4GMKA

Crystal structure of ribose 5-phosphate isomerase from the probiotic bacterium lactobacillus salivarius ucc118
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
PNQDELKQLVGTKAVEWIKDGMIVGLGTGSTVKYMVDALGKRVNEEGLDIVGVTTSIRTAEQAKSLGIVIKDIDEVDHIDLTIDGADEISSDFQGIKGGGAALLYEKIVATKSNKNMWIVDESKMVDDLGQFPLPVEVIPYGSGTVFKRFEEKGLNPEFRKNEDGSLLHTDSDNYIIDLHLGKIENPKELGDYLINQVGVVEHGLFLDIVNTVIVGRQDGPEVLEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ribose 5-phosphate isomerase from the probiotic bacterium Lactobacillus salivarius UCC118.
pubmed doi rcsb
source organism Lactobacillus salivarius
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 75
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4gmkA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gmkA01
3ENWA 1VL1A 1NE7A 1XTZA 2P9EA 4OQQA 4M8LA 2QRRA 3CSSA 5HJ5A 3NRBA 1UJ6A 3TX2A 2J0WA 3OBIA 4TM8A 3ENQA 2W48A 2DT9A 4IO1A 3KV1A 1CD5A 2RQKA 3BXEA 2KO1A 2ZHOA 3O1LA 2J0XA 1HOTA 3HN6A 3NWPA 3EB9A 3OFFA 1FQOA 1LK7A 3IXQA 3EFBA 1PSDA 4PWUA 3MTJA 1YBAA 2PA3A 1ZPVA 3LWDA 3L7OA 3P96A 1PBTA 3AAWB 2R5FA 5IT4A 3E15A 1SC6A 3DC2A 4NMLA 3BXFA 2I9SA 3BXHA 3N0VA 3OFGA 5IT0A 1U8SA 3KWMA 3DHWC 2JHEA 3S1TA 3OFHA 3AB2B 2LQJA 1Y7PA 3MAHA 3AB4B 4R9NA 3BXGA 4L5JA 3ENVA 3LHIA 2RE1A 2MDAA 3CEDA 3NZEA 4X84A 3IBWA 4R7TA 2OKGA 2F1FA 3U7JA 1UJ5A 3UW1A 2P9CA 2QMWA 3W7BA 2NYIA 1FS6A 4TM7A 1YGYA 5FIIA 3DHXA 2BKXA 2RI0A 3CH7A 2J0EA 5JJBA 1UJ4A 1LK5A 4GO7X 3ICOA 3HHEA 1DEAA 3E7FA 2RI1A 2QMXA 3MWBA 4LUBA 5T41A 1FRZA 2PC6A 3OC6A 1FSFA 1HORA 3LUYA 2WU1A 1KS2A 1O8BA 3DDNA 3K5PA 4GO1A 2F8MA 5IS2A 4L50A 2H9ZA 3OFEA 2GNPA 1LKZA 3TUZC 4L4YA 2CDQA 1Y89A 2O0MA 3LOUA 4L5IA 2RQMA 2FGCA 2BKVA 4L51A 1JT9A 3TUIC 1FS5A 2QSWA 1M0SA 4GMKA 3TUJC 2LVWA 4OQPA 4L4ZA 1RWUA 2JOQA 2P9GA 2DTJA 4GO5X
chains in the Genus database with same CATH superfamily
5AJ3F 1YB7A 5C5IA 3CNHA 2E4YA 4OB7A 1VFNA 3ASZA 1UMJA 2OBFA 4B6QA 1WXXA 1QAXA 4W6QA 5AWFC 3BV8A 4F4WA 4Z0HO 3F56A 2B6NA 2P2CA 4RGYA 3R7BA 5ESWA 5HMWA 5GZ3A 3C3WA 3WL8A 3I04M 4OF4A 2QA4S 3F3KA 4D2IA 3Q23A 1LF5A 1XTJA 3EVBA 1JDVA 4CKXA 1FDNA 4B7UA 1OBHA 4BHTA 2W6ID 4DR6B 3ZNNA 1T0PA 3E8OA 3ANYB 3T1HF 1G8SA 1QH8B 3COZA 1KTQA 1FP6A 1L7QA 2PU5A 1DTSA 1SUIA 1ZUIA 1P60A 1VMEA 4EPWA 2EW2A 2PMWA 1BX0A 1YR3A 2QVLA 3OEYA 4J43A 1WUJS 2IUFA 1OQ6A 4IUDS 1KAGA 1G6Q1 4TQGA 1U3VA 3UOGA 3OQMA 3KDAA 4M1ZA 4N7RA 3C97A 1XL0A 4X7PA 1QDUA 1Y8QB 4ZVRB 3RAEC 1DOHA 2GLTA 2M6RA 3WGQA 4HT7A 1BD4A 1XJCA 4ES3A 2CZCA 1WU8A 3CDWA 3C5EA 3KXPA 4CM5A 3KSMA 3IP5A 2HW3A 1T0HB 3A1NA 1AGRA 4PWDA 2ZROA 2JFZA 3RSCA 3GRRA 1XD2A 4DQPA 2H2WA 1JLGA 2NXJA 3OJOA 3F67A 2PL5A 2FB9A 2ANBA 1TUBA 2D5CA 1I6MA 3PQ5A 5EWMA 5C2JB 4EBBA 1FERA 3POTB 2P3QA 4UAGA 2FQ1A 4EW3A 1D1SA 4EELA 1IHXA 4LDRA 5CH3A 1ZI6A 2QK4A 3QKIA 3WKAA 1S97A 2FU5C 4B2IA 3J80U 1FTQA 3MTBA 5KX5F 1MVOA 1UXGA 5HGJA 4A1OA 3U7JA 3AVPA 2DH6A 2ZIEA 1YRXA 5GMEA 2PZFA 5ALXA 1TNDA 2XGQA 4Y1RB 3A04A 4ISBA 5HILA 2QM0A 1DQYA 1RHRB 2HFSA 2YY5A 3ZV3A 2FPPB 4NLRA 2E9RX 1SAYA 1B15A 1SVLA 4KPUA 1P9LA 3PFEA 2YVAA 3UWOA 4P6QA 2ATCB 1KEWA 1GZ5A 4V38A 2A5LA 1LXJA 3PHIA 2W9CB 3DE7X 4TSRA 5LMZA 3QVMA 1YC2A 2P9QA 1LDGA 2ZVQX 1Y6QA 3ISND 4J2TA 4M60A 5FOWA 3B9PA 3PGMA 5IAJA 1WCYA 4K03A 1CCWA 4FF3A 5MN6A 3HNOA 4D9KA 1QTNA 3EH1A 4TZ0A 3IEXA 5DYGA 2JDID 2NO6A 2VJPA 4HS4A 4ESVA 1G5IA 3R6LA 3W5IA 2WU4A 2Q6TA 1LWFA 1WWKA 2Q3DA 4C0XA 1NRJB 4GPIB 3D1QA 1TCCA 3GEHA 2ASEA 3BXOA 3CO0P 2XG8A 3K0SA 2VLBA 4MK4A 4DL6A 1W30A 1S1WA 4LRUA 2QTRA 4J9PA 3ZNQA 3QPCA 5J4VA 2ZCUA 4YJ2F 5A2GA 5JLJA 3VAAA 2I65A 2B9WA 5AVXA 4CR6A 4I3GA 4CRWB 1RWNA 2Q3LA 4EVRA 3R41A 2FPGB 1VQ1A 4AD6A 1X7VA 4DARA 2O0JA 4JUCA 2YWJA 3T95A 2GAFA 4YRCA 1WKJA 2GLUA 3EAQA 1XC7A 5IZCA 1OLSB 3MBKA 4EMBA 4LXTA 3AYXB 5MAOA 2FXVA 2M6SA 4NECA 4RHUA 2ZE7A 4QPCA 5DCYA 3IFEA 4CFZA 4IIDA 4XR9A 5BRJA 1X7ZA 3DMRA 4CI9A 1MXFA 4YRGA 2BFWA 1V1RB 1GTJ1 2B21A 5B1EA 1XNRB 2OHOA 5KHLB 4KTQA 2JI7A 4KV9A 2FHPA 5M29A 3L4SO 1TIBA 1RHMA 3K5IA 2C3MA 4D98A 4QFBA 3I5AA 4LMRA 1TKZB 2DCMA 3BKXA 4I66A 5AXCA 5EOVA 1RLMA 3DNPA 3W2WA 1GPMA 2NAPA 2UP1A 1NF9A 4YCSA 2G5TA 2SCUB 3AFIA 2HYIC 2IPAB 5LYJA 1CR0A 2ZT8A 1N9GA 1NXTA 5IZ4A 4Q47A 4KRGA 2CNOB 1QE1B 5JYDA 4Q02A 1XAGA 3WYEA 3RGIA 3TOQA 2GO8A 1QVRA 5BV1A 4IIUA 3FPLA 2O59A 1SQGA 4GZLA 1F12A 1UPFA 3DCYA 2VJOA 2QA5A 4ZIRB 1U3GA 1WACA 4HZUB 2ZANA 5JQGA 5J1EB 1T3NA 1J24A 4HY3A 2FG6C 5E9AA 1SHUX 3R1IA 1X60A 2V9PA 2J3DA 4EAAA 1ZXXA 1U49A 4K8RA 2NO0A 1C14A 1QLWA 1UJNA 3EGDB 4BIMA 1OI3A 5FWAA 3UT6A 2FJXA 2DPIA 3ABZA 4EAQA 4UJ3A 5C37A 3E58A 5IKEA 5FLXY 3BTUA 3NBFA 2EX4A 3TIIA 2CN1A 2M5YA 4BDPA 1VJQA 2XH8A 3IOBA 1FNDA 4TTTS 4URHA 5KYWB 3VDQA 1XRSB 3A0UA 4XDHA 2JOQA 1J5EJ 4OQQA 3SHFA 1T4DA 3ZGOA 3K89A 3HVJA 4CT4B 1OSNA 5F7ZA 4L3NA 4M38A 3FYUB 2HVHA 3FVQA 3RQSA 2GFHA 1NMQA 3IJEB 3QV2A 2VIIA 1MFZA 3GVIA 1TF2A 4PX3A 4HN4B 3OLVA 2ILVA 3BOSA 4PXCA 2QLLA 4MRRA 1WPXA 4GW3A 4RK1A 4O33A 3SBOA 3CUUA 5GM1A 2I80A 2JFXA 2C4HA 1RC8A 3M30A 3AVXA 2HSWA 2I7CA 3V81B 3BXXA 3KHRA 5TXGA 4KLCA 1E98A 1QUFA 3I12A 4A26A 1YK9A 5C5EA 4O3QA 4O6VA 1V41E 5LP6F 1W5AA 2GJIA 1JPJA 1Y11A 2BW0A 1OPZA 5LMNF 1Y3HA 4X93A 4MUMA 1O94C 4U02A 3DV0A 4I6YA 3KD3A 1JV2B 2V7EA 5J47A 4GUAA 1PV2A 5ALKA 1QRSA 1BHJA 1P9YA 3IT1A 2HWTA 1PR3A 3L9WA 2JEZA 3U1NA 3L95X 3BQ9A 2WAOA 5EZ6B 3HI9A 3ILSA 3O4RA 3BR9A 2CJBA 3DLEA 2X9VA 4REOA 1BDJA 4HAZA 3W6ZA 5EIEA 1N2XA 3HRHA 3R9IA 3RWMB 5JUWA 2FQWA 4Y7CA 2CFSA 1LWXA 1TL7C 2RCNA 4X84A 3TW0A 2I78A 2OFFA 4E5NA 4K6OA 3ZDDA 2VN8A 1X87A 2KS6A 2Q6KA 2R7WA 2IV7A 5KG6A 3X1ZA 4R0JA 2EKDA 1T6BY 4QXAA 3A2NA 3DCAA 4MA0A 1ZGGA 3FGVA 3VO9A 1VE1A 5EWJA 2VJAA 4W5QA 4KQJA 1D0SA 4H1UA 4L95C 5KSOA 2XYGA 2IYZA 4O4LF 1DKUA 2XECA 3AM3A 2JL9A 3QEBZ 1YDEA 1OY9A 4WFAQ 3ZC3A 3UWMA 2J3QA 2VG5B 1PGJA 3MK31 3IESA 4DF4A 4DN0A 7AT1B 3OJLA 2AQHA 1DDIA 5AKKA 3H1AA 5JZVA 2VT2A 2Z56A 5IV3A 3GFGA 2B8PA 1VP9A 2C2HA 4KKXB 1SKBA 3F98A 2XT6A 4PSDA 2CPFA 4XJXA 1Z83A 4DR7J 4UQTA 2PMDA 4YAGA 2W4DA 1V3SA 1ZW1A 3R4VA 4NASA 1ICIA 3H5TA 3OLZA 3RTAA 1V3ZA 4ZAWA 4D44A 4EGFA 2AJFE 1IBLF 3M81A 1HDIA 4EEZA 1QC5B 4QR1A 4L85A 2TS1A 4LRYA 4OHXA 1E63A 2ZVIA 1LRKA 4JNCA 4D3SA 2UZ4A 1UFLA 1RYHA 3DCNA 2QX9A 4JHXA 5JNVA 4RFVA 5EL0A 2WUFA 3EAFA 4MV0A 2IYEA 2RHJA 1WI8A 4I5EA 1WOOA 4LVOA 4XJTA 5JS6A 1KY4A 1TI7A 4DCOB 3R3UA 1AS0A 3DE2X 1QGED 5ALOA 5JOQA 5LJ5Y 1VC0A 2H5EA 1D9ZA 1Q91A 3PJ9A 5AVVA 3EIEA 4DGQA 2LXIA 5AK3A 1XJ5A 3S0JA 4RSMA 1O95D 1PW7A 4PICA 1RBAA 2FUG9 2VU5A 2VBXA 4CO0A 3HCRA 4K9OA 2XUGA 3WLPA 4FYPA 4GPTA 4QBIA 2X4IA 3IP1A 5D5HA 3ZZ1A 2WWXA 2R7VA 4GMXA 3PF9A 4OLBA 3A1YG 1U02A 3G82A 1M76A 3F1LA 4TKTA 3TR5A 1C0TB 1E6LA 1DAEA 3V1TC 4D4LA 4ZPXA 1VRUB 1T36B 1RP7A 1VB3A 2Y68A 1Y48E 4NRUA 3RARA 3CSDA 1XR3A 3W7VA 1EVEA 1SK9A 1YZTA 4V03A 4QUDA 2R7NA 3WRXC 2HA2A 1ORWA 1E59A 2X0IA 3UHJA 4IFTA 4IXNA 3EVNA 1CQMA 3MWBA 5GZ1A 3PTZA 1YQGA 3IRXA 2J59A 2RAQA 3N53A 2OXFA 1U3CA 4H1VA 1Y89A 4ZPVR 3PC8A 1A82A 1E77A 1HE1C 1Z6AA 3AM5A 4JI1F 3EGIA 3LRTA 3SBMA 5FT9A 2VCHA 1DURA 1DG1G 3GFTA 2OBLA 2JI8A 4WZBE 2HWUA 1RT4B 4NK4A 4OH1A 1YRBA 2O8BB 4DR4B 3TNYA 2JCYA 3LRPA 1Q7EA 2NU8B 3X1WA 1JEJA 1UM9A 2PJDA 4P3YA 3PZPA 4DG1A 1Y6JA 4TUYF 5DNYB 3R8YA 3S2FA 4FKYA 4XTRA 5B58C 5CABA 5CEFA 5BSUA 5IT9Y 2XRYA 1NUUA 4OP3A 2C2NA 1VC2A 3HU5A 3NS6A 3HHLB 2E9SA 1E1NA 2DXEA 3MUVP 5BQ5A 2B4VA 1YZHA 1XJWA 4KO2S 1N1GA 4I4TA 4X54A 3V46A 2P3SA 2VODA 3BK2A 4QDJA 1FMLA 2X42A 3WYDA 2Q99A 1P2UA 4COOA 2WHOA 3EXIB 3QOFA 4Q1VA 4N77A 4A8FA 4L08A 2H4JA 2HQCA 3NJ4A 4AWXA 2RIRA 2IBSA 3CA8A 2XHWA 3Q8LA 4WBNA 4X66B 4AZWA 1L1EA 1C8KA 4C3OB 4LF4J 4NCKA 1L5LA 4C07A 2G0TA 1Y4UA 2JCGA 4MQEA 3PDWA 3UH0A 1HBUA 1DKOA 3N74A 4EUEA 1RDFA 2WWRA 1AK1A 1RKIA 2HVZA 4BWMA 1YHNA 2ZS9A 4P7BA 1RQ2A 3MMNA 1V45E 5ES3A 1HYBA 3V42A 3AM4A 1N9KA 2C8JA 3RHZA 2VYFA 4YJGB 3HVWA 3TD9A 3M9OB 2YJ4A 4ECWA 2FZCA 2GVZC 4IIHA 1KTVA 5J1TB 4YUVA 2HF7A 3OTQA 3GXBA 3FOZA 3FOFC 2RMLA 3B7GA 2E5LB 1WM1A 1QV9A 1ACJA 4N49A 3BDAA 1YJAA 3DI6A 3SLRA 2XGJA 1PRYA 1MMNA 3SJAA 3K05A 2COEA 5HVHA 5AI5A 1E79D 4TZ6A 5DGBA 2YWGA 1RTDA 5KOHB 4ZCIA 1AUQA 2C4MA 4NXNF 1IH8A 2VOJA 4P4UA 4K4XA 2XS7A 1A9ZA 4J1SA 5A0VA 4UE2A 2D6FA 1XA4A 2RRAA 4PF1A 3RRBA 5L9AA 3DZJA 1ZM9A 2FLWA 4QJIA 3KQVA 1A5AB 3HYRA 1LSSA 4ZTBA 5EMHA 4OX9J 1XMJA 3CEMA 1XMOF 2H7XA 4OZ2A 5KYXB 2VC0A 5C42B 4J9QA 4PLHA 1WB5A 3NAQA 1Z0DA 5C8XA 3ZO7A 3ND9A 2WKSA 3L0PA 3HU2A 1R4MA 5DEIA 1XVAA 1CY2A 1UA0A 5CFRA 1GTRA 1PJCA 5E0KB 3Q7PA 2BJVA 3ZJ4A 1ZOLA 4EJ2A 2AVDA 2D1CA 1CHNA 1T8EA 1Y8AA 4R2IA 4CT9A 1S1XA 5ETKA 2LLZA 1KYIA 3K57A 4IX9A 5G3ZA 1UAGA 3H11A 4QUHA 3RVSA 4B33A 1ZVVA 4LF8F 2XYQA 3PLRA 1M9NA 1J1UA 4M3NA 1GO2A 4PZCA 3FUXA 4ZN3A 4DPYA 1NRIA 1FU7A 4L5IA 4Y0AA 4KPUB 3GK3A 4ZJYA 1YBHA 1R4NB 5IEJA 3U09A 5AHWA 4Y9TA 1BXKA 1GG5A 1Q5PA 1EFVB 1U0HC 2G0CA 3RVNA 2R7LA 1XN9A 3TSZA 3G9CA 4OV1A 1U7PA 2V7GA 2W25A 3EZNA 4R81A 2Z2KA 2GBFA 5BYJA 2AFRA 4BN0A 2NUBA 1N6HA 1N8NA 4KE5A 2HHWA 1NG1A 1S6OA 3GYXB 5CD1A 2UXBF 3I9ZA 3GGOA 2H7CA 1X13A 3N0VA 3UQZA 5E6RA 5EP4A 2V65A 3GV7B 3R0JA 4GI2A 4TRRA 2RRNA 4LXUA 1FDOA 3FMVA 1PL7A 2WABA 2HPZA 1XK6A 2ERXA 3G0BA 1LPOA 1WHTB 2TMGA 3P9ZA 5DRYA 3O47A 2O5DA 2Y1OA 2HZAA 2GZRA 1C7IA 4FYKA 4B75A 4ETZA 3L5KA 4WSOA 4B79A 4ACAA 1WXDA 3DV0B 1DIAA 2PBRA 5EJ6A 4EHNA 5JS7A 4M7OA 2QLBA 4NF2A 3AJAA 1DJMA 4KQ9A 2B94A 1Y9JA 3G0OA 3ZVMA 4N7TA 3HFRA 1EARA 5BYBA 1R4NA 4B3DA 3RF6A 1D8YA 1QPZA 2V50A 3M8SA 1EFRD 2V6JA 1K5DA 1WY5A 2FQXA 2BAGA 5KTYA 1TA0A 3VHLB 4DQIA 2OGWA 4P9SA 3O26A 1DC4A 3TQCA 4RH3A 3TLMA 2ZM6F 4M4SA 2XA1A 3OIWA 1N7HA 1QH1A 4MJ3A 2EZ8A 2QZ9A 2DEIA 4JN6B 1WZ2A 2XNQA 3CCTA 3VTFA 4R3UC 4E30A 1Y5NA 1QH0A 3LVFO 3AB8A 3KKEA 1XZEA 1XIQA 5DISB 3G1WA 3SZ2A 1FD8A 1ZCBA 3N0RA 3NBAA 4WBFA 1QR6A 2JH8A 2LV8A 2UYCA 5JPDA 4FYDA 1ULUA 1N33J 5K20A 3W2GA 4P3XA 2BELA 2REXB 3P2EA 2GJSA 3UAVA 3E3LA 4MW2A 2IXFA 1O6ZA 3JQDA 1E3WA 4QUIA 4TVBA 5H81A 5CA0B 2F43A 2R11A 2CVHA 5GMOA 3ZIUA 3C87A 1PBAA 3BEGB 4BMSA 3KK3A 2Q9CA 2CQCA 2QZJA 2BCGY 4OLOA 2AJ0A 2AGVA 5JAMA 2BUNA 4RW9B 4BB0A 1UMBA 4XDGA 3HVTB 1HD0A 3IE0A 1TL4A 4YBRA 4BB5A 2XJ4A 2M2IA 1RTJA 1NU8A 3ZW8A 5F21A 2QQ0A 2XNKA 1URRA 4M1MA 3IS9B 3PCOB 3UAGA 1M2HA 1R0RE 1R8AA 3D6TB 4B6PA 1FEEA 1F5CA 4HFRA 2BI7A 5KFSA 4KVGA 5K6TA 2O1XA 5L95A 2RGWA 1R8QA 5FI1B 5LQCA 4AKGA 1S3FA 3BGDA 3NJRA 1IDN1 3RVJA 1Y8CA 5SY4A 4NZZA 2GK7A 3R40A 1DO2A 1VGQA 3G7SA 2AK3A 1IRIA 1MEEA 4HRAA 4UM9B 4NATA 2Z3WA 1DEHA 2EFOA 5J23A 3R7SA 2DWCA 4C0WA 1II9A 4MWBA 4BGIA 5KYYB 3D66A 3QAEA 1A9PA 1EUZA 4FDTA 1CQXA 4OMDA 4HNUA 5ETPA 2RHGB 4WFZA 4YQWA 5LBTA 4AXXA 4BQNA 2Z8QA 1IZ0A 4PHHA 4JX8A 3LCJA 3KAPA 3MG9A 5A5VA 2HSEA 2VHEA 2RI6A 3ICWA 4OFWA 2VP2A 3I9MA 5CCMA 4NL5A 1BFUA 2LKDA 2WEKA 3L0YA 4IIEA 2QT9A 1Y81A 1FESA 1Q0RA 1HKAA 3WGHA 4P2BA 1E4YA 5EE1A 2QRGA 1GXTA 3U44B 4OFXA 4BFSA 4XFDA 1XJQA 2YJZA 4JIGA 1WNTA 5F78A 5JFGA 4D9GA 4USHA 5GVQA 3UCUP 3GRCA 1R9NA 2J6IA 1RI4A 4BVLA 3NHSA 3EVCA 4LYFA 2BGMA 3E53A 4YO7A 1B74A 3PT5A 4WFKA 4QYZJ 2AB0A 4AN4A 2VHYA 1Q8BA 2PRZA 4EA9A 4RVHA 5LBUA 3KUKA 2P9CA 4F25A 2ONCA 2XY6A 4FNOA 5A2QU 5AW6A 3ROKA 1OYWA 2CL6X 3KK0A 5JWRA 1R0WA 2HMIB 3GWGA 3S1SA 3H5OA 4I1VA 4EMTA 4DLYA 2ORED 4QPDA 2Z08A 4DL3A 2CVPA 4MRSA 5FUVA 4N82A 5DI3A 4QOGA 1SEPA 4NZ9A 1V5GA 2X9LA 3BRWD 4LF7B 4ALMA 4TU8A 2VJVA 4WINA 5E3JA 4DV2B 2R9LA 2XVYA 1PYTA 3DZ8A 4H4DA 5JVHQ 3D3WA 4QTXA 1JQBA 4CDIA 5A04A 2RU3A 1UWVA 1T9GS 2JRSA 4YHHB 5BPFA 1WTCA 4IRMA 2Q1LA 4U2DA 5F8LA 4CMKA 4KXXA 2E4VA 2UZ1B 1C29B 4ES1A 1SM4A 2AE1A 3OTWA 1O08A 4CKZA 1PJTA 5L9NA 3HEMA 4OIXA 4ZHQA 5HF8A 1IOWA 5FFNA 4DOZA 1VLQA 2D8AA 1RLCL 2WKQA 4EUFA 4D45A 1WBJB 4CLZA 2HPHA 4EG8A 3C6UB 4UTVA 2F40A 5F8NA 5JQGF 4V1CA 1YKGA 2JL1A 1XUOA 3UGQA 3H5VA 4X1OA 4ECRA 1HE4A 1RYFA 4NCAA 3GEGA 1TK3A 1KPGA 2AUNA 5LU9A 3ETOA 5LMUF 5LQRA 3FPBA 1FIUA 5L7TA 2OQVA 1MZVA 3JD0A 2BJDA 5D51S 3UM9A 4PPZA 1LQ9A 5K3FA 2EFJA 4BASA 3DFUA 4IKPA 3D3KA 1TK0A 1WW8A 1Y1KE 1UA1A 4JQSA 5D3KA 4NZYA 3G6WA 3M89A 1VKOA 2C4NA 4DSOA 1RM0A 3LAKA 3WG9A 2JZNA 1QIIA 1PQPA 1T9UA 1YVEI 4UBMA 5JFOA 1JLQA 3DKDA 4EHBA 1MAUA 2RI0A 4OYAA 1QRRA 1PG5B 4A47A 5F4ZA 5KNBD 4LMZA 4JBCA 1Z0UA 4RBUA 2C2OA 2ZJ6A 3T61A 3GYBA 2G2YA 4ZARA 5KC8A 1DHRA 1AXRA 4ED1A 2BKVA 3A6JA 1J9GA 1FLAA 3DZIA 1M67A 4EPRA 4DWWA 3G0IA 3H7AA 3B6KA 4WGFA 3AGQA 3OCVA 3PE3A 2JGJA 4M7PA 1FDWA 4ER5A 3QIDA 3JQ8A 3KOWA 3ZHXA 2JFKA 1NJZA 4ZJOA 2Q27A 3GEEA 4BDSA 1UKUA 1JILA 4HNQA 3DBVO 5EHXA 1OJ4A 4HAWA 3U16A 4PCQA 1ZWKA 4C20A 2NPFA 3OTDA 5FNZA 1Z5PA 2NVOA 2OD6A 3GNQA 3MB5A 5E2AA 3W64A 2WJJA 5CPBA 4HL9A 1TGVA 4LHZA 2C78A 4YR0A 3H2IA 1ZIPA 3MGCA 5AKLA 1KYZA 3OR2B 2HQDA 5BR8F 1A8UA 3FSEA 3UWDA 4J75A 2OXTA 4IS3A 4J4HA 2VA2A 1MQ8B 5G3YA 4EX7A 4BLVA 2Q2VA 3ZZTA 1Z2EA 2QGNA 4J9LA 3RH0A 3AF1A 4BX0A 5BYKA 3SBXA 3UXEA 5J4HA 2XXAA 3MMZA 5DW3A 3MMAA 4NI2B 1E89A 4IJUA 3ZK8A 1UADA 5FHQA 4JLDA 2LYVA 3KYBA 1CBKA 2GCIA 3I0RB 2JFYA 1KS9A 2V68A 1PGZA 4LFAJ 3NT4A 3OTHA 4H1TA 1IPFA 1S4EA 3DOFA 1KDNA 2EKLA 1NYRA 3PPXA 2OZLB 4XLLA 3RGWS 2ZAGA 3GA0A 5CVJA 5CDHA 4KMMA 3N2LA 3AEKB 2J9GA 4X1KB 3ZDZB 5JJ5A 5DM60 2W2MA 1FRXA 3T1VA 1F6BA 1YVFA 2QJWA 3QWPA 2DR6A 1A5BB 2ZRMA 3FGOA 4F6RB 1GXLA 1SZCA 1L4UA 3GUCA 2VJYA 3BE6A 4BP1A 3KNGA 5J5VA 3QU7A 1M5TA 5B7QA 2HFVA 5D7BA 4ZDIA 3RABA 5ALMA 1EX1A 5H59A 1LW7A 5BSEA 4NBWA 3S29A 3M6XA 2YYAA 2CK3D 2XWJI 1EWKA 3IR6A 5FJ4A 1O1YA 4F8EA 4G09A 3ZHSA 3P5BA 4B7CA 4O4HA 4MTPA 1VL0A 3OZBA 3THOA 3OEWA 2D5BA 3SX0A 5DDQC 4OBWA 2R4UA 4FIDA 3E1KA 1XYGA 3GFPA 3UV7A 3QWIA 2ZB3A 1OUMA 5I7RA 1JSXA 4C4YA 3EAGA 1WUIS 2QGFB 2R2TA 3W5HA 2GKOA 1JJ4A 3VGVA 2HM7A 1RT6B 1U1MA 2C0QA 1BOFA 1TEXA 1G38A 3ITHB 3PFKA 2WKPA 2IYLD 1XP8A 2QQFA 2VYCA 1AFJA 2ORYA 3L0BA 3ETLA 2V7UA 3MAAB 4LF5J 1HPZA 4DLGA 5E1DA 4ATNA 1UPUA 3JYPA 1PNRA 5FWDA 1PHRA 1ZK2A 3WYGA 2H63A 1V5WA 2F1IA 4IDNA 1LW0B 3L1VA 2ZI6A 4QIGA 3PDCA 1IR2A 1GGVA 1F4VA 3CZCA 4YCAA 1KDRA 3R9WA 4Q3NA 2ZJ4A 2ZJBA 2VP0A 4BC1A 4CT0A 1GM5A 3H6GA 3CD5A 3G2LA 4BQQA 3MM5A 1GSHA 2XCPA 3ZXXA 4C0AC 3TLJA 1BW9B 3EX7C 2Z57A 1BE8A 1IKWA 3QVTA 3D6JA 3NW9A 4I8IA 1RTZA 2NIPA 4L6V3 1S8OA 3FE2A 3K15A 1H1LB 2M7SA 4AL5A 3FBEA 1RWBA 3JY6A 2B5WA 4X8HA 2MHNA 4BLOA 1D4ZA 3UK7A 5J2PA 1GQQA 2SKDA 3UZUA 1Q5YA 1VKZA 2HMTA 1GU0A 4IILA 3P0JA 3QPAA 3WIVA 3R4CA 2J32A 4OHMA 5FEUA 3CVJA 1OR8A 3HACA 3LG2A 4GL4A 4MWCA 5BQFA 2Q1UA 4IG4A 3WK8A 3EGDA 3PQ4A 1H6BA 1VLOA 5B09A 4B6EA 1N77A 1FXWF 1I1OA 4G5FA 2AMLA 3JZMA 4MUIA 3VALA 1V8ZA 4G25A 1V5VA 3NEJA 1EWVA 5M2UA 5A62A 4RNDB 3ZLUA 3N2GB 3D4JA 4INOA 3RC8A 5J1PA 1PSZA 1RLDA 1NQAO 5ELLA 2PKCA 1Y5LB 2FJ0A 3OM1A 1MGOA 5GAGI 3H59A 2KM8C 4QGAA 3G9TA 1I5RA 3PFGA 1GAXA 4O8ZA 4I99A 1M2OA 1K3UB 4U9RA 4A0SA 1NRKA 3W04A 2PZMA 2XS5A 4BV9A 4UDXX 2AJBA 3UYKA 3PX0A 1CC8A 3OA2A 3MPYA 1CG6A 1A98A 3K8ZA 1FFWA 5LQMA 4DV2J 4OHVA 4USMA 3AKEA 2G70A 4BFLA 1HDRA 2SNIE 3TAMA 1GRVA 1OWLA 4XB1A 1YL7A 2CQ3A 3TFWA 4MIYA 2OSVA 3TNJA 3GJQB 5JC1A 2CZVC 3QE4A 4A8KA 3LX8A 4E5PA 4U5QA 1E6UA 3C3JA 4HO1X 1WC0A 3HCOA 1CD5A 1YXMA 2A33A 4AXBA 5HJEA 5MHTA 2E82A 2GXQA 3ROXA 3PRBA 2OILA 1RWKA 3FCHA 2G2OA 2H2FA 5KFIA 4K40A 1SQSA 4RK7A 4JI5F 4H0NA 1JFFA 3IPLA 3RKSA 1UZUA 4UHHA 2ZD1B 1QR2A 3T3NA 521PA 2GJ9A 2VS1A 1E5XA 1HC7A 5CAEA 4W9NC 4NI2A 3R3ZA 2GBIA 5BSHA 4ZA2A 2O2EA 4JXJA 5DXAA 1JLFB 1XROA 1M6YA 3CR8A 2ZJ7A 1XEZA 2UXCJ 2MJUA 1C0KA 2XX3A 3GFRA 3MM8B 4LJAA 4N9QA 4KFCA 2GUWA 3QWAA 4R9VA 4L0QA 1XU4A 1MG5A 3BMNB 5HM8A 3C3PA 1KOJA 4HVLA 4OQPA 3QXGA 5JXJA 1TQ8A 3H2SA 4NFLA 3M5PA 3N0WA 1O5JA 3BKTA 1L5OA 5KFHA 1Z26A 1ZVJA 2HK8A 3PUYA 2IM3A 2YJ3A 2M1XA 5CU7A 5FUWA 3IRUA 5A3SA 2C3OA 2Q3FA 4JI5B 4WTYA 3CCMS 3N8KA 3BB5A 4GM1A 4J1QA 1GAWA 1GAJA 1SELA 3ZV4A 2KXFA 4OYYA 1DFDA 3K9LA 3AOCA 3KUUA 3P2KA 3LHFA 4L4RA 1XZGA 1BXRB 5K3SA 2NZXA 1HV8A 3E9QA 2NSCA 4ZP1A 2IEDA 2ZYTX 4NONA 2QZSA 1B6SA 2R8JA 5AM3A 4G81A 4Q16A 1ZUNB 5JAIA 2ZRDA 5C7PA 3M49A 4NEQA 3GONA 2PNJA 4DF8A 2B5OA 3HZOA 4YAOA 4U39A 4KX5A 3HZZA 5C42A 4WCDA 3SIXA 3V3KA 4BKQA 4UNNA 4DRXB 5TMBA 4QPPA 1OGJA 3DTVB 5K0JA 3HUEA 3UPTA 2EW9A 1KNXA 1KI2A 1WCIA 3RC1A 5CCXA 4J7AA 1WOSA 1BXGB 1IHOA 2IUUA 1FMFA 1AF7A 2AD1A 4J5OA 2X8LA 4P1ZA 4MLZA 1GLNA 4YXWD 3D2BA 4L0CA 2A30A 3VKHA 1E9BA 5JUMA 4DLEA 2GH1A 3K0AA 2CPDA 1MA0A 2VFVA 4R9SA 2I91A 1RBZA 5AW9A 2Q0SA 2C5FA 1FL9A 1CK4A 2C7QA 1YGPA 1E3QA 2FUNB 4CL3A 2X5JO 4MLDA 3L02A 3Q3JB 2Q0XA 3H90A 3UHOA 3JD4A 3JALB 1UPAA 2VZ0A 1AMUA 5I7OA 1N33B 3S1TA 4TQAA 2JGMA 3QX3A 4V3BA 3Q2IA 2B4KA 2RAPA 4A4JA 3GXOA 2M6KA 1GXSB 3TLBA 2ZHBA 2R7QA 4C4SA 4KBYA 3D2AA 1HYGA 1VHTA 4MTLA 4YJ2A 1AURA 4G9GA 4S04A 4N3AA 3AFOA 3FNHA 4JV5F 2W7OA 3L41A 4AP5A 1ONSA 5A6VA 1PLLA 2I4RA 1U04A 2FJPA 2VXBA 1KD1T 2D1FA 4G4IA 1WJ9A 1IKXB 2ZBGA 1R6XA 5FBQB 3AW9A 1HMPA 3QV1A 1FYFA 2PX3A 3JTNA 5ALZA 3PX4A 3PQDA 2B5JB 4QW9A 1C1BA 4CM2A 5DHPA 3NY0A 1SVNA 4GO5X 3RG2A 4EWLA 4R69A 1IWPB 2XZOA 3OKCA 1W76A 2IU0A 1FK9B 4X4SA 4G84A 4MUEA 1BMQA 3WRYA 1JHMA 4B7AA 3KJVB 2JDJA 1RHKB 5FLXA 2VUIB 1WR8A 1OPXA 4M8NE 2E1RA 3QSYB 2AIRB 3HH8A 1JHYA 2MSTA 4A6EA 2XSJA 4F2WA 5K3OA 1PZHA 3O3CA 3W8DA 4IDHA 4Q4HA 1RPAA 3NMRA 1ZNYA 1OXMA 5BQXA 3B82A 3B9BA 2VA8A 4KNYA 2GA8A 3A6DA 4FWTA 4Y2JA 4NBLA 2F43B 3K70C 3H8YA 2OM2A 1U1PA 3M1LA 4FYVA 3U4MA 3PICA 4JDPA 3X44A 4DWVA 4HGPA 4YCMA 1IBSA 2VDNB 2QL7B 4Q7AA 1M6EX 4TWRA 2ZH9A 5C7YA 1B42A 4QCLA 3U81A 3X2EA 4DPXA 1RT3A 1OIAA 4UXJA 1JR2A 2EKQA 3TLGB 5IM4A 5HGXA 1BYIA 1XRNA 4HYEA 1CETA 4HH0A 1NR5A 5EGSA 2BH9A 1UFRA 4RGBA 2P8IA 1ICEB 1V6SA 4PCLA 2YS6A 5AW5A 4AKTA 1OXBB 3QKWA 2V7XA 1ZJ6A 5A76A 3P19A 3BD7A 4ZPWR 4LIPD 1PG5A 1GUAA 1RS0A 1QHYA 2IYIA 1OT5A 1W4CA 1BHQ1 2PBZA 5DGCA 1JH8A 5KYNA 4EHDA 5LL6P 3GA7A 1DAHA 3KLFB 2C3UA 3IJPA 1H6KX 4Y2RA 1JBKA 1OSDA 2A9RA 3IJRA 4MPTA 3PNIA 3DCJA 2ZE6A 4WY8A 3NGSA 1I7DA 4G1IA 1GTVA 3TE6A 1OFGA 2RKIB 3H98A 1NMEA 5K14B 3FZ2A 3HE3A 5AHKA 5DT9A 2N1MA 2CHVA 4YMGA 4UXIA 1TM2A 1GMVA 3RG8A 2W6QA 3DZBA 5M7EA 2WJIA 3H05A 4LXQA 4JA2A 3TI0A 4LTDA 5DWDA 5JXHA 1TO2E 3K0KA 2C5GA 3W6UA 5M34A 4W7IA 4ASUA 1A4IA 5JALA 1Z2LA 3DDHA 3GLGB 3OFEA 4X4UA 3I6PA 4AMYA 2NPIA 4KFBB 3QBEA 2NU6A 5GVRA 5I3UB 1SPXA 5BNFA 3RFTA 1ESNA 3X1JA 3ZD8A 1JNYA 3ERCA 2H1SA 2OV3A 3T5CA 1UWLA 1V39A 3WYAA 1E2BA 1QBKC 1KFJB 3ZIAA 2Y27A 3M3PA 4PSCA 2WAAA 2BJWA 1QVFR 1CUFA 1KY2A 3OHMA 1P3JA 5KFFA 2J0XA 3SG0A 1TJ5A 1LW2A 1T24A 3H1FA 4MNTA 4F4UA 4JI6B 2X3DA 1P29A 3LP8A 3AG6A 2GEVA 3H3XA 1P73A 3CVYA 2GVDB 4HWKA 1SXJE 3AVUA 3EJWA 4JQOA 4ZVOA 3KJFA 1N2IA 4GF5A 3R9KA 3PQ6A 4CMEA 3N58A 2X1HA 3U4CA 2QA1A 1U9IC 1FFCA 1YK0A 4TS1A 1Y3DE 1SUCA 1GPAA 1SUWA 1QM9A 4WNYA 5DHSA 2YQ4A 1ISMA 1UCNA 1VRVA 1WDKA 3OQOA 5G53C 3I09A 3MILA 2WAQD 2LGJA 3GAZA 4HDKB 2XWSA 5DI3B 2RH5A 4CPDA 1H23A 1KYQA 3FSGD 1YIJS 2GBCA 2PX0A 3DMYA 4YQZA 4G9BA 4F9FA 1V8PA 2QTBA 3LH5A 2RH9B 4M0PA 1M5RA 4PYMA 1NRXA 1P2SA 1HR0B 1ZK3A 3GJTB 1GXSA 4ZAZA 3PJWA 1J5PA 1N36J 1FTSA 3RAGA 4EATA 5MLCV 4X71A 4TQRA 2CCKA 1HOTA 3OFFA 3WOHA 1SUPA 1U0GA 4EUSA 5TQ2B 3ZYZA 1EFLA 4J0QA 3ITHA 4RH0A 1OI4A 2W5UA 4DUZB 3QZ8A 1SXJA 1M1GA 3W9YA 4KB5A 3QT8A 4PNEA 4NWBA 4URSA 1K3FA 5AQ1A 3BN3A 4O4LA 1KERA 5AM4A 1UPXA 1TT5B 1J90A 3E70C 2HBZA 1UC5B 2RGEA 1N5JA 2V7PA 1ID1A 2G0NA 4EBFA 4R1QA 1E3DA 2Q6BA 2MMCA 1XMSA 1MR3F 1YS9A 4EY3A 2M6LA 4ND2A 3WLKX 3MR6A 1NBAA 1VBYA 1B26A 1KBRA 3LS2A 1KORA 4DEVA 1IY2A 1I5OA 2ZB8A 4KIJA 4ZI2A 3N0TA 3UANA 3GPAA 1GNQA 2QG9A 1YJXA 1XTZA 4YT8A 1R0XA 4FF4A 4PZ0A 5E6UB 2WUVA 2DY1A 4ZQCB 2Q6CA 4XPIA 3SHVA 1H9BA 4R51A 5F98A 3D02A 4K0KF 4EBEA 4B3OA 5L3QB 1KSPA 2D7CA 3H4VA 5PGMA 3R3XA 3PR1A 4NR0A 4TY8A 3AG5A 1LH0A 3FEYB 3QGIA 3AJ9A 3H2KA 3QVVA 4N8DA 2RGDA 2PSDA 4NENA 5BXIA 2E5HA 1KO8A 4CLTA 2Q2WA 2RD2A 4L02A 4ILLA 1UVNA 4DSZA 3PTAA 1KGSA 3FFAA 3G5LA 2C2MA 4TV9B 1NDKA 1K6MA 3OFNA 2YRFA 4C06A 1C3OA 1U7OA 2V59A 1QLJA 5ALFA 2QTFA 3M8YA 3BR8A 1P5JA 3FDIA 3ZWBA 3FNQA 4KE8A 4JJKA 2OHDA 1PKUA 2WB1D 1TEVA 2CD7A 2VO1A 4FDLA 2P65A 5CURA 3OFND 3K1JA 3WKCA 1EZZB 1ECJA 1ST2A 1PVOA 3I64A 5AIBA 3LDGA 2JIQA 5HM6A 4JBNA 3TL3A 4NLOA 2VF5X 2HHPA 3H5YA 3WK4A 1PR4A 2D0OB 1KE2A 4DCPA 1L4MA 1NQXA 2QRRA 3A4MA 3PXGa 3CLUD 2BE2A 2DT9A 4HNSA 1MVLA 1U0EA 5KYXA 3NOQA 1NJSA 1S1TA 1KAEA 4RQUA 5U1PA 3KETA 3QKSA 2PLNA 3N8DA 5IARA 1TYDE 4PQFA 5SZJA 4ZMBA 1XGKA 4ENSA 1HLFA 1NXVA 4X24A 1PVDA 1UOPA 3BZBA 3DAPA 1DP4A 1L4FA 3AKZA 2I2CA 3AI1A 4XYLA 3WV4A 1FK9A 4ZN6A 4ZVPB 1OYYA 1E5TA 4N40A 3CEDA 4AJPA 5AKJA 3GLUA 1PT7A 3EY9A 4FFPA 3RYLA 5LLTA 2WB2A 1P17A 4ID3A 1VHIA 5CQGA 3QT5A 5LR6A 2CHUA 3DTVD 2QORA 3RSSA 3QQCD 1HQUA 1RT7A 2B99A 3VMMA 4PYRA 1RJDA 5LYJB 2LWIA 1JT9A 4P38A 1N2CA 4M0CA 5DHQA 3FY4A 3P9XA 3UJ7A 4FXVA 5L6LB 1S7IA 4TSFA 4FONA 2IHUA 3GH1A 4I46A 4S0MA 5IULC 5K6AC 1FRJA 4PUOA 4FWIB 1Q77A 4XWGA 4DLRA 4C2UA 1CS0A 3INTA 4REQB 2XY7A 1ULBA 3IKVA 4LVNP 4QR0A 3U1TA 3NX4A 1K9MT 5DVZA 1KJ8A 4C3UA 2XSZD 4Z3DA 5CG1A 3RVQA 3SYLA 4JI1J 1ANKA 2X23A 2R87A 4LY0A 4F7DA 4L4SA 1X7WA 4TQUS 4WBNF 3NWEA 1U7TA 3L77A 2WF9A 4A0GA 2RD5C 4Q7MB 4IG3B 4OHFA 4BNXA 3QMPA 4Z4HA 2IVFA 3MPVA 2J5KA 1KP3A 1O5IA 1IOLA 1RZRD 2YNMC 2PFFB 4D6XA 1MX3A 4C48A 1S77D 5J2UA 1W2IA 2GPAA 3ONDA 4WFJA 3IT2A 3PW7A 3SVLA 3M8QB 2NUTA 3WLEA 3AUYA 4X4TA 2EG2A 4EY8A 2LECA 2I7XA 2W2OA 3UXMA 2ECFA 5AT1A 1D0VA 1JHQA 1RAIB 1O03A 1AKVA 3E3XA 3MRVA 3LXRA 1Q0SA 1QX3A 2QFJA 3DGPB 2VHZA 4EVSA 2AD5A 1WVMA 3JWIA 4B34A 4NA3A 1DC8A 5GADU 1PSWA 4PPQA 5H4HA 4X4VA 4DILA 5EWLA 2QWXA 3ZY3A 4LZNA 5GIPE 1K5HA 5AUOB 1CYDA 1UL3A 4AFFA 4KUHA 4F86A 4JSTA 2NSBA 2CJPA 1H98A 3WGYA 3Q85A 1T8TA 2ZWIA 5ELMA 2W11A 3OVBA 3V4FA 1GL7A 3VZDA 2YWDA 3UA4A 2OHXA 4FDFA 3IIIA 2QUKA 2FN9A 3PVSA 2M9KA 2HJ9A 3LTNC 4Q9DA 2NSDA 4G26A 1KAOA 4KQIA 1KJ9A 4ZVUA 2KRBA 4COKA 2JFNA 5JS8A 1UPMB 1F3OA 1AA9A 1MTOA 1FT8A 3AV3A 3CO0S 1HFEL 5EXTA 1MJGM 3TI7A 2ZLBA 4PBTA 4E33A 2E7WA 2ZJYA 1D1PA 3UJ9A 1UWKA 4RLFA 4HR2A 1T36A 4MS1B 1SU6A 2R84A 1RHMB 2PYZA 3PZBA 4KAFA 4FLFA 2RG7A 2XF2A 3ZJ5A 5C24A 3J81A 4HMQA 5KVCA 5IH7A 1PG2A 1IWGA 1DQ8A 4QBFA 1NK5A 3WYCA 5HVNA 4MXDA 2YIDA 2O48X 3NWPA 2XT0A 5LA6B 5THQA 3KB6A 5HRCA 4KAIA 2R6HA 3GVHA 4HEA9 3LXUX 4FE7A 3GMSA 2VG6A 4WA8A 4DCVA 5HSGA 5E3QA 4F85A 1RKUA 5HSPA 1WHTA 2HJVA 1E6MA 3IGVA 5IC4B 5IJWA 4G8JA 3M1IA 3NGUA 2OEJA 3QT6A 3D2CA 3CZAA 3DB2A 4PWYA 4H17A 3FTDA 4KOEC 1H3NA 2ZCVA 4MQEB 1E8DA 4X3OA 2PLFA 4YWJA 5LMNB 2MKYA 1I51A 1K0FA 1D9AA 3USZA 3H2JA 1AM4D 4D0GA 4NYZA 4U96A 4ZP8A 4YFUA 3RYHB 4E8UA 2WTBA 5EY5B 3SN6A 2G4LA 3L3CA 4ZOLF 2RUGA 5IM0A 1MB3A 3P9RA 1ZGZA 2EBUA 1JLBA 2WVBA 2XB8A 1DTQB 4DIMA 4I9UA 5TS2A 4ZKEA 3I34X 4NBTA 2RS2A 3LQQA 1NUQA 1RISA 4KP7A 1OD6A 2OYSA 3MWJA 3MQ2A 5IDXA 4C3ZA 3IS9A 1XZDA 5DOZA 2ZQ5A 4X8MA 1DMRA 2HDWA 5BO5A 1G7TA 3LPLA 5EXSA 5IT0A 3NV9A 5DMHA 4IH1A 5IHXA 4Y6LA 3KEMA 2XYGB 4UEWA 2EKZA 4ZOAA 3BMCA 3D2WA 3FF4A 1REGX 4UBKA 3HP6A 2IYTA 1U8TA 3SYKA 3H1PA 2RSQA 3M4XA 4DRYA 4RIHA 1P1IA 2XTJP 3PCXA 2WE8A 2BCEA 1TCAA 2GS9A 2WA1A 5ALPA 4FEEA 4RTLA 4MVJA 5F4BA 5J2PB 3TZKA 2O67A 2XMDA 3TNDA 3I01A 3JARB 3ZCPA 3QVSA 2HJRA 4UUAA 3T38A 2B35A 5JD5A 4TYQA 3T5JA 4DIKA 3GUHA 2DBZA 1ULHA 3BBLA 2XCIA 3NWJA 1EYZA 3DT9A 3URMA 1JHZA 4R5MA 4KTTE 4UBNA 5FV7A 2B8WA 4WK2B 4AJHA 4Q1BA 1UWBA 1SBQA 4Z4EA 1JN0A 1FS4A 5M2RA 1AN0A 1P4GA 2I8CA 2Z2YA 2JEYA 2NZ2A 3G96A 4XIFA 2X0KA 1P7WA 5LDDC 3SK0A 2DHHA 1R8HA 3LWLA 4C3MA 3BPSA 5ILGA 5DMXA 3TSYA 1IUOA 4NCGA 2H00A 5AUNB 3CBGA 4INPA 3HK2A 4IRCA 1PIEA 1CJKC 4CNYA 2OC4A 2VQEB 1XMQB 3NHMA 1A7UA 3E7FA 1IIBA 4OUKX 3C3XA 2Z2JA 1WABA 1Q0HA 4DR7F 5C52B 2J76E 1AQIA 1Z82A 3VR2A 3H20A 4FHEA 1GJRA 3K2BA 3J80Y 2IIVA 5GAEU 2LVWA 4DFJA 5EIXA 4L4ZA 1VLJA 4TLLB 1LD3A 2BHNA 4YCDA 2YTZA 3BIWA 4D4HA 1JDBC 5HKOA 1G1MA 3NWGA 4TL7A 4BATA 3LPEA 5EUHA 2P75A 3DLLQ 2IZ1A 4Q18A 1YB5A 1WF1A 3LY5A 2VJDA 4L3VA 3INNA 3B4MA 3FOAA 2Q7DA 1VYTA 1WZIA 1EAYC 5AVSA 3DAHA 2XY5A 2HRQA 2JIZD 1DJQA 3H2VE 4BAUA 4QC2A 5JYCA 2J0QA 1NQUA 2XKBA 1D2HA 4NLXA 2COKA 5A8RA 3E5NA 1PDOA 1RQGA 3AIOA 2ZATA 2QR5A 3CW8X 2JLEA 1T0TV 2W2QA 3I5XA 3BQ0A 1M90T 2HHJA 1MPXA 4X3PA 1S1MA 1WZUA 1S3SA 3WC4A 1KZ7B 3W4JA 3LU1A 2EK1A 4ZJUA 4OUDB 3DZCA 4QNNA 2K6GA 4TVAB 3VC7A 4IIJB 3FJ2A 1A50B 1Z9BA 5DG8A 3VTAA 4DEXA 3JARA 3IAXA 1FNCA 3O3OB 2Z0GA 1I94B 5KYUB 5GQSA 3GLTA 3LPCA 3RR7A 2YW2A 3F47A 3G1UA 1YZYA 3K09C 5B0AA 3FCSB 2UXDJ 2FC8A 3X3UA 3E5MA 5A8KB 5IJAA 2YQ5A 4X62J 2QTZA 4JV0A 5HK8A 5FOQA 3EPLA 1RVV1 2HQBA 3KKKA 3GFQA 1ORTA 3QPUA 2GIRA 3EN0A 3H7IA 3WTBA 2B4RO 2FPIB 4QO7A 1VK3A 1UKAA 4UKDA 1PYGA 3JQAA 3GJ0A 3OQNA 1XQXA 4Y6PA 3Q8YA 2GIQA 1JMTA 4J6EA 1FMJA 1S2IA 5JDIA 5IWAB 2CNKB 2O2HA 3EVMA 2ZZMA 1OVGA 4K4UA 1YVRA 4KQGA 4K9QA 2QZPA 4XWAA 1KR5A 4U7TB 4ZO6A 2FZGA 1Y8RA 2DXIA 3JSMB 4O4GB 1Z6QA 1J0EA 3TJRA 3TR0A 1EFPA 1WPGA 3UBMA 5AOCA 2W2LA 3ISJA 4KLAA 2YXDA 1L9KA 1XWWA 2KRRA 2GNAA 3FNIA 5EE3A 4GZ3A 2WTMA 2YWCA 4UUOA 1T8YA 3V6DA 5L1JA 4B3TF 4ICLB 3C19A 4NDNE 3LMKA 1DRZA 3I6BA 3OP1A 3KZNA 4XWWA 1F3LA 5C24B 4ZK6A 4DV7F 1W6UA 2C8VA 5F0WA 2DFLA 4WERA 1V8DA 5KTNA 2BGGA 3Q2OA 2BZ1A 3RC3A 3IB6A 4ZOSA 3OTOF 1PJ7A 1RLTA 1YQ9A 4K4ZA 3ZVLA 3C6TA 1LWCB 5CIYA 2CPEA 1RTJB 1W29A 2CVQA 5HS4A 5KAMA 4DU8A 3CFYA 4JHLA 3RRYA 2CEKA 3PNSA 4QBGB 2QMXA 1EK2A 3MJHA 2GTIA 1UC8A 3NYWA 3PU6A 1JLMA 1PC4A 2UAGA 4V19J 1EG7A 1N6LA 5AIAA 1B0TA 1E6CA 2R3VA 2BEKA 5KNLA 4M87A 2IYYA 1O6FA 3VJKA 2I22A 2B37A 3AZOA 4F5WA 1ORDA 1Q8IA 2ZU0C 3THYA 1W4BA 3MOZA 1Q92A 4JEUA 5BYAA 2HF9A 1PAEX 2O8FB 4NU6A 2DTDA 1EK6A 1MROA 4MI1A 3X2SA 2BA9A 3IN5A 4Z1MD 4DMCA 1S3GA 3F6SA 1BMFA 5DX0A 3JCZA 4F56A 2RGCA 3QMVA 4X6LA 2ZHOA 3MCAA 4DR6F 5TE9A 1W73A 3TEFA 3R3YA 3BFJA 1FWKA 5HKKD 3VKFA 3N6XA 2FEWB 4M9UA 3NVKI 5DM6Q 1D3WA 2FPRA 3KWLA 1QFMA 3PENA 4N47A 4ND8A 4F02A 4MZDA 4C6SA 3IRVA 2HFJA 2FWRA 3GIIA 3LKDA 4MS4B 5CH7B 1CJCA 4I9NA 1M1UA 4MIKA 3K31A 5JVDF 4R54A 2CXNA 3CVXA 4PTLA 5ECDA 1IMOA 4YECA 3B2QA 4LSLB 2VPYB 2QEQA 9LDBA 3EGWB 4IG3A 1UXIA 1KPIA 2GCFA 1DWOA 2Y1JA 1B93A 2VAXA 5IDYA 1FRMA 3MM8A 2JLZA 4XQCA 1FDBA 3PEJA 4DF3A 2B4QA 3N75A 2E5IA 4OU4A 2AMFA 3K0CC 4EA6A 5GMKa 2EGGA 3H1GA 4IM7A 4ENTA 1EDEA 2DSTA 4F8JA 1P7YA 3N01A 4PG6A 2V4ZA 3D64A 3PHTA 4CM9D 1GEEA 4P3NA 4FB4A 3SR0A 2HWHA 2EWVA 1B7GO 3R3TA 1YZVA 3W1EA 4P5PA 3A1EA 3IAM1 2GV1A 3PX2A 3EXHB 3AAWB 4D3FA 3HRKA 4D8TA 1JMVA 1QNFA 4D6PA 1ZXLA 3MTGA 2EPIA 1F06A 2WSBA 3W5SA 1TM5E 1HT1E 1JEAA 4G86A 4G5XA 5DWVA 1DZ5A 1X39A 4J94A 3ZVKA 3DL7A 4V0NA 5IT9A 1FCAA 3AUUA 4MIBA 1JEDA 5DCWA 2J9DA 1GYRA 3RO7A 2R7TA 4JBHA 1BGWA 2OPSA 1RZMA 2MY7A 2ODEA 2WT8A 3VHXA 5JCJD 3PKZA 2C2ZB 1CF4A 3FKSD 2P2DA 1NATA 4I50B 3LP6A 4IL5A 3CW9A 3IBFB 3NBPA 2I3DA 4BNMA 4B3SF 2YQ3A 3S01A 4JV5B 5KIAA 4S1VA 1TK9A 4OMFG 1N2CB 4WK0B 2NUAB 3SCLE 4G5OA 5K0SA 2C9ZA 4LJ8A 3OOJA 2JAHA 1K08A 2JARA 3LI2A 1K8AT 3SFGA 4IG0A 3CPJB 4Q66C 2DIVA 5FD8A 4JENA 2DR8A 3OLBA 1QKJA 5CYFA 1RT2B 5P21A 5K8LA 3Q1KA 2XT9A 1S8AA 5ENVA 5SZTA 1KI9A 5CYPA 1RJFA 2CVFA 3OEEA 2IEGA 4A8JB 3WAKA 1WD6A 2GN4A 1KRXA 5JISA 3VDMA 4URFA 4EB6A 2YUTA 4MFBB 2YHIA 1QE1A 5EGNA 4EQ6B 1NL3A 3N3AC 3QNUA 3X0DA 4DKXA 5JY1A 4FYWA 1HNZF 1Q19A 5CP8A 3MHYA 4I50F 3VNAA 3EJ6A 2E87A 4Q7LA 1EFKA 1L7RA 2AX1A 2XA9A 3OPXA 2H1WA 1SVIA 3N5CA 3QYPA 4MQLA 4GLLA 3C16B 3B60A 3LBHA 3D0QA 1G60A 3F5FA 4MWOA 2WBRA 4N5NA 3TZBA 4KIGA 4ZVTB 2FQYA 4MWTA 1G41A 4DV6F 2O8CB 4WY2A 2OESA 5IJ0A 3SQNA 4UPVA 1YU9A 1ML3A 2PVCA 4EHHA 5K3AA 2CLLB 2FZ4A 4MW0A 1PNVA 4IDGA 1N56A 1NJ6A 3NHUA 4Y6SA 1PT5A 1EDDA 4P0QB 2CVOA 4YRPA 3BH7B 4TL6A 2OCGA 2DE0X 1KZ1A 3V34A 3ZEAA 4EPVA 4F7WA 4QXOA 3EG9B 1MU2B 3V6HA 2E1PA 1GUZA 2G9ZA 2JAXA 4DXLA 4WH0A 1FFDA 3O0DA 2B4PA 1GGFA 2ZZNA 1YR7A 1DQPA 2DKOA 3AESA 4KKOA 2D74B 5HMXA 1MZPA 4F1WA 4C4TA 3DOKB 4M0EA 5CG2A 2CUKA 2P9JA 2J08A 3SYZA 4B3MF 1BXGA 1L4EA 1FZQA 2G4VA 4GO7X 3GFHA 4JXKA 3CVWA 4BMCA 2EGUA 2BMBA 1C1DB 4MLCA 3DOKA 2ECPA 4WBNB 1HZZC 1QX4A 1NNUA 2GWHA 4QRDA 1UUFA 2VSOA 3BCUA 5EIBC 2BDTA 1QHGA 1VOTA 4OYLA 5AVTA 3LP0A 4RD4A 4ZRMA 1E0SA 2P5TB 3P20A 1WMDA 1YV9A 1ONBA 1X9IA 2XY4A 1X3SA 4H0CA 4NS4A 2PL1A 3R9XB 1C4WA 3U39A 4DV6J 4QO8A 3NOVA 1UINA 4TN5A 5BSKA 1QK5A 2ABWA 4MS3B 4UF4A 3RC9A 1GKKA 4CFSA 4MIEA 1XVLA 4RD6A 1HH4A 3IHTA 3GO4A 1IR1A 4CF7A 3EPKA 2BRKA 1WHWA 2GRUA 1IZ7A 4GGPA 4QDKA 3EPIA 3R5XA 1SB9A 4CG3A 4N39A 2OFPA 1JXOA 3O95A 1XXHA 2R68A 3WIBA 4O3FA 1E4EA 1EP3B 1N8SA 2P90A 2F5GA 1Q7GA 1HBJA 3SJCA 2GHQA 4YRRA 2XCRB 4EUKA 3A3KA 3CXUA 3ME5A 3W1YC 4MHSA 4X1YB 2Z8YM 4PN3A 2QMOA 1E94E 3IIJA 1CY0A 2HLPA 2BDUA 4XM0A 2QPLA 2HRCA 3ACBA 4I8DA 3S2UA 4A16A 1LKZA 2Z6UA 1VL5A 2IRYA 4IOKA 3UHPA 1CIJA 4KXLA 4FU0A 1V6AA 5DLDA 2XO6A 1NLUA 4DBQA 4YP9A 4PS0A 4B44A 2P9ZA 1JK9B 2Z9CA 4DUZJ 2HUNA 2WRMA 3QVWA 4CEJA 3UFXB 1VE9A 2HY7A 1M8JA 5BP7A 4D57A 2QY9A 3OF2A 4KMOA 1WVGA 3KQPA 3GDGA 2GJKA 5IQ6A 3NKVA 3I8SA 4CLRB 3F7TA 2R1UA 3NGTA 3N5FA 4MQUA 4HOYA 4NMLA 4ANDA 2MSWA 3GFSA 1U1FA 4HT3B 4MUHA 3P9KA 3NOGA 4DB2A 3COYA 3LHDA 4E14A 4G56A 1PWYE 1PL0A 1TTQB 3OFHA 3E27A 3I32A 2WU3A 3FZEA 3EXFA 2XHCA 3LALA 5E7OB 4R1LA 3DMJB 3AR8A 4GKVA 4QXPA 3IBCB 5FO1A 1VQKS 3BTSA 3PUIA 1PG0A 3D43A 1DRUA 3ZU2A 2WWYA 3FOCA 4UC0A 3DGEC 2H3HA 1OILA 1IJFB 3AKDA 2HZCA 4K9DA 1ZYQA 2I5PO 2GHRA 1S57A 5KJCA 2DJIA 2R8IA 3UMVA 3HYLA 4P2FA 2CDAA 4K88A 4JLOA 3C6UA 3L1UA 3RVMA 3M8RA 1QFXA 1HE2A 1ISIA 2GT1A 2BFDA 4MJXA 3VU9B 3ABQB 1VL2A 2BJEA 1JPNA 3PQ7A 2AP6A 2OORC 5CFPA 1Q95A 1W49A 4JI6J 3WGLA 2IWHA 4I4TB 2VKRA 1DIBA 1D5CA 4CWBA 3BVPA 2AFVA 2ZBUA 4GRAA 4IDAA 2W6PA 3TBFA 3TEHB 4POOA 1U8SA 4JI0J 1G2EA 2VTBA 2PO7A 4X2BA 2UVQA 3FRJA 3MNFA 5JR3A 5K2OA 1SIOA 3P9QA 3CWQA 1C3XA 2C20A 5TGZA 1RZUA 4FMCB 2HJWA 2EFQA 3WMWA 3ZCRA 3DAFA 4HEHA 4V39A 3D9BA 1Y3FE 2Q5IA 3KUXA 1WXHA 4P81A 4KVAA 1TPZA 2ZYVX 1GITA 1ZRHA 1CV2A 5DDPC 3I5UA 1KL7A 4IHKA 2BW7A 3VGTA 1YCHA 4B87A 1AN9A 2QENA 1Z68A 5DS7A 4WFXA 2PK3A 2VRBA 4Z7OB 2PWAA 2XMSA 4D0SA 2IV2X 3REQA 5I8PA 1P1HA 5FUYA 3OUZA 4DHVA 1B6GA 2ZPTX 1SKUB 4MYDA 1D1QA 2ONYA 2GD1O 4QFMA 2PS3A 3P8BB 1YK1A 1ECFA 3UK6A 4I6JA 4KITB 1EZZA 3N9UC 1DI0A 4UUXA 1GAOA 5LP1A 2BOAA 1NW8A 2BR4A 4ZIRA 1REQB 4PCVA 3CNOA 1UM9B 4OYMA 4DSNA 3MOJB 4ZP7A 3GA5A 1QG6A 3F71A 3KXIA 2B8QA 3IEIA 3EWSA 4I1IA 5J2UB 3IP9A 2EDAA 2OKGA 3W77A 2OAQ1 3ENZA 4MDEA 1E1LA 1YS1X 2VUUA 3KVYA 3RUHA 1TKCA 3SC6A 2VQEF 3M4ZA 4OK3A 1NEEA 1GIAA 1KAQA 3M5WA 1YBFA 3FHJA 1TQLA 3F8TA 1XEAA 4MYCA 2PQMA 5FI3A 3OF3A 2P5UA 1OF1A 3BFVA 4AD8A 1U8UA 5DIFA 1BWRA 2IS4A 3C3LA 3G86A 1HQDA 4DV1B 1UP6A 1SV5B 2LQBA 4F45A 3HEBA 4A8HA 5BR1A 2C0PA 2QV7A 3O4GA 5KDLA 1YHYA 4NEHB 3EDRA 4FFRA 1J2YA 4YMIA 3WNDA 1L7PA 1KK2A 4MKXA 3TKAA 5FV4A 1HURA 2OSRA 5I3QA 3PNLA 2OEMA 1TW2A 2QR3A 2WOJA 1TT5A 5DM2A 2UVDA 4A5OA 1NXPA 2X4DA 1BDMA 3F6YA 3JVIA 3QLJA 4BCCA 5JEDA 5CH8A 3U44A 3JQBA 1AT1B 2V3VA 2G28A 4ESOA 3PIDA 1UFVA 2GYYA 4DM7A 4IKOA 5H5JA 4BCDA 2WZQA 1HBOA 5J43A 1KZYC 4CDRA 5EEGA 3E35A 1QVZA 2UXDB 3MWEA 2XCSB 5CT5A 4NYIQ 2QVGA 4BAGA 1Q8LA 3DDOA 2NZYA 1G21A 2AYBA 3BB4A 2Y0DA 3OIGA 1Q15A 3B9RA 5B7PA 3D3NA 4LOKA 3QRQA 3PIIA 4E5SA 1GG9A 3V4LA 3UQSA 2BN4A 3WXMA 1UMBB 2YHUA 3RK4A 2KTQA 1QP0A 3ZWYA 3ML1A 3VC2A 3CM0A 3ZDFA 1W7AA 4JI7J 1ZRNA 1W6RA 3PGLA 3ZWAA 1VCMA 3RTCA 4MMZB 4NBRA 1U1DA 2E6UX 3I55S 2VBZA 4X8OA 2OCPA 4UU7A 1SCNE 3E05A 2ZK7A 2HBQA 2ZR9A 3IG1A 4YAWA 5JD3A 3WQHA 1U6BA 1P7VA 3EGXA 5D77A 2H54B 4A73A 3T5LA 4PNZA 3EZYA 1NJYA 5HMLA 2Y0EA 1TLTA 4ZT4A 1HR0F 4GICA 1C7QA 2G76A 4YUZA 1K8YB 1LWCA 1P91A 3F8SA 4R84A 1P19A 4Q0BA 1ONOA 3BWDD 4QJ3A 1X2EA 5DGIA 3QOYA 2VHUA 3IAHA 3BSNA 3K3PA 2HTFA 4NV0A 2KT3A 3CZQA 2KYRA 2FVQA 3HJNA 4H3KB 4NARA 4Y9SA 4XIGS 3S2IA 1R6UA 3G5TA 4N0DA 3V9AA 1WP4A 3CO9A 3CTMA 4JV2A 3PHBE 2UYYA 3OSPA 1A7JA 1RP5A 3JU3A 3TW8B 4BNLA 4BB6A 1BE0A 1HO3A 1LBEA 2F9MA 4YT4A 2OK7A 2QQGA 2GTPA 4KYVA 4RMJA 2QG9B 4WZ6A 3IAEA 3KR9A 4I6GA 4IHJA 2RE8A 1R37A 1W25A 2A57A 2YWXA 3WQRA 5IVDA 4M76B 2HIAA 1PJLA 1SFRA 1X5SA 5MDHA 5JU6A 5F3WB 5HQ3A 2Z58B 1Y7PA 4HDHA 5TGDA 4IHJB 4AJ2A 3K0AB 2QN6B 3L8DA 2JKZA 2OC9A 3PKIA 2PX6A 4R6XA 1XD2B 4HI0E 4EG3A 4GC6A 1C3EA 2B1GA 2CWDA 3INGA 1E9VA 2N1BA 1V3RA 4PIPA 1IPHA 3GRVA 1ZBDA 2NNLD 3NU1A 4XD2A 3R7NA 4JI2B 4KR0A 1LZKA 4P3OA 3KK1B 3NH9A 4BLTA 3K5LA 2B56A 3M2UB 4F3NA 4UHCA 3EYZA 4TMKA 2YMMA 2O1PA 1Z4OA 4PLWA 1CQIA 4P7TA 1NZJA 1M8PA 4F0MA 3K8QA 3KG4A 4N1AA 5IF9A 2E4AA 4XARA 4P7JA 4CW7A 1DG9A 2BI4A 3MB8A 3UJ6A 1RCFA 5CCLA 2Y1IA 4OJKA 1RPTA 1X8KA 1G4CA 1X0PA 1SBCA 3WX0A 1DXHA 2G8LA 1R0YA 4QJ5A 2G7MC 4D42A 3OBBA 1B14A 4HFJA 4HEA1 1CFJA 1HY3A 4BO7A 1NSPA 3UXHA 3D8NA 2X2PA 3G9UA 5CFZA 3GU0A 1CWUA 4B5KA 2K7ZA 2NZ8A 3FTNA 2VPXB 3DLBA 4TV8F 3UF0A 1K66A 3KFVA 1H3EA 4CV0A 3WIEA 3CJSA 5A0YB 2JA1A 5G0RA 1VLZA 2HQOA 4B9MA 3F74A 3AI3A 2F65A 1G7CA 6FDRA 4LISA 3TTYA 1UMKA 1FJHA 1BEEA 4R8LA 1Z36A 1CUVA 3NAMA 3PUVA 4XCXA 3HSDA 4K81B 4NEYA 4WHMA 2FLOA 2GESA 2IV3A 1W44A 3J7ZT 1R2QA 1RAHA 2D3OR 3CCFA 2CLIB 2IEBA 2C3PA 2GN9A 3Q8QB 2FPUA 1X4AA 4JV1A 2DGXA 4EG4A 2WHPA 3S81A 1YJQA 4MA4A 1GADO 2R1TB 5COAA 2ZRIA 2W2PA 2FFAA 4DPMA 3S2GA 1EFUA 1LX7A 1M5UA 2VK4A 3N76A 2EQ5A 4BNGA 3PW2A 1GNRA 1IQUA 4FB5A 2HNYA 2WQZA 1V5EA 3WYBA 1HHTP 5FOXA 3T9EA 1SKAA 1ZJ5A 2XNJA 3C1AA 2HEIA 1OWOA 3J80A 1R0SA 4R2HA 4V24A 2IU4A 1KONA 3U3ZA 3MLAA 1VR6A 5FOUA 3TKLA 4M83A 4A8OA 4OYZA 1A9TA 2W2MP 2CJYB 3CPEA 4C08A 3WL3A 2GW8A 3C8ZA 3MEEB 3HJUA 5DGAA 3TJ8A 5DO9A 1WORA 3J7AC 3VNUA 4KN5A 2XA2A 5JBQA 1Z62A 4YUAA 2R79A 4DXAA 4EGAA 4DRXA 1C2YA 3MT0A 4XVHA 4QD3A 4BMDA 4RPKA 1WETA 4FYYB 4W5RA 3ZKWA 3IQDB 2CZQA 1LOUA 3KZCA 4MVJP 4WNAB 4DA0A 4C7MA 3KYDA 2YIVX 4LFCF 2W6CX 2FUKA 2Y9PB 2XQVA 3BGSA 1NXSA 1PS0A 3VAFA 3OR1A 1LPNA 4QJBA 4X45A 1R88A 2RBEA 5A6PA 1S8NA 5FULA 1FFGB 2EIXA 5K51A 1XBWA 4DNQA 4MPPA 2VD3A 4DFDA 3E48A 3GG2A 5GAHI 2KE5A 2VASA 1E18A 4MGHA 3E8XA 4HYKA 3H4DA 4KK4A 1IBKJ 4C7QA 3DEJA 5B0GA 1T10A 1Z0KA 3ELDA 2JGEA 1RBQA 3ENKA 2QD1A 4NLUA 4OJ1A 3VPAA 2V7QA 5DI9A 4XW2A 1WU7A 3PNVA 1QLNA 1EFDN 5DIZA 2NXCA 1XPOA 4Y1RA 3HHLA 3CH5A 1REQA 3T12A 5FPSA 1R8BA 1QB7A 3OLWA 1KZHA 3Q89A 5KU1A 1ZNXA 3RUDA 3ODPA 3RS9A 4B32A 2N47A 5KBYA 3T9AA 3CGIA 3MM5B 5D6OA 1WG4A 5DNCA 2D59A 2RGNA 3FQKA 4DX8H 1U2EA 3HHLD 3RWOA 3OX1A 1CUDA 1HNNA 3EGVA 4J9NA 1IXYA 1NK6A 1X19A 4MW6A 4KSEB 1W2HA 4O0MA 1TC2A 4EECA 3ND6A 5LWQA 3FFTA 4QJVA 2QLJA 2B2XA 3Q9LA 4QTZA 2GGSA 4X64B 2FPMA 4MGYR 1E9EA 1YQTA 3L43A 1RJEA 3DVQX 1VHWA 3SJUA 3T99A 2C4KA 4RUHA 2Y1LB 3P5TL 3PYLA 3LVBA 1FPMA 2CT8A 3QNWA 5BN4A 1A4XA 1VCTA 1FS5A 3KWFA 4WNCA 4KBIA 2B1QA 4ELVA 3GPLA 1ZEJA 1X4GA 1HYHA 1A4RA 4LJMA 3PYDA 4MMYB 5KJEA 5ALTA 2B3DA 3JAMY 4FJ2A 1X80A 1ZMBA 2ZT5A 3OECA 3S40A 2GPNA 4U2KA 1UODA 5DZ6A 5DTIA 2HHHB 3K8OE 5JW6A 1GAQA 4JB8B 3OHPA 1OLUA 4OJ3A 4ED3A 1UP4A 1UWBB 4IVRA 5EI5A 1B00A 1B16A 3EOAI 4N7MA 2QTLA 3RB0A 5G4DA 4HDSB 5F7OA 3PJGA 2CFRA 1HNVB 3E3MA 4LDZA 5TV2A 3RYFB 2J87A 4RK6A 1JHPA 1FWPA 2XMTA 2Z2XA 3C2PA 3LQ4A 1HZZA 5CNJA 2ZQZA 2ACEA 1I6WA 3V8RA 3VH1A 1Z6XA 3HKCA 2ATIA 1KXZA 2VJBA 1D2MA 1DU4A 1AA6A 3G2KA 2POCA 3TAUA 2VC2B 1RWOA 4ARBA 4L28A 1D9FA 4C21A 1IKVB 1QKIA 4U7FA 2BEUA 3VMFA 3G8AA 1NM5C 1JKIA 4DV4J 1XCMA 3VV3A 3I96A 3D0IE 2XLBA 2PX5A 3IUMA 1MDFA 4P2SA 4TMWA 3EICA 3RVPA 2XSZA 4B8YA 1BJRE 4IIYA 4ZVHA 1FYEA 1BC6A 2D1YA 4K05A 3BT7A 1UOEA 4RBVA 1T1RA 1NPKA 2P1ZA 2Z9DA 2PS9A 1E1CB 4C0SA 2OUGA 4OAQA 4CRJA 4UOEA 2KB2A 3ABOB 3QATA 4B3TJ 3SZGA 5L45A 2IC3A 2YYYA 5JY6A 2XSJB 2JAPA 2Y0PA 2ZH5A 1QV6A 4OHCA 5GGXA 3RUAA 4PBSA 2AVNA 2WIDA 2E4ZA 1DLOA 4V0MA 1RABA 1HG0A 2MINB 2PZ8A 3ZBUA 5I4CA 2OFOA 1N6RA 1JJIA 1JQKA 1J99A 3KLOA 4E94A 3ZH9B 1K7YA 3CB2A 1JX6A 4MH0R 1UH5A 3OZCA 4QLAA 1LFPA 4N3GA 1HPLA 1RQ7A 1XN4A 1D0IA 3MWFA 3GQBA 3ILYA 2IVYA 4UVHA 2YINC 1Y9DA 3T3GA 4LRBA 1MMFB 1XZHA 1DL5A 2ZC3A 4OLJA 1U4OA 4QBTA 3WWOA 1JLRA 5BN3A 1U2GA 1X9SA 4PZYA 2PVSA 2R6ZA 4KR3A 5EXXA 2NM0A 2WSCC 5DTQA 4PYAA 4AJOA 4PO9A 1H8ED 4DMHA 3I2IA 1WQ3A 3N6LA 3NL0A 2PMZD 3T9BA 3NPMA 4FR2A 4XVQA 4FD2A 4PO3X 4RJTA 1VHQA 2V0NA 1YSJA 2IP4A 2QP4A 1RXOB 3BIXA 4CTAB 4MROA 1P5HA 1FW6A 2J3HA 1CQJB 1H8EA 3FMIA 3KUDA 1TMJA 1GN9A 4UCQA 2CNWD 1NKVA 3BWVA 1J4AA 3CDAA 5J3JA 2I6GA 4HTJA 1AZSC 3KYCA 1MJ5A 5CVCA 4J16A 2FZKB 1KIMA 3IFSA 1ADJA 3KOOA 4BNUA 4EB8A 3BMOA 2VYND 3ZE7A 4M9XA 1NSQA 4CWAA 1MJFA 3SJBA 3O4JA 3PXBA 3M05A 6REQA 1RRFA 3ESXA 1RTTA 3Q98A 4KLZA 1OA1A 2UUAF 3GT3A 2GX6A 2AZDA 1OLOA 1H4QA 4EO4A 3MBIA 4NZ6A 2MYUA 2RONA 1QYCA 5F7XA 3UJ8A 4OZ5A 5AJTA 1A2OA 3T7RA 2BCJQ 4OHBA 2QM3A 2V8DA 5B3LA 3A06A 4QIWD 3H1TA 2E18A 5IC6A 5HI7A 1OWNA 4INZA 1QHSA 4ZLPA 3SSOA 1P0FA 3EPHA 1NSKL 4QG7A 1BVUA 5FAXA 5HVGA 3ICLA 5JQGB 1U99A 3H5SA 4NYJQ 1NSAA 4Y2XA 2H7VA 4MR8B 2GD0A 1MH9A 2GIFA 1MP0A 2LQ5A 4DQ0A 3W90A 4ZANA 2YXNA 5ETTA 3OG9A 1Y7LA 5EIHA 1VE6A 3K70B 3HZRA 1VSTA 4J49A 5H9FJ 2JPDA 2YV5A 4YK7A 3AD8C 1R0BG 4TXSA 1K73T 1GQSA 1XJ0A 1QFJA 1UBNA 4XCVA 1P5RA 3DYBA 4BQPA 2OHHA 2OORA 3E7PA 5DU2A 3A1FA 3K72B 3QLVC 3CQ9A 5D3ZA 4FX5A 5HCNA 4PG4A 4ZAGA 4IINA 3LX4A 2VDIA 3E9ZA 4Y2SA 3MN1A 1UJ6A 3OJ0A 4RW6A 3M34A 1XLVA 3TX2A 2FWPA 1TD1A 4H6XA 3T7DA 4RYDA 4E13A 3LHKA 1IB6A 2A0KA 2J9RA 1U0OC 3UUFA 3AEQB 3TZZA 2RGAA 4C3VA 2A9PA 4NG4A 2OB2A 4A2WA 3ZN2A 1EB0A 4ZC1A 4DXHA 3W3SA 2FR1A 2CHEA 5CR9A 3ICPA 1GTSA 4EJSB 2PS0A 2JLYA 4ZD6A 1XTPA 2CJFA 4UU1A 1NQOA 1LBQA 1LBSA 4QDXA 5TQ0B 2L48A 1FJGJ 2OIHA 2O9JA 3W2IA 4J7CA 4EU0A 3GUUA 1QH1B 4DQXA 2OZKA 4BKUA 3FMFA 1Y4ZA 4Q37A 3NP5A 4QREA 1PJQA 3L7DA 2C8KA 2V55B 1SUFA 4HEJA 2FG7C 4IXMA 1AYEA 4YCCA 4LGVA 1RM4A 2Q1WA 3W5ZA 4KSBA 1YF3A 1Q81T 1WL8A 4NU8X 4MCAA 5HFAA 1RXYA 4ZP6A 1DQNA 2QYHA 3HBJA 3LTEA 4UBJA 3TIGA 4DV4F 4TMXA 3QXJA 5T67A 5EC8A 3AXSA 1I4DD 2A2ZA 3NGMA 4CM0A 2KM1A 3ICCA 4YPVA 3QJGA 4X97A 1Z4UA 1IVZA 1P31A 2ZJAA 1W88B 4QUKA 2H0AA 4B40A 1VQ8S 2I4LA 2CZGA 4K9NA 2XTMA 3NCHA 3KKPA 2YN4A 4YMSA 1YQWA 5ULLA 1WG8A 3TDMA 2WWTA 2BJ1A 1P75A 3HC7A 4Y28C 5DP1A 3V33A 2Q4TA 4ZT5A 1S1UB 3OETA 2XAUA 4UT4A 1NQWA 2IVMA 2EBGA 3TA0A 1GV0A 1KEVA 4PQEA 4CQ1A 2Z4RA 5KSZA 2FPKA 4X00A 1I2CA 1SG6A 2DQYA 5D3MA 4EA7A 3GIRA 2O5RA 4OJGA 1ZM4A 2FHKA 3FROA 1Q57A 5JSYA 2VYVA 2VKZG 3QLEA 4PZZA 2IJFA 2X86A 5A8WA 1RU1A 1BKSB 2RG1A 3HBFA 3KKQA 2B30A 4EARA 5H80A 2PZGA 1YFKA 4NS1A 1AQLA 1Y63A 3QLHB 3HYNA 1XDSA 1NBHA 3RYIB 1XN1A 3LY7A 4NU5A 3THYB 1FU8A 5KFMA 3PJFA 4P3PA 3H8JA 1PP4A 2YFKA 2PRJA 1EHWA 1Q12A 1E5VA 3FTEA 1CG2A 1M2KA 5CVVA 3OZFA 1N5DA 1T6ZA 4GL2A 3PWKA 2R47A 4HACB 3UCFA 4BNTA 4UPEA 4M5MA 1HE3A 4C0HA 4W8OA 4NA1A 1YTYA 1E61A 4Z7QB 3R0ZA 3D6UA 1OYVA 2FN8A 1S12A 4JJAA 2H54A 4WLEA 4IDCA 3QZ7A 4XA8A 2AMVA 1STOA 3NVAA 1SC6A 3IAM6 1W0JA 3GCXP 1A97A 4DT1B 3G5MA 1KAHA 4YMLA 2D1SA 1EWQA 2GAOA 4JROA 1YS6A 1PN3A 4F2RA 3D1OA 2WZ1A 2VP9A 4EGLA 1WLSA 4BO3A 4G1PA 2CBXA 1KNZA 2H92A 3T5TA 2GBLC 2J3KA 1G1AA 1W0JD 3QA3E 2IIBA 4JI4B 1E2QA 3UJPA 4NABA 1RTDB 2IIPA 1N9GB 4DNOA 4JL5A 3IQFA 3RLIA 3PG5A 3PXCX 3NAZA 1VMAA 1VPDA 5E4YA 3HVRA 1CPYA 2ZDQA 5DRTA 1S6PB 3RJ5A 2BC9A 4Y34A 1QVAA 2Z5VA 3JR7A 2HREA 3GPBA 5HJXA 2O7RA 4AX8A 4LBHA 1CJTA 3MTIA 2FZCB 1VL1A 3D1HA 4TYWA 2FUCA 4YV7A 5E8JA 3CNQS 3AESB 1R6TA 4TTVA 4MQMA 3MTEA 1YZ3A 1SZDA 4ZQHA 3KKNA 1R50A 3IVRA 5EMMA 2WT9A 1E1RD 5M5BA 4BMXA 2BEWB 3K94A 3BXFA 1OTHA 4UM9D 1V16B 4W82A 1UZDA 3OICA 4RW4B 2UYOA 4LBWA 4O4RA 2F1JA 2AC7A 1NM5A 1QE0A 3AHEA 2ZBEA 2XTAA 3OPNA 1RCUA 7YASA 3N2GA 3EF1A 4O4GA 2QUHA 4QZVA 3DUFB 5ALIA 3QYYA 1OX4A 4NDAA 5LVAA 1GDTA 4RW6B 2PUGA 4LY3A 4HDKA 1ES9A 2Q46A 2NZVG 4M9SA 3ULHA 4F4XA 4JT2A 2KH9A 4P52A 4RFSB 2AYXA 3Q1LA 2V5UA 5DRKA 1K4MA 2DUNA 2FPXA 1CSJA 2QY6A 2V7TA 1DKNA 2P67A 2ASLA 4ZJQA 4PGHA 2GEBA 1N2OA 2Y0BB 2RQCA 1K5PA 1DAKA 1ECGA 2GZHA 5KG0A 4Y18A 2WIAA 3DOCA 5CXUA 3NS7A 4JP1A 4PRFA 3O92A 4LPSA 3ETGA 3BZUA 3I37X 1VIMA 4CKCA 2J46A 4KHPB 5AJHA 1R8JA 2QLMA 3VVLA 1G3OA 4JD5A 4R9UC 2QMYA 4MR9B 2W9BB 1O5OA 2ET6A 1H38A 3C8DA 4RTKA 5CLIA 1BE6A 3FB1A 2GXUA 1K7FB 2JVKA 1Y5NB 2AXQA 4CR8A 3P2JA 2V9WA 3HZHA 4YMEA 4ZMSA 1VGYA 4HDMB 2KQUA 1YCDA 3LP5A 3CCVS 4H60A 3BBCA 3VAMA 2JFFA 4NYOA 3A4LA 4JBYA 4W5NA 3P6YC 3VU1A 4MWSA 4X64J 1BMFD 1LQTA 2DBVO 1JHDA 1QYRA 4WK4B 3O7WA 4PLVA 5JVDB 3I2JA 1WBBA 2K4MA 4CVNA 4HHHA 3E6AA 5FOTA 3IR6B 3A6FA 5FOSA 4EFDA 1TCVA 3ZY4A 1L3UA 2EBFX 4FZ3A 5L4SA 4H77A 1I2BA 3C6XA 3A13A 2HC9A 4MKAA 4K50A 4WU2A 2G5GX 5KTQA 1ATIA 4Q82A 3PEUA 4KQCA 1RXCA 1YJ9S 4HHUA 3GHYA 3QIPA 4W8GA 4ACBA 1A8SA 2FIUA 4RELA 2F00A 1Q8KA 1RAEB 1ODTC 3KZKA 2RJ3A 3ENVA 3HY3A 3UWKA 3TH5A 4Y2VA 5BW8A 4OLHA 5AVWA 3N70A 1QZTA 4DJEC 2RHDA 2IUSA 4NZMA 1JHAA 3AOEA 4QU8A 3M2VA 4G0NA 4FOOA 4JT4A 3CPSA 4TKVB 3QXCA 1NYTA 4Q1AA 2HQ1A 4D0NA 1U1EA 3JW8A 2ZRAA 3GNTA 1ZNZA 3COVA 1ECLA 5AJXA 5IVIA 4WASA 4E88A 2ZH7A 1Y1LA 1ZPDA 1A4UA 5EXDA 5IM4F 1T8PA 1NP6A 3DOHA 1HDEA 3OESA 3CC2S 4B3HA 2BX6A 3DLKB 2FXIA 1F17A 4LSZB 1A77A 1OXUA 3CRVA 1HEYA 4CM3A 4MUKA 4KDCA 3KYIB 3LX5A 3UWTA 5HJ5A 2D3O1 2UZ1A 3TXYA 1HNWJ 5KWEA 3GGJA 3X1KA 1FFBA 5BQPA 3S5JA 1HYSA 4PWZA 1J8QA 3JWGA 3FSXA 3GD7A 5TJ9A 5JSUA 2FJDB 4F4JA 1ZH6A 3QVUA 2WPDA 2WJZB 3WK5A 2GFFA 1NXXA 5A2QY 1RZ3A 2OBXA 4JLJA 3L05A 4OX9B 5EIOA 3KUGA 2AXPA 1DBQA 4QL3A 5BNIA 1YSCA 1QFZA 2KFZA 5ADHA 1NK7A 1IOVA 4UMEA 1M6VB 2C99A 2BJ9A 1SH3A 3L0SA 5JCJA 2QL6A 2CPIA 5DETA 1A9XB 1ODFA 2P0AA 4LF7J 5IBCA 4E09A 1P6UA 5DLPA 2HCBA 5BPHA 3W7BA 1S6QA 2HHVA 3IG1B 2RBKA 2NUUG 3ZDYB 1EDBA 2FEAA 2HBQB 2DD8S 1J9EA 1PNOA 2RGNC 3LUYA 4QGSA 3AIKA 3MM7B 2YVLA 3H5UA 3SXPA 1UETA 1MC1A 1I4EB 1WI6A 4YP5A 4AG3A 2CMGA 4PVDA 1EPUA 3HVIA 3PFIA 3KPWA 3ZD7A 1QUPA 4USVA 5KG2A 1YJVA 3W6OA 5GAJA 1I6KA 5AVZA 4KI7A 5JROA 4CLYA 4Z8YA 4QJ4A 3R5GA 2RGGA 3BJYA 1EUCA 4AU1A 5ER9A 5AXNA 1D9DA 5LXTF 1QONA 4R1MA 4B46A 1SU7A 3CR3C 4L8YA 3OM8A 4WE1A 4WZAA