4GMP1

Crystal structure of enterovirus 71 strain 1095 procapsid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
225
structure length
218
Chain Sequence
HSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGGVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTKDLEYGACPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords capsid protein VP0
publication title Structures of the procapsid and mature virion of enterovirus 71 strain 1095.
pubmed doi rcsb
molecule tags Virus
total genus 31
structure length 218
sequence length 225
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gmp100
5L7OC 1RUD3 3VBHC 4JGZA 1NCQC 2R041 1EAH1 1B35B 4QPGB 1RUG2 1AR83 1NA1C 1RUJ2 1AR72 5BNPC 2BPA2 1HRI2 4GB32 3ZFGA 1FOD2 1RVF2 1R083 1MQTA 1D4M2 4CDXA 4RS5B 2HWE3 1RUC3 1WCDJ 1QJY3 1TME2 4Q4X2 2FZ1A 1AYM3 1C8M2 5C4WA 1R091 1MEC2 1ND3B 1R1A2 2RS31 4Q4W2 1RUH1 1PVC2 1NCRA 1BMV1 2R062 5ACA1 1RUG3 2BFUS 1RUJ3 4QPGA 4IV1B 1PO22 1HRI3 4AEDA 1ZBE2 1NY72 1RVF3 1POV3 4GH4B 1COV1 1D4M3 1A6CA 5AC92 1F2NA 4YVWC 2XBO1 3J8F2 3JBG2 1AYN1 3JD71 4RS5A 2PLV1 4FTEA 3VDDC 1TME3 4QPIB 1M06G 1QJU3 1POV0 2RS51 1HXS2 1C8M3 1PGW1 4Z92B 1R1A3 1MEC3 4Q4W3 4Q4Y3 1ND3A 2R072 1PVC3 2ZAHA 2ZZQA 5L7OB 4CDQC 1AL22 1NCQB 1RUF2 2XPJA 1RMU2 2R063 4Y5Z0 2ZTNA 1H8TC 1PO23 4LLFA 1QJU1 3ZXAC 4IV1A 1ZBE3 1X36A 3VBOC 3VBSA 2VQ0A 5AC93 3ZFFC 4EJRA 3J8F3 3JBG3 1VBB2 3VBFC 1QQP2 5C9AB 1HXS3 4QPIA 2WFF1 4N43C 4JGYB 2R073 1RUE1 5DDJ1 1RUI1 2TBVA 5ABJC 2HWD1 1FPN2 1RMU3 5CFDC 4WM8C 3NAPC 2BUKA 1VBE3 2DF7A 4CEWA 1VBA2 1V9U2 1VRH1 1VBC2 1PGL1 4YVSB 3VDDB 1QQP3 5CFCC 1HX6A 1VBE1 2BFUL 4CDWB 5C9AA 1VBD3 4JGYA 1Z7S1 2MEV2 1EV11 1HRV2 4RQPB 3DPRB 1FPN3 4CDQB 2RR12 2HWB1 4WM7C 1TMF2 1VBD1 1ASJ2 1W39A 4RR3C 1NG0A 2IZWA 2RM23 2X5IC 4Q4V1 4PDWC 2HWF2 2WS92 1VBC3 1RUD1 4YVSA 1AR81 5BNOC 4NWVA 2RM21 4CDWA 2MEV3 2HWC3 3ZFEC 1HRV3 3VBUB 1R081 5ABJB 4RQPA 2RR13 3DPRA 5BNNC 3LOBA 1AR62 4WM8B 3NAPB 1AR92 4BCUA 2HWE1 1RUC1 4CEYC 1K5MB 1B35A 1QJY1 1TMF3 1ASJ3 2WZR2 1AR73 1AYM1 2HWC1 4GB33 1PIV2 1ND2C 1OPOA 1FOD3 2HWF3 2WS93 4IV3C 2RMU2 5K0UB 1RUG1 3VBRC 4N53C 1RUJ1 1AR71 1ZBA2 1RHI2 4Y4YA 1HRI1 4JGZC 4GB31 4Q4X3 1X33A 1FMD2 1RVF1 5D8AB 1POV1 3VBUA 5A33B 1VB4A 3CJIB 4RHV2 1AR63 1D4M1 3ZFGC 1BEV2 3VBHB 3NAPA 1NA1B 1MQTC 1TME1 2WZR3 2QQPA 1RUI2 1K5MA 5BNPB 1C8M1 4CDXC 1R1A1 1MEC1 1PIV3 4GMP3 2GSYA 4Q4W1 5J96B 4Q4Y1 2X5IB 1PVC1 1BBT2 2RMU3 3FBMA 2R061 2RS12 5K0UA 4GH4A 4GMP0 1PO21 1ZBA3 1RHI3 1NCRC 1C8NA 1ZBE1 5A32B 1NY71 3ZFEB 4QPGC 4N53A 4RHV3 5D8AA 5A33A 4AEDC 3CJIA 1BEV3 5AC91 1PO12 1AL23 1RUF3 3J8F1 3JBG1 5L7OA 3VBHA 1NCQA 4CEYB 1QJX2 3JB4C 1HXS1 1NA1A 3TN92 2FZ2A 5BNPA 4RS5C 2R071 2R042 1EAH2 1AUYA 3JB8A 5JZGC 1AL21 1RUF1 1RMU1 2RS13 4YVWB 1VBB3 1ND3C 4N53B 4Q4V2 5C8CC 5FOJB 4IV1C 3ZFGB 1VBB1 1HQNA 3VBSC 1H8TB 1QQP1 1R092 2RS32 3TN93 1RUH2 1OHFA 1BMV2 2R043 1EAH3 3VBOB 5ACA2 4QPIC 1VBA3 1FPN1 1V9U3 3M8LA 3ZFFB 4YVWA 1OOPC 3VBFB 1IHMA 3VDDA 4N43B 1QJZA 1COV2 2XBO2 1VBA1 1AYN2 1V9U1 3JD72 2PLV2 1VBC1 5FMOS 4AEDB 4CEWC 5CFDB 2RS52 4CDQA 1PGW2 1R093 2RS33 1H8TA 1RUH3 2MEV1 4NWWA 1HRV1 5ACA3 5JZGB 2RR11 3VBOA 5C9AC 1QJU2 4JGYC 1VAKA 3ZFFA 4CDUC 4Q4Y2 1TMF1 1ASJ1 5CFCB 3VBFA 5C8CB 1E57A 1AL0G 2Y26A 1COV3 4N43A 3S6PA 2XBO3 1FOD1 2HWF1 1AYN3 2WS91 3JD73 4FTBA 2PLV3 1DDLA 1GFF2 5ABJA 2RS53 1AR93 2WFF2 5CFDA 3VBSB 4WM8A 2BBVA 4Q4X1 4WM7B 1RUE2 4RR3B 5DDJ2 2GH8A 4YVSC 2HWD2 4PDWB 1AR61 1AR91 5JZGA 4CDWC 5C4WC 1F8VA 1CD3G 1OOPB 2WZR1 4RQPC 3DPRC 4FSJA 1CJDA 5LK7B 5CFCA 5BNOB 5C8CA 1PIV1 4GMP1 1VRH2 1FMD3 1PGL2 1B35C 5GKAC 2RMU1 4CEWB 5BNNB 1VBE2 2WFF3 1ZBA1 1RHI1 1Z7S2 1EV12 1RB8G 1RUE3 5DDJ3 1RUI3 4WM7A 2WWSA 1FMD1 2HWD3 4RR3A 3HAGA 1ND2B 4RHV1 1BBT3 4IV3B 2HWB2 1BEV1 2X5IA 4PDWA 1VBD2 5FMOL 4CDUB 3VBRB 3VBUC 1OOPA 4JGZB 1SMVA 1VRH3 5BNOA 1RUD2 5A32A 3IDEA 1BBT1 3ZFEA 1AR82 1K5MC 4RFT0 2RS11 1PO13 5BNNA 2RM22 1Z7S3 1EV13 1MQTB 1QJX3 5J98B 1R082 4CEYA 5K0UC 1VB2A 4CDXB 4GH4C 2WLPA 4FTSA 1ND2A 2HWB3 4SBVA 2HWE2 1RUC2 1PO11 1NOVA 1QJY2 4IV3A 5C4WB 1AYM2 2HWC2 1QJX1 5D8AC 4CDUA 3VBRA 3TN91 3CJIC 1NCRB 4Q4V3
chains in the Genus database with same CATH superfamily
5K8SA 1RUD3 2W1UA 4P9XA 1DIWA 5F32A 1AVBA 1E5IA 2Q8EA 4ES9A 4TZDA 1NA1C 2Y64A 3H7JA 3WF4A 3T09A 1O7FA 1AR72 2YUEA 5FQ0B 1KEXA 3BN6A 4GB32 1V6IA 5C3OA 2ZHKA 1REFA 4DS0A 4AHWA 4R4XA 3T2QA 1XC6A 2WZEA 1SFPA 2G4IA 1OXCA 5FY1A 5FZFA 2ZZJA 4ZKTB 2J7MA 1SBDA 1S0FA 1BCXA 2OPKA 3FHQA 2ZGQA 2DCJA 1DLCA 3OBRA 1WD3A 4QX3A 3ASIA 1QJY3 1TME2 4AI1A 1AYM3 4LXLA 4AGGA 4E2SA 4KQ7A 1C8M2 5F2WA 4JDMA 1R1A2 1ND3B 3D0JA 4WV8A 4Y5TA 3IT8A 3I2OA 1JTZX 2XHNA 1UYZA 4WVZA 1G9CA 1QXJA 1NCRA 2H6CA 2YU1A 4M0NA 3UGHA 2PAEA 4Z07A 2QQLA 4YW2A 2UWAA 4K1YA 4LHKA 2P1BA 2BFUS 1BJQA 1PX4A 5A7PA 1RUJ3 1XNDA 5DQ0A 4IV1B 4Y26A 5FYYA 3I2DA 2W1WA 2BV4A 1HRI3 1G8WA 1XOYA 1UU5A 4D94A 1ZBE2 1NY72 3RJRA 4AI3A 4B1LA 1F9KA 1MS1A 1POV3 2VZUA 5FDBA 5A1AA 2ZX4A 3B69A 3OD0A 1QXRA 1COV1 5FBZA 2O8OA 3CDZB 4P9JA 5FXWA 1PZ8A 3JD71 4RS5A 4UBGA 3I2GA 4XXPA 5C6CA 4AYUA 5LY2A 1G7YA 1JXNA 3VL8A 3ZXKA 4D7TA 5FOBB 2Z5WA 3ZPOA 2YGMA 1GWKA 2J22A 1SEFA 4M0HA 2R072 5JDBA 1AX1A 1PVC3 4XURA 5JR7B 4P5HA 3T3YA 4INDA 4F83A 4CDQC 3SITA 1K3IA 1AL22 3AMPA 4JQRA 4NHYA 1JOJA 4ASKA 1A8MA 4EN7B 2ZTNA 3VDAA 4R9CA 1PO23 4Q2FA 4HMZA 5HXMA 2WNVC 2BWAA 1VIWB 5FPAA 3WNKA 1QMJA 1A8DA 3GCWA 4XJ9A 4A42A 3VN4A 5AFBA 2YGLA 1DBNA 1XJAA 5AC93 3AP5A 3KCCA 4NRMA 4Q0PA 3J8F3 1DLLA 1Q8PA 1GR3A 3ON7A 5F6KA 4COUA 5FR3A 5I8YA 1N3OA 4YG6A 2YBSA 4M3CE 1SBEA 2E53A 4N90A 2R0FA 2GDFA 2XMLA 1HXS3 4QPIA 2OS2A 5C3RA 4CCEA 1OLRA 4AZZA 1S2EA 4NHXA 1GSLA 3AK0A 2C9KA 1RUI1 1Q3EA 1W6MB 3I2JA 3UKNA 3OGRA 2HWD1 3WDYA 3K46A 5CFDC 4ZPIA 4JHTA 1NQJA 2LTNA 5E16A 3O5SA 2YU2A 4Q5OA 1CZSA 2C1FA 4M4RA 3D4KA 3O7OA 2GZWA 3NV1A 3K3NA 1OH3A 4KWLA 1S2BA 3PLQA 1SLBA 4QHBA 4QMAA 5FXZA 4XABA 1HN0A 5HCAA 2WZ8A 1KS4A 3MUY1 4OQ9A 1MS3A 2Z42A 4XHXA 4Y1XA 4OI2A 4NJ4A 3OG2A 4V2WA 1W0OA 3UNPA 2PELA 1BK1A 1MS0A 3SCFA 3G6JB 4BIOA 3ZKUA 3F95A 2JDZA 1XNCA 1U0AA 3VDDB 1O4ZA 4KWKA 5CKQA 5LY1A 1GZWA 2BFUL 4B4RA 2EVXA 1AJOA 1SBFA 4Z8BA 2FCUA 1ZNPA 2FHRA 4AFMA 4JGYA 3O1RA 5C9AA 1JOPA 4NN0A 2KA3A 2WFPA 1W99A 5BYNA 1OD3A 1OVPA 1FPN3 3I2KA 4XQDA 3VZLA 1UMZA 2IUWA 1FV3A 3B5LB 4BE3A 2HWB1 4HOOA 3I59A 4XFHA 4YWAA 3ZR5A 4RR3C 5EJZB 1T2XA 3MUZ1 2IZWA 2LS6A 2NM1A 4LBKA 4BK5A 1ZZBA 2KXLA 2WT1A 4EYUA 3RJ2X 2XH6A 4MADA 4A6OA 2AH2A 3NNJA 1W8ZA 3D5OA 4UFLA 3B9IA 1JW6A 1LOGA 1APNA 3IMNA 4CP9B 1QKQA 1UY2A 1PZ7A 4CU9A 1CGPA 4NWVA 3KT7A 4Y20A 4I0WB 4XTPA 3A22A 2MEV3 2VCCA 5JXIA 1CVNA 1HRV3 3UJOA 2PHRA 3LAGA 3VBUB 2O8QA 1R081 4OVEA 4A45A 4GJYA 4AQ2A 2ARBA 2EAKA 2ENRA 4A3ZA 5IJRA 2E32A 3OGJA 4EWAA 3CLPA 5BNNC 2DUOA 3MDPA 1AR62 1KFXL 4Z2AA 2XLAA 3NAPB 4PLOA 3ACGA 5DAXA 4BCUA 3ZYJB 1DQ1A 1RUC1 3TOJA 1TMF3 3FUOA 1ASJ3 3NNMA 3WDXA 1DGWX 3K3OA 2D6PA 2P4EA 5EYYA 5GLVA 2PYTA 3S0MA 5FY5A 2Q1MA 2Z4FA 3H7YA 4IEOA 2DCYA 2VOVA 2A6ZA 2QTWB 1OPOA 1FOD3 4IE7A 4PLMA 1NAEA 4BB3A 3FL7A 5JVVA 2RDNA 2VMIA 2RMU2 2Q8OA 5JR2A 1WBFA 2OYZA 3H3UA 3LPGA 4NRQA 3CU7A 1UOBA 2YG0A 2WL1A 1RUG1 4D6SA 3PTRB 4FQ4A 1F4HA 2PFWA 3ORJA 5FZ9A 4Y4YA 4AI8A 2H0BA 2Y0IA 3E6CC 4Q4X3 3B7MA 3IDBB 4QKDA 4PBPA 1H9PA 4UWDA 2LM3A 1H2MA 2PMWB 5F5QA 3CJIB 5A6ZA 5A80A 1H9WA 3W9AA 2BW8A 1D4M1 3LIGA 4AHXA 2IFRA 3ZXDA 2VMDA 1F15A 4R9BA 1NA1B 2YC4A 1RINA 1LEDA 1CIWA 1DQ0A 4AQTA 2ZAAA 1WLDA 2PHWA 5LA9A 3LPFA 1MEC1 1PIV3 4Q4W1 4DIQA 5J96B 3LFIA 5J1XA 2X5IB 4P9WA 1BBT2 4RL7A 2DU1A 4XZUG 3FBMA 2GALA 4YGEA 2XR4A 1CX4A 1X7NA 2VGDA 3FMGA 4NMIA 3RWNA 2R061 3ZLIA 5FZ4A 5K0UA 4KL1A 5LK5A 3OOXA 2ZGRA 4GMP0 3T0BA 2GMMA 1ZBA3 1HDKA 3OYWA 4FFGA 1NCRC 2ARCA 3APBA 2UU8A 3AP4A 3HBKA 1XU2A 3FN9A 4XJUA 3ZFEB 4BZ4A 4C0HA 3EO6A 3AVRA 3J26N 1D0HA 2VAUA 4RHV3 5H9RA 4YGCA 5A33A 2BVBA 5BXXA 3BPZA 4PF5A 4GZ9A 2JECA 2BGCA 2GC3A 4HVOA 1N3QA 5DPNA 4BJ0A 1UQXA 4CEYB 1LHNA 1O3TA 1P8JA 4QB6A 3ZIXA 1UPSA 5BNPA 5L36A 3I3DA 3IM0A 1YFWA 4QXKA 1S0EA 2QE3A 4RS5C 4XETA 5FLHA 4URAA 5BV6A 1WW5A 3N9MA 4IEXA 4E2GA 5HI0A 2IXHA 3VKLA 3VD3A 1GNHA 4P9LA 1YEWA 1UZWA 2AZ5A 4I3PA 2W94A 4J6GA 5J09A 4BXFA 5C8CC 3DKWA 1HB3A 2BU9A 3U10A 4QU2A 4UW6A 4G4FA 1NT0A 4QWNA 2WNUA 3M3CA 1CAVB 3LEKA 3SC7X 1LOBA 4YG3A 4AEJA 2QUOA 2XVGA 1XU1A 1WZXA 2QQNA 3BB6A 2RE9A 3WNPA 2XJVA 3MIDA 2JB4A 4UF0B 1DQ6A 4ZU7A 3SMHA 1C28A 3MPBA 4AW7A 4CXXA 4DXRA 3RWKX 2EXKA 2WNVB 4R52A 3B01A 4BQYA 5IK7A 1EAH3 2BBAA 3KM5A 4LBLA 4QPIC 1D4VB 1STMA 1VBA3 3H3LA 4J1XA 2VOKA 3KGZA 1ZRIA 3WF0A 2A71A 2XL9A 3DUIA 2VC9A 3N7JA 4LUKA 3MHZA 3AP9A 3DF0A 1W8FA 5A7WA 2IVJA 3THDA 4Y1ZA 3VDDA 4A41A 4AVAA 1XBFA 4Q0UA 4EWDA 1BZWA 4AFBA 1COV2 4IGQA 4S2HA 5A7SA 5C8WA 5IVEA 4XFIA 1H8VA 4JC1A 4KI5M 3SEPA 2LALA 5FCCA 1V9U1 3JD72 4R9AA 1VBC1 1TQ5A 1ENRA 2E7TA 3VKNA 5APAA 2WWJA 5CFDB 1MS8A 3ROUA 1LOCA 2ZGLA 4UW4A 5ERLA 4Q0QA 2WO3A 1W9SA 4OHXA 1W3XA 4QX7A 3WNNA 3H8XA 1TVGA 3JCIA 1Q43A 3KV5A 3CL1A 5DZFA 1KXGA 3AZZA 1FXZA 2JENA 2VQUA 4YFWA 5AVAA 1J83A 2QCSB 5FZOA 1SZBA 2SLIA 2UURA 3U14A 5JLVA 3H0OA 2V5YA 2RR11 4YW5A 2FDGA 3HNBM 4JGYC 1GUIA 2B7YA 1VAKA 4LKFA 3ZFFA 4A6SA 5HCBA 1JZ3A 4OMDA 4Y22B 1K5JA 4MG2A 5C71A 1Q8SA 2G9GA 2D97A 4N43A 3S6PA 5FYTA 4A4AA 2XBO3 2DU0A 4GULA 2Y6GA 2HWF1 1AYN3 4U2AA 2PLV3 2VW1A 2ZKNA 1V6NA 4P5YA 2RS53 2WAAA 1AR93 1OLME 1XE0A 3I54A 4OCTA 5BUVA 2BBVA 2VE1A 3T4VA 3RNSA 1QNWA 1S55A 4JAAA 3TEXA 1WMDA 4RR3B 3ILRA 2W0XA 2GH8A 4EZHA 2HWD2 1FATA 2ZBJA 3DXTA 2R7EB 4K3UA 4UFJA 5CB7A 2ZEXA 1W28A 5FPXA 3LE0A 2JEMA 2NMNA 2QKDA 1OKOA 5I0DA 4HKWA 5FZLA 2ZGKA 4WVWA 2BNNA 2CU5A 5SV5A 2WZR1 2ILMA 2ZGSA 4CCOA 4UW3A 3C7HA 1CJDA 3AZWA 1RJ7A 4XF3A 1JUHA 3DYMA 3D6EA 4K8FA 5F37A 3T30A 3NV3A 1AJKA 3MW3A 4DMIA 2QFEA 2VTXA 4META 5BNNB 1WA4A 3ACHA 1AX2A 1Y9QA 4OHZA 3AX4A 1RHI1 4MXWB 3OF1A 1IGOA 4LPLA 5JOWA 2LROA 3LA7A 4WVMA 5DDJ3 3WNMA 3WW1A 1MVQA 4QXBA 1H2KA 5T5PA 3NJYA 1FMD1 1UYPA 4GKXA 4TXWA 5T5LA 3VV1A 2VUDA 4URTA 3J4UH 3TNPB 2P6CA 1W2UA 5FAXA 1HJGA 2HWB2 4KBZA 4XFBA 2X5IA 3N35A 5L9BA 4BWOA 4CCDA 5DAPA 2QZ2A 4P00B 4CDUB 3MV01 4PI0A 4D6RA 2WJSA 2GMEA 1Q8QA 1OOPA 4LHSA 1DU3D 1PMHX 3ACIA 2JXAA 4IXLA 4LEJA 3T2PA 2XQRA 2QBXA 4B7KA 3NWKA 3IDEA 4H14A 2GC2A 4FCAA 3ZFEA 3T0DA 2WUHA 2ORXA 3PJQA 4XC9A 5JIAA 4RFT0 2RS11 1DQ5A 2D5HA 5HXVA 1AF9A 1W8NA 1PO13 1S0DA 1K12A 1GANA 2GNMA 4FP3A 3T2TA 5KHIA 2PN5A 2YV8A 4YZ4A 1F5FA 1XNAA 1OBNA 2JDYA 4FO9A 1R082 4CEYA 3D8CA 2F6BA 1VB2A 5FK8A 1J3PA 4E9KA 5K0UC 2JG9A 3PMEA 4XUNA 2GC0A 4JTNA 4GKYA 3SQOA 2GNDA 1ND2A 2VH9A 1NKGA 4BMBA 2GP5A 1RUC2 2YC0A 2UYAA 3MBWA 3PVBB 1WWYA 1UW8A 3UKTA 3WQ1A 3AZVA 1IZ3A 2J1EA 2WBKA 1QJX1 4LUMA 3ZSJA 4CA9A 1XB9A 5FZIA 3AXEA 3TN91 5FO9B 1NCRB 1ZZCA 4M01A 2VBDA 4KGQA 4FI9A 1GYKA 4Q4V3 3C7GA 4X6RB 3VHRA 3LGRA 4LOSA 4KWJA 5J36A 3IAQA 5EIYB 1TZOA 1J84A 2FDKA 3QH6A 4CUBA 4CP1A 1RUG2 1W9YA 2RHPA 1ZZ7A 2ZA9A 3W5NA 1H4HA 2AR6A 2W5FA 5E88A 5BNPC 2BPA2 3MV11 5FV3A 1UY4A 1JZ7A 5IVYA 3O12A 3O0XA 3RQ0A 4I02A 1GV9A 1O4YA 3CJXA 4AOCA 4K20A 4BXSV 2WN3A 1F5JA 2Q5TA 1V6KA 1UNBA 4XXAA 4ORFA 1D4M2 3N3HA 4CDXA 4CSWA 4RS5B 3HOBA 2XLGA 4TSVA 2A3YA 3LZZA 1WCDJ 3H1WA 3DL3A 2WIIB 4F8AA 1SFNA 3AM2A 4PIZA 1PM7A 2WNUC 3A7QA 5F1RA 1MEC2 3PUSA 2CYFA 2RS31 4Q4W2 1RUH1 5JOXA 4KBBA 4K21A 3I2IA 5A3LA 2WSUA 1BMV1 4IEVA 1U5ZA 5LBEA 4GJZA 4TLFA 2R062 5ACA1 1ZZ9A 2A5ZA 3C8XA 1O4TA 3JXSA 4QPGA 1U5XA 4EROA 1SLLA 2VPVA 3ECQA 4NAOA 2VECA 4QQHA 1TNRA 3GALA 2Y6LA 2Y34A 3VD7A 4HLTA 2VNRA 4RA0A 4ARYA 2BEOA 5CADA 2WRAA 5A7QA 5T3NA 1GWMA 1W8UA 4GH4B 2CGPA 1RXFA 2CNAA 2N7GA 1HIXA 2A6WA 5FUPA 3SKVA 1O3SA 4ASMB 3VDDC 1TME3 4QPIB 2XQXA 1QJU3 1AXYA 1POV0 3FWEA 4QM9A 4FAGA 1C8M3 4ZZ5A 2DBIA 5F5CA 1R1A3 2BGPA 3VKMA 4AG4A 4Q4Y3 3Q8FA 1TNFA 4JHZA 1XYPA 2ZZQA 2VNOA 4IEWA 3N7KA 1NCQB 2OIIA 5IVVA 2XPJA 3LA3A 4LBQA 1YQ2A 5EJ3A 4CCLA 4C0BA 4LLFA 4LHLA 4AF9A 4BM8A 5I0TA 5HCFA 1CESA 1ZBE3 1SLTA 4ZU4A 2VMEA 5M0TA 4JKLA 5B4NA 2GNTA 1QNYA 5FZHA 1R1ZA 1XNKA 5EHDA 2EXHA 5FZDA 2W3JA 3DXUA 5FRAA 4L8QA 1UF2C 3OY8A 1ZZ8A 3ZFFC 4QKNA 2CGOA 1CWPA 5LEJA 4BQ1A 2VVEA 5GZFA 5AVPA 1GZWB 2XJSA 4MH0E 2XJQA 5LRRA 1W0PA 4CXYA 2CSGA 2FMYA 2YBPA 2WFF1 3GJBA 4IDZA 4N43C 4JGYB 5CAZA 1N1VA 5DZGA 3RDIA 1JYCA 3KF3A 1RGSA 4CCKA 1A34A 2YDEA 2XUEA 3WW3A 2R073 4DEVA 1RUE1 4FXGB 5I93A 2TBVA 4YM0A 4E4ZA 5FZAA 5EJ1B 2FCTA 3QD6A 4K1ZA 1NLQA 2ETEA 3B00A 3NAPC 2FQPA 2YPDA 1LR5A 2H6BA 3GM8A 3I59B 4LK7A 1UPIA 2V09A 3HBZA 3O1SA 4W65A 5KHGA 1J1LA 2GNBA 4XIOA 5IK5A 4YW3A 4ZHNA 4M3CB 1J1TA 1VBE3 2A6YA 5EPAA 4YFZA 1LHUA 3ZXGA 4DXSA 1N1TA 2VZ1A 2HBUA 2P6HA 5F8PA 3UKVA 2EIBA 3EBRA 3MIFA 4FOYA 4MXWA 5CZKA 1E5RA 1V9U2 3T0AA 1VRH1 1VBC2 2V4VA 4MGZE 5I8TA 1KQRA 2JKXA 3PVNA 3F2ZA 4QB1A 4QAWA 4IGPA 2NLRA 1JOBA 1O91A 1NX9A 4Y20B 1HX6A 1BLZA 4NOTA 1LOFA 5FPVA 1REDA 2QNKA 4S2GA 1Q8OA 2I45A 3MLKA 4OI0A 4NIAA 4RD7A 1JZ4A 3ZYHA 1LCLA 2VZTA 2NN8A 3AXDA 1OFNA 2CWSA 2RR12 1G9FA 4XMIA 1I5ZA 3RYRA 2JG8A 3POWA 4R4ZA 5IK4A 4MGQA 1QDOA 4ISRA 4QX2A 4D7YA 4C91A 2RM23 3DYOA 3PIJA 2R32A 2X5IC 5I8SA 2DUPA 3KQ4B 1DQ2A 2HWF2 5IATA 4OMCA 1MZ5A 3OCPA 1YHFA 1QH6A 1AR81 1PK6A 1XRUA 4B8EA 3ZYBA 4CP2A 2PAKA 4WZFA 2BTVC 2W95A 4OZOA 4Y1YA 4OLLA 4YZ3A 1H1AA 2B4KA 1OKQA 1YO8A 4Q27A 3WG4A 3ZFEC 1GZ9A 1GZCA 3Q8EA 1REEA 2TNFA 4OUEA 4OULA 3IB3A 3DPRA 4BH9A 3AMQA 1O8SA 4C1XA 5A6YA 4YW4A 4WM8B 1YFYA 1HKDA 4MVTA 1F31A 3DGTA 4P08A 2HH9A 2HWE1 3HQUA 4CEYC 2G9ZA 2RDQA 2WZR2 2JG9C 2MHFA 2Q30A 4XAAA 4JZRA 4LO8A 3FZ3A 1ND2C 4Q29A 2DVFA 2VQTA 2Q1FA 2CHHA 3E6DA 5EQUA 1W04A 4QT6A 1YLLA 2PHUA 4AFCA 5K0UB 4QDQA 5F3GA 5ANNA 2XJPA 3K4DA 4HSJA 5KHKA 1S2KA 3OYWB 4JTOA 5FO7B 3OB8A 4FPKA 5IUQA 3ZKYA 1RHI2 4L99A 5GLWA 1C1LA 3IIAA 3O0WA 1CQ9A 3RZKA 3H42B 2DYCA 2DCKA 3NO8A 5DXDA 1FMD2 1RVF1 3LDBA 5A33B 5IHRA 1PNGA 1G6NA 1V00A 2VZOA 1AR63 3H3ZA 3EHKA 2WQ4A 3DEMA 5LZ6A 4YW7A 3MI8A 2WNEA 2RJ2A 4AHYA 2QQPA 1DF0A 3VD4A 3GBGA 3IPVA 1W2TA 3SH5A 5EP9A 1K5MA 3MF6A 5BNPB 2YBKA 4CDXC 1W06A 3GZEA 3RG0A 1NQDA 5J37A 1KJLA 3WOGA 2GMPA 2WSVA 2RMU3 1UAIA 1AZDA 2XVLA 4XYXA 2RS12 1W6PB 3ENRA 3N9QA 4Y1VA 4MGSA 5FY8A 4GH4A 1CZTA 4K8RB 5FFOC 2HLEA 1I1EA 2FDFA 1TG7A 2Z2SB 3RZMA 2DFCA 1K42A 3TEYA 4FP2A 1VMJA 1FNZA 4G9SB 3WF2A 1DZRA 3WLUA 2WNUB 4BMEA 4QPGC 4HN1A 5KBFA 1JYIA 1WW7A 4B29A 4GALA 2ORZA 4YW1A 2WAOA 5D8AA 4AGRA 4MLOA 4FPJA 3NJZA 1ULOA 2DTWA 4BQ4A 1RUF3 3HN1A 3JBG1 4HKOA 1HJFA 2QQKA 3AVSA 4LR4A 2W46A 1NCQA 2ZGOA 3ZXFA 2VOWA 2DVBA 1QJX2 3KCXA 3BGAA 3ZYFA 3TN92 1E5HA 2XVKA 1J3QA 1C5IA 3R05A 4LNVA 2VBPA 4TYSA 4FQZA 1KJRA 4NIHA 2BOJA 2VMHA 3JQXA 2AEYA 3V0BA 1AUYA 2W52A 4LQRA 3MFAA 1RMU1 3RZLA 2JWPA 1LULA 3R4UA 2YB7A 1TE1B 1VBB3 5DZEA 1XNTA 1QJFA 4N53B 4LHNA 4PF1A 3U78A 4E4HA 5I0RA 5A7WB 4JDNA 4GWNA 4UW5A 3N9LA 4MX3A 4XJ8A 3AFKA 3VHOA 4HZFA 1VJ2A 4DEQA 2C6SA 3TRSB 2YHJA 2JE7A 3SEEA 3GF6A 3O14A 4OI1A 3JUUA 1U12A 2C9AA 2EXJA 3RGBA 2I07B 2PQSA 1HN1A 2WO1A 3C7EA 1QWRA 3AYAA 1HQNA 2XG3A 4HT1T 4QGNA 1QQP1 1WMEA 2WKKA 5FP4A 2RS32 1RUH2 3U1XA 2IXJA 3TNQA 5E1RA 5FZOB 1ZRCA 2QQMA 1BMV2 4M3CA 1XSRA 1Y43B 3WW2A 4ISQA 1WCSA 5DN2A 4EQVA 5ACA2 1XNBA 5B4XA 3WNXA 3M8LA 3ZFFB 4FVVA 4YVWA 3ZIWA 4H7LA 2EF6A 3GBWA 1LU2A 1UXZA 3UESA 3UL2A 3KT1A 3O1VA 2EICA 4M00A 1UX6A 3NVCA 4N43B 4GD4A 1QJZA 4BK4A 1CPNA 3UYJA 1LGBA 3WDUA 1W6QA 4AFAA 1VBA1 5JOYA 3C7OA 5JI9A 1DFQA 2Q1ZB 1HW5A 3E1F1 3H8OA 3CZJA 3VB9A 4O65A 1NXD1 3BTZA 1H2LA 2GH2A 3K4ZA 5D2AA 1DZQA 3PUQA 4XJWA 3IAPA 4JRLA 5GLTA 1HB1A 2K9ZA 4NIGA 1H8TA 3M1HA 2VMCA 1HV0A 1QHDA 3ZN6A 4E4SA 2G9FA 4KU8A 1LNSA 2OPWA 2ZX1A 4NWWA 3BYWA 2JDAA 3HJRA 1JBCA 1W90A 4XZPA 1LOFC 2O1QA 2OZJA 3CMGA 3N7LA 4QQPA 2ET7A 3VBOA 1UU4A 2OUJA 1S0CA 5CIRA 3QLQA 3ME2A 1GICA 5GZEA 2ZEWA 4LJHA 4NPMA 4CDUC 3A0NA 1IOAA 1EPWA 1WD4A 1NE4A 3EQEA 4UAPA 4OFGA 4HONA 4UXAA 3K2OA 5FO8B 1JZ8A 1O8PA 3AKQA 2UWCA 5FZ7A 2JIJA 2ZHLA 1GP5A 2ZACA 3I2HA 2JG8C 1COV3 4Y24A 2YXSA 5DUXA 1QEXA 1YXWA 1SLCA 3KF5A 4ONUA 5LASA 3WNLA 2WS91 3ILNA 3JD73 3ZPYA 2Z69A 4H3WA 1FV2A 3LIHA 4AK3A 1DDLA 1W9WA 2R49A 1J59A 4L2NA 3KLSA 1S4CA 3UETA 4PLNA 2WFF2 2DCTA 2IXCA 5DG1A 3DCQA 1XYNA 4WM8A 3VBSB 3I4IA 4WVMB 2VZRA 3PNAA 1IS5A 1RUE2 1T6GC 2Q4SA 2XKPA 3ES1A 3THCA 3D3AA 2KR2A 1PK6C 2QDNA 3FE5A 4KWUA 2AGSA 5ANQA 2EXIA 2Y6HA 3V0AA 3CIHA 1LHOA 4RN5A 3USSA 4YZ5A 3BU0A 3A23A 3ZXJA 4AE2A 1UKRA 1V0AA 3MLJA 1AR91 5JZGA 5F5AA 4BIFA 5I0UA 1WUVA 2V72A 1RJ8A 5FPBA 3WINE 3ZX7A 1OOPB 4WZCA 4JDOA 3PL0A 3FFZA 3WD5A 2D43A 3DPRC 1O59A 3WV6A 4FSJA 4NHLA 1WLTA 4MGYE 5CFCA 3HNYM 4GMP1 2OXBA 3PURA 4IERA 4EN9B 2ZGTA 1VRH2 3U0ZA 2EIDA 3ZMOA 1VLNA 5GKAC 4FOQA 4S2FA 5IT6A 4KNCA 2SBAA 2Y6JA 3TEWA 5H9QA 2JDNA 2VZPA 4D0QA 2V4AA 4FPEA 2XJRA 5F39A 2C5DA 1LECA 1V6OA 2WYSA 2VTXJ 3RFRA 5FYVA 1RB8G 2XLFA 1YUDA 1RUI3 3GZAA 2DVAA 2JG9B 1Y3TA 5FKCA 2HWD3 1LU1A 4E8DA 1X82A 3HAGA 4W6YA 2KM2A 1ND2B 1FNYA 2RG4A 2PHLA 5SV8A 5L19A 2PQQA 4HK8A 3WNOA 3GZUC 1BEV1 3KMHA 4Y33A 4PDWA 4QQ2A 2Q8DA 4MO3M 4A3XA 4AVSA 5G05L 4BQXA 1GOHA 1IG3A 2VOTA 1CPMA 2ZMLA 3IBMA 2UWBA 3J7HA 1ULGA 3ZN5A 1JYNA 1W6PA 1Q5OA 3BTYA 1D2QA 2ZOEB 2VVDA 3PTYA 5F2SA 3VZKA 5BNOA 3SCHA 1SACA 3KVAA 3GDBA 4XCBA 1AR82 1K5MC 5FPUA 3E5XA 5DUWA 3LSDA 3NMBA 5LATA 3VLBB 4I09A 4YARA 3DN7A 3QOPA 3GBFA 4MYEA 3VD5A 1KDKA 1W9TA 2QQIA 1LOEA 2E33A 2GN3A 4MHUA 5KXEA 1ST8A 4QB2A 5K7PA 4CDXB 4UOJA 1IQDC 4GH4C 3MIHA 3THPA 4YG0A 4FTSA 3M3IA 5T50A 3WHTA 5A3WA 5KXDA 4WVVA 2VW2A 2HWB3 4SBVA 2HWE2 2WINB 3JQWA 1LENA 1OURA 1PO11 3AYCA 3PVOA 4IV3A 4W50A 3VZOA 3INAA 1MZEA 1EUTA 5A3MA 4HPKA 1GNYA 2C26A 5D8AC 1H6XA 3CEWA 1N3PA 4N53A 4DXZA 1X9PA 3SLIA 4JGZA 2A75A 2ARAA 1NCQC 2R041 4LT5A 1B35B 2Y60A 3MFCA 4QPGB 1FX5A 4IUGA 4X6QB 2XOMA 3R4SA 1J3RA 1OF4A 5A3PA 5A3TA 3BKZA 3NL1A 4TN7A 2NQYA 1AXKA 2W68A 4XAEA 4LBJA 3W21A 4JV4A 5FY9A 1PVXA 2LRPA 1FOD2 2O0OA 1RVF2 1R083 1GOGA 1HQWA 1MQTA 4AEKA 4AVTA 1TEIA 3ZSKA 5L9VA 2UY9A 2PHDA 5LA2A 1YC61 5C3SA 3ACFA 4FOWA 1UL9A 1IKPA 3LF7A 4P14A 5IK8A 1RUC3 3FLRA 4KH9A 2RVAA 2RV9A 4Q4X2 2FZ1A 2JDPA 2OKXA 4CPBA 1ONAA 2YC2A 1PM4A 1POQA 3I97A 3KHBA 3WG3A 3MGUA 5C4WA 2PHFA 3GHMA 1R091 2W87A 1EUUA 3B93A 2ET1A 3A0KA 3S7IA 2X10A 5IVFA 1Z0HA 1GP6A 3AZXA 4HG6B 3OUHA 4LBQB 4CUCA 3BVCA 2XXZA 4CRQA 5T55A 1RUG3 1GKBA 3UGFA 1H6YA 5D21A 1ENSA 2WN2A 1LGNA 1SQ4A 3BALA 3C3VA 3K51A 4BU2A 1CAXA 2YROA 5FP7A 5EXOA 1DGLA 5FYMA 4CP0A 3HD8B 3N9OA 4NVPA 4WBBA 4XF1A 4FPOB 3BTAA 2CAUA 2ES3A 3HT1A 1QXPA 2V73A 2GAUA 5A3UA 3OY8B 3WR0A 1NYWA 4IW3A 2A1XA 2VL4A 4LA2A 2WLQA 1D4M3 3RS6A 3RYPA 1BVP1 1ALYA 1F2NA 1UOGA 3AZYA 3H9AA 1UZ0A 3JBG2 3K48A 4YVWC 5LB6A 3C2UA 4JKKA 2OQ7A 2CTVA 1FI2A 1Y9MA 3M70A 4LIVA 1M06G 4FPGA 4LLOA 3OJBA 2DV9A 1YFUA 4QKBA 4DOUA 3GNEA 1BK0A 1F35A 1LKNA 1MEC3 4Q4W3 1MACA 1VAVA 5GZCA 4LORA 1VR3A 2A3XA 5LA0A 5L7OB 2BDRA 4D7SA 1W03A 1RMU2 2R063 2W1SA 1W2AX 2ZABA 5HV0A 4Y5Z0 4YM3A 4LO4B 1H8TC 4XFCA 2D6LX 3BIWE 1QJU1 3OBAA 3WY6A 4JRAA 3ZXAC 2WA3A 5LRSA 3ABZA 2VO5A 3KGLA 3RMYA 1BQPA 1X36A 3AMNA 3IKWA 4HBNA 5FYUA 3WT3A 2BP6A 1JYXA 2Z79A 5JCTA 4DO0A 2P3KA 2VW0A 3VBOC 2VNGA 1C5HA 3TWIA 4GXLA 3VBSA 2VZQA 4COVA 3KCYA 5EZWA 4LITA 5F9TA 3OTFA 3B02A 4L92A 4LBNA 4EJRA 1L7RA 2F17A 4K9SA 3WUCA 4XBQA 3UGGA 1KRIA 3VZNA 2R16A 2A6XA 1QQP2 4XACA 3W58A 3WZ1A 2MPFA 3URFA 1RUNA 2C24A 2KD7A 2ARXA 3FHAA 3THTA 2VXJA 2H0VA 2JKBA 3LFMA 4XFGA 1NZCA 1LODA 5FZMA 1BYHA 5CBLA 4B4PA 2QQVA 1O5UA 2CGNA 3VUOA 2D98A 1SFYA 2Q8CA 2D93A 4PIYA 4YRDA 1OLMA 5KC6A 4WM8C 2JG8B 2BUKA 1D0GA 2B45X 2QZ3A 3C7FA 4V2VA 5TSWA 3CO2A 3D82A 4HANA 1W6NA 2E31A 5LCWL 4YPJA 1XYOA 2B8MA 2DF7A 2DDUA 4QHOA 5D1IA 4Y3OA 3I2FA 4HVQA 3DKQA 1GNZA 1BKZA 1UCXA 4NE9A 1CAUB 1VBA2 5JSRA 2WR9A 3OGGA 4QX0A 4MGIE 3U11A 4AWDA 2WYFA 1PK6B 4FOVA 2VXRA 3N36A 5CISA 3VHNA 2HEYF 1VALA 1SLIA 5CFCC 4ZXEA 1T6BX 1VBE1 5GZDA 3NNFA 1CIYA 1NUKA 1VBD3 3P1IA 1CJPA 1OQ1A 1RIRA 3AB0A 4CXWA 1Z7S1 4NR1A 1EV11 2EALA 2HKXA 3DPRB 3ZYRA 1FAYA 3MPPG 3WHUA 4NPRA 3HQXA 4IE6A 4LTAA 3I3EA 1OH4A 4JQTA 1YI7A 1GQGA 1IS3A 2J1VA 2GU9A 5FBJA 2B9UA 4CVUA 2X29A 5JIUA 1MR5A 4OQ8A 4I2OA 4DXTA 4CUGA 2QQUA 3LWCA 2ID4A 3R0RA 4X8NA 4LBOA 2B39A 2ZMKA 4PDWC 4AGVA 2UY8A 2D6OX 1UZZA 2WS92 5LW9A 5LEKA 1VBC3 1RUD1 3PIGA 4B7EA 1WCKA 4D69A 3E97A 1LRHA 4YVSA 1JZ5A 4LO7A 1X8EA 3OPWA 4QX8A 3KQRA 3BU7A 4E2QA 5BNOC 3CKHA 2RM21 2XJTA 4N7UA 4CDWA 1DGRA 2HWC3 5GM0A 2B46X 1DCSA 2GC1A 3JU9A 1OA4A 4PCRA 5I91A 2FMDA 1LJ7A 5ABJB 4RQPA 2BZDA 2RR13 3USUA 2VUJA 3LOBA 1W6OB 1YQ6A 3H8UA 2HYKA 1AR92 1JU3A 4R8HA 1D7PM 4CU6A 3NQHA 4XFAA 2CDPA 3IPVB 3WQ0A 1YQ5A 2W91A 1K5MB 1B35A 1QJY1 1G86A 3BUCA 2VCBA 2F4LA 1AR73 1AYM1 4GB33 3IWZA 1EPZA 1UKGA 5K9YA 1UXXX 4F7ZA 2AACA 2HWF3 4IV3C 1WKYA 4MUVA 4MXVA 2NP0A 1WMXA 2ZHMA 3POIA 3VKFC 4DFSA 4YM2A 4KGGA 1S0BA 1WGPA 4N53C 1RUJ1 2D44A 3S5QA 4CTEA 3NSTA 1G9AA 3FFQA 1HRI1 1I5PA 2XB6C 5IVCA 4JGZC 3NNGA 2D6MA 1FYUA 4DQAA 1ULPA 1X33A 3Q8BA 1D2SA 3MEPA 1UZVA 4KG0A 4L9BA 2JX9A 2A3WA 5D8AB 2GP3A 1POV1 4XIKA 4YZ1A 2LUWA 5GLZA 3PHMA 3SCGA 4O9EA 1BEV2 3BTXA 3AP6A 3RZGA 1BXHA 1JS9A 1G9BA 1X8MA 3H1MA 4EV0A 1MQTC 2WZR3 5FZKA 4OYUA 4COZA 1V70A 3HQRA 3AMHA 1GMMA 3KV6A 4DINB 2GSYA 3VDBA 1OVSA 3V0BB 3NJVA 2VNVA 2LW8A 1PVC1 4Q8LA 5DAVA 1B09A 4L97A 1UMHA 5T5JA 5JMCA 2ZX3A 5EFUA 4PQ9A 1PO21 1RHI3 1KGYA 3MIEA 2WT0A 3POYA 4DRVA 1IPJA 1ZA7A 1HV1A 1KITA 1Y7BA 1H30A 1VE0A 4LO6B 4DUVA 3KHCA 1PX3A 3OPTA 1OA3A 1JH5A 1C1FA 3AFGA 5AC91 5CG8A 1U5IA 1PO12 1AL23 3J8F1 3AJYA 5GALA 5L7OA 1N47A 1S1AA 1WCQA 1WBLA 4IETA 3VBHA 4EN0A 1ACCA 1JYVA 4QXCA 5IAVA 1HXS1 2I74A 4YLZA 3T4HB 3Q9OA 4UFHA 1JODA 2FZ2A 1OD5A 5JI7A 5CG9A 3ZVXA 3AYEA 3AC0A 3OD4A 2R042 1VMHA 4PIXA 1CONA 2BWCA 1PZ9A 4YGDA 4ATEA 2VZVA 1LAJA 4LULA 4JX0A 3WG2A 1RUF1 2RS13 3LB9A 1E5SA 4XW3A 2QJVA 4YVWB 2VY0A 4FBFA 4ZXKA 4YZ2A 4PI2A 4Q4V2 4P9IA 1OA2A 2ZKLA 2YFZA 3GGLA 2WWUA 5L73A 5L9RA 5FOJB 1W6QB 1AX0A 2XGXA 4IEYA 4TLGA 3PU3A 4PT6A 3GXUA 3VZMA 3WP5A 3ZFGB 5FZEA 1VBB1 1QIQA 2JE8A 3M3QA 5K4LA 3WX5A 4QM8A 2IFWA 3KV9A 3VBSC 1H8TB 1SLAA 3H1YA 4XDPA 1R092 1YIPA 4XMAA 3ZN6B 4E27A 5HV4A 2DVGA 2E63A 4XUTA 4OI4A 5FXXA 3TN93 2JDHA 4Q1PA 4ATFA 5JXGA 1RUOA 4I3GA 2P5BA 3H50A 3IDAA 4HL0A 3U37A 3VBOB 4YNIA 5C5TA 3TEZA 2ZGUA 4LKDA 1FPN1 2WZPP 1YNAA 1CAUA 1W2OA 3AL6A 5FP9A 5IVBA 1HB2A 2ZCWA 2VTFA 3S57A 3EJKA 1OOPC 2E7QA 1IHMA 4FT8A 4BLJA 3KB5A 4AAPA 2X53S 4OHVA 4IEPA 1YYNA 5BPXA 1IQAA 4NAMA 4GWIA 4AFDA 1SPPA 1VMFA 3MW2A 2RJKA 4YGBA 2NYYA 3LQCA 5FMOS 4AEDB 1O3QA 1EP0A 3LSEA 3EXUA 3SISA 2HEVF 4BOWA 2RS33 1V6LA 5FY0A 1RUH3 4LK6A 2EIEA 4HK9A 4CCCA 2MEV1 1MS9A 3IN9A 1HRV1 3V0AB 1QOTA 5ACA3 3SKJE 3VHPA 1C57A 5JZGB 2WDBA 4HXCA 5C9AC 2WC2A 1QJU2 2RJLA 3ELNA 3W59A 4CUAA 3OSDA 1MS4A 5EV7A 1J58A 3PU8A 3OEBA 3RPQA 2PA7A 5A6XA 3CNAA 4COYA 2MNGA 4Q4Y2 1TMF1 3LDKA 1ASJ1 1ULFA 4QX5A 5A7NA 3VBFA 5CFCB 4CPBD 1NXMA 1AL0G 2Y26A 4G3YC 4Q0VA 2ERFA 1FOD1 3BIEA 4CCMA 2J42A 3L2HA 4FFHA 5LWBA 1Y9GA 5CKNA 3HPNA 4M3CF 2VQAA 4XBLA 4XDOA 2DUQA 3O1MA 1GFF2 2ZEYA 3ALQA 3WF1A 2ADEA 5ABJA 4HVRA 3WDTA 1W6OA 3AKTA 3KT4A 3I3BA 3ZXLA 4I01A 4AVVA 1Y4WA 4Q4X1 2ZGNA 4NHKA 1X50A 2A7AA 3MLLA 4LOTA 4X8PA 4YVSC 5J48A 2Q0AA 5KHJA 4HKLA 4PDWB 1ULCA 5F6LB 3HEIA 3QACA 4W8JA 4CDWC 1QDCA 1CD3G 2A73B 3BCWA 5DAQA 2CV6A 1ZM1A 1CX1A 4FPLA 4RQPC 3M3EA 1ULDA 2P34A 2J1SA 3ZN4A 4QPYA 5BNOB 5C8CA 1PIV1 1NLRA 1QOOA 1H0BA 3NNLA 5FY7A 1RXGA 3HIFA 5FP3A 2R1DA 3UV9A 3P3NA 4AI9A 2VCAA 1B35C 4GAZA 4W4ZA 4CEWB 3OPZA 1VBE2 2WFF3 3OUIA 1ZBA1 1R64A 1Z7S2 1EV12 4QXHA 5FZGA 1RUE3 3L2YA 2BYVE 4PQQA 4OHYA 3PMSA 4Y1UA 4WM7A 2G1MA 2PHTA 2E51A 1UY0A 3S5AA 4BLIA 4K7JA 1OUSA 4P02B 4DY5A 4RHV1 1BBT3 4IV3B 1KD7A 1QH7A 1AXZA 5CNAA 1WCUA 4HPKB 2XL7A 5FMOL 1VRBA 2D3SA 5B2GB 2JJ6A 5A3OA 3O1PA 4E4DX 4ZY9A 4DUWA 2NZ9A 2YMZA 4FFFA 1ZYBA 1OLQA 4NIDA 4JGZB 1AHSA 5JUVA 1SMVA 1VRH3 4A7ZA 1RUD2 3V65A 3CHXA 1MPXA 3J7NA 4IE4A 4O9GA 1A3KA 1LOAA 2D6KA 1NZIA 2J1AA 2W92A 3WQ7A 4YW6A 2E9QA 4DZGA 1CAWA 1Q8VA 1UYYA 5DAWA 3UT0A 1YIFA 2RM22 4XUQA 2R1BA 3ATGA 5DUVA 3SH4A 2AYHA 1MQTB 5J98B 2TEPA 1OC1A 4UT5A 4J25A 1LESA 3ZMNA 2ATFA 2WLPA 1H1IA 3FHIB 3LEIA 3VZJA 3M7AA 1UY3A 1W8HA 1DGRN 1H4GA 1QJY2 3U07A 5C4WB 1AYM2 4UFKA 4N7IA 3DYPA 3HT2A 4JVAA 3FUQA 1ENXA 4NO4A 5FYHA 4GIQA 3VBRA 1DZTA 2BOIA 3AJZA 3P5BA 2C0ZA 3FLTA 2VZ3A 4SLIA 4ZONA 3MIBA 3WDWA 5L7OC 3VBHC 1OQEA 2PHXA 2VBBA 1EAH1 3POGA 2Y6KA 4QQOA 2BNMA 1AR83 1JN2P 5KR7A 1CAXB 1RUJ2 1YJLA 4MSVA 4XBNA 5FLIA 3V64A 1HRI2 4QPWA 4ES8A 2J1RA 3ZFGA 1S0GA 4NPLA 4DRRA 4RGKA 3S7EA 1K45A 2W39A 3WG1A 1RTVA 4HFSA 4Y5SA 3IDCB 1W3VA 4BQWA 2YY1A 4FAHA 1UN1A 3I3MA 4CU7A 5C3QA 4A7KA 3VGIA 3EMRA 3HNMA 2HWE3 3KVBA 4I0BA 1UIKA 4AI2A 1IPSA 1GQPA 1MZFA 2XDVA 4R9DA 2EA7A 3BPSA 3LD8A 4ARXA 1WW4A 2W9XA 2JDMA 5LA1A 1XSQA 4HN0A 1PVC2 1UIJA 3WVJA 2OVUA 5J3UA 3KD4A 5CA6A 2PAMA 4MGTA 2OUHA 3I3QA 5CYYA 1PO22 2FCVA 3TYJA 4ZS2A 3LKJA 3ZYPA 2W1QA 2OQ6A 4AEDA 5FQ0A 3DV8A 5FWEA 1IS6A 4HSLA 3UK9A 1Z78A 1ODNA 1RVF3 2ZGPA 2O14A 4TWTA 3PJYA 5F3CA 4Q1RA 3QCWA 1A6CA 2VG9A 4IE5A 5AC92 1YWKA 2JB8A 2XBO1 3J8F2 1AYN1 4MV2A 4H7MA 4AQ6A 2PLV1 4FTEA 2XONA 4CZSA 2A70A 3RVHA 2ADDA 3NKTA 4LIUA 5LBCA 1UY1A 1HXS2 2RS51 2WQZC 1PGW1 1X9TA 3CQOA 1ULEA 4XHBA 4Z92B 2WA4A 5H9SA 1UOJA 4MZUA 2R30A 5LBFA 5BY5A 2ZHNA 1ND3A 1CN1A 1VAMA 2BGOA 2ZX2A 2ZAHA 3MF9A 4NRPA 4UYBA 1W8OA 4KMQA 1LHVA 1RUF2 1OFSA 1V6JA 2G19A 5KC5A 1N1YA 2BNOA 2YFUA 3FBYA 4U36A 3S30A 3SXWA 5T52A 1W6NB 5FZ3A 1SDWA 3MICA 3IZOA 4IV1A 2UYBA 5FJHA 5J7MA 4K6BA 3RI9A 4O7XA 5FWJA 4DY3A 2I2SA 4ITCA 4LBQD 4FPFA 4XQ4A 2VR4A 3JZVA 3POEA 3X29B 2EAAA 3A4UA 2VQ0A 3J9SA 1UMIA 1FT9A 4KU7A 3JBG3 1VBB2 2Y38A 4XJZA 5FKBA 3VBFC 5F7UA 4AHZA 4BYYA 5C9AB 4B1MA 4HETA 2HJIA 3N9NA 5C70A 3I49A 1CR7A 2P37A 3B94A 3A21A 2RDRA 3MW4A 4IEQA 3ILFA 4KG8A 3WDVA 1KDMA 2WNOA 4AVCA 1YRZA 5GJ6A 5FPZA 2ZEZA 3ZM8A 5DDJ1 2TUNA 2VCMA 4AI0A 4H2AA 5ABJC 1BHGA 1FPN2 1RMU3 1JU4A 1RITA 4A7YA 5F3IA 1YCIA 2D7FA 4N8MA 5FZ0A 5JWPA 2A6VA 1UX7A 2ZGMA 4XEZA 4YYOA 3M4FA 3RSJA 3KS7A 1IG0A 4Q0SA 3BOWA 2QQJA 2D3RA 3SNMA 4CEWA 5JSOA 2J1UA 1MVEA 4ET7A 1HLCA 3WF3A 3VDCA 1XE7A 3MO4A 2VVFA 1PGL1 4YVSB 4ASLA 1YQCA 3N7MA 2E7AA 5FYBA 3I8TA 3G7DA 3WCRA 1YQ8A 1UYXA 1QQP3 4H55A 4AR2A 5KXBA 4CE8A 4RGAA 2ZXQA 5CKMA 3WEZA 4CDWB 3PUHA 4AAXA 4XUPA 2GN7A 2PTMA 1WW6A 2MEV2 5FUIA 4B3NA 1HRV2 4RQPB 4LA3A 3USUB 1US3A 2OX0A 4BQ3A 3T1LA 1S0IA 4QGLA 4CDQB 1W6MA 5A1FA 5FJKA 3SHRA 1SCRA 3ST7A 1DYPA 1KS5A 2J1TA 5HPOA 3PVEA 4QHZA 4WM7C 2D40A 1TMF2 1VBD1 1ASJ2 1VPHA 1UWWA 1W39A 1NG0A 3ACLA 3AYDA 3FC0A 4XF0A 1IS4A 3POBA 5KWRA 2WO7A 4EWEA 1GLHA 4Q4V1 4W6WA 2R6QA 3V56A 4NHMA 4NROA 4A44A 5C33A 1IPKA 3QBQA 2VUAA 2Y0OA 3WP4A 4BA6A 4RFRB 2DWRA 1O3RA 2PXJA 5FXVA 3ZYGA 4LMFA 2RDSA 2ZMNA 2FDHA 1LTEA 4BISA 3KWVA 5IWFA 1SG3A 1ODMA 1SHWB 1JMUB 1W0NA 4YM1A 2BRTA 3POJA 5FTTC 2K46A 4COWA 1UU6A 1RC6A 3WSOA 2JDKA 4IEUA 5G04L 3WW4A 2QQWA 2XKOA 1BVVA 4XJAA 3E6BA 1JUIA 3KV4A 1JZ2A 5FZBA 3T2OA 1DHKB 4N9IA 3KSCA 4N9HA 5FZ8A 3RZJA 1W9FA 2OA2A 4Q8KA 4XOGA 3O1OA 1JYTA 1UO9A 4Q26A 1QOSA 2IXKA 3OEAA 5LBBA 1U5YA 1DP0A 2HWC1 3GYDA 4I0AA 4FPCA 4GA9A 1OT5A 1IKQA 1PIV2 1LEMA 3PUIA 1W2NA 2WS93 2V5DA 3ZSLA 3LEMA 3HMYA 1GP4A 1ZA4A 1MS5A 4Z1VA 4FFIA 3VBRC 4BPZA 4QX1A 4DNYA 1AR71 1ZBA2 4CP9A 1Q56A 2JD4A 3WP3A 4GB31 1MZ6A 4OUMA 2JD9A 5FPLA 3ZSEA 5A6QA 5HCHA 3KZ4C 3GZTB 2AENA 3VBUA 4V1PA 1VB4A 3P6BA 1WLCA 3N9PA 4RHV2 5JXJA 3NRUA 5FMBA 3ZFGC 2R0HA 2WABA 3VBHB 2HBTA 4PJYA 5CEHA 3NAPA 1ZX5A 5T54A 3ZSMA 4ZU5A 1TME1 4XQWA 4D8MA 3E5UA 5EWSA 2IXLA 1ENQA 1RUI2 3POSA 5JPNB 1ZREA 1C8M1 1EYBA 1R1A1 4GMP3 4XTMA 3EB7A 3LOIA 3AMMA 4Q4Y1 5FY4A 3IIIA 1KFUL 5JAXA 3RI8A 5FZ1A 1LGCA 5DUUA 3R6SA 4CCNA 4F3JA 5FZCA 4IESA 1WLWA 4CU8A 1DGWA 4FPYA 4LE4A 4JKMA 1G9DA 3RYKA 3O1TA 1LB2A 2F4PA 3K77A 4GWMA 4RGGA 4D6QA 1C8NA 4XE9A 2ZPXA 1ZBE1 5A32B 2IXIA 3LCPA 3RMXA 1NY71 1I6XA 4L0PA 3MIGA 4XCAA 3GHNA 3VL9A 4XVHA 5FYZA 4C90A 3H8RA 2B9VA 3U4XA 2VZSA 5FYCA 2FDJA 4AEDC 3CJIA 1BEV3 3EYPA 1PNFA 2JICA 4Y4RA 5JPMB 2K2SA 4RSUA 4E8CA 1EY2A 4LBMA 5H9PA 4IGOA 3BI3A 1GBGA 3JB4C 1NA1A 1XXNA 5EYXA 1HQLA 1L3JA 2R071 4UBHA 2CL2A 1EAH2 4L11A 3ZXEA 5FUNA 2FBEA 5DMYA 5IFPA 4UFMA 4XPVA 3JB8A 1L7LA 1AL21 4EN6B 3ETQA 4JCKA 3ZO0B 5JZGC 4CCJA 4XF4A 5JMOA 1F4AA 5A7OA 3AKPA 2VJXA 3Q8AA 1ND3C 4MOAA 4IL7A 5BNQA 5A1LA 5F3EA 2DCZA 3VKOA 2JDUA 2D6NA 5GLUA 4LE3A 3AP7A 5FK7A 2WO2A 1SPPB 1GQHA 4XDQA 4IV1C 4BHPA 2VULA 4BDVB 3VD9A 3CBNA 1VP6A 4ZS3A 4I30A 2VU9A 1GOFA 3MZHA 4O61A 4XUOA 1ZRDA 2XHKA 3LEGA 4IEZA 5E6HA 4QKFA 5A3NA 3HVDA 2DURA 4XF9A 2CY6A 5FMDA 3NJXA 3AKSA 1N1SA 5FMCA 3E5QA 5A70A 1OHFA 3RZZA 3FJSA 2R043 3QH7A 3NW4A 4XILA 4AL9A 4CYDA 3ES4A 2WT2A 4QGMA 2OW4A 1YJKA 1ZRRA 3PDQA 1HB4A 1V9U3 3FX3A 4QDRA 3W5MA 4B4QA 1SDDB 2BJSA 5CU1A 1XPWA 2QDRA 2Y33A 3VBFB 3O1UA 4QD2A 1QGLA 2VUCA 2AEZA 2QVSB 1OMIA 3ETPA 2P3YA 4C8DA 2E26A 4FXKB 2DBNA 2XBO2 4A2UA 1AYN2 4ZZ8A 2VMGA 2PLV2 4BQ5A 1CAVA 5AFEA 4AEMA 4DB5A 4CEWC 2RS52 4CDQA 3AL5A 1PGW2 2YZ4A 3TAYA 1DYOA 1R093 3T08A 1H1MA 2ZX0A 4P9YA 5JSPA 3I7DA 4OUSA 4UF0A 1XQNA 3GCXA 2VD7A 1DQ4A 1JHNA 4BQ2A 5IAXA 2W08A 4LKEA 4QQLA 2WNVA 4PHZA 3B9CA 1NE6A 5KHHA 3TBDA 3HN3A 3K75B 1JZ6A 2P3JA 1L7QA 1ZZ6A 3OBZA 3WUDA 1I3HA 3OGSA 1UOFA 3OGVA 4Z2WA 1DYKA 2HYXA 2L9LA 2Y6FA 4AQSA 5JOZA 5FYIA 2IC1A 3IMMA 1E57A 3R4DB 5C8CB 5T5OA 4EE2A 1GU3A 2WQ8A 5E8AA 5IVJA 4W6XA 1S0JA 3K4AA 3B3QE 5CVRA 3WXPA 5IW0A 1DG6A 1ZRFA 4FTBA 2JE9A 4DPNA 2OT7A 3SH3A 5FREA 2CWMA 2XWBB 2W2IA 4C1WA 5E89A 3TB0A 3RZHA 2AC1A 4P9GA 3MYXA 5CFDA 2XUMA 1OUXA 3M3OA 1W8WA 2YYOA 3HWJA 4WM7B 5KXCA 1OQDA 5FYSA 2B5HA 5DDJ2 4IQPA 2OZ6A 4YSFA 5FLJA 1RL3A 2AREA 3N4MA 1PMIA 2C4XA 4GWJA 1URXA 3ITQA 4PBOA 3ZDVA 5GZGA 3OUJA 1AR61 3LDRA 2D3PA 2BVVA 1O6UA 1W8TA 3P3PA 4FPHA 5C4WC 2CAVA 4AVBA 1F8VA 2HEWF 2W47A 2ZS6B 1PHMA 2K0GA 2FDIA 2X05A 2ZJCA 4IE0A 4Y22A 3NV2A 4NIIA 3WCSA 5C5UA 5LK7B 1NLSA 2DFBA 3WP6A 1JI6A 1FMD3 3O0VA 2BERA 3WQBA 1PGL2 2VM9A 1W05A 3U4SA 4EN8B 2RMU1 3CZUA 5DG2A 1CAWB 2NMOA 1GZTA 4OZXA 4D3WA 1OF3A 1WMFA 1I9RA 2XWJB 1OI6A 5IFTA 2IVIB 5ISLA 1QF3A 3W20A 3ZR6A 4TTGA 4J1WA 3M2MA 1M4WA 5I0SA 3FLPA 2X09A 4AXOA 3GJAA 3L9JT 2VMFA 2WWSA 4RR3A 1CZVA 3AKRA 5FIXA 1YFXA 1OSGA 2CDOA 1SCSA 4LKSA 5FP8A 1A78A 3NV4A 2Y8KA 4XFFA 3DECA 1WA6X 4K40A 4DUXA 5IYYA 1V6MA 1VBD2 2X8KA 3BOPA 2P17A 3Q8CA 4UI9L 3D0SA 3VBUC 3VBRB 4QU1A 2P2KA 2JIGA 3RRDA 5FZ6A 4GQ7A 1ZVFA 3J7LA 3PUAA 3OBTA 4MHRA 4QDSA 2FD8A 1QU0A 5A32A 3HR9A 3ZDSA 1UD1A 4RYDA 1BBT1 3POFA 3T1MA 3CF6E 5F5IA 3UJQA 2IWGB 4LO5B 1OPMA 1H2NA 2NPIA 1YI9A 5BNNA 1QJEA 4OHWA 2E6VA 1RYYA 3ZOIA 1Z7S3 3NKGA 1XE8A 2EIGA 1PGSA 4S2DA 1EV13 1QJX3 1JYWA 4NUBA 1US2A 3ZYIB 5JXHA 4UFIA 2YPJA 1UZYA 2VOXA 5HBAA 4Z82A 3U75A 5C7GA 2DVDA 2AUYA 5C3PA 1JHJA 1GWLA 3LA2A 1NOVA 2P3IA 1O5LA 1C3HA 1QY4A 1LHWA 4M4PA 2DTYA 3J7MA 2HWC2 2XJUA 4MGKE 4EZ4A 4CDUA 1PMJX 5DABA 2QQOA 2D5FA 3CJIC 2B42B 1C4RA 2BQPA 3BODA
chains in the Genus database with same CATH topology
5K8SA 1RUD3 4P9XA 1DIWA 1AVBA 4ES9A 4TZDA 1NA1C 3H7JA 1O7FA 1AR72 2YUEA 5FQ0B 4GB32 1V6IA 2ZHKA 1REFA 4DS0A 4AHWA 4R4XA 2G4IA 2ZZJA 4ZKTB 1SBDA 1S0FA 1BCXA 2OPKA 2ZGQA 2DCJA 3OBRA 1WD3A 3ASIA 1QJY3 1TME2 4AI1A 1AYM3 4AGGA 4E2SA 4KQ7A 1C8M2 4JDMA 1R1A2 1ND3B 3D0JA 4WV8A 3IT8A 1JTZX 4WVZA 1G9CA 1QXJA 1NCRA 2H6CA 4M0NA 2PAEA 4Z07A 4YW2A 2UWAA 4K1YA 4LHKA 2BFUS 1BJQA 1RUJ3 1XNDA 4IV1B 4Y26A 3I2DA 1HRI3 1G8WA 1UU5A 4D94A 1ZBE2 1NY72 3RJRA 4AI3A 1F9KA 1MS1A 1POV3 5FDBA 2ZX4A 3B69A 3OD0A 1QXRA 1COV1 5FBZA 2O8OA 4P9JA 1PZ8A 3JD71 4RS5A 4UBGA 4XXPA 5C6CA 4AYUA 1G7YA 1JXNA 3VL8A 3ZXKA 4D7TA 5FOBB 2Z5WA 2YGMA 1SEFA 4M0HA 2R072 5JDBA 1AX1A 1PVC3 5JR7B 4P5HA 4INDA 4F83A 4CDQC 3SITA 3AMPA 1AL22 4JQRA 1JOJA 1A8MA 4EN7B 2ZTNA 4R9CA 1PO23 4Q2FA 4HMZA 2WNVC 2BWAA 1VIWB 1QMJA 1A8DA 4XJ9A 3VN4A 5AFBA 2YGLA 1DBNA 5AC93 3AP5A 3KCCA 4Q0PA 3J8F3 1DLLA 1Q8PA 1GR3A 5F6KA 4COUA 5I8YA 1N3OA 4YG6A 4M3CE 1SBEA 2E53A 4N90A 2R0FA 2GDFA 1HXS3 4QPIA 1OLRA 1GSLA 3AK0A 3UKNA 1RUI1 1Q3EA 1W6MB 2HWD1 3WDYA 5CFDC 1NQJA 2LTNA 5E16A 3O5SA 2C1FA 3D4KA 3O7OA 2GZWA 3NV1A 4KWLA 1S2BA 3PLQA 1SLBA 4QHBA 4QMAA 5HCAA 1KS4A 1MS3A 2Z42A 4XHXA 4Y1XA 4OI2A 1W0OA 2PELA 1BK1A 1MS0A 3SCFA 3G6JB 4BIOA 2JDZA 1XNCA 1U0AA 3VDDB 1O4ZA 4KWKA 1GZWA 2BFUL 4B4RA 2EVXA 1AJOA 1SBFA 4Z8BA 1ZNPA 2FHRA 4AFMA 4JGYA 4NN0A 2KA3A 2WFPA 5BYNA 1FPN3 4XQDA 3VZLA 1UMZA 1FV3A 3B5LB 4BE3A 2HWB1 3I59A 4XFHA 4RR3C 2IZWA 2NM1A 4LBKA 1ZZBA 2KXLA 2WT1A 3RJ2X 2XH6A 2AH2A 3D5OA 3B9IA 1JW6A 1LOGA 1APNA 3IMNA 1QKQA 1PZ7A 1CGPA 4NWVA 3KT7A 4Y20A 4I0WB 4XTPA 2MEV3 1CVNA 1HRV3 3UJOA 2PHRA 3LAGA 3VBUB 2O8QA 1R081 4OVEA 4AQ2A 4EWAA 2ARBA 2EAKA 2ENRA 5JOXA 3OGJA 3CLPA 5BNNC 2DUOA 3MDPA 1AR62 1KFXL 2XLAA 3NAPB 4PLOA 4BCUA 3ZYJB 1DQ1A 1RUC1 3TOJA 1TMF3 3FUOA 1ASJ3 3WDXA 1DGWX 2D6PA 5EYYA 5GLVA 2PYTA 3S0MA 2Q1MA 3H7YA 4IEOA 2DCYA 2VOVA 2A6ZA 1OPOA 1FOD3 4PLMA 5JVVA 2VMIA 2RMU2 2Q8OA 1WBFA 2OYZA 3H3UA 3CU7A 2WL1A 1RUG1 4FQ4A 2PFWA 4Y4YA 4AI8A 2H0BA 2Y0IA 3E6CC 4Q4X3 3B7MA 3IDBB 4PBPA 1H9PA 2LM3A 1H2MA 5F5QA 3CJIB 3W9AA 1H9WA 2BW8A 1D4M1 4AHXA 2IFRA 3ZXDA 4R9BA 1NA1B 1RINA 1CIWA 1DQ0A 1LEDA 4AQTA 2ZAAA 1WLDA 2PHWA 5J96B 1MEC1 1PIV3 4Q4W1 2X5IB 4P9WA 1BBT2 4RL7A 2DU1A 3FBMA 2GALA 4YGEA 3RWNA 1CX4A 1X7NA 2VGDA 3FMGA 2R061 5K0UA 4KL1A 5LK5A 2ZGRA 4GMP0 1ZBA3 2GMMA 1HDKA 3OYWA 1NCRC 3APBA 2UU8A 3AP4A 1XU2A 4XJUA 3ZFEB 4BZ4A 4C0HA 3EO6A 3J26N 1D0HA 4RHV3 5H9RA 4YGCA 5A33A 2BVBA 5BXXA 3BPZA 4PF5A 2JECA 2BGCA 2GC3A 4HVOA 1N3QA 4CEYB 1LHNA 1O3TA 3ZIXA 1UPSA 5BNPA 5L36A 5FLHA 3IM0A 1YFWA 4QXKA 1S0EA 2QE3A 4RS5C 4XETA 5BV6A 1WW5A 4IEXA 4E2GA 5HI0A 2IXHA 3VKLA 1GNHA 4P9LA 2AZ5A 4I3PA 4J6GA 5J09A 5C8CC 3DKWA 3U10A 4QU2A 4UW6A 4G4FA 2WNUA 3M3CA 1CAVB 1LOBA 4YG3A 4AEJA 2QUOA 2XVGA 1XU1A 3BB6A 2RE9A 2XJVA 3MIDA 1DQ6A 4ZU7A 3SMHA 1C28A 3MPBA 4AW7A 2EXKA 2WNVB 4R52A 3B01A 5IK7A 1EAH3 3KM5A 4LBLA 4QPIC 1D4VB 1VBA3 4J1XA 2VOKA 3KGZA 2A71A 2XL9A 3DUIA 3N7JA 4LUKA 3AP9A 3DF0A 3VDDA 4Y1ZA 4AVAA 4Q0UA 4EWDA 1BZWA 4AFBA 1COV2 4S2HA 5C8WA 4XFIA 1H8VA 4JC1A 2LALA 5FCCA 1V9U1 3JD72 4R9AA 1VBC1 1TQ5A 1ENRA 2E7TA 3VKNA 5CFDB 1MS8A 3ROUA 1LOCA 2ZGLA 4UW4A 4Q0QA 4OHXA 3JCIA 1Q43A 5DZFA 3CL1A 1KXGA 3AZZA 1FXZA 2JENA 4YFWA 5AVAA 2QCSB 2SLIA 2UURA 5JLVA 3H0OA 2V5YA 2RR11 4YW5A 4JGYC 2B7YA 1VAKA 3ZFFA 5HCBA 4Y22B 1Q8SA 2G9GA 2D97A 4N43A 3S6PA 2XBO3 2DU0A 4GULA 2HWF1 1AYN3 4U2AA 2PLV3 2VW1A 2ZKNA 1V6NA 2RS53 1AR93 3I54A 5BUVA 2BBVA 3RNSA 1QNWA 1S55A 4JAAA 1WMDA 4RR3B 3ILRA 2W0XA 2GH8A 2HWD2 1FATA 2ZBJA 4K3UA 5CB7A 5FPXA 2JEMA 2NMNA 2QKDA 4HKWA 2ZGKA 4WVWA 2BNNA 5SV5A 2WZR1 2ILMA 2ZGSA 4UW3A 1CJDA 3AZWA 1RJ7A 4XF3A 1JUHA 3D6EA 4K8FA 3NV3A 1AJKA 3MW3A 4DMIA 2QFEA 4META 5BNNB 1WA4A 1AX2A 1Y9QA 4OHZA 3AX4A 1RHI1 4MXWB 3OF1A 1IGOA 5JOWA 3LA7A 4WVMA 5DDJ3 3WW1A 1MVQA 5T5PA 1H2KA 1FMD1 4GKXA 5T5LA 3VV1A 4URTA 3J4UH 3TNPB 1W2UA 5FAXA 4XFBA 2HWB2 2X5IA 3N35A 4BWOA 2QZ2A 4CDUB 2WJSA 2GMEA 1Q8QA 1OOPA 1DU3D 2JXAA 4IXLA 4LEJA 4B7KA 3NWKA 3IDEA 4H14A 2GC2A 4FCAA 3ZFEA 3PJQA 5JIAA 4RFT0 2RS11 1DQ5A 2D5HA 5HXVA 1AF9A 1PO13 1S0DA 1GANA 2GNMA 4FP3A 3T2TA 5KHIA 2PN5A 2YV8A 4YZ4A 1F5FA 4FO9A 1R082 4CEYA 3D8CA 2F6BA 1VB2A 4E9KA 1J3PA 5K0UC 2JG9A 3PMEA 2GC0A 4JTNA 4GKYA 2GNDA 1ND2A 2VH9A 4BMBA 3PVBB 2YC0A 1RUC2 2UYAA 1UW8A 3UKTA 3WQ1A 3AZVA 1IZ3A 4LUMA 3ZSJA 1QJX1 3AXEA 3TN91 5FO9B 1NCRB 1ZZCA 4M01A 4KGQA 4Q4V3 3VHRA 1GYKA 4X6RB 3LGRA 5J36A 4KWJA 3QH6A 4CP1A 1RUG2 2RHPA 1ZZ7A 2ZA9A 1H4HA 2AR6A 5E88A 5BNPC 2BPA2 3O12A 3O0XA 3RQ0A 4I02A 1GV9A 1O4YA 3CJXA 4K20A 1F5JA 2Q5TA 1V6KA 4XXAA 4ORFA 1D4M2 3N3HA 4CDXA 4RS5B 2XLGA 4TSVA 2A3YA 3LZZA 1WCDJ 3H1WA 3DL3A 2WIIB 4F8AA 1SFNA 3AM2A 4PIZA 1PM7A 2WNUC 5F1RA 1MEC2 4Q4W2 2CYFA 2RS31 1RUH1 4KBBA 4K21A 5A3LA 2WSUA 1BMV1 4IEVA 1U5ZA 4TLFA 2R062 5ACA1 1ZZ9A 2A5ZA 4QPGA 1O4TA 1U5XA 4EROA 1SLLA 2VPVA 3ECQA 2VECA 4QQHA 1TNRA 3GALA 4HLTA 2VNRA 4RA0A 2BEOA 5CADA 5T3NA 4GH4B 2CGPA 2CNAA 2N7GA 1HIXA 2A6WA 1O3SA 4ASMB 3VDDC 1TME3 4QPIB 1QJU3 1AXYA 1POV0 3FWEA 4QM9A 1C8M3 1R1A3 3VKMA 4AG4A 4Q4Y3 1TNFA 1XYPA 2ZZQA 2VNOA 4IEWA 3N7KA 1NCQB 2OIIA 2XPJA 3LA3A 4LBQA 5EJ3A 4C0BA 4LLFA 4LHLA 4AF9A 4BM8A 5I0TA 5HCFA 1CESA 1ZBE3 1SLTA 4ZU4A 2GNTA 1QNYA 1R1ZA 1XNKA 2EXHA 5FRAA 4L8QA 1UF2C 3OY8A 1ZZ8A 3ZFFC 2CGOA 5LEJA 4BQ1A 2VVEA 5GZFA 5AVPA 1GZWB 2XJSA 4MH0E 2XJQA 5LRRA 1W0PA 2FMYA 5CAZA 2WFF1 4N43C 4JGYB 1N1VA 5DZGA 3RDIA 1JYCA 1RGSA 2YDEA 3WW3A 2R073 1RUE1 4FXGB 5I93A 2TBVA 4YM0A 4E4ZA 4K1ZA 3QD6A 2ETEA 3B00A 3NAPC 2FQPA 1LR5A 2H6BA 3I59B 1UPIA 2V09A 3HBZA 4W65A 5KHGA 1J1LA 2GNBA 4XIOA 5IK5A 4YW3A 4M3CB 1J1TA 1VBE3 2A6YA 4YFZA 1LHUA 3ZXGA 1N1TA 3UKVA 3MIFA 3EBRA 4MXWA 4FOYA 1V9U2 1VRH1 1VBC2 4MGZE 5I8TA 1KQRA 3PVNA 2NLRA 1O91A 4Y20B 1HX6A 4NOTA 1LOFA 1REDA 2QNKA 4S2GA 1Q8OA 2I45A 3MLKA 4OI0A 4RD7A 1LCLA 2NN8A 3AXDA 1OFNA 2CWSA 2RR12 1G9FA 4XMIA 1I5ZA 3RYRA 2JG8A 3POWA 4R4ZA 5IK4A 1QDOA 4ISRA 4D7YA 4C91A 2RM23 2R32A 2X5IC 5I8SA 2DUPA 1DQ2A 2HWF2 1MZ5A 3OCPA 1YHFA 1QH6A 1AR81 1PK6A 1XRUA 4B8EA 4CP2A 2PAKA 4WZFA 2BTVC 4Y1YA 4OLLA 4YZ3A 1H1AA 1OKQA 1YO8A 4Q27A 3WG4A 3ZFEC 1GZ9A 1GZCA 1REEA 2TNFA 4OULA 3DPRA 4BH9A 3AMQA 4C1XA 4YW4A 4WM8B 1YFYA 1HKDA 4MVTA 1F31A 3DGTA 2HWE1 4CEYC 2WZR2 2JG9C 2MHFA 2Q30A 4LO8A 3FZ3A 1ND2C 4Q29A 2DVFA 3E6DA 4YSFA 4AFCA 4QT6A 1YLLA 2PHUA 5K0UB 2XJPA 4HSJA 5KHKA 1S2KA 3OYWB 4JTOA 5FO7B 4FPKA 5IUQA 1RHI2 4L99A 5GLWA 1C1LA 3IIAA 3O0WA 1CQ9A 2DYCA 2DCKA 3NO8A 5DXDA 1FMD2 1RVF1 5A33B 1PNGA 1G6NA 1V00A 1AR63 3H3ZA 3EHKA 2WQ4A 3MI8A 2WNEA 4AHYA 2QQPA 1DF0A 3GBGA 3IPVA 3SH5A 1K5MA 3MF6A 5BNPB 4CDXC 3RG0A 1NQDA 5J37A 1KJLA 3WOGA 2GMPA 2WSVA 2RMU3 1UAIA 1AZDA 2XVLA 4XYXA 2RS12 1W6PB 3ENRA 4Y1VA 4GH4A 5FFOC 1I1EA 2Z2SB 2DFCA 4FP2A 1FNZA 4G9SB 1DZRA 3WLUA 2WNUB 4BMEA 4QPGC 4HN1A 5KBFA 1JYIA 1WW7A 4B29A 4GALA 4YW1A 4AGRA 5D8AA 4MLOA 4FPJA 3NJZA 2DTWA 1RUF3 3HN1A 3JBG1 4HKOA 4LR4A 1NCQA 2ZGOA 3ZXFA 2VOWA 2DVBA 1QJX2 3KCXA 3TN92 2XVKA 1J3QA 1C5IA 3R05A 4LNVA 4TYSA 4FQZA 1KJRA 2VMHA 3JQXA 3V0BA 1AUYA 2W52A 3MFAA 1RMU1 1LULA 3R4UA 1TE1B 1VBB3 5DZEA 4N53B 4LHNA 5I0RA 4JDNA 4GWNA 4UW5A 4XJ8A 4MX3A 3VHOA 3AFKA 4HZFA 1VJ2A 3TRSB 2YHJA 2JE7A 3GF6A 3O14A 4OI1A 3JUUA 1U12A 2C9AA 2EXJA 2I07B 1QWRA 3AYAA 1HQNA 2XG3A 4HT1T 4QGNA 1QQP1 1WMEA 2WKKA 2RS32 1RUH2 2IXJA 3TNQA 5E1RA 1ZRCA 1BMV2 4M3CA 1Y43B 3WW2A 4ISQA 1WCSA 5ACA2 1XNBA 3WNXA 3M8LA 3ZFFB 4FVVA 4YVWA 3ZIWA 4H7LA 2EF6A 3GBWA 1LU2A 3UL2A 3KT1A 4M00A 1UX6A 3NVCA 4N43B 1QJZA 1CPNA 1LGBA 3WDUA 1W6QA 4AFAA 1VBA1 5JOYA 5JI9A 1DFQA 2Q1ZB 1HW5A 1NXD1 1H2LA 2GH2A 5GLTA 1DZQA 4XJWA 4JRLA 2K9ZA 1H8TA 3M1HA 3ZN6A 1HV0A 1QHDA 4E4SA 2G9FA 4KU8A 2ZX1A 4NWWA 1JBCA 4XZPA 1LOFC 2O1QA 2OZJA 3N7LA 4QQPA 2ET7A 3VBOA 1UU4A 2OUJA 1S0CA 5CIRA 3QLQA 3ME2A 1GICA 5GZEA 4CDUC 3A0NA 1IOAA 1EPWA 1WD4A 1NE4A 3EQEA 4UXAA 4OFGA 5FO8B 3AKQA 2UWCA 2ZHLA 2ZACA 5DUXA 2JG8C 1COV3 4Y24A 2YXSA 1YXWA 1SLCA 4ONUA 2WS91 3ILNA 3JD73 3ZPYA 2Z69A 4H3WA 1FV2A 4AK3A 1DDLA 2R49A 1J59A 4L2NA 3KLSA 4PLNA 2WFF2 2DCTA 2IXCA 5DG1A 3VBSB 1XYNA 4WM8A 3I4IA 4WVMB 3PNAA 2XKPA 1IS5A 1RUE2 1T6GC 2Q4SA 3ES1A 1PK6C 2QDNA 3FE5A 2AGSA 2EXIA 3V0AA 1LHOA 3USSA 4YZ5A 3ZXJA 4AE2A 1UKRA 3MLJA 1AR91 5JZGA 4BIFA 5I0UA 1WUVA 1RJ8A 3WINE 3ZX7A 1OOPB 4WZCA 4JDOA 3FFZA 3WD5A 2D43A 3DPRC 3WV6A 4FSJA 4NHLA 1WLTA 4MGYE 5CFCA 4GMP1 4IERA 4EN9B 2ZGTA 1VRH2 3U0ZA 3ZMOA 1VLNA 5GKAC 4FOQA 4S2FA 5IT6A 4KNCA 2SBAA 5H9QA 4FPEA 2XJRA 2C5DA 1LECA 1V6OA 1RB8G 2XLFA 1YUDA 1RUI3 3GZAA 2DVAA 2JG9B 1Y3TA 2HWD3 1LU1A 1X82A 3HAGA 4W6YA 2KM2A 1ND2B 1FNYA 2PHLA 5SV8A 5L19A 2PQQA 4HK8A 3GZUC 1BEV1 3KMHA 4PDWA 4QQ2A 4A3XA 4AVSA 3IBMA 1CPMA 2ZMLA 3ZN5A 2UWBA 1ULGA 1W6PA 1Q5OA 1D2QA 2ZOEB 2VVDA 3PTYA 3VZKA 5BNOA 3SCHA 1SACA 1AR82 1K5MC 3E5XA 5DUWA 3LSDA 3VLBB 4I09A 4YARA 3DN7A 3QOPA 3GBFA 4MYEA 1KDKA 1LOEA 2GN3A 5KXEA 5K7PA 4CDXB 4GH4C 3MIHA 3THPA 4YG0A 4FTSA 3M3IA 5T50A 3WHTA 5KXDA 4WVVA 2VW2A 2HWB3 4SBVA 2HWE2 2WINB 3JQWA 1LENA 1PO11 3AYCA 3PVOA 4IV3A 3VZOA 3INAA 1MZEA 5A3MA 4HPKA 5D8AC 3CEWA 1N3PA 4N53A 4DXZA 3SLIA 4JGZA 2A75A 4LT5A 1NCQC 2R041 1B35B 3MFCA 4QPGB 1FX5A 4X6QB 3R4SA 1J3RA 3NL1A 2NQYA 1AXKA 2W68A 4LBJA 4JV4A 1PVXA 2O0OA 1FOD2 1RVF2 1R083 1HQWA 1MQTA 4AEKA 4AVTA 1TEIA 3ZSKA 2UY9A 2PHDA 4FOWA 1UL9A 1IKPA 4P14A 5IK8A 1RUC3 3FLRA 4KH9A 4Q4X2 2FZ1A 1ONAA 3WG3A 3MGUA 5C4WA 2PHFA 3GHMA 1R091 3B93A 2ET1A 3A0KA 3S7IA 1Z0HA 3AZXA 4LBQB 4CRQA 5T55A 1RUG3 1GKBA 1ENSA 1LGNA 1SQ4A 3BALA 3C3VA 3K51A 4CP0A 1CAXA 2YROA 5EXOA 1DGLA 3HD8B 4WBBA 4NVPA 4XF1A 4FPOB 3BTAA 2CAUA 2ES3A 3HT1A 1QXPA 2V73A 2GAUA 3OY8B 3WR0A 1NYWA 4LA2A 2WLQA 1D4M3 3RS6A 3RYPA 1BVP1 1ALYA 1F2NA 3AZYA 3H9AA 3K48A 4YVWC 3JBG2 3C2UA 2CTVA 1FI2A 3M70A 1M06G 4FPGA 4LLOA 3OJBA 2DV9A 1YFUA 4DOUA 3GNEA 1MEC3 1LKNA 4Q4W3 1MACA 1VAVA 5GZCA 1VR3A 2A3XA 5L7OB 4D7SA 1RMU2 2R063 2ZABA 4Y5Z0 4YM3A 4LO4B 1H8TC 4XFCA 2D6LX 3BIWE 1QJU1 3ZXAC 3WY6A 4JRAA 2WA3A 5LRSA 3KGLA 3RMYA 1BQPA 1X36A 3AMNA 3IKWA 4HBNA 3WT3A 2Z79A 5JCTA 2P3KA 2VW0A 3VBOC 2VNGA 1C5HA 3TWIA 4GXLA 3VBSA 4COVA 3KCYA 5EZWA 5F9TA 3OTFA 3B02A 4L92A 4LBNA 4EJRA 4K9SA 3WUCA 4XBQA 1KRIA 3VZNA 2R16A 2A6XA 1QQP2 3W58A 3WZ1A 2MPFA 3URFA 1RUNA 2ARXA 3THTA 2H0VA 2JKBA 4XFGA 1NZCA 1LODA 1BYHA 5CBLA 4B4PA 1O5UA 2CGNA 3VUOA 2D98A 1SFYA 2D93A 4PIYA 4YRDA 5KC6A 4WM8C 2JG8B 2BUKA 1D0GA 2B45X 2QZ3A 5TSWA 3CO2A 3D82A 4HANA 1W6NA 1XYOA 2B8MA 2DF7A 5D1IA 4HVQA 1GNZA 1BKZA 1UCXA 1CAUB 1VBA2 5JSRA 3OGGA 3U11A 4MGIE 4AWDA 1PK6B 4FOVA 2VXRA 3N36A 3VHNA 2HEYF 1VALA 1SLIA