAQA 1NIJA 5LYJB 1I6WA 3QPIA 4IIEA 4B6JA 3UNYA 3A26A 1D4AA 4QX6A 3RU7A 4X4NA 3TBHA 1W4AA 2VL1A 2FP4B 5LUAA 1O54A 1PAEX 1TD9A 5ALSA 1GPYA 3HZZA 2YN0A 5MF6A 4U9RA 5E0KB 3LY9A 1GX5A 5AW7A 1YTYA 1EI9A 1NM5C 1Y4SA 3GWCA 2NSBA 2CQ1A 4D3XA 3DQZA 3U0BA 1Q4RA 3JALA 5ALZA 3VOBA 1TU4A 4WE1A 4ENWA 3KT8A 2BY4A 1A69A 1K89A 3AP1A 3IIJA 2XVZA 4GSYA 4KQHA 3A13A 1QAOA 3P9RA 1QANA 1D09B 2XMPA 1KDYA 3OR2A 4JT4A 4YV0A 4P4TA 1I7DA 1U4OA 1SKBA 1A27A 1UPBA 2IY8A 2VFAA 1RP1A 4PZPA 4MUNA 2VJMA 3R7BA 2I55A 2KM8B 2XY7A 3LP1B 3H1GA 2GJIA 1MMDA 5HFNA 1OXBB 2G25A 1SIUA 5DT9A 2RHRA 1QKKA 3GFGA 4BNFA 4Q3LA 3OCXA 3WA7A 2IYOA 3H90A 2XMUA 1F2UA 1E6VA 5CTJA 4KFBB 1VOTA 1UPTA 3I6MA 2I6SA 3X1XA 3OLYA 1OZGA 1MEJA 1S99A 4Y2SA 2FP4A 3MQ4A 1T4GA 3VYSB 3PX4A 2HK2A 4TLMB 4PCQA 3QLHA 4QUDA 4KXFB 3OJXA 4DABA 1KVIA 1XCOA 1Z33A 2B51A 1PNVA 2HXSA 5CNIA 1LPOA 1Z2CA 4ANCA 4L8LA 2VKTA 4Y2QA 1XN4A 2AN3A 4KL8S 3LXUX 4KIAA 3UFXA 4FUTA 5ES3A 2QX6A 2D2EA 3WDLA 1SUWA 1IMJA 2CDAA 4ZI7B 1AHNA 4E03A 2AWNA 2GK3A 4DIEA 4QTUB 2MB0B 4ETMA 1SBRA 3TUIC 2XODA 1PHPA 1ZMXA 3MK31 2QBYA 4ECWA 4B3OB 3SHWA 1T2AA 1GT8A 4UCXA 2AUTA 4PIVA 2V7EA 3JS5A 4Z0NA 1ZR4A 3K16A 1TKZA 1S0VA 2AJDA 1SUDA 2A14A 3GUHA 1PO7A 3B3JA 3GH3A 4FBLA 1B8VA 4QJ5A 4INOA 2VQFF 2XZOA 3PW0A 1W88B 3FI0A 2GVDA 2QLMA 3V7YA 2NYHA 2FLNA 4HNQA 5L46A 4RIIA 1YVUA 3OSZA 4TMVA 4L9AA 2OKCA 4E5VA 3IV7A 3VNAA 4ZO9A 2GJ8A 4NPAA 4DLTA 1V1JA 2H65A 3CJ5A 2PMEA 2ZD1A 4MK4A 4O02B 2GQ2A 4HFJA 2UAGA 2X1MA 1I36A 2DM6A 3CZAA 2GA8A 1MNEA 4PANA 4WBFA 4ECZA 2DBRA 3KUUA 4MTLA 2DHDA 5B55A 3JRNA 2MKYA 3FRIA 3KQOA 2O5DA 2YXLA 3KOOA 3B4DA 1OT5A 4PO3X 1GTSA 4LNUB 3KLFB 4AZWA 3K15A 2CHEA 3RKSA 5FOSA 2M9KA 3FE2A 4HEA9 3AEUB 4K3VA 3LXXA 2HMYB 1S48A 3OMLA 1Z6ZA 3DBLB 3DZCA 1XXHA 3W9BA 4WRRA 4P7FA 1O2DA 3QVGB 3QT7A 1DKLA 3OQIA 5THKA 4CNBA 5HZGA 1NLUA 1M2GA 5I4IA 5D00A 2XI2A 2CW5A 1AKTA 4MUFA 4OK5A 3ZXUB 4JSTA 721PA 1YB1A 2W2OP 3W62A 3C43A 4JOSA 2C2MB 5KFRA 1J24A 4GMXA 4LY6A 1W1WA 4FEAA 2K1RB 5EUHA 3BWCA 2V2VA 1W76A 2KLHA 4QBKA 1D04A 4PPFA 5DDPC 3UTDA 2V2ZA 1WXIA 4S1OA 1QVGR 1C7QA 1XWWA 5EL0A 3EMVA 4RA6B 4B4VA 2NX2A 1H23A 4B3IA 5ICMA 1UQUA 4HV4A 4K6GA 4JJIA 3A1EA 4FKMA 5ALDA 2DBYA 2PJZA 4LSGA 1TFRA 3G9ZA 4J9MA 1KMNA 1FBNA 2Z2LA 2GS9A 3OAAD 4WKYA 4KO8A 1FPQA 2YV4A 4O63O 1VDMA 1H93A 3PR1A 1E2UA 1NDHA 3C6YA 3EGEA 1MNQA 1WZIA 1F6DA 1UWKA 3GCGA 3QLTA 4OZLA 4MPDA 2GHVC 1CY6A 1Y8QA 4KPCA 5EHNA 5A4KA 1DRUA 4LXUA 1TU0A 3P9IA 1GPJA 3D1LA 5IJAA 2R8BA 3WOHA 2DNHA 1UJCA 3ZDCA 1REVB 2JX2A 2DNLA 2JLUA 4KACA 1YI1A 3DMNA 3O8LA 4CKEB 4MPRA 2PZFA 2QEQA 3IUMA 2XMRA 4H35A 5LQRA 4MVJE 1OFTA 1UPXA 4CV0A 4FVCA 3JU3A 2IBTA 2AD5A 3L8EA 4USVA 4G9BA 4C7OB 1U7PA 3K0FA