4GMLA

Crystal structure of human not1 mif4g domain
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
235
Chain Sequence
VLFQGPHMLEENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCR4-NOT transcription complex subunit 1
publication title The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 76
structure length 235
sequence length 235
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gmlA00
2I2OA 1HU3A 3L6AA 1UW4B 1N52A 1H2UA 2FULA 4C9BB 4IULA 2KZTA 2HM8A 3RK6A 2IU1A 3D3MA 1H2VC 2IOLA 2VSOE 4CT4A 5ANRA 1UG3A 4B89A 3FEYA 4CEMA 2RG8A 3JUIA 4CRWA 2ZU6B 3EIJA 4B8AA 4GMLA 4JHJA 2IOSA 3FEXA 1N54A 2KZTB 1PAQA 2NSZA 4JHKA 4B8CB 1H2TC 1H6KA 4GMJA 2IONA 2GGFA 2VSXE 4LUNU 3EIQC
chains in the Genus database with same CATH superfamily
2H6FA 3L16A 1HX8A 3DPYA 1K1BA 2PM7A 1TJFA 3DEPA 2DZNA 5EDSA 3ML9A 4DUIA 1U3CA 4JEUA 4BETA 1HS6A 2CG2A 3NF1A 1N95A 3FH5A 5AQBA 1BU9A 2CHWA 1JUQA 3FTWA 1U2VG 4U0ZA 5AARA 3UT8A 3CSFA 2Q7FA 3UKUG 3Q7FA 3P2BA 5JJ6A 1AWCB 4G2VA 1XGWA 4NURA 2PM6A 3UIPC 3B7RL 1IHGA 3BU8A 3SFXA 1WM5A 3ZNGA 5J08A 3CVVA 2XHEA 3ISMC 3PZ1A 3NZUA 3Q9NC 3E34A 2I6HA 4L7TA 2OVFA 1Z3YA 4ACKA 3CGHA 3Q79A 4N5QA 4BERA 1YYHA 2ZGGA 1ELWA 3DXMG 4HRMB 4M3OA 1IKND 2PZIA 3UM0A 3G2SA 2GROB 3CHRA 4GA1A 1N11A 3TWRA 3UQ3A 3ZFWA 2MOWA 4ATGA 4AEZC 2V5FA 4KXKB 3TWTA 2ONDA 4EZJA 3IV0A 1KZOA 4A55A 2KCVA 4CDNA 2MHKA 2B6CA 5G2NA 2XGSA 4GMJA 2C0MA 4N2SA 2UY1B 3ZGQA 1QBQA 3TJPA 3MCXA 1BI8B 3UMVA 4MS6A 5FINA 2F37A 1NZNA 1OY3D 5ARGA 4JD2G 2BKKB 1Q2ZA 3IEGA 3HXBA 1IQUA 4HVBA 3RRUA 5CBNA 1INZA 3AAAC 4G8KA 4BWRA 2NXPA 3C3RA 3FTVA 3APDA 2H6HA 3L13A 4ZHBA 1HH8A 1YMPA 5D66A 4DX5D 1SW6A 5JJTA 2XCBA 3PZ3A 2EIME 4RQIA 4GPMA 2YINA 5D0OD 3ZU7B 2QZAA 4TXRA 3D3MA 4IYPA 4J7WA 3FU6A 3FUNA 3G2VA 3CK9A 1TN8A 3EHQA 1E8XA 5FWQA 2F8XK 4U95D 4BTBA 4BY6A 4U8HA 2MRIA 4PS7A 2KXPC 3GZ1A 3O48A 5KWDA 4F1SA 3FP3A 3FDHA 1L5JA 2DZOA 3DSXA 3JUEA 3SFYA 2XS8A 4IN3B 2RFAA 2EQXA 4U04A 5HQ8A 3GZSA 4HOTA 5D2MC 1OCRE 4FA6A 4FC8A 4Q94A 4YDEA 4K5CA 4Q69A 3TAXA 4A1SA 4F1PA 4WAFA 1Y6IA 3OAWA 1WDYA 3RO3A 1OUVA 3LVQE 3RJVA 1IQRA 4B94A 4HB5A 1WAO1 5KCMA 3RAUA 3VTXA 1RW2A 4XX5A 4UQXA 2IJGX 4GTTA 2WPVA 3JXIA 2YHCA 3ZIMA 3E32A 2OOEA 5EYLA 4BFRA 4MRUA 2IO3C 3PEVB 5M72A 2DWZA 4MLPA 1TYQG 4CGWA 1BD8A 3S7JA 2B0OE 5LFAA 3CHPA 3UKRG 4TRQA 2IONA 2LNIA 4UQYA 3MYVA 2QC9A 5HI7A 5LP0A 3LEWA 4GTQA 3L9TA 2J49A 3E33A 4I9CA 3DSWA 3PUJA 2V8SE 2Y4TA 1AP7A 2EINE 4FADA 3MEKA 2WXFA 5JHBA 3OTNA 1EDUA 5CRVA 4FU3A 1JWFA 2LAIA 4YVQC 3Q47B 4C9BB 5KJLA 3FUIA 2WVIA 4XE0A 1A17A 2IY0C 2WXQA 2L6JA 4AXHA 4K03A 4X8QA 5ENRD 2LAHA 1ZU2A 1MX2A 3DSSA 4V3IA 1HFAA 4G24A 4AY5A 3T5XA 2RKKA 2J08A 2ZXWE 5BV0A 2XEHA 3U64A 2JEKA 3S7FA 3U66A 3FU3A 2EILE 5DIZA 3B7TA 3S2AA 3SF4A 1FT2A 4BT9A 4DX7D 1V54E 5BXUA 4FP7A 4LUNU 1KT1A 1D9SA 2C2LA 4NQ0A 3FWVA 2L6BA 3IXEA 5FQ8A 1K8KG 2J9QA 2XGOA 1ELKA 4GTSA 3EU9A 2J4DA 2LXLA 3VLFA 3ZYLA 5C1DA 4OVVA 3ZN3A 2XRYA 2R5SA 4UI9C 4UWKA 3QOUA 4I1OB 3SO8A 1N52A 1MX4A 3QAQA 4CT0A 5FQ4A 4U7EB 2GRRB 2FI7A 4GTMA 3EUVA 5CMWA 3SBSA 3FUFA 2VGXA 2X6IA 1BI7B 4B8CB 3URZA 3NB2A 2V4HC 3ONKA 4F6RD 2FULA 3TWWA 3CIAA 3ESLA 1NP7A 2P9KG 2VSOE 4WWOA 4WNFA 3UM3A 4GTPA 3HHMA 4GZ5A 3CLJA 1UJKA 3RRNB 3F6QA 1FT1A 4B8AA 3PVLA 4HLLA 1MHQA 2P9NG 3B95A 5ENTD 5KBAA 2NSZA 1OXJA 4Z68A 2J8SD 4EECA 2XEEA 3NZSA 3QWVA 3UPVA 4L9PA 5AAOA 3BG0B 2I1KA 1OWOA 4HI8A 3R9AB 2IF4A 3T8KA 3Q78A 3T9KA 2QYUA 4JEHA 3DRAA 5G05J 2VQ2A 3CVLA 4OAUC 3VTYA 3Q5MA 1OT8A 3UI2A 4GZ6A 4AV7A 4CDMA 2VSYA 5C2YA 4B93B 4I1AA 4DRXE 3ASHA 4N3BA 5IY5E 1O1RA 2WXIA 2OEWA 4P29A 4UI9K 2KZTB 2GRPB 3I5PA 3ASFA 3FH8A 2VGEA 5AQ7A 5A6CA 4N39A 5CCMA 3PDNA 2DVWA 1TJCA 2KATA 3KEZA 3FEYA 2WB2A 4J8SA 3X2QE 5A7DB 1IXVA 3FHEA 3JQ0A 2UWJG 5ENSD 3QARA 3UT4A 1PY1A 3G2TA 3APFA 5CECB 1E7UA 5CMYA 2XEVA 2X6KA 3CK8A 4GPKA 2XRZA 4I6GA 3HG0D 1H2VC 2WM9A 3L82A 5HRYA 3IBEA 2F8YA 4FHKA 2WQ6A 4UWHA 1V55E 3AS8A 2VSNA 2XPYA 4F7AA 1ZB1A 3FUDA 4TXPA 2GRQB 4HNAD 4RVBA 5AYWD 3E30A 3V30A 1SZ9A 2X3MA 5G04J 2KCLA 4ACLA 1FCHA 3FUKA 4NIKA 4JZYA 3V79K 1RZ4A 3CR3A 2RG8A 5D0QD 5ANLA 3B7BA 2WXJA 1SA4A 3EHMA 3ESKA 3IHVA 3UT7A 3FU5A 5LX8A 1MX6A 5BXOA 1TNBA 3U4TA 2XPIA 1MYOA 2GW1A 2KC7A 4KYOB 3CVWA 3DSTA 4C0MA 1WY6A 4I6EA 4DX6D 5G55A 2CHZA 3AG1E 2X38A 1LD8A 5FQ6A 3AU4A 4KT6B 1LTXA 4I2WA 3S7DA 2VYIA 3E4BA 5LOZA 4CT4A 3ZUVB 3HVEA 3I4GA 3TG4A 5BNWA 5JHAA 1B89A 4U8VD 3DPDA 3C72A 3QDNA 4IULA 4BX9A 1N4RA 2HR2A 3U3WA 1N0QA 4FHJA 4J8DA 3PZDA 3Q7AA 3QNKA 4YVOA 1K1AA 1H2TC 3BG1B 4I2ZA 5AN8A 2RFMA 3QB2A 4APOA 3ZRHA 1HF8A 4QFVA 3I4RB 4JB8P 1HXIA 2BUGA 3CHSA 2P9SG 2VGXB 3C98A 1LF8A 3CKBA 4CRWA 2I1JA 1NA0A 4L2YA 3RU0A 1YCSB 3HRAA 5ENQD 3NOCD 2CFUA 2FBNA 4E85A 3D9IA 1HZ4A 3CV0A 4H7XA 4HORA 2J4BA 3FTZA 3FUMA 2BTDA 2V0PA 2QY7A 4RG6A 1TEZA 1OCOE 5DBKA 5FZQA 3UIOC 4EPZA 3GW4A 3KAEA 3CVXA 4JA9A 3V2OA 4TXQA 3Q15A 4J8EA 3ZYMA 3UM1A 3G2WA 3ZYKA 3DWLG 4TUUA 4J6IA 4JXTA 3SY2A 3AG4E 5ANRA 5KJKA 4GMRA 3CVPA 2WXRA 2GRLA 3FUEA 3T5VA 1N4PA 3NQPA 1N54A 3HDXA 4AM9A 3ML8A 3CVNA 4Y6WA 2WXNA 4HQDA 2BF0X 1FVFA 1SVXA 4N3CA 2J07A 4CEMA 3LY9A 2XS1A 1A5EA 3AG2E 2M63A 2R17C 4KBQA 3NAWA 3CVYA 4GYWA 2V4LA 4QQIA 5ARFA 4DI4A 3CHMA 1O5MA 2WMOA 2KZTA 1TNZA 3ASDA 2PL2A 1K3ZD 4CGVA 4K5BA 1JCRA 4DI3A 2BEDA 4B89A 4PUCA 1N4QA 1OCCE 4HOQA 2LXMA 5AIJA 3Q73A 4HLEA 3PE3A 1IYGA 4ILHB 4G8LA 2L0IA 4XKBA 4DK5A 4LNGA 4HBDA 3JYSA 1KLXA 3MX3A 2YQ8A 3E37A 3SI5A 3ABLE 4U07A 3MA5A 3MKQB 4LNBA 1E96B 4UWLA 3LDZA 3OXGA 5EYPF 1DNPA 4WNEA 2P9PG 3OXFA 4CYMD 3TWUA 3DBSA 2P58C 1E90A 3SFZA 4HS2A 3LJNA 2QYJA 2P2CP 3CSTA 1N9AA 2OCCE 1TR4A 2IO2C 1JWGA 3MZLB 1DVPA 5T8IA 1FPPA 5CERB 2VGYA 2X6FA 4FLBA 3LVRE 3APCA 3HVEB 5J90A 4AJWA 3IKOB 3UINC 4TV3A 5EN5D 4K5AB 3J5QB 4GYYA 4LNUD 4I17A 4HRLA 5B1BE 4Y6CA 3D9PA 2Y4UA 2ETBA 1H19A 3S7BA 3TWXA 2NYJA 3AG3E 4LG6A 4BT8A 3Q75A 3MJWA 3UTMA 2IQCA 3LS8A 1H6OA 4DX1A 1OWMA 3UX4A 2XPZA 3JXJA 1NA3A 4U63A 2KCKA 3GZ2A 1WG0A 4N2QA 5BV1A 1X81A 1EPUA 5KJNA 1VDYA 3SZ7A 4ANXA 4I6JA 1KT0A 3P1UA 1E8ZA 3PS6A 1HO8A 5BPPA 1QNFA 4TUMA 4JW1A 4KVMA 1OWLA 1LD7A 2GGFA 5A23A 3D9JA 2P9IG 2R02A 4HRNA 1O1SA 4ZFHA 2WXPA 3B7SA 3L17A 2AXVA 3HIZA 4C0EA 2C0LA 4JC8A 1X5BA 2Y0BG 5CCLA 1JCSA 3ZEFA 1H0AA 4XEIG 3D9HA 2FO1E 4L23A 2P9LG 1PC2A 5G05C 4O60A 1TNUA 4G26A 1OWNA 3R9MA 3ZXSA 4A63B 2E2EA 4FJYA 4ABNA 4NACA 4BESA 4WNDA 5JJ7A 3V2XA 4H7YA 4WUYA 4KVOA 3FU0A 4JL0A 2IFUA 2Y69E 1QYMA 4JA7A 4JHJA 5H7PA 5B1AE 3I3NA 3KSQA 4GZ3A 2EIKE 4UUCA 3CVUA 3C3OA 1HU3A 1S64A 4HXIA 1UG3A 4OVUA 2A5UA 2AWIA 2VJ8A 3TWQA 2CHXA 3ULYA 2PQNA 3R7QA 5HKPA 4F3VA 4J0UA 4Q96A 2I2OA 3D9OA 1NI1A 1O1TA 3JQ1A 2R03A 4J8FA 5LCWJ 3ASGA 3EHRA 4JVSA 4C48B 4U0SA 5T4YA 4WNGA 2X6JA 3CKCA 3CHQA 3TWSA 5G04C 3LCAA 3L6AA 4YDYA 2EIJE 3DSUA 4EBAA 2H6IA 2ETCA 3HXFA 2LSVA 2FEZA 4GZDA 4O1OA 3DSVA 4AP2A 3WXXA 2GRMA 4F53A 3R7RA 3CEQA 2YHEA 5AQAA 3D9MA 1ELRA 1HG5A 4GU5A 3CK7A 2X6HA 3N71A 4WWNA 4ILGA 3ZVVA 3Q4AB 1MJ0A 1TNYA 3SQVA 3FTXA 3MKQA 4MBGA 4WWPA 4CCAA 4A3VA 2IU1A 2OV8A 5ENNA 5CEDB 4YNDA 1OCZE 3ZXPA 3ZHEA 2GRNB 4FULA 4GTOA 4UWGA 3HXEA 4GZCA 4JPSA 3EIQC 4N5CA 4XZ4A 4ANUA 2BKGA 4HOUA 4EQFA 2Y3AA 3LPZA 2E0IA 3PH0C 3QWWA 3PNLB 5FTPA 1E8WA 5EILA 2DYRE 2MYOA 1HG2A 1OWPA 1TN6A 4ME2A 3PEUB 3QK0A 2XENA 4GTVA 3FUJA 3L08A 3T8MA 5ENOD 4URKA 2ZGDA 2LO6A 5FT9A 3LY7A 3FUHA 1IHBA 5BUZA 5E76A 5HS0A 2VTBA 2JLBA 3U9WA 3QWPA 1N94A 2ZIRA 1UN9A 2RD0A 2A4ZA 4R7LA 3EU5A 3DXKG 1KZPA 2AVPA 4YDOA 3TGOA 3FTYA 4A1GA 5JA4D 4EHMA 4AVXA 4FJZA 1HE8A 3ONLA 5EX0A 5FIOA 2QFCA 4J8YA 3WG7E 1UW4B 4EZKA 3ASNE 2XZDG 3EHNA 4K0RA 4ILIA 4KMOA 3TL5A 4PH4B 1D8DA 4HI9A 3BUAA 4ANWA 4IRUA 3LJ3A 2VSXE 3QKYA 1DC2A 2AXUA 3EDTB 2KM4A 4I43A 3CQGB 4A3TA 4CDRA 4PDXA 4B0ZA 2ZU6B 3EIJA 4L2LA 2XCCA 3HXDA 3MGBA 3QJZA 3CQCB 3W9FA 4E6HA 1MQSA 4O1PA 2HYZA 4I1MA 1MZCA 2DYSE 1U3DA 2WXHA 3JCKC 5FZRA 4EZLA 2HO1A 3SD5A 3RIBA 2PNNA 3UXGA 4OAVB 2FO7A 3FH7A 3LKUA 1E8YA 4LRZA 1XNFA 3GYZA 4AIFA 1S0PA 4L1BA 5JMND 2F0YA 4RSYA 2IOLA 5KNGA 3ULEG 3ENEA 1UN8A 2ILRA 4OYSA 3KD7A 2XGMA 5ENPD 3ZYQA 4U96D 2XZTG 1H6KA 3BEEA 1NFIE 5CEAA 4G23A 1SZAA 2PQRA 3RK6A 4LSZE 2AJAA 3KS2A 3SHFA 2JABA 3L22A 2IEJA 4XI9A 4GCNA 4UQZA 4U8YD 2A5EA 3ABME 4FLHA 3AS4A 3QC1A 4KZ0A 1D8EA 5FJYA 2AXZA 3RSEG 4XI0A 3NBNB 2WQ7A 3D9LA 4GA0A 3RRMB 1GW6A 3LXUX 1TN7A 3AJIA 3TXMA 5CBOA 4AY6A 3BQOA 3ZHEB 2J09A 5EIDA 3Q49B 4APFA 4JHRA 1YA0A 4RLYA 3VLDA 3NOGD 2WXLA 4HFGA 2WMNA 4N3AA 3SBTB 4JHKA 2WXGA 1Y8MA 5AENA 4KZCA 1H2UA 4BSXA 1BPOA 3FTSA 3PREA 1FVHA 4GAAA 1UOHA 4GA2A 1G3NB 3EJNA 2AW6A 5AJDA 3V31A 2R05A 4HOSA 3D9KA 4UWFA 1ZBPA 4BX8A 3FY4A 3K9IA 3PE4A 3VLEA 4DPRA 4CZ2D 3Q9UC 3FFLA 4GYOA 3G2UA 2OVBA 3HYMB 3FULA 1NL4A 3TG5A 1KPSB 2VTBB 4G1TA 3B13A 1UJJA 4GMLA 1Z6TA 1H6PA 3PZ4A 3TWVA 5BT1A 1Z5SC 2HE0A 3DEOA 4RG9A 5CRUA 3W9GA 3UM2A 4GTRA 3SGHA 3ABKE 4DJAA 3ASOE 4PS3A 3AS5A 1BLXB 2KBXA 3CHOA 1S63A 5BW8C 2FF4A 2Y1LE 1DCQA 2DIWA 3UUXA 5AJLA 1SA5A 5T3RA 2L0TB 2UY1A 1N0RA 3JUIA 2WXKA 3ZKJA 3KEAA 4NRHB 4BSZB 3RO2A 3FTUA 4ATZD 5KJMA 3PNTB 4AOFA 3TXNA 1EF1C 2LSUA 1JCQA 2WQHA 1QZ2A 4W9RA 4I9EA 4LERA 2DBAA 5ITZF 4DLQA 2R2LA 2XQ0A 1W3BA 2LUHA 2ZISA 2NC9A 4O6FA 4BEPA 3LY8A 4LCTA 5KNHD 4UI9J 4G25A 4U0UA 3D9NA 2HM8A 2P9UG 1SQMA 2WXMA 3C5RA 3J5PA 3B7UX 3ULQA 4MKTA 1P5QA 2DCPA 2L9BA 2R59A 2WXOA 4DLOA 5LCWC 4BTAA 2CG3A 3LYAA 3RKVA 4LEUA 4ANVA 3L54A 2I9CA 3MV3B 5FQ7A 3KSLA 5EKQD 4DX2A 3IHYA 3PUKA 5B3SE 3MKRA 4M7CA 3SNXA 3HXCA 1S70B 3O4ZA 1Z3XA 1N4SA 2CFZA 4GB9A 1TNOA 5CHEE 1PAQA 4EBAG 1DCEA 5E75A 3C3QA 2OEVA 5EIBE 4XIFA 3ZW3A 1QQEA 4G11A 5AQ9A 4D10C 1JPLA 3PZ2A 5FZSA 3OXLA 1E7VA 2H6GA 1EYHA 3AU5A 4PS8A 4YDWA 2IOSA 2YNQA 3PRZA 3FEXA 3CVQA 2V5QC 3MV2B 4GCOA 2ETAA 3ZPJA 5EX3A 4XKCA
chains in the Genus database with same CATH topology
3ONLA 4XKBA 5EX0A 4DK5A 2QFCA 4I1OB 3L16A 1UW4B 1N52A 3JYSA 1HX8A 4EZKA 1KLXA 3QAQA 4CT0A 3EHNA 3MX3A 4K0RA 5FQ4A 4ILIA 2PM7A 2YQ8A 2FI7A 4KMOA 1TJFA 3SI5A 5EDSA 4U07A 3ML9A 3TL5A 1U3CA 4JEUA 4PH4B 3MA5A 3MKQB 5CMWA 1HS6A 1E96B 3SBSA 2CG2A 3FUFA 2VGXA 2X6IA 3NF1A 3FH5A 4UWLA 3LDZA 2CHWA 4B8CB 4ANWA 3OXGA 4IRUA 3URZA 3LJ3A 2VSXE 1DNPA 4WNEA 3OXFA 1JUQA 3FTWA 3ONKA 3QKYA 4U0ZA 2FULA 3UT8A 3CIAA 3CSFA 3DBSA 3ESLA 2P58C 1NP7A 2AXUA 1E90A 3EDTB 2Q7FA 2VSOE 4WWOA 4WNFA 3SFZA 2KM4A 4HS2A 4I43A 3HHMA 3CQGB 4GZ5A 4A3TA 3CSTA 4CDRA 3P2BA 5JJ6A 3CLJA 4PDXA 4G2VA 4B0ZA 1UJKA 1XGWA 3RRNB 2ZU6B 3EIJA 4B8AA 3PVLA 1JWGA 4NURA 4L2LA 3MZLB 1MHQA 1DVPA 2PM6A 5T8IA 2XCCA 2NSZA 3MGBA 3CQCB 3QJZA 4E6HA 2VGYA 1MQSA 2X6FA 2HYZA 4FLBA 4EECA 3B7RL 1IHGA 3LVRE 3APCA 3NZSA 1WM5A 3HVEB 3QWVA 4I1MA 3UPVA 5J90A 4AJWA 3CVVA 5J08A 3BG0B 2I1KA 1U3DA 2XHEA 1OWOA 3IKOB 3R9AB 3NZUA 2IF4A 4TV3A 2I6HA 2WXHA 3JCKC 4L7TA 5FZRA 4EZLA 4GYYA 2OVFA 4JEHA 4I17A 1Z3YA 2HO1A 3SD5A 4ACKA 3CGHA 3RIBA 5G05J 1ELWA 2VQ2A 4M3OA 3CVLA 4Y6CA 3VTYA 3Q5MA 2PZIA 2FO7A 3FH7A 3G2SA 1E8YA 3LKUA 1XNFA 3D9PA 4GZ6A 4LRZA 2Y4UA 3CHRA 3GYZA 4GA1A 4AIFA 1H19A 3S7BA 4AV7A 4CDMA 1S0PA 2VSYA 4L1BA 4RSYA 5C2YA 2IOLA 3UQ3A 3ZFWA 4I1AA 4BT8A 2MOWA 3ENEA 3MJWA 1UN8A 4ATGA 4AEZC 2IQCA 3LS8A 2V5FA 4KXKB 3ASHA 2ILRA 2ONDA 4OYSA 4N3BA 4EZJA 2WXIA 3KD7A 3IV0A 4P29A 1OWMA 3UX4A 2XPZA 2XGMA 1NA3A 4A55A 2KCVA 4UI9K 5EX3A 4U63A 2KZTB 3ZYQA 4CDNA 2MHKA 3I5PA 5G2NA 2XGSA 1H6KA 3ASFA 3FH8A 3BEEA 4GMJA 4XKCA 2KCKA 3GZ2A 5A6CA 4N39A 5CCMA 3PDNA 4G23A 1SZAA 2C0MA 4N2SA 2UY1B 3ZGQA 4N2QA 3TJPA 5BV1A 1EPUA 1TJCA 2PQRA 5KJNA 1VDYA 3MCXA 3RK6A 3UMVA 2KATA 3SZ7A 4MS6A 4ANXA 3KS2A 3KEZA 3SHFA 1NZNA 3FEYA 1KT0A 4I6JA 5ARGA 2WB2A 3P1UA 4J8SA 3L22A 4XI9A 5A7DB 3FHEA 4GCNA 3JQ0A 1E8ZA 3PS6A 2UWJG 4UQZA 1HO8A 3QARA 3UT4A 1PY1A 3G2TA 3IEGA 3APFA 5BPPA 1E7UA 1QNFA 5CMYA 4FLHA 3AS4A 3QC1A 4JW1A 4KVMA 1IQUA 1OWLA 4KZ0A 2GGFA 4HVBA 5A23A 2XEVA 5FJYA 2AXZA 3D9JA 3RRUA 2X6KA 4XI0A 1INZA 3CK8A 4GPKA 2WQ7A 2XRZA 4BWRA 4I6GA 1H2VC 2WM9A 3D9LA 4GA0A 2NXPA 3FTVA 2WXPA 3B7SA 3IBEA 3L17A 3APDA 2AXVA 3HIZA 4C0EA 3RRMB 4FHKA 1GW6A 2C0LA 2WQ6A 3L13A 4UWHA 1HH8A 3AS8A 2VSNA 3LXUX 4JC8A 2XPYA 4F7AA 1X5BA 3FUDA 5JJTA 2XCBA 3TXMA 4AY6A 4RVBA 5CCLA 3ZHEB 3ZEFA 1H0AA 2J09A 2YINA 5AYWD 5D0OD 1SZ9A 2X3MA 5G04J 2KCLA 4ACLA 1FCHA 3D3MA 4IYPA 4L23A 3FU6A 3FUKA 3FUNA 1PC2A 3Q49B 4JZYA 5G05C 4APFA 3G2VA 3CR3A 2RG8A 4JHRA 5D0QD 5ANLA 3CK9A 1YA0A 4G26A 1OWNA 3ZXSA 2WXJA 3VLDA 4HFGA 2WXLA 4N3AA 2WMNA 3SBTB 4JHKA 3EHMA 3ESKA 2WXGA 1Y8MA 5AENA 2E2EA 4FJYA 3IHVA 4ABNA 1E8XA 4NACA 3UT7A 4KZCA 3FU5A 5FWQA 1H2UA 4WNDA 4BTBA 5JJ7A 4BY6A 4H7YA 5LX8A 4BSXA 4U8HA 1BPOA 4WUYA 2MRIA 3FTSA 4KVOA 3FU0A 3PREA 1FVHA 4PS7A 3U4TA 4GAAA 2XPIA 3GZ1A 3O48A 2GW1A 4GA2A 2KC7A 4JL0A 4KYOB 3CVWA 4F1SA 4C0MA 1WY6A 3EJNA 3FP3A 2IFUA 3FDHA 4I6EA 5G55A 4JA7A 2AW6A 4JHJA 2CHZA 4HOSA 3D9KA 1L5JA 2X38A 1ZBPA 3I3NA 4GZ3A 4UWFA 3AU4A 5FQ6A 4BX8A 3CVUA 4KT6B 3FY4A 1HU3A 4IN3B 4I2WA 3S7DA 2EQXA 2VYIA 3K9IA 3PE4A 4U04A 3E4BA 3VLEA 4DPRA 5HQ8A 5LOZA 3GZSA 4HXIA 3FFLA 4HOTA 4GYOA 4CT4A 3G2UA 1UG3A 2OVBA 3FULA 3HYMB 4OVUA 2A5UA 2AWIA 3HVEA 3I4GA 2VJ8A 4FA6A 3TG4A 4FC8A 3TG5A 2CHXA 4Q94A 2VTBB 4G1TA 3B13A 1UJJA 4GMLA 5BNWA 5JHAA 4Q69A 2PQNA 3TAXA 1Z6TA 3R7QA 4A1SA 4WAFA 1B89A 4F3VA 4J0UA 5BT1A 1Y6IA 4Q96A 3OAWA 3DPDA 2I2OA 3RO3A 1OUVA 3D9OA 3LVQE 3JQ1A 3QDNA 4IULA 4RG9A 3RJVA 4AVXA 4BX9A 2HR2A 4J8FA 5LCWJ 3ASGA 3U3WA 1IQRA 4B94A 4JVSA 3SGHA 4DJAA 1WAO1 5KCMA 4U0SA 4FHJA 4J8DA 4PS3A 3VTXA 3AS5A 4XX5A 5T4YA 3PZDA 4WNGA 3QNKA 4UQXA 2IJGX 3CHOA 4YVOA 5BW8C 2X6JA 2FF4A 2WPVA 3CKCA 1H2TC 3BG1B 4I2ZA 2DIWA 2YHCA 3CHQA 3ZIMA 5G04C 3QB2A 3LCAA 3L6AA 4APOA 2OOEA 4BFRA 4MRUA 1HF8A 3UUXA 3ZRHA 4QFVA 3I4RB 3PEVB 5AJLA 4EBAA 5M72A 1HXIA 2BUGA 3CHSA 2L0TB 5T3RA 2VGXB 2LSVA 1LF8A 3C98A 2FEZA 2UY1A 4GZDA 3CKBA 4MLPA 3JUIA 4CRWA 2WXKA 2I1JA 1NA0A 4L2YA 4AP2A 4NRHB 4CGWA 3WXXA 3RO2A 3S7JA 5LFAA 3FTUA 3CHPA 2GRMA 3RU0A 5KJMA 4TRQA 3PNTB 2IONA 4F53A 3R7RA 3CEQA 2LNIA 2YHEA 4UQYA 3MYVA 4AOFA 3D9MA 1ELRA 1HG5A 2CFUA 5HI7A 2FBNA 5LP0A 3LEWA 4FJZA 4GU5A 3TXNA 3CK7A 1EF1C 2LSUA 4E85A 2WQHA 2X6HA 1HZ4A 3D9IA 3N71A 4WWNA 2J49A 1QZ2A 4W9RA 4I9CA 4ILGA 3CV0A 4H7XA 4I9EA 4LERA 4HORA 2DBAA 3PUJA 2J4BA 3ZVVA 3FTZA 3FUMA 2V8SE 3Q4AB 4DLQA 2BTDA 2Y4TA 2V0PA 2QY7A 2XQ0A 4RG6A 3MEKA 4FADA 1W3BA 1TEZA 5DBKA 2WXFA 5JHBA 2NC9A 3OTNA 5FZQA 1EDUA 4O6FA 3FTXA 3LY8A 4LCTA 4EPZA 3GW4A 4FU3A 4UI9J 1JWFA 2LAIA 3MKQA 4G25A 3KAEA 4U0UA 4WWPA 4YVQC 3Q47B 4C9BB 3D9NA 2HM8A 4CCAA 4A3VA 2IU1A 2OV8A 5ENNA 5KJLA 3FUIA 4YNDA 1SQMA 3CVXA 2WXMA 4JA9A 3ZHEA 2WVIA 4XE0A 4FULA 1A17A 3B7UX 3Q15A 3ULQA 2WXQA 2L6JA 4AXHA 4K03A 4J8EA 3ZYMA 4UWGA 3G2WA 1P5QA 4MKTA 4GZCA 3ZYKA 2LAHA 1ZU2A 4JPSA 2DCPA 4TUUA 2L9BA 2R59A 4V3IA 1HFAA 2WXOA 3EIQC 4G24A 4N5CA 4DLOA 4XZ4A 4AY5A 5LCWC 3T5XA 4J6IA 4ANUA 4BTAA 2J08A 4HOUA 4JXTA 4EQFA 5BV0A 2CG3A 5ANRA 5KJKA 2Y3AA 3LYAA 3RKVA 3LPZA 2E0IA 3CVPA 2WXRA 2GRLA 4LEUA 3FUEA 3T5VA 3PH0C 4ANVA 3QWWA 3L54A 2I9CA 3NQPA 3PNLB 5FTPA 1E8WA 3MV3B 5FQ7A 1N54A 3HDXA 3U64A 2JEKA 1HG2A 1OWPA 4AM9A 3ML8A 5EKQD 3IHYA 3S7FA 3CVNA 3U66A 3FU3A 4ME2A 5DIZA 3PEUB 4Y6WA 3QK0A 3B7TA 2WXNA 2BF0X 3PUKA 3S2AA 3SF4A 3MKRA 1FVFA 3FUJA 3L08A 3SNXA 4BT9A 4N3CA 2J07A 4CEMA 3LY9A 3O4ZA 1Z3XA 2CFZA 3T8MA 4GB9A 2M63A 2R17C 5CHEE 4URKA 2LO6A 1PAQA 5FT9A 4EBAG 3LY7A 4KBQA 3FUHA 3CVYA 4GYWA 2V4LA 5BUZA 5E76A 4FP7A 4LUNU 1KT1A 5E75A 2VTBA 5ARFA 4DI4A 2C2LA 2JLBA 4XIFA 3ZW3A 3U9WA 3CHMA 1QQEA 2WMOA 2KZTA 3QWPA 4NQ0A 3ASDA 2PL2A 4G11A 4CGVA 3FWVA 1UN9A 5FQ8A 4D10C 1JPLA 5FZSA 4DI3A 2RD0A 3OXLA 1E7VA 2J9QA 2A4ZA 4B89A 4PUCA 2XGOA 1ELKA 4R7LA 4HOQA 5AIJA 2AVPA 3AU5A 1EYHA 2J4DA 4PS8A 4HLEA 3TGOA 2IOSA 2YNQA 3PE3A 3PRZA 3FTYA 3FEXA 3VLFA 3ZYLA 4A1GA 1IYGA 5C1DA 3CVQA 4ILHB 4OVVA 3ZN3A 2XRYA 2R5SA 3MV2B 4GCOA 4UI9C 3ZPJA 4UWKA 3QOUA 5AJDA 1HE8A 2L0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2O A;  1HU3 A;  3L6A A;  1UW4 B;  1N52 A;  1H2U A;  2FUL A;  4C9B B;  4IUL A;  2KZT A;  2HM8 A;  3RK6 A;  2IU1 A;  3D3M A;  1H2V C;  2IOL A;  2VSO E;  4CT4 A;  5ANR A;  1UG3 A;  4B89 A;  3FEY A;  4CEM A;  2RG8 A;  3JUI A;  4CRW A;  2ZU6 B;  3EIJ A;  4B8A A;  4GML A;  4JHJ A;  2IOS A;  3FEX A;  1N54 A;  2KZT B;  1PAQ A;  2NSZ A;  4JHK A;  4B8C B;  1H2T C;  1H6K A;  4GMJ A;  2ION A;  2GGF A;  2VSX E;  4LUN U;  3EIQ C; 
#chains in the Genus database with same CATH topology
 2H6F A;  3L16 A;  1HX8 A;  3DPY A;  1K1B A;  2PM7 A;  1TJF A;  3DEP A;  2DZN A;  5EDS A;  3ML9 A;  4DUI A;  1U3C A;  4JEU A;  4BET A;  1HS6 A;  2CG2 A;  3NF1 A;  1N95 A;  3FH5 A;  5AQB A;  1BU9 A;  2CHW A;  1JUQ A;  3FTW A;  1U2V G;  4U0Z A;  5AAR A;  3UT8 A;  3CSF A;  2Q7F A;  3UKU G;  3Q7F A;  3P2B A;  5JJ6 A;  1AWC B;  4G2V A;  1XGW A;  4NUR A;  2PM6 A;  3UIP C;  3B7R L;  1IHG A;  3BU8 A;  3SFX A;  1WM5 A;  3ZNG A;  5J08 A;  3CVV A;  2XHE A;  3ISM C;  3PZ1 A;  3NZU A;  3Q9N C;  3E34 A;  2I6H A;  4L7T A;  2OVF A;  1Z3Y A;  4ACK A;  3CGH A;  3Q79 A;  4N5Q A;  4BER A;  1YYH A;  2ZGG A;  1ELW A;  3DXM G;  4HRM B;  4M3O A;  1IKN D;  2PZI A;  3UM0 A;  3G2S A;  2GRO B;  3CHR A;  4GA1 A;  1N11 A;  3TWR A;  3UQ3 A;  3ZFW A;  2MOW A;  4ATG A;  4AEZ C;  2V5F A;  4KXK B;  3TWT A;  2OND A;  4EZJ A;  3IV0 A;  1KZO A;  4A55 A;  2KCV A;  4CDN A;  2MHK A;  2B6C A;  5G2N A;  2XGS A;  4GMJ A;  2C0M A;  4N2S A;  2UY1 B;  3ZGQ A;  1QBQ A;  3TJP A;  3MCX A;  1BI8 B;  3UMV A;  4MS6 A;  5FIN A;  2F37 A;  1NZN A;  1OY3 D;  5ARG A;  4JD2 G;  2BKK B;  1Q2Z A;  3IEG A;  3HXB A;  1IQU A;  4HVB A;  3RRU A;  5CBN A;  1INZ A;  3AAA C;  4G8K A;  4BWR A;  2NXP A;  3C3R A;  3FTV A;  3APD A;  2H6H A;  3L13 A;  4ZHB A;  1HH8 A;  1YMP A;  5D66 A;  4DX5 D;  1SW6 A;  5JJT A;  2XCB A;  3PZ3 A;  2EIM E;  4RQI A;  4GPM A;  2YIN A;  5D0O D;  3ZU7 B;  2QZA A;  4TXR A;  3D3M A;  4IYP A;  4J7W A;  3FU6 A;  3FUN A;  3G2V A;  3CK9 A;  1TN8 A;  3EHQ A;  1E8X A;  5FWQ A;  2F8X K;  4U95 D;  4BTB A;  4BY6 A;  4U8H A;  2MRI A;  4PS7 A;  2KXP C;  3GZ1 A;  3O48 A;  5KWD A;  4F1S A;  3FP3 A;  3FDH A;  1L5J A;  2DZO A;  3DSX A;  3JUE A;  3SFY A;  2XS8 A;  4IN3 B;  2RFA A;  2EQX A;  4U04 A;  5HQ8 A;  3GZS A;  4HOT A;  5D2M C;  1OCR E;  4FA6 A;  4FC8 A;  4Q94 A;  4YDE A;  4K5C A;  4Q69 A;  3TAX A;  4A1S A;  4F1P A;  4WAF A;  1Y6I A;  3OAW A;  1WDY A;  3RO3 A;  1OUV A;  3LVQ E;  3RJV A;  1IQR A;  4B94 A;  4HB5 A;  1WAO 1;  5KCM A;  3RAU A;  3VTX A;  1RW2 A;  4XX5 A;  4UQX A;  2IJG X;  4GTT A;  2WPV A;  3JXI A;  2YHC A;  3ZIM A;  3E32 A;  2OOE A;  5EYL A;  4BFR A;  4MRU A;  2IO3 C;  3PEV B;  5M72 A;  2DWZ A;  4MLP A;  1TYQ G;  4CGW A;  1BD8 A;  3S7J A;  2B0O E;  5LFA A;  3CHP A;  3UKR G;  4TRQ A;  2ION A;  2LNI A;  4UQY A;  3MYV A;  2QC9 A;  5HI7 A;  5LP0 A;  3LEW A;  4GTQ A;  3L9T A;  2J49 A;  3E33 A;  4I9C A;  3DSW A;  3PUJ A;  2V8S E;  2Y4T A;  1AP7 A;  2EIN E;  4FAD A;  3MEK A;  2WXF A;  5JHB A;  3OTN A;  1EDU A;  5CRV A;  4FU3 A;  1JWF A;  2LAI A;  4YVQ C;  3Q47 B;  4C9B B;  5KJL A;  3FUI A;  2WVI A;  4XE0 A;  1A17 A;  2IY0 C;  2WXQ A;  2L6J A;  4AXH A;  4K03 A;  4X8Q A;  5ENR D;  2LAH A;  1ZU2 A;  1MX2 A;  3DSS A;  4V3I A;  1HFA A;  4G24 A;  4AY5 A;  3T5X A;  2RKK A;  2J08 A;  2ZXW E;  5BV0 A;  2XEH A;  3U64 A;  2JEK A;  3S7F A;  3U66 A;  3FU3 A;  2EIL E;  5DIZ A;  3B7T A;  3S2A A;  3SF4 A;  1FT2 A;  4BT9 A;  4DX7 D;  1V54 E;  5BXU A;  4FP7 A;  4LUN U;  1KT1 A;  1D9S A;  2C2L A;  4NQ0 A;  3FWV A;  2L6B A;  3IXE A;  5FQ8 A;  1K8K G;  2J9Q A;  2XGO A;  1ELK A;  4GTS A;  3EU9 A;  2J4D A;  2LXL A;  3VLF A;  3ZYL A;  5C1D A;  4OVV A;  3ZN3 A;  2XRY A;  2R5S A;  4UI9 C;  4UWK A;  3QOU A;  4I1O B;  3SO8 A;  1N52 A;  1MX4 A;  3QAQ A;  4CT0 A;  5FQ4 A;  4U7E B;  2GRR B;  2FI7 A;  4GTM A;  3EUV A;  5CMW A;  3SBS A;  3FUF A;  2VGX A;  2X6I A;  1BI7 B;  4B8C B;  3URZ A;  3NB2 A;  2V4H C;  3ONK A;  4F6R D;  2FUL A;  3TWW A;  3CIA A;  3ESL A;  1NP7 A;  2P9K G;  2VSO E;  4WWO A;  4WNF A;  3UM3 A;  4GTP A;  3HHM A;  4GZ5 A;  3CLJ A;  1UJK A;  3RRN B;  3F6Q A;  1FT1 A;  4B8A A;  3PVL A;  4HLL A;  1MHQ A;  2P9N G;  3B95 A;  5ENT D;  5KBA A;  2NSZ A;  1OXJ A;  4Z68 A;  2J8S D;  4EEC A;  2XEE A;  3NZS A;  3QWV A;  3UPV A;  4L9P A;  5AAO A;  3BG0 B;  2I1K A;  1OWO A;  4HI8 A;  3R9A B;  2IF4 A;  3T8K A;  3Q78 A;  3T9K A;  2QYU A;  4JEH A;  3DRA A;  5G05 J;  2VQ2 A;  3CVL A;  4OAU C;  3VTY A;  3Q5M A;  1OT8 A;  3UI2 A;  4GZ6 A;  4AV7 A;  4CDM A;  2VSY A;  5C2Y A;  4B93 B;  4I1A A;  4DRX E;  3ASH A;  4N3B A;  5IY5 E;  1O1R A;  2WXI A;  2OEW A;  4P29 A;  4UI9 K;  2KZT B;  2GRP B;  3I5P A;  3ASF A;  3FH8 A;  2VGE A;  5AQ7 A;  5A6C A;  4N39 A;  5CCM A;  3PDN A;  2DVW A;  1TJC A;  2KAT A;  3KEZ A;  3FEY A;  2WB2 A;  4J8S A;  3X2Q E;  5A7D B;  1IXV A;  3FHE A;  3JQ0 A;  2UWJ G;  5ENS D;  3QAR A;  3UT4 A;  1PY1 A;  3G2T A;  3APF A;  5CEC B;  1E7U A;  5CMY A;  2XEV A;  2X6K A;  3CK8 A;  4GPK A;  2XRZ A;  4I6G A;  3HG0 D;  1H2V C;  2WM9 A;  3L82 A;  5HRY A;  3IBE A;  2F8Y A;  4FHK A;  2WQ6 A;  4UWH A;  1V55 E;  3AS8 A;  2VSN A;  2XPY A;  4F7A A;  1ZB1 A;  3FUD A;  4TXP A;  2GRQ B;  4HNA D;  4RVB A;  5AYW D;  3E30 A;  3V30 A;  1SZ9 A;  2X3M A;  5G04 J;  2KCL A;  4ACL A;  1FCH A;  3FUK A;  4NIK A;  4JZY A;  3V79 K;  1RZ4 A;  3CR3 A;  2RG8 A;  5D0Q D;  5ANL A;  3B7B A;  2WXJ A;  1SA4 A;  3EHM A;  3ESK A;  3IHV A;  3UT7 A;  3FU5 A;  5LX8 A;  1MX6 A;  5BXO A;  1TNB A;  3U4T A;  2XPI A;  1MYO A;  2GW1 A;  2KC7 A;  4KYO B;  3CVW A;  3DST A;  4C0M A;  1WY6 A;  4I6E A;  4DX6 D;  5G55 A;  2CHZ A;  3AG1 E;  2X38 A;  1LD8 A;  5FQ6 A;  3AU4 A;  4KT6 B;  1LTX A;  4I2W A;  3S7D A;  2VYI A;  3E4B A;  5LOZ A;  4CT4 A;  3ZUV B;  3HVE A;  3I4G A;  3TG4 A;  5BNW A;  5JHA A;  1B89 A;  4U8V D;  3DPD A;  3C72 A;  3QDN A;  4IUL A;  4BX9 A;  1N4R A;  2HR2 A;  3U3W A;  1N0Q A;  4FHJ A;  4J8D A;  3PZD A;  3Q7A A;  3QNK A;  4YVO A;  1K1A A;  1H2T C;  3BG1 B;  4I2Z A;  5AN8 A;  2RFM A;  3QB2 A;  4APO A;  3ZRH A;  1HF8 A;  4QFV A;  3I4R B;  4JB8 P;  1HXI A;  2BUG A;  3CHS A;  2P9S G;  2VGX B;  3C98 A;  1LF8 A;  3CKB A;  4CRW A;  2I1J A;  1NA0 A;  4L2Y A;  3RU0 A;  1YCS B;  3HRA A;  5ENQ D;  3NOC D;  2CFU A;  2FBN A;  4E85 A;  3D9I A;  1HZ4 A;  3CV0 A;  4H7X A;  4HOR A;  2J4B A;  3FTZ A;  3FUM A;  2BTD A;  2V0P A;  2QY7 A;  4RG6 A;  1TEZ A;  1OCO E;  5DBK A;  5FZQ A;  3UIO C;  4EPZ A;  3GW4 A;  3KAE A;  3CVX A;  4JA9 A;  3V2O A;  4TXQ A;  3Q15 A;  4J8E A;  3ZYM A;  3UM1 A;  3G2W A;  3ZYK A;  3DWL G;  4TUU A;  4J6I A;  4JXT A;  3SY2 A;  3AG4 E;  5ANR A;  5KJK A;  4GMR A;  3CVP A;  2WXR A;  2GRL A;  3FUE A;  3T5V A;  1N4P A;  3NQP A;  1N54 A;  3HDX A;  4AM9 A;  3ML8 A;  3CVN A;  4Y6W A;  2WXN A;  4HQD A;  2BF0 X;  1FVF A;  1SVX A;  4N3C A;  2J07 A;  4CEM A;  3LY9 A;  2XS1 A;  1A5E A;  3AG2 E;  2M63 A;  2R17 C;  4KBQ A;  3NAW A;  3CVY A;  4GYW A;  2V4L A;  4QQI A;  5ARF A;  4DI4 A;  3CHM A;  1O5M A;  2WMO A;  2KZT A;  1TNZ A;  3ASD A;  2PL2 A;  1K3Z D;  4CGV A;  4K5B A;  1JCR A;  4DI3 A;  2BED A;  4B89 A;  4PUC A;  1N4Q A;  1OCC E;  4HOQ A;  2LXM A;  5AIJ A;  3Q73 A;  4HLE A;  3PE3 A;  1IYG A;  4ILH B;  4G8L A;  2L0I A;  4XKB A;  4DK5 A;  4LNG A;  4HBD A;  3JYS A;  1KLX A;  3MX3 A;  2YQ8 A;  3E37 A;  3SI5 A;  3ABL E;  4U07 A;  3MA5 A;  3MKQ B;  4LNB A;  1E96 B;  4UWL A;  3LDZ A;  3OXG A;  5EYP F;  1DNP A;  4WNE A;  2P9P G;  3OXF A;  4CYM D;  3TWU A;  3DBS A;  2P58 C;  1E90 A;  3SFZ A;  4HS2 A;  3LJN A;  2QYJ A;  2P2C P;  3CST A;  1N9A A;  2OCC E;  1TR4 A;  2IO2 C;  1JWG A;  3MZL B;  1DVP A;  5T8I A;  1FPP A;  5CER B;  2VGY A;  2X6F A;  4FLB A;  3LVR E;  3APC A;  3HVE B;  5J90 A;  4AJW A;  3IKO B;  3UIN C;  4TV3 A;  5EN5 D;  4K5A B;  3J5Q B;  4GYY A;  4LNU D;  4I17 A;  4HRL A;  5B1B E;  4Y6C A;  3D9P A;  2Y4U A;  2ETB A;  1H19 A;  3S7B A;  3TWX A;  2NYJ A;  3AG3 E;  4LG6 A;  4BT8 A;  3Q75 A;  3MJW A;  3UTM A;  2IQC A;  3LS8 A;  1H6O A;  4DX1 A;  1OWM A;  3UX4 A;  2XPZ A;  3JXJ A;  1NA3 A;  4U63 A;  2KCK A;  3GZ2 A;  1WG0 A;  4N2Q A;  5BV1 A;  1X81 A;  1EPU A;  5KJN A;  1VDY A;  3SZ7 A;  4ANX A;  4I6J A;  1KT0 A;  3P1U A;  1E8Z A;  3PS6 A;  1HO8 A;  5BPP A;  1QNF A;  4TUM A;  4JW1 A;  4KVM A;  1OWL A;  1LD7 A;  2GGF A;  5A23 A;  3D9J A;  2P9I G;  2R02 A;  4HRN A;  1O1S A;  4ZFH A;  2WXP A;  3B7S A;  3L17 A;  2AXV A;  3HIZ A;  4C0E A;  2C0L A;  4JC8 A;  1X5B A;  2Y0B G;  5CCL A;  1JCS A;  3ZEF A;  1H0A A;  4XEI G;  3D9H A;  2FO1 E;  4L23 A;  2P9L G;  1PC2 A;  5G05 C;  4O60 A;  1TNU A;  4G26 A;  1OWN A;  3R9M A;  3ZXS A;  4A63 B;  2E2E A;  4FJY A;  4ABN A;  4NAC A;  4BES A;  4WND A;  5JJ7 A;  3V2X A;  4H7Y A;  4WUY A;  4KVO A;  3FU0 A;  4JL0 A;  2IFU A;  2Y69 E;  1QYM A;  4JA7 A;  4JHJ A;  5H7P A;  5B1A E;  3I3N A;  3KSQ A;  4GZ3 A;  2EIK E;  4UUC A;  3CVU A;  3C3O A;  1HU3 A;  1S64 A;  4HXI A;  1UG3 A;  4OVU A;  2A5U A;  2AWI A;  2VJ8 A;  3TWQ A;  2CHX A;  3ULY A;  2PQN A;  3R7Q A;  5HKP A;  4F3V A;  4J0U A;  4Q96 A;  2I2O A;  3D9O A;  1NI1 A;  1O1T A;  3JQ1 A;  2R03 A;  4J8F A;  5LCW J;  3ASG A;  3EHR A;  4JVS A;  4C48 B;  4U0S A;  5T4Y A;  4WNG A;  2X6J A;  3CKC A;  3CHQ A;  3TWS A;  5G04 C;  3LCA A;  3L6A A;  4YDY A;  2EIJ E;  3DSU A;  4EBA A;  2H6I A;  2ETC A;  3HXF A;  2LSV A;  2FEZ A;  4GZD A;  4O1O A;  3DSV A;  4AP2 A;  3WXX A;  2GRM A;  4F53 A;  3R7R A;  3CEQ A;  2YHE A;  5AQA A;  3D9M A;  1ELR A;  1HG5 A;  4GU5 A;  3CK7 A;  2X6H A;  3N71 A;  4WWN A;  4ILG A;  3ZVV A;  3Q4A B;  1MJ0 A;  1TNY A;  3SQV A;  3FTX A;  3MKQ A;  4MBG A;  4WWP A;  4CCA A;  4A3V A;  2IU1 A;  2OV8 A;  5ENN A;  5CED B;  4YND A;  1OCZ E;  3ZXP A;  3ZHE A;  2GRN B;  4FUL A;  4GTO A;  4UWG A;  3HXE A;  4GZC A;  4JPS A;  3EIQ C;  4N5C A;  4XZ4 A;  4ANU A;  2BKG A;  4HOU A;  4EQF A;  2Y3A A;  3LPZ A;  2E0I A;  3PH0 C;  3QWW A;  3PNL B;  5FTP A;  1E8W A;  5EIL A;  2DYR E;  2MYO A;  1HG2 A;  1OWP A;  1TN6 A;  4ME2 A;  3PEU B;  3QK0 A;  2XEN A;  4GTV A;  3FUJ A;  3L08 A;  3T8M A;  5ENO D;  4URK A;  2ZGD A;  2LO6 A;  5FT9 A;  3LY7 A;  3FUH A;  1IHB A;  5BUZ A;  5E76 A;  5HS0 A;  2VTB A;  2JLB A;  3U9W A;  3QWP A;  1N94 A;  2ZIR A;  1UN9 A;  2RD0 A;  2A4Z A;  4R7L A;  3EU5 A;  3DXK G;  1KZP A;  2AVP A;  4YDO A;  3TGO A;  3FTY A;  4A1G A;  5JA4 D;  4EHM A;  4AVX A;  4FJZ A;  1HE8 A;  3ONL A;  5EX0 A;  5FIO A;  2QFC A;  4J8Y A;  3WG7 E;  1UW4 B;  4EZK A;  3ASN E;  2XZD G;  3EHN A;  4K0R A;  4ILI A;  4KMO A;  3TL5 A;  4PH4 B;  1D8D A;  4HI9 A;  3BUA A;  4ANW A;  4IRU A;  3LJ3 A;  2VSX E;  3QKY A;  1DC2 A;  2AXU A;  3EDT B;  2KM4 A;  4I43 A;  3CQG B;  4A3T A;  4CDR A;  4PDX A;  4B0Z A;  2ZU6 B;  3EIJ A;  4L2L A;  2XCC A;  3HXD A;  3MGB A;  3QJZ A;  3CQC B;  3W9F A;  4E6H A;  1MQS A;  4O1P A;  2HYZ A;  4I1M A;  1MZC A;  2DYS E;  1U3D A;  2WXH A;  3JCK C;  5FZR A;  4EZL A;  2HO1 A;  3SD5 A;  3RIB A;  2PNN A;  3UXG A;  4OAV B;  2FO7 A;  3FH7 A;  3LKU A;  1E8Y A;  4LRZ A;  1XNF A;  3GYZ A;  4AIF A;  1S0P A;  4L1B A;  5JMN D;  2F0Y A;  4RSY A;  2IOL A;  5KNG A;  3ULE G;  3ENE A;  1UN8 A;  2ILR A;  4OYS A;  3KD7 A;  2XGM A;  5ENP D;  3ZYQ A;  4U96 D;  2XZT G;  1H6K A;  3BEE A;  1NFI E;  5CEA A;  4G23 A;  1SZA A;  2PQR A;  3RK6 A;  4LSZ E;  2AJA A;  3KS2 A;  3SHF A;  2JAB A;  3L22 A;  2IEJ A;  4XI9 A;  4GCN A;  4UQZ A;  4U8Y D;  2A5E A;  3ABM E;  4FLH A;  3AS4 A;  3QC1 A;  4KZ0 A;  1D8E A;  5FJY A;  2AXZ A;  3RSE G;  4XI0 A;  3NBN B;  2WQ7 A;  3D9L A;  4GA0 A;  3RRM B;  1GW6 A;  3LXU X;  1TN7 A;  3AJI A;  3TXM A;  5CBO A;  4AY6 A;  3BQO A;  3ZHE B;  2J09 A;  5EID A;  3Q49 B;  4APF A;  4JHR A;  1YA0 A;  4RLY A;  3VLD A;  3NOG D;  2WXL A;  4HFG A;  2WMN A;  4N3A A;  3SBT B;  4JHK A;  2WXG A;  1Y8M A;  5AEN A;  4KZC A;  1H2U A;  4BSX A;  1BPO A;  3FTS A;  3PRE A;  1FVH A;  4GAA A;  1UOH A;  4GA2 A;  1G3N B;  3EJN A;  2AW6 A;  5AJD A;  3V31 A;  2R05 A;  4HOS A;  3D9K A;  4UWF A;  1ZBP A;  4BX8 A;  3FY4 A;  3K9I A;  3PE4 A;  3VLE A;  4DPR A;  4CZ2 D;  3Q9U C;  3FFL A;  4GYO A;  3G2U A;  2OVB A;  3HYM B;  3FUL A;  1NL4 A;  3TG5 A;  1KPS B;  2VTB B;  4G1T A;  3B13 A;  1UJJ A;  4GML A;  1Z6T A;  1H6P A;  3PZ4 A;  3TWV A;  5BT1 A;  1Z5S C;  2HE0 A;  3DEO A;  4RG9 A;  5CRU A;  3W9G A;  3UM2 A;  4GTR A;  3SGH A;  3ABK E;  4DJA A;  3ASO E;  4PS3 A;  3AS5 A;  1BLX B;  2KBX A;  3CHO A;  1S63 A;  5BW8 C;  2FF4 A;  2Y1L E;  1DCQ A;  2DIW A;  3UUX A;  5AJL A;  1SA5 A;  5T3R A;  2L0T B;  2UY1 A;  1N0R A;  3JUI A;  2WXK A;  3ZKJ A;  3KEA A;  4NRH B;  4BSZ B;  3RO2 A;  3FTU A;  4ATZ D;  5KJM A;  3PNT B;  4AOF A;  3TXN A;  1EF1 C;  2LSU A;  1JCQ A;  2WQH A;  1QZ2 A;  4W9R A;  4I9E A;  4LER A;  2DBA A;  5ITZ F;  4DLQ A;  2R2L A;  2XQ0 A;  1W3B A;  2LUH A;  2ZIS A;  2NC9 A;  4O6F A;  4BEP A;  3LY8 A;  4LCT A;  5KNH D;  4UI9 J;  4G25 A;  4U0U A;  3D9N A;  2HM8 A;  2P9U G;  1SQM A;  2WXM A;  3C5R A;  3J5P A;  3B7U X;  3ULQ A;  4MKT A;  1P5Q A;  2DCP A;  2L9B A;  2R59 A;  2WXO A;  4DLO A;  5LCW C;  4BTA A;  2CG3 A;  3LYA A;  3RKV A;  4LEU A;  4ANV A;  3L54 A;  2I9C A;  3MV3 B;  5FQ7 A;  3KSL A;  5EKQ D;  4DX2 A;  3IHY A;  3PUK A;  5B3S E;  3MKR A;  4M7C A;  3SNX A;  3HXC A;  1S70 B;  3O4Z A;  1Z3X A;  1N4S A;  2CFZ A;  4GB9 A;  1TNO A;  5CHE E;  1PAQ A;  4EBA G;  1DCE A;  5E75 A;  3C3Q A;  2OEV A;  5EIB E;  4XIF A;  3ZW3 A;  1QQE A;  4G11 A;  5AQ9 A;  4D10 C;  1JPL A;  3PZ2 A;  5FZS A;  3OXL A;  1E7V A;  2H6G A;  1EYH A;  3AU5 A;  4PS8 A;  4YDW A;  2IOS A;  2YNQ A;  3PRZ A;  3FEX A;  3CVQ A;  2V5Q C;  3MV2 B;  4GCO A;  2ETA A;  3ZPJ A;  5EX3 A;  4XKC A; 
#chains in the Genus database with same CATH homology
 3ONL A;  4XKB A;  5EX0 A;  4DK5 A;  2QFC A;  4I1O B;  3L16 A;  1UW4 B;  1N52 A;  3JYS A;  1HX8 A;  4EZK A;  1KLX A;  3QAQ A;  4CT0 A;  3EHN A;  3MX3 A;  4K0R A;  5FQ4 A;  4ILI A;  2PM7 A;  2YQ8 A;  2FI7 A;  4KMO A;  1TJF A;  3SI5 A;  5EDS A;  4U07 A;  3ML9 A;  3TL5 A;  1U3C A;  4JEU A;  4PH4 B;  3MA5 A;  3MKQ B;  5CMW A;  1HS6 A;  1E96 B;  3SBS A;  2CG2 A;  3FUF A;  2VGX A;  2X6I A;  3NF1 A;  3FH5 A;  4UWL A;  3LDZ A;  2CHW A;  4B8C B;  4ANW A;  3OXG A;  4IRU A;  3URZ A;  3LJ3 A;  2VSX E;  1DNP A;  4WNE A;  3OXF A;  1JUQ A;  3FTW A;  3ONK A;  3QKY A;  4U0Z A;  2FUL A;  3UT8 A;  3CIA A;  3CSF A;  3DBS A;  3ESL A;  2P58 C;  1NP7 A;  2AXU A;  1E90 A;  3EDT B;  2Q7F A;  2VSO E;  4WWO A;  4WNF A;  3SFZ A;  2KM4 A;  4HS2 A;  4I43 A;  3HHM A;  3CQG B;  4GZ5 A;  4A3T A;  3CST A;  4CDR A;  3P2B A;  5JJ6 A;  3CLJ A;  4PDX A;  4G2V A;  4B0Z A;  1UJK A;  1XGW A;  3RRN B;  2ZU6 B;  3EIJ A;  4B8A A;  3PVL A;  1JWG A;  4NUR A;  4L2L A;  3MZL B;  1MHQ A;  1DVP A;  2PM6 A;  5T8I A;  2XCC A;  2NSZ A;  3MGB A;  3CQC B;  3QJZ A;  4E6H A;  2VGY A;  1MQS A;  2X6F A;  2HYZ A;  4FLB A;  4EEC A;  3B7R L;  1IHG A;  3LVR E;  3APC A;  3NZS A;  1WM5 A;  3HVE B;  3QWV A;  4I1M A;  3UPV A;  5J90 A;  4AJW A;  3CVV A;  5J08 A;  3BG0 B;  2I1K A;  1U3D A;  2XHE A;  1OWO A;  3IKO B;  3R9A B;  3NZU A;  2IF4 A;  4TV3 A;  2I6H A;  2WXH A;  3JCK C;  4L7T A;  5FZR A;  4EZL A;  4GYY A;  2OVF A;  4JEH A;  4I17 A;  1Z3Y A;  2HO1 A;  3SD5 A;  4ACK A;  3CGH A;  3RIB A;  5G05 J;  1ELW A;  2VQ2 A;  4M3O A;  3CVL A;  4Y6C A;  3VTY A;  3Q5M A;  2PZI A;  2FO7 A;  3FH7 A;  3G2S A;  1E8Y A;  3LKU A;  1XNF A;  3D9P A;  4GZ6 A;  4LRZ A;  2Y4U A;  3CHR A;  3GYZ A;  4GA1 A;  4AIF A;  1H19 A;  3S7B A;  4AV7 A;  4CDM A;  1S0P A;  2VSY A;  4L1B A;  4RSY A;  5C2Y A;  2IOL A;  3UQ3 A;  3ZFW A;  4I1A A;  4BT8 A;  2MOW A;  3ENE A;  3MJW A;  1UN8 A;  4ATG A;  4AEZ C;  2IQC A;  3LS8 A;  2V5F A;  4KXK B;  3ASH A;  2ILR A;  2OND A;  4OYS A;  4N3B A;  4EZJ A;  2WXI A;  3KD7 A;  3IV0 A;  4P29 A;  1OWM A;  3UX4 A;  2XPZ A;  2XGM A;  1NA3 A;  4A55 A;  2KCV A;  4UI9 K;  5EX3 A;  4U63 A;  2KZT B;  3ZYQ A;  4CDN A;  2MHK A;  3I5P A;  5G2N A;  2XGS A;  1H6K A;  3ASF A;  3FH8 A;  3BEE A;  4GMJ A;  4XKC A;  2KCK A;  3GZ2 A;  5A6C A;  4N39 A;  5CCM A;  3PDN A;  4G23 A;  1SZA A;  2C0M A;  4N2S A;  2UY1 B;  3ZGQ A;  4N2Q A;  3TJP A;  5BV1 A;  1EPU A;  1TJC A;  2PQR A;  5KJN A;  1VDY A;  3MCX A;  3RK6 A;  3UMV A;  2KAT A;  3SZ7 A;  4MS6 A;  4ANX A;  3KS2 A;  3KEZ A;  3SHF A;  1NZN A;  3FEY A;  1KT0 A;  4I6J A;  5ARG A;  2WB2 A;  3P1U A;  4J8S A;  3L22 A;  4XI9 A;  5A7D B;  3FHE A;  4GCN A;  3JQ0 A;  1E8Z A;  3PS6 A;  2UWJ G;  4UQZ A;  1HO8 A;  3QAR A;  3UT4 A;  1PY1 A;  3G2T A;  3IEG A;  3APF A;  5BPP A;  1E7U A;  1QNF A;  5CMY A;  4FLH A;  3AS4 A;  3QC1 A;  4JW1 A;  4KVM A;  1IQU A;  1OWL A;  4KZ0 A;  2GGF A;  4HVB A;  5A23 A;  2XEV A;  5FJY A;  2AXZ A;  3D9J A;  3RRU A;  2X6K A;  4XI0 A;  1INZ A;  3CK8 A;  4GPK A;  2WQ7 A;  2XRZ A;  4BWR A;  4I6G A;  1H2V C;  2WM9 A;  3D9L A;  4GA0 A;  2NXP A;  3FTV A;  2WXP A;  3B7S A;  3IBE A;  3L17 A;  3APD A;  2AXV A;  3HIZ A;  4C0E A;  3RRM B;  4FHK A;  1GW6 A;  2C0L A;  2WQ6 A;  3L13 A;  4UWH A;  1HH8 A;  3AS8 A;  2VSN A;  3LXU X;  4JC8 A;  2XPY A;  4F7A A;  1X5B A;  3FUD A;  5JJT A;  2XCB A;  3TXM A;  4AY6 A;  4RVB A;  5CCL A;  3ZHE B;  3ZEF A;  1H0A A;  2J09 A;  2YIN A;  5AYW D;  5D0O D;  1SZ9 A;  2X3M A;  5G04 J;  2KCL A;  4ACL A;  1FCH A;  3D3M A;  4IYP A;  4L23 A;  3FU6 A;  3FUK A;  3FUN A;  1PC2 A;  3Q49 B;  4JZY A;  5G05 C;  4APF A;  3G2V A;  3CR3 A;  2RG8 A;  4JHR A;  5D0Q D;  5ANL A;  3CK9 A;  1YA0 A;  4G26 A;  1OWN A;  3ZXS A;  2WXJ A;  3VLD A;  4HFG A;  2WXL A;  4N3A A;  2WMN A;  3SBT B;  4JHK A;  3EHM A;  3ESK A;  2WXG A;  1Y8M A;  5AEN A;  2E2E A;  4FJY A;  3IHV A;  4ABN A;  1E8X A;  4NAC A;  3UT7 A;  4KZC A;  3FU5 A;  5FWQ A;  1H2U A;  4WND A;  4BTB A;  5JJ7 A;  4BY6 A;  4H7Y A;  5LX8 A;  4BSX A;  4U8H A;  1BPO A;  4WUY A;  2MRI A;  3FTS A;  4KVO A;  3FU0 A;  3PRE A;  1FVH A;  4PS7 A;  3U4T A;  4GAA A;  2XPI A;  3GZ1 A;  3O48 A;  2GW1 A;  4GA2 A;  2KC7 A;  4JL0 A;  4KYO B;  3CVW A;  4F1S A;  4C0M A;  1WY6 A;  3EJN A;  3FP3 A;  2IFU A;  3FDH A;  4I6E A;  5G55 A;  4JA7 A;  2AW6 A;  4JHJ A;  2CHZ A;  4HOS A;  3D9K A;  1L5J A;  2X38 A;  1ZBP A;  3I3N A;  4GZ3 A;  4UWF A;  3AU4 A;  5FQ6 A;  4BX8 A;  3CVU A;  4KT6 B;  3FY4 A;  1HU3 A;  4IN3 B;  4I2W A;  3S7D A;  2EQX A;  2VYI A;  3K9I A;  3PE4 A;  4U04 A;  3E4B A;  3VLE A;  4DPR A;  5HQ8 A;  5LOZ A;  3GZS A;  4HXI A;  3FFL A;  4HOT A;  4GYO A;  4CT4 A;  3G2U A;  1UG3 A;  2OVB A;  3FUL A;  3HYM B;  4OVU A;  2A5U A;  2AWI A;  3HVE A;  3I4G A;  2VJ8 A;  4FA6 A;  3TG4 A;  4FC8 A;  3TG5 A;  2CHX A;  4Q94 A;  2VTB B;  4G1T A;  3B13 A;  1UJJ A;  4GML A;  5BNW A;  5JHA A;  4Q69 A;  2PQN A;  3TAX A;  1Z6T A;  3R7Q A;  4A1S A;  4WAF A;  1B89 A;  4F3V A;  4J0U A;  5BT1 A;  1Y6I A;  4Q96 A;  3OAW A;  3DPD A;  2I2O A;  3RO3 A;  1OUV A;  3D9O A;  3LVQ E;  3JQ1 A;  3QDN A;  4IUL A;  4RG9 A;  3RJV A;  4AVX A;  4BX9 A;  2HR2 A;  4J8F A;  5LCW J;  3ASG A;  3U3W A;  1IQR A;  4B94 A;  4JVS A;  3SGH A;  4DJA A;  1WAO 1;  5KCM A;  4U0S A;  4FHJ A;  4J8D A;  4PS3 A;  3VTX A;  3AS5 A;  4XX5 A;  5T4Y A;  3PZD A;  4WNG A;  3QNK A;  4UQX A;  2IJG X;  3CHO A;  4YVO A;  5BW8 C;  2X6J A;  2FF4 A;  2WPV A;  3CKC A;  1H2T C;  3BG1 B;  4I2Z A;  2DIW A;  2YHC A;  3CHQ A;  3ZIM A;  5G04 C;  3QB2 A;  3LCA A;  3L6A A;  4APO A;  2OOE A;  4BFR A;  4MRU A;  1HF8 A;  3UUX A;  3ZRH A;  4QFV A;  3I4R B;  3PEV B;  5AJL A;  4EBA A;  5M72 A;  1HXI A;  2BUG A;  3CHS A;  2L0T B;  5T3R A;  2VGX B;  2LSV A;  1LF8 A;  3C98 A;  2FEZ A;  2UY1 A;  4GZD A;  3CKB A;  4MLP A;  3JUI A;  4CRW A;  2WXK A;  2I1J A;  1NA0 A;  4L2Y A;  4AP2 A;  4NRH B;  4CGW A;  3WXX A;  3RO2 A;  3S7J A;  5LFA A;  3FTU A;  3CHP A;  2GRM A;  3RU0 A;  5KJM A;  4TRQ A;  3PNT B;  2ION A;  4F53 A;  3R7R A;  3CEQ A;  2LNI A;  2YHE A;  4UQY A;  3MYV A;  4AOF A;  3D9M A;  1ELR A;  1HG5 A;  2CFU A;  5HI7 A;  2FBN A;  5LP0 A;  3LEW A;  4FJZ A;  4GU5 A;  3TXN A;  3CK7 A;  1EF1 C;  2LSU A;  4E85 A;  2WQH A;  2X6H A;  1HZ4 A;  3D9I A;  3N71 A;  4WWN A;  2J49 A;  1QZ2 A;  4W9R A;  4I9C A;  4ILG A;  3CV0 A;  4H7X A;  4I9E A;  4LER A;  4HOR A;  2DBA A;  3PUJ A;  2J4B A;  3ZVV A;  3FTZ A;  3FUM A;  2V8S E;  3Q4A B;  4DLQ A;  2BTD A;  2Y4T A;  2V0P A;  2QY7 A;  2XQ0 A;  4RG6 A;  3MEK A;  4FAD A;  1W3B A;  1TEZ A;  5DBK A;  2WXF A;  5JHB A;  2NC9 A;  3OTN A;  5FZQ A;  1EDU A;  4O6F A;  3FTX A;  3LY8 A;  4LCT A;  4EPZ A;  3GW4 A;  4FU3 A;  4UI9 J;  1JWF A;  2LAI A;  3MKQ A;  4G25 A;  3KAE A;  4U0U A;  4WWP A;  4YVQ C;  3Q47 B;  4C9B B;  3D9N A;  2HM8 A;  4CCA A;  4A3V A;  2IU1 A;  2OV8 A;  5ENN A;  5KJL A;  3FUI A;  4YND A;  1SQM A;  3CVX A;  2WXM A;  4JA9 A;  3ZHE A;  2WVI A;  4XE0 A;  4FUL A;  1A17 A;  3B7U X;  3Q15 A;  3ULQ A;  2WXQ A;  2L6J A;  4AXH A;  4K03 A;  4J8E A;  3ZYM A;  4UWG A;  3G2W A;  1P5Q A;  4MKT A;  4GZC A;  3ZYK A;  2LAH A;  1ZU2 A;  4JPS A;  2DCP A;  4TUU A;  2L9B A;  2R59 A;  4V3I A;  1HFA A;  2WXO A;  3EIQ C;  4G24 A;  4N5C A;  4DLO A;  4XZ4 A;  4AY5 A;  5LCW C;  3T5X A;  4J6I A;  4ANU A;  4BTA A;  2J08 A;  4HOU A;  4JXT A;  4EQF A;  5BV0 A;  2CG3 A;  5ANR A;  5KJK A;  2Y3A A;  3LYA A;  3RKV A;  3LPZ A;  2E0I A;  3CVP A;  2WXR A;  2GRL A;  4LEU A;  3FUE A;  3T5V A;  3PH0 C;  4ANV A;  3QWW A;  3L54 A;  2I9C A;  3NQP A;  3PNL B;  5FTP A;  1E8W A;  3MV3 B;  5FQ7 A;  1N54 A;  3HDX A;  3U64 A;  2JEK A;  1HG2 A;  1OWP A;  4AM9 A;  3ML8 A;  5EKQ D;  3IHY A;  3S7F A;  3CVN A;  3U66 A;  3FU3 A;  4ME2 A;  5DIZ A;  3PEU B;  4Y6W A;  3QK0 A;  3B7T A;  2WXN A;  2BF0 X;  3PUK A;  3S2A A;  3SF4 A;  3MKR A;  1FVF A;  3FUJ A;  3L08 A;  3SNX A;  4BT9 A;  4N3C A;  2J07 A;  4CEM A;  3LY9 A;  3O4Z A;  1Z3X A;  2CFZ A;  3T8M A;  4GB9 A;  2M63 A;  2R17 C;  5CHE E;  4URK A;  2LO6 A;  1PAQ A;  5FT9 A;  4EBA G;  3LY7 A;  4KBQ A;  3FUH A;  3CVY A;  4GYW A;  2V4L A;  5BUZ A;  5E76 A;  4FP7 A;  4LUN U;  1KT1 A;  5E75 A;  2VTB A;  5ARF A;  4DI4 A;  2C2L A;  2JLB A;  4XIF A;  3ZW3 A;  3U9W A;  3CHM A;  1QQE A;  2WMO A;  2KZT A;  3QWP A;  4NQ0 A;  3ASD A;  2PL2 A;  4G11 A;  4CGV A;  3FWV A;  1UN9 A;  5FQ8 A;  4D10 C;  1JPL A;  5FZS A;  4DI3 A;  2RD0 A;  3OXL A;  1E7V A;  2J9Q A;  2A4Z A;  4B89 A;  4PUC A;  2XGO A;  1ELK A;  4R7L A;  4HOQ A;  5AIJ A;  2AVP A;  3AU5 A;  1EYH A;  2J4D A;  4PS8 A;  4HLE A;  3TGO A;  2IOS A;  2YNQ A;  3PE3 A;  3PRZ A;  3FTY A;  3FEX A;  3VLF A;  3ZYL A;  4A1G A;  1IYG A;  5C1D A;  3CVQ A;  4ILH B;  4OVV A;  3ZN3 A;  2XRY A;  2R5S A;  3MV2 B;  4GCO A;  4UI9 C;  3ZPJ A;  4UWK A;  3QOU A;  5AJD A;  1HE8 A;  2L0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...