4GMKA

Crystal structure of ribose 5-phosphate isomerase from the probiotic bacterium lactobacillus salivarius ucc118
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
227
structure length
227
Chain Sequence
PNQDELKQLVGTKAVEWIKDGMIVGLGTGSTVKYMVDALGKRVNEEGLDIVGVTTSIRTAEQAKSLGIVIKDIDEVDHIDLTIDGADEISSDFQGIKGGGAALLYEKIVATKSNKNMWIVDESKMVDDLGQFPLPVEVIPYGSGTVFKRFEEKGLNPEFRKNEDGSLLHTDSDNYIIDLHLGKIENPKELGDYLINQVGVVEHGLFLDIVNTVIVGRQDGPEVLEAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ribose 5-phosphate isomerase from the probiotic bacterium Lactobacillus salivarius UCC118.
pubmed doi rcsb
source organism Lactobacillus salivarius
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 75
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4gmkA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gmkA01
1DEAA 1O8BA 2O0MA 4GO7X 2F8MA 1HORA 2J0WA 2P9EA 2P9GA 2QMWA 3KWMA 3MTJA 3HN6A 3N0VA 2W48A 3OBIA 3W7BA 1HOTA 2RQMA 1M0SA 3CSSA 3TX2A 1FSFA 3MWBA 2FGCA 2QSWA 1YGYA 1UJ4A 2H9ZA 3OFGA 3P96A 2DT9A 1FS6A 2DTJA 3DHXA 3TUZC 3ENQA 3L7OA 1FQOA 3TUJC 3UW1A 3BXEA 3LUYA 2PC6A 2OKGA 3NRBA 3DC2A 2F1FA 1SC6A 2RQKA 2ZHOA 3BXHA 4L51A 3IBWA 4L4ZA 4L5JA 1UJ5A 4TM7A 2GNPA 1RWUA 3S1TA 1Y89A 3LOUA 4PWUA 3BXGA 5JJBA 3CEDA 2QMXA 1PSDA 4GMKA 4X84A 5IT0A 1Y7PA 3AB4B 5IT4A 1U8SA 2P9CA 3BXFA 2J0EA 4LUBA 3ICOA 3TUIC 2RE1A 3ENVA 3OC6A 2MDAA 1LKZA 1NE7A 2I9SA 3LWDA 4NMLA 1VL1A 3KV1A 3DHWC 1FS5A 1LK7A 4OQQA 5HJ5A 2QRRA 2KO1A 3AAWB 1PBTA 2RI0A 1JT9A 4M8LA 2BKVA 4L4YA 3NZEA 4L5IA 4TM8A 2BKXA 4OQPA 3U7JA 1YBAA 2LVWA 3AB2B 3OFEA 3K5PA 1CD5A 2LQJA 4IO1A 3O1LA 3CH7A 4GO1A 1ZPVA 3ENWA 2R5FA 1FRZA 2RI1A 1UJ6A 5IS2A 3OFHA 3LHIA 2JOQA 2JHEA 3OFFA 1KS2A 2PA3A 1XTZA 3EB9A 4GO5X 5FIIA 3HHEA 5T41A 1LK5A 3MAHA 3EFBA 3E15A 3E7FA 3DDNA 4R9NA 3NWPA 2CDQA 2J0XA 4L50A 3IXQA 4R7TA 2NYIA 2WU1A
chains in the Genus database with same CATH superfamily
1EK5A 2OMKA 5E6SA 1P8AA 4C05A 1OLXA 3ZYCA 4F93B 1REQB 3KELA 1W94A 2H16A 3NWGA 3VAFA 1DBPA 1R50A 3MAJA 2MMYA 5C2JB 1W49A 4NPOA 2XWPA 2V59A 2HA5A 2AN3A 3R7BB 1RKXA 1JIVA 3MT8A 1WW3A 3PGJA 4A6EA 3PI6A 2OHHA 1MX5A 3AKEA 5TPWB 4MWCA 5GIPE 5ARCA 1XMBA 2G5TA 2JH9A 1O0BA 1JG7A 4KO1S 3JWGA 1L5FA 3RR7A 1WHSA 4S1OA 2ZRNA 4X24A 4OJ1A 3LUDA 1PT9A 3WC4A 2VBCA 5DZ6A 1ADJA 1PIEA 5FA5A 4LQLA 1N33F 4EZ9A 4CTKA 2UZ1B 5DNYB 3FX2A 3PUYA 4M94A 1PGQA 1C2PA 5JNLA 4YX9A 1C1XB 2EGGA 1SNYA 5JSZA 1Z17A 4TVOA 4V0QA 3RYHB 5JNVA 3L6UA 1R4NB 2V0NA 3NO4A 4B3SB 3KKFA 1PJRA 1TJ4A 3B1YA 4UM9D 3X1KA 1WX1A 3IE1A 1WSAA 3D7NA 1QAYA 4PUOB 3RK4A 2OC4A 3SBMA 4KQXA 4J6EA 5LKAA 2V9KA 4BASA 3VNSA 2UZ1A 2M98A 2OTJS 5HMZA 2HFVA 1ZPDA 2FB0A 1A98A 4KGZB 4YPFA 1C30A 3QTTA 5F7ZA 1P72A 4NBWA 1MAAA 2GPBA 3R7WB 1MO5A 3RYHA 3WBZA 5LDHA 3R3ZA 2QQEA 2BHNA 5E0OA 1RYBA 4MQEA 2PZLA 3A6FA 4KKOB 2Q2OA 4CXMA 4MCJA 4B4KA 4AW9A 2MHNA 3L7BA 2R7NA 1HNZB 4Q1BA 1K7EB 3D66A 4B4DA 2YQ3A 2PSZA 3VI4B 2A0FA 1XTZA 3TW4A 3RBXA 3WP0A 2W70A 2R7RA 5DOZA 1CLUA 3BJZA 3PO5A 4EA6A 1DEAA 4MUMA 3V6MA 3K9QO 3V8NA 5CFPA 2D4AA 4I3HA 4P34A 1IUNA 3A10A 2BL4A 3EK2A 4G0WA 4KXLA 1DXOA 3R5JB 4FNMA 2JGIA 2ZRKA 4RX6A 2ZU0C 4JT9A 1EFVB 4MW2A 2OY0A 1NVBA 2J9ZB 3LGHA 3SIXA 1A8QA 4IW3B 2PMBA 4JX9A 2ZD1A 3T7SA 2PFKA 5J59A 2P7HA 4K9SA 4U6SA 4QIHA 3KLEA 3NV7A 4OQXA 2VXCA 1X4EA 4YJHA 1DCTA 4DEYA 5EYPB 4GPTA 5AUNB 1Z06A 4ZOLF 1DCMA 2R8KA 2GVNA 4W6ZA 1VJQA 4RACA 4ZO6A 4ZARA 2CKMA 4A5OA 3GV0A 4N41A 4HB0A 3MWGA 1R6XA 2PT5A 4CCAA 2FY1A 3CO0S 2NLOA 4AZ3A 2NXCA 3C3BA 3R5JA 1EFHA 2MYNA 4AJ2A 1TAQA 1N5YA 3QKRB 1G98A 4QYXA 4ECWA 4L57A 3FDFA 3SAJA 2QVXX 1PW7A 5CXSA 3VAYA 1P5JA 4C3OB 4M1TA 2VC0A 4ZCMA 1GXSB 3PV0A 1PGZA 3U3OA 3THVA 1YITS 5F4ZA 2QYCA 2DGXA 4LHWA 4FDVA 1BQ3A 1EBUA 2O0JA 3IMFA 4Z9XA 4IFIA 2OGTA 1ABEA 3VTIA 2ZI6A 1KA9H 1LCIA 1X1CA 2OSVA 5E6RB 3SJ7A 5EYPA 2WUWE 1AMUA 3S2ZA 2FKAA 1ZGBA 5HP4A 2AJ0A 2YYZA 1DARA 2J7KA 2CUZA 1KP9A 4HPJB 3PRHA 3TXAA 2EDCA 3NGUA 4OX7A 5LJ5Y 4MR7A 1YKGA 4DX8H 3DL7A 2FWPA 5ALPA 3BSFA 5EDWA 3AKCA 3BH7A 4G8JA 4PWUA 1AKNA 1DLOB 4KNVA 1W8IA 1J1IA 3MBKA 2RE1A 3Q8UA 2ZUAA 1FEZA 4CYUA 3AJ9A 5I7FA 1PJ2A 2VP4A 4RHTA 3BGWA 2OK7A 1VJGA 2OBNA 2BE2B 1S6YA 2G5CA 4LHZA 5LU9A 5DM7Q 2QROA 4DIFA 1P3DA 1JDZA 3DT9A 3STYA 2V9CA 1QUPA 5JSUA 3AA9A 1M1YE 4BWVA 4PZCA 3HF5A 2GD1O 1ZOTA 2XC9A 4EIWA 4HNGA 1FNCA 3OKFA 1VQ8S 1TPZA 4IIXA 4U7WA 4I2PA 2OHVA 1NHWA 3TQTA 1Q8KA 3QZ8A 1M34E 4HPXB 1TA0A 3MJEA 4PQEA 1NG9A 4I50A 1QHYA 3HP4A 1GGMA 1XRQA 4R51A 3ENAA 1WCIB 1YZYA 1GRVA 1ZNXA 1IBKF 1DQAA 3VOSA 3FVTA 4XH9B 4E14A 4ZT4A 4OBBA 2MSSA 4FJ2A 5ABPA 5TMPA 3LC7O 3E9CA 4PY2A 3K9FC 4J43A 3BQ1A 3CLRD 3ZHOA 5ALJA 1D09A 2HZ7A 4PWZA 4LJLA 4FKXA 5IXSA 4OQDA 3JSMB 3W60A 1Q1GA 5DGAA 4WXHA 5B4TA 3ISJA 2XMTA 2OO4A 4JLDA 2ZCJA 3R3WA 3UCXA 1PQ4A 1W4ZA 3SBOA 3OC0A 3RRMA 2Z95A 4W5WA 4PPFA 5FLYA 3TJ9A 1LW2B 1JTFA 3IWXA 1KXZA 4MV6A 4LYGA 4U4AA 4BQPA 4DMFA 4PO9A 2GK6A 4ZC8A 3PGKA 4LJKA 5JV5A 4E7OA 4A36A 5C81A 5JS6A 3LC2O 1C2TA 1YRUA 3DLEB 2OBFA 1JECA 4TQSA 3BFKA 4RC9A 5JHGB 3HHLB 5KYUB 1KE2A 1Z34A 5EXXA 3QEBZ 5K4GA 5LSRA 1DZ5A 1FFHA 4MOWA 1U4NA 1Y4ZB 2R00A 1TK0A 2DH7A 3HYLA 2OLEA 2WJIA 5HUHA 3ZI7A 4L51A 1TJNA 2HA6A 3SQGA 2XB2D 1QUFA 4IFVB 1ECCA 4AJJA 4UHEA 4JN6B 3CVVA 5HBMB 2KI5A 3B51X 3C6QA 4CG3A 1VCNA 3KTQA 4TYAA 1SOMA 5TQJA 2I2YA 1EP3B 1LJUA 1IKVA 5KG3A 2CLMB 1KNXA 1YCGA 1II0A 3A70A 1WEKA 4HNHA 5MFPA 2BGMA 3OHMA 3QF7A 1KKLA 4LHEA 1CUFA 4FEEA 4IH7A 1OLSB 2HTEA 3JARA 1PV2A 3PR1A 4N7TA 3FNEA 3JSAA 1PR1A 5EWJB 3KJXA 4FFWA 1OVGA 2DF8A 3NXSA 1N5IA 2R0QC 4AB1A 2XTJA 1PJ5A 1RHMB 1C3EA 2BW0A 3CVXA 5K20A 3NXKA 3GQBA 3L0IB 2YWWA 3PCOB 1MROA 2CQIA 1HLFA 1PYOB 4OHBA 1FW6A 3NNHA 4RD6A 2QW1A 4TL8A 2PEBA 4IJVA 5KNCH 3D8HA 1RJWA 2GAIA 2YHSA 2EZUA 4KO3S 3ZHQA 1MG7A 2R1TB 3JARB 3MHTA 3ZE8A 4Q9KA 3CEDA 1ETUA 3VVLA 3VKFA 2OFOA 4QPDA 5FAKA 2CSXA 5FO0A 4DR7F 3TUPA 4B6GA 1N2OA 1LF5A 1YZGA 1MW8X 5ETPA 1FXDA 1DFGA 4DA7A 3GQBB 2OXEA 3QOXA 4UATA 5BSMA 4M1KA 3PUVA 3M49A 2WWWA 4UJ3A 6NULA 2D2IA 1NVAA 4JOSA 5AXNA 3P8ZA 2D9PA 1JFVA 1R0AA 2VBXA 2CVQA 3EGWA 4QBIA 2AMCB 1NXVA 1X7ZA 2E4XA 3HK2A 4NU8X 3AZPA 3HBFA 1WM1A 4ZYWA 4DR4B 3W7BA 3F5FA 5F8HA 2YVUA 1WVMA 3T1TA 4FYYA 3DFUA 2DR3A 1N9KA 1V16B 3CNOA 4OAPA 1Z4JA 1QE0A 2R2AA 3T94A 2P9JA 4G37A 2R84A 3HA2A 4DBZA 3QVVA 3N2KB 1BWVA 2EW1A 4Q7AA 4P4SB 2Z6AA 1TZKA 5JS8A 1YFLA 1V8ZA 3DDCA 3C8ZA 2PE5A 2KWIA 1KJNA 5AVQA 2OLKA 1ZH4A 3LNTA 5DVZA 5HEKA 3R9KA 3SYKA 2DUJA 2FPIB 2RHJA 4XX1A 1Y7IA 3O74A 4CDRA 4D3ZA 4D0SA 2W7TA 3W63A 1KTVA 3AM3A 2BGJA 1LPPA 2ZRJA 5CW1A 2QT7A 2QA4S 3RANA 2YHAA 4XM0A 4CKCA 3ZU5A 3KYCA 1Y6RA 3B3AA 4NZPA 4G8CA 3MNFA 1FDTA 3M83A 8RUCA 3RAFC 4FN4A 4DXAA 4E5PA 4L5YA 2QG9A 5JSHA 3BIOA 4NMXA 2IDJA 5B2EA 4DV3J 3NCTA 3ZDDA 3U4AA 1RZRA 5AKYA 1SQEA 4CKWB 3NIBA 2GBGA 1LWCA 1V3SA 5ETNA 4MQFB 2QM7A 5DRTA 2RQMA 3DLJA 1WLYA 3MAAC 2Z9BA 3I76A 4KE9A 5SZIA 4PS0A 4HUJA 1X86B 4LGVA 1QHGA 1WXIA 4M83A 4V2IA 3LK6A 2EWHA 5G0UA 2I3GA 1HL7A 4J0FA 4RKRA 3O73A 2DCLA 4WFKA 2AKEA 4D81A 3T52A 3H2KA 3CW9A 4ASUD 4YQFA 3G0CA 4E5UA 2OHOA 4TN5A 4JI3B 4YV2A 1GXLA 4NE7A 2C2WA 4V19J 4X60A 1RI2A 1HBNA 2WTMA 4ELTA 2J48A 1Y82A 1G1MA 5DI9A 2VHJA 2CZ9A 4Q4AB 3WVNA 4NNPA 2O23A 2DSNA 5CT4A 1RT6A 4ZT2A 5IZCA 4I6AA 2BN4A 4TS3A 4G9GA 2WM3A 3T3HA 4UNSA 2P2CA 2X1BA 3JWPA 3I2FA 4ZAXA 1Y8QA 5T6MA 3BWXA 5KYYB 2HWTA 3GJSB 3R0XA 3DMRA 2BRLA 1G4AE 2OECA 3UV7A 3FBTA 3S68A 1OILA 1E6YB 3C19A 3TPFA 3NTUA 2BANB 3PXUA 1I94F 3R20A 3TLKA 1VYHA 4MUXA 4CUZA 5IM4F 3UCEA 3A37A 2IYFA 2WJWA 1MZPA 5HVGA 3R5GA 2JVOA 3D6VA 3RH0A 1GDTA 2MZQA 3OQBA 5E1OA 4RH0A 2H11A 3SSNA 1W44A 1P6TA 1T11A 2ZVSA 2L2QA 2V5HG 1P4SA 4X20A 1YT5A 1KEUA 4IXTA 5F3TA 1R8XA 4IOKA 2PRZA 1ITPA 1AKRA 1T29A 1MPTA 1GX5A 4YCMA 1BJTA 1JJFA 5I7WA 4ZOLB 5AO9A 2KB0A 5ICEA 4YJGB 4B6EA 4IUCS 1F12A 1KDOA 4BVGA 4J9RA 3UUFA 4PRLA 3A8EA 2WNIA 3L9WA 3SR3A 3CF2A 4ZHQF 1ZW1A 2PX5A 2VUGA 5HA5A 3LCVB 3Q2TC 1HPLA 5EQTA 1KMCA 4LPKA 3OLCX 2FHOB 4ZMBA 4DUGD 2MU1A 4PXSA 3FETA 2OPRA 1MQAA 2ZIGA 4UD2A 2K87A 3F46A 2LCQA 3QRRA 2YVQA 4YP9A 2CVEA 3CRQA 2WJJA 4CM8B 5IM5A 4XPIA 3TCXB 2JIZD 4C01A 3WLIA 3HVUA 2XJ4A 2BMAA 1PJ3A 3G82B 1U2QA 5HTOA 4P82A 4PBRA 5IXYA 4AYTA 4NYIR 5M29A 2IXAA 5ILGA 3FUTA 1JLFA 3DRSA 4Z4EA 4OK6A 4C0SA 1H05A 5L3ZA 4E22A 1EX1A 2XULA 4LZAA 2ZG6A 2FK8A 3KB8A 5A62A 3A6KA 3DWEX 1Z25A 5D0EA 2BGWA 1XTIA 3N87A 2V6GA 2VDJA 2C7GA 2JGMA 1YLXA 2V8BA 5KVCA 3CGIA 2ZSAA 2VUIB 1ZPWX 5KFEA 1YQXA 1OBOA 3I6IA 2AQKA 2ODNA 3TOSA 5D77A 2QT0A 3OJUA 3B52X 3ZLTA 1VP9A 5J43A 1USKA 1LWFA 4NVRA 2Z5VA 4EO9A 1CUZA 1S7IA 3DZFA 4NCGA 1VG1A 1W0KD 1V5WA 3EZYA 4PZDA 2OE2A 3G82A 5L8RC 1AQ6A 3LBNA 4HX2A 1THTA 4WY2A 1YH3A 3RC8A 3PVXA 1JLFB 3LA0A 1P4RA 2VZ0A 4FYPA 4HEA9 1DU4A 3NP5A 1FFBA 5BYJA 1DY3A 4KLAA 5B1HA 3CO5A 2PV7A 1U11A 4GM0A 3DFIA 2W2OA 1QM9A 2PMEA 3KLNA 2SXLA 4RUKA 3PW2A 1JXEA 3NHJA 1QVAA 2QPLA 5U47A 2YXPX 1JJIA 3UMBA 4RDIA 3KOOA 3V2GA 3QI2A 1Z2ZA 5KFDA 1QCZA 2IJNA 2QQ0A 2XTAA 2LIPA 3ZDRA 1QR2A 3SQLA 5F5XA 3NIFB 3HXPA 2O2XA 2AL7A 4XGQA 3SVZA 3TYTA 2UUWA 4PPGA 4YIHA 3VTAA 1GITA 5JSFA 5IT9A 4W8GA 3R7NA 1GRCA 2O19A 4PTYA 1P27B 1BO6A 1DB3A 2CNBA 4JKYA 3IRXB 2V7BA 2P2YA 1M1YA 2OP1A 4MINA 2XUQA 4P4LA 4TVSA 3GFQA 2B0CA 4BZPA 1HBOA 1VBKA 3IOEA 3KT6A 1UVMA 4FKBA 2H31A 3CV3A 3IEVA 4ED4A 2CE7A 3ABZA 3ZW8A 4I68A 1M66A 4PTLA 1DG3A 2RD2A 3EULA 3CM0A 4ECEA 3CJ3A 3EGXB 2E87A 3RS7A 2UUCF 4IQXA 3S2GA 4EUEA 3D2AA 3P2KA 5FULA 2V74B 1KJWA 1XNRJ 1EFAA 4OXQA 2VF4X 1HLPA 3RTGA 1R27B 4DBVO 3W2GA 1B7YB 1UWVA 3R6GB 2ZLBA 2LVBA 1FXWF 2A8YA 1Z6QA 4KPUA 2V45A 2ES4A 3KU1A 4DDWA 4C2UA 5J63A 1XFAA 2W0MA 1FSZA 3AB2B 1YU6A 5K8CA 1YOBA 1IUJA 1HA3A 4ZOCA 2QX0A 2Q5CA 4O5OA 3GEIA 3RUCA 5AESA 3WHPA 1PQPA 1QQ7A 3SHWA 4S24A 1RP5A 4LBIA 5C5EA 5I7SA 2GSWA 1YIJS 1SELA 2B5WA 3UCGA 5MLCV 1ZGCA 2A1TS 2HC9A 2WJ3A 5HMYA 4A8PA 3P9QA 1QM5A 4DBQA 3KTOA 5THXA 2CHGA 5DTQA 2IOHA 2OAP1 5AKZA 1KVJA 1MNEA 3J81k 1AX9A 4RBUA 5IG2A 4IDOA 1VMAA 2BW7A 3REFA 3EY4A 5A7FA 3C3MA 5D3MB 3LVQE 4D57A 3FTQA 2G17A 4YRTA 1Z12A 4QIWD 1M1NB 5LMNJ 3TLYA 2WZBA 2ZWPA 2XGPA 5B6JA 4P3OA 4J94A 3PPXA 3DUWA 3FHJA 2O3RA 4QZVA 1PT7A 5KYGA 4QOSA 4C6SA 3ME5A 1PO7A 2F1IA 4AKHA 3EISA 2HAFA 4EL5A 2WF5A 1SXJB 4G1UC 4DV4B 4CV0A 4H4EA 1KOFA 1G8GA 4WADA 4MFBB 2CXRA 5D3GA 1COWD 3OKPA 1SUFA 2QRVB 5J1SB 3QG1A 1FVHA 1LB1B 2VBIA 4LF7B 3DQZA 3KKZA 1VI5A 2XCTB 5JVHQ 2VBFA 2XEXA 1LC0A 5F23A 3MAAA 2ODWA 1YMQA 3CRNA 1AKUA 3MBIA 3FYSA 3U27A 3NALA 4F3OA 3FHCB 3DKRA 3I6YA 2QZ4A 5CEFA 5CUQA 4QFCA 4RU2A 3SNKA 4MFBA 3A3NB 5DM0A 3U9LA 4YONB 4JHXA 3C87A 2Q21A 1AY0A 1QH0A 2NO5A 4DLVA 2DGVA 3KYJB 5BW8A 2FJVA 5FOTA 4IXMA 3V8BA 2VP6A 1WXEA 2OD7A 4G26A 4NX9A 3JQKA 1NIPA 5AW8A 2PYZA 1K68A 1QE5A 3CMES 4FX2A 3MR7A 3GP9A 1TQDA 2FGJA 3V7UA 2OOKA 5F64A 5BYKA 3FPJA 2W6ID 3JQ6A 4JNCA 3HI9A 3KD3A 3QPCA 4NZMA 4BN0A 3QXCA 3RODA 4U2DA 4CEHB 2IE8A 5LOVF 1R64A 2PA3A 3AXTA 5FPQA 3GL9A 3IDFA 1N34B 3AHJA 5HP1A 3TZHA 2BFAA 2OHDA 4KBYA 4TKLA 4YB1P 4FWTA 3QMPA 2G71A 3IQXA 1RTKA 1BMQB 4IRUB 3N9IA 4XEHA 2Q4TA 4HTAA 3CXRA 3EGCA 5HK9A 2Z9DA 3WIUA 5FNVF 3ACDA 1WBBA 3DAOA 1U0NA 1FS6A 1FZTA 3O5AA 1WF1A 1Y3BE 3A6GA 3IXLA 3BDEA 2RQCA 1OYOA 3K94A 3ZUPA 1AKVA 4DG8A 1VQ1A 4DR7B 2NSJA 2ATCB 2AKWB 1PJAA 2IXTA 3BF8A 1RAHA 5C53B 2AGVA 2JIPA 4US1R 5I45A 2K4MA 2R8EA 4LHVA 4CQMA 3GR0A 1IK6A 2J9GA 2C9OA 3KBBA 5EJEA 5EMJA 5JCXA 2VDPB 2VYND 3I05A 1NBEB 1ZU5A 3IEUA 1SZJG 1VIAA 1YR9A 4RNCA 4Q34A 4ZDWA 4FMDF 4KN8A 4QWAA 3BZUA 3L82B 3TJZA 1YQDA 3WK5A 8AT1B 4Z9BA 1NLYA 3K32A 2PK3A 2UUOA 3NANA 4CO0A 2FI1A 2JAWA 5A4IS 2H0RA 2R6DA 3SZMA 4GO5X 5HCNA 2D4HA 3ISTA 4QUIA 3RNLA 3RM3A 2J0SD 1U8TA 1PFQA 1K2WA 3A06A 5M2RA 3SQOP 3O91A 1A69A 4GEGA 2QL6A 4FEYA 2XS2A 1M1ZA 2A9RA 3SC3A 3EUWA 3GRKA 4EB3A 2VAWA 2OGSA 4XTCS 4BUZA 5BW6B 4EGLA 4LZNA 4EMBA 3NXZA 3T5CA 5KTTA 5G0VA 5E8RA 1KSFX 4RIHA 5TQVA 1L7BA 4XR9A 5D2CA 3PI7A 1T9VA 4DB4A 1OMOA 1VK3A 4AUNA 4G25A 4MQMA 4FVMA 1JI3A 4I1OA 1C1BA 3CCLS 2ZBDA 5DRYA 3CC4S 3F44A 1PAEX 4QHYA 1DJOA 2Q3HA 1RVDA 4PGGA 4F4DA 1QIGA 3UUEA 1HLGA 1VA5A 5ESRA 3MR3A 5FDLA 1PSZA 4HBGA 3WQRA 2I22A 4AF6A 3QGGA 2YY6A 3GFHA 3LOQA 2YKOA 2QRKA 4DQDA 3MM7B 4QOJA 3TOQA 2Y1XA 3JTEA 4DYVA 5JT1A 4L6IA 1RWBA 3CCJS 1A9OA 3H8YA 4FSDA 4QBTA 3BCRA 4KGVB 1TC1A 3LPNA 5AW6A 4G07A 1NMEB 2JLWA 2GBLA 3KP1A 2CJKA 2DFKB 4TS1A 1GCUA 5F1PA 5AM0A 1MX3A 3L1HA 3BDVA 5IPFA 2XF2A 4TQAA 2FX3A 3QLHB 3DKDA 3LOPA 3STVA 3UGKA 2KT3A 2HPAA 3EZ2A 1ZK1A 1Z9BA 1ZM7A 2Y9HA 1PJTA 4N5IX 5G0TA 2QE6A 9MHTA 1SEPA 1CJSA 2PMCA 1OLOA 3VTKA 4MRVA 4RHUA 5H0IA 2XSJA 3LYAA 4OQJA 1X38A 1DWOA 1Z0IA 4RD1A 2PYIA 3FGOA 1V5GA 4N0EA 1BFUA 2XY4A 4NG4A 3Q6IA 1BDBA 3G0HA 1B15A 4LF8F 4NWBA 3KQWA 3IGVA 2UVPB 5DI3B 1RCFA 4P8RA 1XZNA 5CFNA 3M8QA 1DAHA 1X4CA 1N5TA 4OAOA 3SEOA 5ETKA 4KYVA 3BDIA 3WYNA 5DPMA 4DV0J 1Q0ZA 5HQMA 1UH5A 2JHEA 3C8DA 2C2DA 4U9RA 3MPUA 3X3UA 2FPUA 5HZHA 2ID4A 4C4TA 4GKVA 1E62A 3CCFA 4IPTA 4DUTA 3IP6A 3L7LA 3GLKA 4LVUA 4WYLA 4OZ5A 3O2IA 4JB2A 2P11A 5LDDC 2DHSA 4PF1A 1YTUA 3AILA 3DO5A 4XDGA 5AVXA 3VKGA 2VSNA 1UZLA 1NNI1 4B3FX 4CM1A 3PYXA 1V1MA 4UNQA 4OATA 3PHLA 5TGTA 4ZEWA 1C7ZA 4P7FA 2O5VA 1PJCA 4QHSA 2HPVA 3BSYA 1DIHA 4ACBA 5G02A 5K3DA 1DT3A 2Z5GA 5KHOC 1MG5A 2BRUC 5FNZA 2G36A 3MCWA 3MPDA 4IVRA 4WDRA 1XMXA 5JO9A 3ZNNA 4PXBA 2B21A 3KQHA 1SMKA 3TQHA 2JVKA 1VFNA 4Z4GA 5I8ZA 5LQMA 4DL5A 1GYQA 4HWGA 3N05A 4Y98A 2WK1A 4MYDA 4ZV9A 4C20A 4N77A 1KQSR 4CKBB 2VBZA 4ZCLA 4ADSG 5FTMA 1A50B 4PLGA 3O47A 1G1AA 4UQLA 1TVCA 4IZIA 1TM3E 3UBMA 4KQGA 3O6VA 2DKNA 2ZSIA 4GUAA 5AJ3F 2RE8A 3VTFA 2B7BB 5K0GA 5LM3A 4Q9JA 2EERA 3X3HA 1E6UA 5C1IA 1RXEA 2RGWA 3C6KA 1FRIA 2H59A 2YNIA 2IGBA 3UAGA 2F65A 3TR0A 1KC3A 4LISA 1MMFB 2RKBA 4D02A 1CETA 4LV6A 3RFXA 1GQEA 2RHBA 3ZH9B 2VODA 3I6BA 2IEBA 3DGEC 2R85A 4EFNA 1CYEA 2JEIA 4ED9A 1JW9B 2J33A 3IPYA 2CNKA 1MRSA 1JLRA 1ZA2B 1UBHS 2KJVA 1XZMA 5J2UA 4N3CA 5AVJA 5J58A 3A32A 3KSDO 2O8FB 5BRJA 4N5DA 1AE1A 1GP2A 2BTEA 2EZ9A 5M04A 2QL7A 1N3YA 1EDBA 4RD3A 5MGBA 2JCSA 2Y27A 4OBWA 1R5BA 4CIWA 3FUYA 4NCKA 4DG9A 3H86A 4EHJA 3NBPA 5KZMB 4ND3A 4CMIB 3N5BA 1ZXLA 3PWZA 4KR3A 3GRRA 3NCHA 2F8SA 1Q0SA 3DBOB 2HYIC 4ZLJA 3OBIA 3VGSA 3S6JA 3CEAA 1IQTA 3TQCA 1FXUA 2EKBA 2PWAA 3HUDA 1KSHA 1A9QA 4E07A 4P38A 3EEOA 4L5JA 3NM6B 4OQEA 1BQ4A 4F0MA 3MUNA 3JAKA 2ZE6A 4ZP6A 4IIUA 1KY4A 4CO2A 3NS7A 4OXYA 3WWEA 3EFEA 1P4AA 1ZRHA 1PVVA 2DHHA 4A8WA 1IAVA 3F4BA 3H25A 1Y6QA 4DLYA 3DXSX 4CMIA 4KQEA 2HA3A 5IUNC 5AQ1A 3FYUA 1JF8A 4AN0A 1AIPA 1GA6A 2EW2A 4YUYA 4LZOA 4MS3A 1E98A 3ZTOA 4UBLA 5KJCA 1W7AA 5J5AA 4QOTA 4ICLA 4KO4S 1PRYA 1CF2O 3VV2B 1EZ1A 3C0KA 2K7KA 4ES1A 5D1HA 1OXKB 2ODEA 1JEYA 1GQFA 3VKHA 2QUHA 3MTEA 4ZO7A 5KFAA 4EB0A 3PVCA 1WD7A 4E2FB 3QWAA 3FAKA 4ALKA 2RHDA 3W2HA 4YLGA 4QBKA 4R5HA 4J76A 4YRJA 4BB0A 4E5DA 2RG1A 4ANEA 3UGTA 4GZ6A 4WFAQ 1P1LA 1OIXA 1WD6A 2AXQA 4PLVA 1OBCA 1G6HA 4AL4A 5EWGA 3A2KA 4P73A 2B1RA 4DA0A 4MKFA 5ALIA 4JI7B 3BM5A 2AZTA 4YMEA 1U7XA 4RM2A 1AF7A 4M98A 3INGA 1K6XA 4FOLA 3NOCA 4NNJA 4FW8A 5B5SA 4PR6A 1X0PA 4D3HA 4NMHA 5G1OA 1ZRNA 3BGSA 1M6YA 1L3VA 1BHNA 3OIDA 4O44B 3OIGA 4LREA 4LYAA 3BIJA 1Y1TA 4FOSA 4PCQA 3NAHA 1OXTA 3O2SB 4YAGA 5T3UA 1HT0A 3I04A 4O1IA 3OCZA 3RHTA 2AGOA 2J0XA 3QF4A 2X22A 1W4CA 4ZRNA 3S99A 1BE8A 4RY9A 2DNRA 2VK2A 3WFIA 2VBYA 4CM7A 2RF2A 1OOEA 2GO7A 2E5HA 3PT9A 2R8PA 1SCBA 3KDPA 2AOTB 3PM9A 3I52A 2Q66A 3EXAA 5JCOA 5DLPA 1S01A 4HUTA 1F9EB 5CHYA 3L7JA 3NS5A 2Q3LA 1QUVA 3QH4A 1FQKA 4EG5A 1XPJA 1NN0A 1E4VA 4OZ0A 3ZE0B 1CQXA 4REQA 1F60A 1YVRA 4AZ0A 2BFOA 4FKYA 2D3WA 5DHSA 5DN6D 3FNQA 4XX0B 4NFLA 4E98A 2J45A 1V4VA 1XWWA 3OKAA 4R2XA 1Z2NX 2HSGA 3L79A 3FDJA 3B12A 2GN8A 4LDQA 2H29A 5IZCC 1QANA 4TYNA 3AVOA 3EIQA 3PQDA 2JC1A 1OFVA 4BO0A 4X1YB 1C0EA 1S1TB 2F7SA 4ZP1A 2G25A 3X1JA 2NUPA 3FKSA 4G0UA 2QMUA 4M0PA 2FJEB 1R5OA 2GVZB 2AX3A 4BNZA 3K1AA 4C06A 2D41A 3M05A 1RLDA 2VG7B 3WYEA 3RD5A 2XB6A 3QE0A 1Q3TA 3K9BA 2NVUB 1L5SA 4QGAA 2FWMX 3BIXA 3E3LA 1YZUA 2H9IA 4WN9A 1QG0A 4XUEA 2FPLA 4D80A 2CD7A 5JXGA 1G5IA 1TT5A 1N2CA 4TXMA 3AERB 3HULA 1OSDA 3HDJA 3FI9A 2B82A 1YAHA 1I7NA 3N07A 2EGHA 1NMXA 1PL0A 2YV2A 3B6KA 2X9NA 3T1VA 4DL3A 2PGIA 1TA9A 4IQMA 2HGSA 4AFFA 3PL1A 2VG7A 1CZOA 2W6QA 4OZNA 4LSGA 4B80A 4OVKA 3OTCA 5GV8A 4KE6A 1Q17A 2V55B 4X61A 1EH5A 1PZGA 3WB9A 5JC1A 2LP4Y 4ALJA 1X13A 1PBNA 2AKAB 2ZXFA 1YKWA 1ISRA 1P0QA 2HVDA 4XSHA 3VR5D 2ADBA 3DHVA 2B43A 3CCQS 1EGMB 4ND7A 1GG5A 4WZ6A 1WHSB 1E2DA 1RBQA 1TT5B 4FXPA 2YWCA 5CX1A 1W5FA 3C70A 2AU0A 5LL6d 2OLWA 1W88A 2I4IA 4NPHA 2IDMA 2M2BA 2W8ZA 3V4IA 1DJNA 5I9TA 1L6IA 2Z0GA 5HKLA 5JXIA 4RETA 1NVGA 3CC2S 4JKIA 2ID8A 2HRYA 3QGPA 4OHZA 4GYWA 2X8JB 5LVAA 3D5QA 2IEZA 1Y5NB 5J5VA 4A1FA 3JD0A 4J8PA 3GONA 3SCIE 1SBTA 1XJWB 3AGQA 4TZTA 4RTJA 3R6LA 2FVRA 1U2GA 1ZD5A 4QOHA 3TLMA 4LX8A 5I9MA 1DC8A 2J3DA 3W9HA 2XQGA 2OPPB 4OYHA 2BI7A 5F33A 3A3OB 4PAWA 3TXYA 4V0LA 2BVNA 1UXHA 2VXYA 4FIDA 4D8WA 1C4CA 1UMBB 1F14A 2Y68A 4JU9A 1ZX1A 4JJFA 2XCOA 3C7AA 4L9SA 3PDNA 4OYRA 4Z9YA 5FHRA 4YH1A 3GEPA 4TWZA 2VTEA 4V39A 3IPXA 3BK7A 2DUMA 4EMUA 4XPCA 4C4XA 3HSZA 1NMQA 1Y5RA 3KWJA 4WCVA 5E41A 1OZHA 5HJXA 2HQOA 1XMVA 2XUZA 2FEMA 5LCXA 1CV2A 4J16A 1M6EX 2H1CA 1SIUA 3Q86A 3UEOA 1U1LA 5JPCA 4NDAA 4YASA 2YWXA 5CXQA 2VAMA 2ZJ5A 3AF2A 5C8VA 4RSHA 1Z36A 1ZESA 3IBWA 2A0FB 5J47A 1EWQA 3MD1A 4JI2B 4RJJA 2L18A 3FFBA 4R2KA 4W82A 3PKJA 4H4KA 3TECE 3D8UA 2X3YA 1E4EB 4JT8A 1M7HA 1U99A 1GAQA 2HIQA 4EJ6A 5CEJA 1VCOA 1EHYA 4CLEA 3FMPB 3I9OA 4A8TA 4O2BF 4ER3A 3RC7A 3ROQA 1O6ZA 3SR4A 2XI4A 4N8DA 1L7MA 3W9YA 1OFIA 5FBLB 1YB1A 4ND6A 2QVGA 1XU7A 4JBXA 1E89A 1TDJA 2V4JA 3ZJVA 2JC0A 3I0NA 2PO4A 2PGJA 3I56S 3PDIB 3PZRA 3A3PA 1XERA 4W4MA 4DA8A 3PNPA 3VSDA 1QFYA 3PNYA 5J2QA 2VHVA 2ET6A 4K88A 3ZCVA 1W2GA 2IYQA 2UUAJ 2IF0A 3PUWA 4YP6A 2I6XA 2V5AA 2XE4A 2C7VA 1H2RS 2N7YA 4L5BA 3W62A 3UW3A 2XTMA 2L9DA 3WFJA 1H23A 1E5TA 4MW9A 3PXBA 2MLZA 2RMLA 3FZYA 4WASA 1U0GA 5TMDA 3T9DA 1P2SA 4UOGA 3Q87B 2ZJ8A 4O3SA 3INNA 3RFUA 2M3DA 3GR1A 3A3PB 1L3SA 4OH7A 4ZAVA 1KEEB 4J4BA 2MINA 4RL1A 5K3CA 1RISA 3WQQA 4CKXA 5CK4A 4KWCA 4L5AA 1DJLA 2QTBA 3CLSC 1PU2A 4I56A 4LFCB 5JY6A 4LBVA 3S4YA 3TVTA 5JVDB 2V8GA 3EPPA 5AVWA 1EIWA 2HFJA 1D0VA 1SHLA 1HLDA 2C2KB 3GG1A 3CWZA 2B1JA 2JD1A 1TL7B 4XWTA 3ZFVA 2GX6A 3ZWDA 3M0EA 2W2OP 4M0DA 3HVTB 2HHHB 4OQMA 1JV2B 5BNTA 1ODTC 1IG0A 4CCHA 3H4DA 4JGGA 1OFUX 621PA 4RA6B 4C4ZA 4I5FA 1RS0A 2ZM6J 3C3AA 4BQNA 3KXDA 3KHHA 1DRUA 4MCHA 1LZLA 2WJHA 3F47A 3LP1B 1SVMA 5HROA 5HBRA 5D4PA 3UAOA 2OFHX 3P9RA 4ZZIA 2WMDA 4I2PB 1KI6A 3C5WP 3GUZA 2BHTA 4DNXA 4LGMA 1UPCA 5IJWA 4I0WB 3K17A 2I9SA 3IOYA 4QOIA 3UT5A 3R74A 4FI3F 4BQOA 1V8OA 1VIVA 3SXJA 3HSGA 2W71A 3T1HJ 1THMA 1YZLA 1WC5A 3QKWA 4RPIA 4HEQA 1M1UA 3LHKA 3D8TA 4RLHA 4X00A 2FZ5A 4LYDA 4X4PA 1PR2A 5K5MA 3R97A 4DLZA 2OD6A 1VHFA 1LBQA 2D3TA 5LD2B 4ZMRA 3W78A 1G9TA 2KMLA 3ECSA 4JVMA 5CB6A 2FLWA 4PGAA 1QX4A 2FR1A 1GSHA 4P08A 2DXDA 2PUTA 1M6VA 1IJEA 1QTIA 1Q4RA 4WXYB 1US8A 2BKPA 1IKYB 4FHFA 3PNIA 3WDMA 2J6TA 3Q11A 2NT3A 1QF9A 5F5LA 3SX2A 5KWVA 5L8VA 1E2EA 2C8LA 4PX9A 4Y9UA 1CRQA 4D4GA 2DB1A 5E7MA 2ALYB 2IU4A 2ZBPA 2CD9A 1HNIB 4GPZA 3KHRA 1U09A 3N01A 2Z6UA 2HFZA 1S9FA 4HHUA 3A6JA 5KSOA 2FIUA 2EX0A 4IFEA 2APOA 4BC7A 1YIAA 2EVWX 1S2LA 5BSKA 1C2YA 2QD5A 1A71A 1NFFA 1U0RA 1FU4A 1D7AA 4G5GA 2Y2VA 2AMLA 2KO1A 1SUEA 4ID5A 1M6VB 3VXKA 3RKSA 3ZTPA 3QHAA 4IO1A 2DFPA 3PP8A 3K57A 1BA3A 4ZDKA 4M0MA 3IKVA 3JASA 3F8SA 1QYWA 3PR2B 1XXHA 4D4KA 2FZLA 3I4FA 4QDTA 3PE3A 4LXTA 3W5UA 3GLFE 1WHWA 1UP4A 3HKCB 3MHPA 3PC8C 1WY5A 1FVXA 2HHHF 4DQUA 4EW3A 4O6VA 5FI1B 1SC3A 1WPGA 2R4QA 4P54A 4QU9A 3KKOA 2WUFA 4B31A 4UF4A 1WDLA 5B57C 1PHRA 2IAJB 3GYNA 5IV3A 5JH7B 1RHMA 3V7WA 4UQPA 1QIKA 5K20B 5EPOA 4M36A 1NXTA 5K09A 2AOUB 3JPWA 3A1VA 2ZC4A 2FFRA 2OIHA 4CFZA 3H16A 4J0QA 3OMLA 4EF6A 3CZRA 4YR0A 1MU2B 1QJCA 2AYYA 4I55A 2PT9A 1NDQA 4PINA 3HB0A 1VHQA 2CKWA 3G5MA 3M5CA 5SY6A 3A9WA 4XKJA 3UCZP 3GJ3A 1U45A 2ACKA 1E59A 4NA3A 1O6GA 3ENNA 1TUGA 1P7PA 1H2HA 4ZRDA 4FYMA 3V46A 1QP0A 1RJGA 4JVNA 4F36A 4KHMA 1EQ0A 3RTVA 3ICLA 1KDYA 4X7MA 2IPMA 4XVUA 3EVBA 4YEAA 3CR7A 4MLZA 5KT6A 4RLQA 3RUBL 1N7IA 2XLBA 3AI1A 3F8WA 3T1QA 2FYTA 1ZISA 4EKDA 4H2DA 3D6UA 1A9TA 2XLJA 4BWMA 1W73A 1ZUWA 1JT2A 4JI8F 1JFTA 4KFBB 3Q8PB 1AXEA 1MVLA 2RGRA 1N8NA 3EC7A 1DQNA 3ZBTA 1EDZA 1WCV1 5IFLA 4IEEA 2IXDA 1E7RA 1U65A 4IKOA 3KQPA 4X1KA 2F64A 1JLSA 4X92A 1TK3A 1ZI8A 3RB4A 4LJ6A 1C7FA 3GLHA 1TCUA 4DDFA 1CEZA 4YACA 2RBKA 2E6UX 2E21A 2LCFA 5DW3A 4DBLE 3WKAA 3CVWA 2UXBB 4YT5A 1BD6A 3NS6A 2PUCA 4URYR 2B92A 3EW9A 1G2EA 5E7IA 3F3MA 5BYQA 2IYOA 4KFBA 1NMYA 4DV5F 3AQ4A 4RZ2A 4CZCA 3SHVA 4TWAA 2DPXA 2MQLA 5L7WA 1IKWA 3AR9A 2ZPUA 2IIPA 2I7DA 1LLQA 1BQNA 1PI3A 2XNJA 2DLCX 1Y8RA 3Q85A 2WWTA 4F5ZA 1JIHA 3KJZA 3GLHB 1O4WA 2A33A 4KUHA 3OM9A 2EP8A 3CJ2A 2GK3A 3HWRA 5F1OA 2CVHA 1KIFA 5KO2A 4KQ6A 3TZZA 5LP6B 3B20A 2D06A 2ZVPX 5P21A 1KJYA 1YBTA 1P1KA 4Q18A 2W25A 3ZE9A 1GNSA 4DR1J 1KAOA 1VQOS 4JQZA 1A76A 1XK6A 2FQXA 1SUSA 4KVFA 1GUBA 5HQLA 1K8YB 2P1ZA 1A4XA 1BQXA 1NDLA 2QRQA 4URXR 3F4LA 2VJUA 3C3KA 4BKRA 2LQJA 2C97A 2AN1A 4DV3B 1UZAA 3HB5X 2FDXA 3BYZA 4I4NA 1ISJA 2WK4A 1E2LA 1INLA 3QTBA 1J8YF 3ZXYA 1U9CA 2UZIR 2VHEA 4QGBA 4XYEA 3B78A 1ZN8A 2E4WA 1JHAA 3AWDA 5FIUA 1HFWA 1NL3A 1RT6B 2LEBA 3DBRA 4DCVA 3QLVA 4DR2F 5GADU 1G20E 4FHCA 3TZYA 2IHR1 5HJEA 4ED7A 4D3GA 4R41A 4YDRA 1Z13A 4AQYJ 4KAAA 1EX8A 3HHLD 4R8KA 5KYYA 3CG0A 3IGFA 4CNZA 4LMAA 1ZNQO 2HUNA 4CLLA 4WLOA 5CVUA 1S6PA 4MX8A 4CF4A 2BANA 4P3PA 1NKCA 1H2ZA 3L0PA 3QOYA 4P33A 5K8NA 1PKXA 3GHYA 5BXQC 5D0RA 5B0DA 4PLFA 2RAPA 3IOMA 5SYMA 2NU6B 3OXLA 3OHBA 3LIIA 3DBRB 3EZFA 4TL9A 4N3NA 4UM7A 5KCMA 4QLBA 3LVBA 3DOFA 3WK7A 1ZQ1A 3M5DA 5A3QA 1H6CA 3QVSA 4N76A 1YE8A 4BO2A 1DRVA 3MD9A 2VQDA 1F5NA 5GAEI 2AT1A 3DLHA 5I9LA 3EHDA 2B1IA 2VPZA 1AG9A 2WAMA 4I4TF 3FDXA 5E95A 1TVKB 2GVDC 4L3WA 4QYMA 4C14A 1U1EA 3BD8A 3TUZC 1KE1A 4JI0J 4KITB 3C15B 1ZH0A 2AJ8A 5FAXA 4V0MA 3W5VA 1ZR4A 1H0SA 1JVNA 4G1VA 1EIZA 1R0BG 4JI4F 4YRRA 5A9SA 3OC6A 3VX4A 2P4EA 2SICE 5GJVC 3IQZA 2ZIWB 1CW2B 4G4SO 2J5BA 2B78A 2CYYA 3KOUA 3O1JC 4IG9A 1YWXA 4OM8A 1LXNA 2NXEA 3GEMA 3ELBA 1HR0F 4Z7NB 1K92A 5JZOA 2WSSD 5HQJA 1P62B 3MEGB 3PRKE 3GD7A 4H0NA 1GFIA 3EQ6A 2P90A 4H3HB 2D0OB 4C89A 3KSAC 4KE5A 5SICE 3W65A 2Z5FA 3ZGVA 2IJFA 4M9UA 4P0QB 4QU5A 4NLWA 3UKJA 1RM0A 2PIAA 4CT8A 4PM4A 1I01A 3FQLA 1EK1A 4FDFA 4B3CA 3SJAA 3MELA 5ENVA 3HKEB 2NS1B 1SC6A 3IEXA 3TR6A 4WTYA 5KNDD 4WNYA 2G8LA 4B43A 3U3JA 3VAMA 3HNRA 4CCWA 1RU1A 1U0SY 1LWFB 1LS1A 2AJDA 4IJKA 4DV0B 4P3XA 2W2LA 3T6KA 3BA1A 3GFGA 2X2OA 3N6MA 1EP9A 2G67A 4TQUS 2VDWB 1WHTB 1N48A 2C5HA 4OK5A 2ORWA 4TL7A 4TROA 1G41A 5CDFA 3IQDB 3GCDA 2ST1A 3K7EA 2K7JA 1BDMA 4CV3A 3HA7A 3WYBA 4XVRA 5L9NA 1LWNA 3OZGA 1D0SA 2Q6KA 3GDFA 4TS4A 2FPWA 2FQWA 4G5FA 3VO1A 2QD1A 3I01M 4L8WB 2D1CA 4QYSA 1OY9A 4GECA 2B6AA 4RW6B 1P61B 4WK1A 2ZWAA 4EEYA 4C8KA 4BLRA 3EZ5A 1JFRA 4I67A 3KL2A 2OWDA 4FT2A 3ZI0A 2ZAMA 1PZFA 4YGYA 3HGTA 1G8MA 3LT2A 1PWZA 4NJMB 3WJ1A 4LSMA 1JDJA 4TUYB 5C42A 2OMOA 1Z5GA 3D5EA 2C20A 3ICOA 4D56A 1XLTC 4KYUA 3NDRA 1IHPA 5FR1A 1AQLA 1N2EA 4HNAB 1HBOB 3AOBA 2JKYA 4TXJA 1M9NA 1QGYA 1H1LB 3F9RA 1H2FA 3EDQA 2J08A 5I3UB 1S1MA 1C9JA 2AXNA 1UM9B 1FNOA 2QUKA 3L8FA 1ZLYA 1SJ4P 3RBVA 4RKQA 1RE0A 2FFQA 3G86A 1ZI9A 3WIOA 2HFNA 3RR8A 2J3LA 1A97A 5JSKA 1IR2A 4W7IA 3NTVA 3M4JA 3BMOB 2XQIA 3K59A 2C2EA 2DH9A 1K1EA 2E5LJ 2MJUA 1AQNA 2CG4A 3OICA 2GAHC 5LM7E 3W3SA 2IZZA 3WRVA 3VALA 3K9CA 3PGVA 5LPNA 4F8JA 3WBJA 3TUJC 4KO8A 3C5CA 2MOKA 1RB0A 1JIKA 1JJCB 1IUOA 1TGYA 4JJ4A 3D0HE 2P9BA 2YMPA 1G7CB 3SKXA 1OLXB 3OCYA 2HJWA 4B9UA 4YJFB 5F2EA 2JDID 2ZHBA 3MILA 3ZLUA 1BW9B 1GIAA 1P60A 5D3KA 1ATZA 4JEIA 1FVSA 3TNFA 4CLDA 1S1XB 1TKXB 4GL2A 3WS7A 2JAOA 5DEOA 5ALRA 4Z9FA 1GU1A 1BS2A 2QW0X 1H4QA 1PDVA 3P2JA 1NJ5A 4U8HA 2B8NA 4M76B 1D9AA 3ND8A 4DN9A 3JVDA 2ZVQX 5D7NA 3PF8A 1CQNA 2ZUSA 4HGOA 2CFRA 3TIVA 4ETIA 1XZEA 1FDOA 1Q0RA 2PVPA 3HNPA 4WPGA 4D79A 5CCXA 3FOBA 2FQ1A 2ZDQA 4BVAA 3G2LA 1ZIOA 5AW5A 4C1NA 4UVHA 5U9CA 2L9WA 4YJFA 5CDHA 1AZSA 3US5A 1PJLA 3V4VB 2AOWA 4R2JA 2CQ4A 2Y0BB 3EFOA 3MBOA 3H2GA 3CF4G 4MV8A 4CTMA 3D0GE 2WYWA 2IDKA 2OPQA 2ILVA 1TV6B 1YDEA 2DWUA 4D97A 5EIEA 1J0DA 5SY4A 1KYVA 4WK6A 2JLCA 2H48B 1ZNZA 4UUMA 3GOQA 3KNAA 3OEED 1MT3A 2ERXA 1RTIA 3OTEA 4UASA 2NR0A 5KTKA 3AP2A 1MRNA 5LBTA 4IUFA 3T9ZA 2YBDA 3C1AA 4WBFA 5G4KA 3PW7A 4LF7F 1LLFA 3I55S 4MA4A 1MW9X 1HWLA 2OPQB 3T34A 1LW0B 3WTCA 4LE2A 3KR0A 2Q50A 2GS9A 5C3UA 1JB9A 1X7VA 3BF4A 3MMCB 4KRYA 4BLVA 2AH5A 2R66A 1U0JA 4KKOA 1T1JA 4GPBA 2CJAA 2UAGA 1UMJA 3OQHA 1HORA 4HFNA 1PW5A 1YZFA 3C3PA 5KFGA 3BE5A 3BGRA 2GPWA 1OH8A 3H97A 4WJBA 1QSGA 3I1FA 4N65A 5L6MB 3HP7A 2HRDA 3FVRA 3U3KA 4BLQA 3WGGA 3OR1A 2VJVA 4BB6A 3ZTSA 2J6IA 1QGAA 5BV0A 4UPVA 1QZ3A 2KFNA 4PQFA 2VRBA 1CS4B 2NPOA 3G89A 3U2QA 4FF3A 4B3OA 3I82A 4TMTA 4ARBA 1P2BA 3P19A 3D7RA 1EZZA 1GG2A 3TVKA 3H7AA 5H8WA 1T0IA 1ATIA 5LQRA 4DNFA 3EMKA 3ABRB 4QBGB 3D6AA 5J4VA 4MLDA 4HO1X 3CSKA 1XROA 1YC2A 3IILA 3D1QA 3UVJA 1ZC3A 4PC1A 2V6JA 2AJLI 3RQIA 4ASUA 2O2CA 2P27A 3TLXA 3KLEB 1LZKA 4M86A 3DE4X 3EXHC 3QU9A 2JLEA 3WBFA 3R5SA 5ITZB 2CVOA 2JVJA 1PN3A 1RAAB 4MH8A 4Z8YA 2FQQA 3WL8A 4WBXC 4S05A 4CQMB 1EFCA 5AKLA 1KRWA 1NW4A 5DLGA 4X3CA 3FKBA 1FNNA 1SUPA 4DJBA 4LTNA 5BWCA 1RI7A 5IT9Y 5FI0B 3HM9A 4M21A 2HA7A 2R7TA 4MIEA 1AH2A 4B46A 2NAFA 1JR3E 3GT3A 1CRWG 1EXNA 3PYLA 4OHFA 1O4VA 1UDWA 4OKIA 3VO2A 3BIFA 3HLUA 3GE9A 3THYA 1PYSB 4MB0A 4I2QB 1ODCA 3W5HA 4Y9RA 2CPDA 3FCUB 1D8TA 5I42A 5E6RA 3C6BA 1Q1ZA 2VL7A 7FDRA 1RAAA 4P6QA 4BVHA 2FMIA 2FRVA 4DF3A 1PCAA 3TM5A 5ENZA 1BCSB 2DY0A 1AGNA 1IM8A 2B2CA 4HN2A 4Z4CA 1XMOB 3K1YA 3TBFA 3BH7B 2FZEA 1T24A 4BX3A 4E12A 2GZSA 1FY2A 2ZT6A 1SJ1A 3UN5A 4KQ1A 4WNCA 1FFDA 2NXJA 5FEMA 2UVDA 1DLOA 1Y8ZA 4HX9A 2G04A 3NHWA 4FEAA 2ZI5A 4WU2A 1KZHA 2YKGA 2Z30A 2GN0A 2B4PA 3VCDA 4JJAA 2KYZA 2PT0A 2ZKLA 3C46A 1LU9A 2GMHA 3HM2A 4ZOBA 5EJMA 1CR2A 2XWYA 3EH2A 4QBHA 3VDMA 1DQ8A 1C30B 2ZJFA 3OQVA 5HRAA 1BCSA 4EO4A 4WUTA 4PZUA 1X87A 4YEDA 1PFKA 2HZAA 2DYKA 1RRCA 1YNOA 4U7UK 3TRDA 5E7QA 1U0HB 4GM1A 2AC4A 2VP5A 4FOPA 3D3QA 4NMMA 5TXGA 3T7JA 5HAOA 3ADCA 4B4WA 5LNK1 2KG0A 3R44A 1ZLXA 1QLNA 4J3JA 2L82A 1LKZA 2B25A 4I5DA 2EKYA 3AUXA 1PS9A 2HFUA 4OHRA 2RK3A 1CWUA 2I6UA 3OLXA 1SZCA 3K0BA 3FN4A 4IWYA 1TYAE 2MHCA 1W30A 3U6BA 3W4JA 5DE3A 4ZICA 4C2TA 1MMDA 4LSZB 1U2CA 3LF2A 2MKJA 4R9UC 1DKUA 3SEFA 4JYAJ 1CJCA 4JODA 4F2RA 2DG2A 1EFVA 4GC5A 4FC7A 3CW8X 4EY8A 1ZOLA 2HQBA 2GO9A 4ZZ0A 1SEVA 3RJ9A 4WT7A 2I4MA 4ZKEA 2YCLA 3KUUA 2X8LA 1A7JA 1FP1D 4K2HA 3B3FA 1DQZA 2Y0PA 1ZEJA 4ZYVA 2YR0A 3LL4A 1AVTA 1OSCA 3OU6A 1GEGA 4TZ6A 1DIBA 2FEAA 3IFEA 4MUYA 5A6SA 5BORA 5K3BA 2C29D 4LSZA 1LQUA 3IVCA 4KQKA 4DV3F 2MT9A 4A23A 2LQ5A 4GLFA 1E6VA 3T3MB 4CMHA 2B69A 3LLMA 3COSA 2IEDA 3H18A 4ZMMA 3RO7A 1NP7A 1Y4ZA 3DXZA 2PUGA 4XZ3A 1N56A 2HQ3A 5LZ2A 3AB7A 3KFLA 3WNDA 3RSSA 2E9ZA 1GD1O 5IWAF 4FMCF 4FR2A 4XWWA 1X8XA 2ZH4A 3JXOA 4US0R 2ASDA 2EWMA 2AR7A 4P92A 4MSUA 4ZU3A 4YN3B 3TAUA 1T6NA 3EASA 3SOPA 3GLGB 2BGGA 3RW6A 3AJEA 1IQZA 5CVEA 4CM0A 1ND6A 3KALA 3P20A 4UBOA 3Q3CA 2VDOB 3KX2A 3WWYA 3B82A 5CVTA 5DMHA 3JS5A 3FZEA 5SZHB 4MMZB 5F9HA 5JO0A 4HJXA 4WESB 4LTMA 2HPZA 1VQYA 5C4GB 2W8KA 5BSVA 3DXFA 4MQ4A 5KSWB 1IZZA 4FDLA 1RADA 2GNAA 1RTHA 3E5RA 3ZCSA 4CYUB 3OOWA 3HVIA 3WSWA 3A14A 1NP6A 5CDSA 2IS4A 3E9ZA 2HRUA 1G6BA 4DV5B 3BH6A 3DE3X 4RAOA 3GLGA 2BH9A 2GF2A 2VI5A 2J0QD 3NTLA 2JFOA 1X1RA 5HPYB 3R0QA 2A9KA 1XN4A 4JR1A 1EP4A 1QIIA 1R2QA 2I54A 2QENA 2WUEA 3JATB 4PYLA 4NASA 1ZU4A 4O4JB 4UEKA 4B2YA 1HUQA 1PBTA 2C1EA 3T3IA 2X15A 1UKBA 2OP0A 4ECAA 1WUYA 4YCJA 1RPNA 1L5LA 1D6NA 1UW9A 1VLVA 4W9NA 2CXOA 1U26A 3BCSA 3DEHA 3X2FA 1FRKA 5B3LA 4UTXA 3AOGA 2IEYA 5ICCA 2D6FA 2HDNB 2ZB4A 1QRRA 4WSOA 2KVIA 3EGIA 2WVCA 1VKRA 4KGXA 4YMTA 2B8JA 1DTSA 3QBVA 3WLKX 3NEKA 3K96A 2PSJA 2OM6A 2ZUBA 3A7EA 3GRVA 4L7QA 2VZEA 3QGHA 2UV8G 4FFDA 1IUKA 4O4JA 5ICSA 1ULTA 3JSMA 4ZHQB 2VPIA 1N2ZA 3CX6A 2F3RA 1CJTB 2PQ2A 3ZXSA 4FQ8A 1ZA1B 5IBQA 1HH4A 4ZVVA 3MC1A 4R31A 4FPRA 1J70A 3OFVA 2NU8A 2DPGA 3LZ6A 4X7RA 1MB4A 3NORA 1V16A 1KWMA 3V32A 4HY3A 3EXHB 4LFBF 4OZ3A 3IAXA 4ETXA 3GRCA 1NPDA 3OZEA 4IMJB 4BLPA 4TV8A 3QSYB 2WD8A 4I6GA 3Q10A 2NYVA 3RS3A 3CCCA 3L07A 2ZH8A 1KD1T 3DLKA 4J1SA 1BEUB 4MGKR 1RW4A 2R8JA 3DW1X 5FPSA 2XOEA 2H5IA 2CUYA 2UUCB 5FCDA 4BX8A 1N5QA 4CLPA 3G2MA 3JWIA 4HH4A 1AHNA 2VR1A 3A8KA 1BEZA 4N6NA 2YJ5A 3ZE1B 4JI6J 4CI9A 1WNFA 3L1KA 2FGCA 2R8HA 4N47A 1EQAA 1LSJA 3CIOA 2OKCA 4N3GA 4F3YA 1TLLA 4RH1A 1SUQB 2IXBA 2VHXA 4LR9A 3SS9X 2V50A 4EP1A 1WP4A 1LWCB 1QZXA 4NLTA 5L4NA 3IB6A 2VWQA 1RWWA 2MLXA 5L9AA 4K50A 4QREA 3IHWA 1IHXA 5BWMA 1J7JA 2ZSKA 5B3JC 4X44A 2ZAIA 3PRJA 3O9MA 2V97A 3VNVA 2G8NA 2ZRMA 1YI8A 1ICEA 3W8NA 5LLSA 4PN7A 1P4JA 4LF6F 3W77A 4MUEA 5LMUF 2G9UA 3R8FA 2Z8ZA 2JJ1A 3TIGA 3IJRA 2VA8A 1U04A 4ZVQB 3CN7A 1B42A 2BH2A 4PYRA 1ESCA 1YRHA 1Y5IB 3PXEA 1S5ZA 2KHZA 2DNOA 3U49A 2FRDA 1MLDA 2B0JA 3K0JA 4KO0B 3ZJ5A 3PXXA 1RWWB 3MD0A 4PXCA 2JCVA 4Q37A 4OMUA 4BWFB 4FVTA 1EGAA 2BC9A 3I4HX 3B9BA 2AW5A 3D1OA 1CY7A 2FR8A 1KXJA 4UREA 2AX0A 4F04A 2IYLD 1RWNA 3J81Y 4O44A 3UO8B 4BCDA 1C0PA 3C7DB 3RASA 2HS4A 5LJ3Y 3INTA 4UZFA 1EVZA 3K0HA 3GLFB 2F55A 5ALTA 1R0RE 3O94A 3UJNA 3QT8A 4M46A 4XRGA 3QPUA 4RZQA 5FLEX 3TAHA 1IOZA 4CLFA 1E32A 1O9GA 2Y6VA 3SQWA 3NUQA 4DCJA 1Q16A 1K6JA 2ZYGA 1QAJA 2R7OA 4P35A 2WMOB 2H2AA 4A16A 4YUZA 3O84A 3C41J 2XUAA 4FX5A 4J0GA 4R0NA 2OXCA 4QU7A 1A77A 1DFIA 2Q41A 2DSTA 5TEWA 3TQEA 1D1PA 3DVRX 3SZ2A 2I4RA 1WUHS 3DMHA 2ZRLA 3KBOA 1EFRA 5H3LA 2B4AA 1UKZA 3IL2A 2GW8A 1WDWB 1JK9B 3ZW9A 2CJWB 4JIMA 3ROXA 2IHVA 3B5EA 1OTHA 2K2QB 2F4NA 4NCHA 4DCOA 2DX7A 3NFRA 5LOVB 3B8HA 3L8HA 2F1JA 1F9FA 1JPVA 4IYQA 4R5MA 4ZPJA 3AUSA 1JFFA 5KU7A 1C0TB 3M81A 1SQ6A 3M32B 4AYBD 2A3NA 3EF3A 3SYTA 3TQSA 3QELA 2OPRB 2XMUA 4J9SA 3CLVA 4D4JA 2AB0A 3KLGA 3AONB 4KN5A 1YVPA 3PW4A 1XPOA 4B79A 1FFXB 2CJWA 2HBQA 3F9IA 3BPDA 4JOBA 3NOGA 3U4MA 3BB3A 5AHOA 4D42A 3MGCA 3MUMP 4L0MA 2EBFX 5SY9A 1N2CB 3OURA 2GHWA 2HWKA 4P7BA 5GV7A 2RDIA 3AC0A 5GM1A 2W6JA 4IQFA 2R1VA 4C7XA 3N8KA 4PBSA 2LW7A 3TW0A 5B6PA 2CV2A 4CO1A 2DQSA 3ABOB 4I5IA 3RHFA 2DB3A 2P62A 1BD3A 4EH1A 3HDHA 3D3EA 1XK7A 1H38A 3GR6A 3FI0A 3ZN2A 4JI3J 3U5ZB 1QR6A 4LIRA 2DBRA 3CCSS 3IE2A 4K7QA 2W6NA 1SXJE 1PUXA 4ZREA 4M0KA 1U2PA 2TMDA 3DBHB 2B4RO 5DISB 4X3PA 4A9AA 1G5QA 3QE9Y 3DCAA 4H60A 2XF8A 5IAJA 5CT9A 5FJIA 2FNAA 4RSMA 1SCJA 4DSOA 1W34A 1EFUA 1OY1A 4AUEA 3GJZA 3U3ZA 1CEEA 2PH1A 2EJWA 2ZB7A 5E3HA 5DYWA 4EKNB 2F3UA 3N70A 3K5PA 4ZITA 3T9NA 3R7SB 2NVBA 4NBUA 3RYFB 2A67A 3BXOA 4KEAA 2ZM5A 4HB2A 3NT5A 3PC7A 4CEJB 2PD6A 2FPXA 4R9NA 2CDQA 2FN9A 3WWPA 1NNEA 4MRMB 1FF9A 2EOAA 4KODA 3VSEA 2DNLA 3GJ6A 3GLHE 5BUSA 2MYPA 3SKVA 3CINA 4G1FA 5MN4A 3T1OA 5BN5A 3A1FA 5E4JA 3CMCO 4EB6A 2DGTA 4X20B 3TZQA 2X13A 5AUQA 4L78A 4M5DA 4ECTA 4JI6F 1HFJA 4GOKA 1CQJA 1NBMD 3A27A 1SJRA 1ACMA 2HCBA 4YJGA 2JC3A 3TWZA 4QEKA 1LI7A 1NLUA 1SJFA 1I7QB 4F71A 2Y3IA 1R3DA 3G1WA 4A8KA 5GMKa 4E2XA 3JU3A 4MWZA 4F96A 1OAOC 2FMXA 3ZGOA 2BY4A 2B1QA 3FTPA 4ER7A 3QITA 3AD9C 3FRYA 1V3VA 2EDAA 2QVZX 5DV9A 2XMRA 2KU7A 4X71A 2ZVIA 5LB4A 2FVYA 1KYIA 1VP3A 4PPQA 4JQYA 1ABBA 1ZBQA 2YYSA 5DT2A 5TQ0A 3UA3A 3TD6A 3ILIA 2G1DA 3ZDFA 4CM8A 3MTJA 2KFZA 3M30A 4MVWA 1PFUA 5IF9A 1BGVA 4RDXA 2CJBA 4FOTA 1E1QD 3I30X 4HAOA 1B8NA 3O9VA 2QA1A 1MJ5A 4UD6A 3DRSB 1ISFA 1TW3A 4F0HA 3SC6A 2ZJOA 1SK9A 1V3TA 3PTLA 3R1LA 3R6DA 4TU8A 3K8OE 1GMWD 2D00A 1NVUQ 4MAFA 4IHQA 5IT5A 5KFKA 1YI1A 1R8CA 5CPBA 1OGIA 2Y8YA 4JUZA 3SE7A 1UBFA 2C03A 3BM7A 3UHJA 3PJRA 4OYWA 3KR2A 1NR1A 2DY9A 1ULSA 4GDFA 3MW8A 2CDAA 3DOOA 3R3JA 4RFLA 4UZSA 1GUZA 3H2LA 3HSYA 4KQHA 4CMKA 4C0AC 1T2UA 1KI4A 4UTNA 1DADA 2IP4A 5A7GA 4AS1A 4OJ3A 2DJIA 1RABA 4F9GA 2QGFB 1AA9A 1YR3A 1V6CA 1SH3A 3CXCR 4NYIQ 2WTFA 1IIRA 1U3DA 4DLTA 2ZZTA 5D5PA 1ULHA 3AY0A 4Q9NA 1E6CA 1YZNA 1OS5A 2XWQA 4QQFA 1F8FA 2Z43A 4L8GA 5HIJA 4I5GA 2HK8A 4Q3NA 1LV7A 1K7FB 6GPBA 1I9CA 2YIVX 4C8OA 3F5SA 4NP6A 1U1QA 2ZDGA 5JJBA 2PX2A 4QGFA 3TFOA 3CVOA 1NKVA 4N3AA 1T9CA 3K31A 3LC1O 4RESA 1CDDA 4HCJA 2ZWIA 2FQYA 1A5SB 3IDOA 3VQTA 1RA6A 2HHLA 1IZ7A 1UFKA 1MO3A 4OO3A 3V4FA 1Q86T 1D04A 6REQA 1KYXA 3X1DA 4C8LA 1HDZA 4RMGA 3U16A 2DNNA 2X2FA 4TMYA 3SIRA 4Q4LA 4E1AA 1A82A 3OPKA 1GUAA 1L1QA 1PTJC 3CPWR 3CR3C 3ZHZA 2EFHB 1QOZA 1L7XA 1DCFA 1SG9A 1Q0LA 4NAVA 2C5LA 4ZGBA 4WXPA 2YNFB 4G4JA 5KNBA 3QFSA 3Q7QA 4MK4A 3RW7A 1E20A 1E99A 5CYQB 2F9LA 3WQSB 4EUFA 1MVNA 1V9OA 4NJOA 3S2SA 4CEHA 2YBEA 3W5IA 3R6GA 4C0KA 2Z2JA 3NRBA 1ECBA 1Q3KA 4TLQA 4DREA 2JDJA 1TVEA 4YQEA 3K0FA 4F9TA 3G2KA 1L1FA 3VH4A 2R6HA 1FDNA 4I4TA 2HSEA 2JFPA 4B9AA 1QGZA 3RFTA 1V8DA 2WYVA 2P41A 3FWKA 1ZIDA 1CLEA 3RUPA 5EWLB 5ER6A 2I2WA 3D2CA 1VL1A 4FFVA 4EHBA 4JI4B 4JUDX 1E3WB 4HGZA 1D4FA 5EPUA 3H1PA 3ZWQA 3IHTA 2OZEA 1G6KA 2C78A 1LSUA 4K9NA 3WKBA 4LK2A 4ID3A 4NAUA 4KIGA 2R3VA 3QSGA 1SUDA 3OWOA 4A8HA 4MB2A 3EEYA 4QJ5A 4ZYXA 3KUCA 2WRZA 1J27A 4PAAA 4C0LA 4YDDB 3G9UA 1CZNA 4I4TB 4C76A 1TF2A 3T15A 3CX7A 1LDMA 4UHHA 1BA2A 1JR2A 3A25A 5LA6F 1NLKL 1HEIA 4IV0A 3GUCA 4IUYA 1TKTB 4EGFA 3TP2A 2JIZA 1FP4A 4WL0A 1RYZA 3OTBA 3H0KA 1FVFA 2GPSA 3GVHA 4B75A 5D3GB 2QRVA 3JASB 1RZMA 3HJBA 3BO2A 1AK1A 4C4PA 4Y2VA 4ANCA 3J81j 4LIWA 1M5SA 3TG8A 4YDQA 2HYIB 1P1CA 1OWXA 3N8IA 5EN4A 1QZZA 1FWKA 2GTIA 2GVDB 2XYHA 2FLVA 4CTJA 3FSXA 1X4HA 2VBWA 4PFJA 2MMCA 3IJ5A 7REQA 3AR7A 4OJHA 3IOBA 2HSJA 1KIMA 3UQSA 3LWDA 1NDKA 2ZAOA 5KI6A 2ZS9A 4DUZB 2PZAA 2FP4A 3R23A 1TYCA 3ZU3A 4BWJA 1NNDA 3AFOA 2Q1SA 5HFAA 4DSLA 1TAGA 3F1LA 1RCUA 1EM8A 1R9GA 2BISA 4D0LB 1GCIA 3N53A 4KQ9A 3CVKA 5E6UA 2YKNA 3HP1A 1TL1A 1NUPA 2V6BA 4EKIA 5L3QA 3Q72A 5B7GA 3PC4A 5LDGA 2BE9A 2UU9B 1LQTA 1OPZA 3LX4A 4LJYA 2LPMA 1MU2A 4RVFA 2XYHB 1CSEE 4J4TA 3K0AB 2EFVA 4LJAA 5GZ3A 1MX9A 4EW6A 7REQB 3ND7A 3IMEA 4QD3A 3K9WA 2A78A 4DCUA 3ROPA 3HCCA 3P0RA 4HYEA 2VP9A 1U4OA 2G2OA 4C88A 4U1RA 4EYGA 3ROKA 1ZSYA 1NX9A 1DUSA 1G59A 3F56A 1ZM9A 4IVNA 4DARA 1G17A 1I10A 2RGEA 1N78A 3M6LA 5E6UB 3SC2A 1J00A 3H1TA 4H54A 3MJDA 2AEFA 2AMVA 3W06A 2VNKA 1YJ5A 2WD9A 4KXWA 2GIRA 3G2IA 4YGXB 1IMJA 1DWPA 2PMWB 5KYXB 3GLIA 3Q24A 4MQBA 2Q8QA 3G8YA 4O2RA 2E2WA 5F8IA 4BFWA 1JYFA 1BMQA 3WWDA 1YRYE 2EBGA 4NV0A 3LFHA 2PFDA 1CX9B 4TMXA 2OO3A 4JASB 4MVJD 4PFKA 4ZVEA 1HQDA 4ETNA 4JJGA 2PBLA 1BYUA 4JLNA 2DPIA 1RWOB 5IJ9A 1QGED 3W3AD 3JSXA 3ONVA 1IEXA 4CM9D 3WGJA 1HHTP 1T5DX 2OHIA 1KYTA 4LY3A 3S1SA 4ECXA 1O5JA 4YAEA 2GKSA 3R8XA 4KHZA 2A2CA 3ESQA 1IIBA 1OAOA 4QQNA 2DJ5A 3D4BA 4WRRA 4PZ9A 4HRVA 4YROA 1JBKA 1ZVJA 1VIDA 1BXGA 3LQFA 3L7DA 4P3KA 4Z53A 1NCLA 1J2YA 3JZFA 4CIDA 3IR6B 4DE5A 5DBGA 2FB9A 2IUFA 2F4VB 4AZWA 3RBZA 2IHJA 1XMIA 3QX9A 3WQHA 1V1MB 2B4QA 2NYAA 4CKEA 2ZUWA 5HO4A 2GF9A 1U3WA 1UAYA 3BEOA 5B1IA 3LD9A 2P3LA 4ER6A 5F9NA 3DM9B 1ZM3A 5BVHA 4G67A 2QIPA 3KK2A 1L4YA 2GJ8A 1DTTA 4B9EA 4Q9IA 4EW1A 1L7AA 2VYCA 3AF1A 2YH1A 1U0TA 4PCLA 4O1HA 2RHTA 3LWBA 4ZHRA 4CQ1A 4YJ3F 1BXGB 3RG8A 4EO8A 3N0TA 1UPAA 2XZTB 3Q7PA 2IVYA 3KWMA 3MUEA 2Q1LA 2GRAA 3D2BA 1IK4A 2ZRBA 1U24A 4MPTA 1RKBA 4P7KA 2B5VA 2R11A 4FF1A 4I14A 1UBJS 1MJHA 3KT3A 2WCXA 4YRDA 3ZCPA 4JI0B 5E0KB 3S8SA 5LSLA 2FG5A 1J5OA 1SM4A 3OJSA 2WI8A 4NEQA 4GXQA 2V4QA 3FTDA 1VQ7S 3ZNJ1 4BS2A 2QSFA 1GT8A 1RAIA 4OZ2A 4U8GA 1T3HA 3AOAA 2BMVA 4XIJA 5LN1A 1W26A 3CE9A 1WQ4A 5HW0A 2KTQA 2QY6A 3LY5A 5TE9A 3BKUA 2JLGA 2H3EA 4ZJZA 4IX1A 1S9GB 2XITA 3GFZA 3ZHSA 5FFFA 5TMEA 3Q2KA 3FVYA 4TLEA 3HRHA 4HWPA 4YJ2F 1RLIA 2Y77A 4QAQA 2RH8A 5I4IA 4MGEA 1UBNA 1YQ9A 2NO7A 2O8FA 2VAXA 1LBSA 3SOZA 5CCDA 2MY7A 4CLRA 1DRZA 2IL1A 2QUZA 1PT8A 1S6QB 1XRPA 2J9XB 4KRGA 3SZOA 1WOOA 3GQVA 3THSA 4WN3A 4ZGGA 1CY0A 5A5VA 1ZG3A 2NYUA 2U1AA 1XOIA 3ZZYA 5DM6Q 3GWGA 4M1EA 4F5EA 4M1QA 4A8YA 5KNCD 2PM8A 3DU5A 1JLQB 4CVNA 2AT1B 4LFAJ 1TTHB 1FYVA 2YJGA 1RYRA 2VT7A 2FF5A 4J9LA 4OXRA 5JQGB 1WD5A 4L8FA 2BEUB 3M6FA 5A0VA 4E1BA 3FPSA 4UMVA 2VONA 4M60A 3PEYA 3E0QA 3Q3IA 2XUKA 4C0WA 3NAIA 2XXAA 1MF7A 1B3RA 4QIVA 2RHRA 3EXG2 5JFOA 7ABPA 3ASZA 1FFEA 3MMAB 3F41A 4FDAA 3JW8A 4V02A 1P9NA 2CA9A 5CPFA 3H5AA 2PZ8A 1RKVA 5EUBA 1RTDA 3IHLA 2C28A 2ETXA 3IA2A 5IHXA 3UI3A 4CM3A 3DLIA 4YBZA 1JX6A 4B1FA 4HQOA 4A8JA 4CQJA 3Q9LA 1ZM4A 1RQRA 3OFGA 4P32A 5SV2A 3T5HA 1TECE 2A3RA 1P8JA 3BHIA 4QXPA 2O1EA 5IKOA 1IOVA 2GOYA 1G3MA 3NHRA 5ALGA 5G1NA 1CNEA 5A4DA 1H5QA 2O2GA 2DQKA 2REXB 4QG7A 5AW9A 1RTDB 3BGUA 1J4AA 1KJJA 4WOBA 4C4WA 2ANCA 2GPYA 1WXWA 2QLLA 1V5IB 2QTNA 1EKRA 1Y9JA 4C8MA 1UEVA 3BC1A 4UXHA 3NVAA 4DKJA 2JJ2A 3TLZA 2CLKB 3DNPA 4I64A 4DPTA 2XR1A 3D0QA 3EYAA 1RDRA 3WQPA 1ZXBA 3VVMA 2DISA 3D3BJ 5HJYA 3UVEA 4NA1A 4ID9A 3KFXA 3ETLA 3I9V1 5A06A 2VHUA 1U0BB 3P3DA 3DTVD 4B2LA 4BOYA 1JHDA 1ZZNA 2QFIA 2QLNA 3MJRA 1UP1A 1PG0A 5J2TB 1L6RA 4QFMA 3K7RA 2UU9J 1GGVA 3PUHA 1UCFA 1ZRSA 5D4OA 2XDWA 4QELA 1IN1A 2E49A 4UM8B 2WF6A 3ZJTA 1GZUA 3QIVA 3GVCA 2Q99A 2RF2B 4GG1A 3FGNA 4HGNA 1F6BA 4L2IB 3U61B 3H5XA 2AZ1A 3OCUA 4RMHA 3M8RA 2C7QA 4TMWA 1N2BA 3RRGA 1UODA 1OIVA 3L7CA 1G4HA 1I6WA 4N48A 1T6ZA 2BONA 2I5JA 1FOEB 3QQCD 1C3JA 3RSLA 2JASA 3OVSA 2I34A 3IQFA 3N2YA 5CYPA 4Y6GB 3EEBA 1VLZA 2ZM6B 5ERYA 1Z5WA 3BILA 3BRWA 1MU0A 2H1LA 3R40A 2RT3A 5IK2A 3HHNB 4TWIA 2WTAA 1TKZB 4FUQA 2DQZA 2HIHA 2AFVA 3OSZA 1NDCA 3KKNA 1WDDA 4YMUA 1Z38A 4UDXX 2GR9A 3TTSA 5AJZA 3QWUA 3UA4A 3W2FA 3AIMA 2FPSA 2OG2A 1YJCA 3AY7A 2I5JB 3FWYA 2ZXEA 3L7AA 3PG5A 4AJHA 3CLUC 1FDAA 4DFKA 3GIDA 4EPTA 1XC9A 4D9EA 5DQGA 1DC3A 2JRCA 3GCWA 2HREA 5ALYA 2XBMA 2J30A 1HWYA 1LPMA 2JEZA 3B7PA 4AO6A 3LUHA 3TD2A 3K1AB 2QLWA 2IGTA 1A7UA 4L0CA 1W4RA 5KC9A 1FXSA 1VGRA 3VPHA 2AFIE 4DXDA 1UC4B 4JI8B 1WOYA 3M2VB 1N6QB 3ZDAA 4RM3A 2XUFA 3P5TL 5AKHA 2W6OA 3IAFA 1KFKB 4JEMA 4ECZA 5JTUA 3G23A 1M2FA 4P10A 3E9QA 3EX7C 4Y6PA 4EO7A 3R5TA 2RS2A 3JQAB 5DIFA 1UKEA 1FSGA 3F4KA 1S0VA 4LY0A 5H3CA 1DIAA 1QFSA 2WWGA 5HXAA 4ANFA 2QLFA 2R47A 5C3MA 2BUNA 2CDCA 3IBCA 2VH7A 5LBIA 4ZO9A 1N5JA 2CVZA 3I5AA 4GMHA 4GOXA 3TTTA 2YRWA 3RVNA 1YZHA 2J3KA 5GVSA 1POXA 5DGXA 3DH0A 5ETVA 4K6HA 1VPEA 3F0TA 2B0GA 3H0PA 2IVMA 4YRNA 3OX3A 4W5NA 4MV3A 2Y0EA 2QZZA 4NEHB 4B3MJ 1K8AT 4DR6J 4ENPA 3G5LA 4LX0A 3D3WB 4BFSA 4E4RA 5LJIA 5C24B 4GLBA 3GA5A 1TVRA 1PL8A 5EP1A 2DYAA 1ORIA 3V4IB 4AJEA 3SHQA 4WACA 3GZNB 3ZS8A 3BGOS 4U3JB 3JRWA 1EZ4A 3KEMA 4YLEA 4CUKA 4IHKA 4HUQB 4X63A 3FNBA 1WZCA 2GJKA 2ASYA 4B5LA 1P19A 3HYCA 4ZVSA 2HPHA 1RWKB 2XZDB 2AOTA 2OPSA 1CDZA 4BC1A 4Q6WA 1QC5A 1EG7A 4MEBA 4OP1A 1OHHA 3AF0A 1BD4A 4RQAA 5JOQA 1TVRB 2YN2A 1Q74A 4DCCA 1XP8A 1UEJA 2DGQA 5A8RA 4HDQB 3CZCA 3HL4A 4HG2A 3B54A 5LXTB 1B3TA 3LDUA 1NNUA 3HCAA 1G21A 1YQEA 2OZKA 1IBMF 2G1AA 2GN9A 1BTOA 2YXNA 1NF8A 2DCUA 3LRTA 3MR2A 4JXJA 5L39A 4V2UA 2H1YA 3O3CA 5MFZA 1X7GA 3WGMA 4DV5J 1O5OA 2YWGA 2C2MA 4M5IA 3K09A 3CHYA 4R9VA 2YRFA 2IPOA 1ACLA 3I4LA 3HN7A 4J0EA 2O6LA 3IURA 4Q4HA 4OV1A 1EXDA 1ISSA 4ALNA 1WQ3A 2E29A 1CS4A 3L8DA 5JRZA 4EBDA 4QRIA 5KFHA 4ZVKA 1I3LA 4L8YA 4ZODA 4PCVA 1ZPVA 3KHKA 5A2QA 5A6VA 4DL2A 2QZ8A 2RMKA 4ZO4A 4Q4JA 5EZ5A 3DAPA 3BJYA 4OPMA 4MQEB 5JFTA 1E1MA 2WB4A 2CFTA 1YSCA 3N79A 3EPLA 1XL0A 2I2DA 3CZAA 3ZXXA 2PLAA 3GAFA 2IPOB 1DZ3A 2IP2A 4W90B 1Y4UA 3PHBE 4FFOA 3N5CA 2PR2A 3MJCA 4IDAA 4PQYA 4EL0A 3HU5A 3D8BA 1L4FA 3E5NA 3U7IA 4OYAA 3OTOB 1MRZA 3V7YA 4R2LA 3EMDA 1CERA 4HGPA 4HP8A 3WK4A 4NLPA 1SBCA 2HVIA 4NEGA 5A4AA 4L76A 3PWKA 4IO9Q 4FS1A 3GDGA 5KOJA 4IDBA 4OGGA 1VSVA 4YI5A 1U48A 3CPSA 4Q45A 4GLLA 2VF2A 3D5MA 1AA1B 1HIYA 2RU9A 2C3YA 2E5LF 2EEPA 4YJHB 4U7TB 2MQMA 3WJ7A 4Z7JA 4ZPVR 4BJ3A 2PZBA 4W1PA 3UWSA 5T8KC 4Q7JB 2ECPA 1RQPA 2YHUA 2MINB 4QATA 3IUJA 1YBVA 3MCMA 4I1VA 4KJZA 2WIAA 2X9QA 4MDEA 1BKSB 3Q41A 3F6CA 5FUMA 4L9WA 1L5OA 4B6OA 3QKRA 1JEQB 3Q9UA 3CRRA 4X6LA 1EGVB 1W87A 3FLAA 3QNWB 1J7KA 4B6RA 4EY3A 4BGVA 2YXBA 2GQ0A 3PQCA 2WAOA 1N33B 3LUFA 1ZH5A 3CPJB 4MI6A 3EUNA 2G9VA 4A73A 1S99A 1FRLA 2ZWMA 3HVTA 4KAIA 1CUDA 1Q7BA 1Q6ZA 2EXXA 3LZCA 2YDYA 5J4YA 4CFSA 4UY85 2OP5A 1RHRB 2EIXA 1XKLA 4Q5VA 4RABA 3FJYA 1MW7A 3IRWP 3BRSA 1QHIA 1Z62A 1CZKA 4GKKJ 1JEQA 1KFDA 5I47A 2ZULA 3D28A 3K53A 4REMA 2J9CA 4EEZA 5CXUA 5LXYA 2NNWB 3L2OB 4AU1A 1BHQ1 5HK8A 2HMIB 1E66A 1FNMA 3QKIA 4H7HA 4OYIA 4BKOA 3CRZA 2BE2A 2BGIA 3KUHA 2EARA 3TQRA 2FFBA 3FD8A 3Q89A 4BC9A 4O0IA 5EHHA 1GADO 1Y9AA 4URQU 3SVTA 2FK7A 4ALMA 1Z6ZA 5AKXA 1T3NA 3KWLA 3H1GA 1L4BA 3HJRA 4NOKA 1Y3HA 1TFWA 2XA9A 1K0FA 3MJTA 4I8XA 3ZDXB 1QAXA 2W93A 4MIBA 1IJEB 1US8B 2BM1A 1G60A 5L51A 4LJMA 3PU6A 1LBTA 2YW9A 3T3DA 1LJ8A 5FOSA 5A0TA 4Y2TA 4NYJR 3L7PA 4MIYA 3LZDA 2O0KA 4QGGA 4JI3F 1X1QA 1KETA 1YJ8A 2V4MA 3HGQA 1MNQA 3R9LA 3FSGD 1XQYA 4I6YA 4UUXA 3FCCA 2XMDA 3L8GA 3H5SA 5GOZA 2O66A 2VT2A 3AUTA 3MWDB 5K2MA 3I42A 3BWDD 4NLYA 1VHDA 1TL4A 2BJ7A 3NMAA 2RRAA 5H16A 1GJRA 3FWNA 4YJKA 3A1NA 1WKLA 4RL6A 3KE8A 4N5SA 3IXMA 4ZVPA 5KFPA 1NPRA 1ULBA 4UTZA 1D5CA 3R3VA 1RD4A 2ZJ1A 1KEEA 3AZOA 1QTNB 4BNXA 4QWEA 1ZOIA 2VF3A 2R8OA 1AZTA 1NT4A 3JQBC 3O8NA 1KAQA 1V11B 4O3OA 3DM2B 3S01A 3GP5A 1DIGA 1NJYA 3LQ2A 2GEFA 4TSKA 4JNKA 3AD7C 2ZUUA 3A1UA 3JRXA 3UWMA 3ZKWB 3RI3A 3LW5C 3L0SA 2ZI9A 4YMGA 2GCIA 4JC5A 1A8PA 2Q4BA 1PX2A 4E5KA 4B2PA 4Y2HA 1WZ2A 1S4EA 3CRVA 1JKHB 4YAWA 3G8TA 3DOKB 1EB0A 4Z0NA 2XY7A 4C3LA 4F38A 1RZVA 3BFXA 2GCOA 1HDYA 4F4HA 3Q12A 5T64A 3EPKA 4M9ZA 4GQBA 4RQBA 1U31A 3EDOA 3GCGA 4DUGA 1X6VA 2DXEA 2ZGVA 3NC1C 5CFOA 4KGMA 4H1UA 3MMNA 3LANA 3PHEA 3RC9A 1RA7A 5HROB 1L8XA 1UP6A 1KI3A 5BNWA 1GMUA 2H2FA 2IH5A 1YUMA 2C1EB 2ETVA 1WU7A 4DN0A 3LKDA 2WLSA 5JH7F 4FFRA 4Z7YA 3K2QA 1LBIA 3WSVA 2AUNA 4I0WA 1M1HA 4KW7A 3EGEA 4NL4H 3HUEA 3STXA 3GLJA 6AT1A 1WY7A 1X15A 2BQ3A 5KVAA 2QN9A 3B2NA