4GMP1

Crystal structure of enterovirus 71 strain 1095 procapsid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
225
structure length
218
Chain Sequence
HSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGGVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTKDLEYGACPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the procapsid and mature virion of enterovirus 71 strain 1095.
pubmed doi rcsb
molecule tags Virus
molecule keywords capsid protein VP0
total genus 31
structure length 218
sequence length 225
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gmp100
2HWE3 1ND3B 5D8AA 5A33A 2R073 1RUF3 4FTBA 1HRI3 2R041 4IV3B 3VBUA 4Q4W1 3VBFA 4WM7A 3CJIC 1AR72 4Z92B 4QPGB 4GB32 1TME2 2XBO3 5BNOB 4Q4V3 3NAPB 1NCRC 1VB4A 5CFCB 3VBOA 3M8LA 3LOBA 5K0UA 5LK7B 1R092 1AR93 5C9AA 2RS13 1HQNA 1RUI1 3CJIB 1FPN2 4YVSC 1PO22 1RUH3 2HWE1 5BNPB 4WM7B 2WZR3 3VBFC 3VBSC 3ZFGB 1ZBE1 2HWF1 1MEC2 4IV1B 1NCRB 5A32B 1R1A1 1RUE2 1AR83 2X5IA 1PO13 1VBA3 1HRI2 1OOPA 1EAH3 3J8F2 4NWWA 4JGYB 1VBE3 1EV11 3ZFEC 4RS5A 5CFDC 1AYN1 4QPGC 5ACA1 1QJY2 2HWB1 1A6CA 1D4M1 4YVWB 3VBHB 5BNOC 1VBB1 2RR13 5L7OB 1COV3 4JGYC 1Z7S3 2HWD2 2MEV3 1AYN3 5FOJB 1QQP3 3VBUB 5BNNB 5CFDB 1PO11 1RUD1 1RUG3 1COV1 4RS5C 1BMV1 1HXS1 1RUF2 4N43C 3DPRB 3ZXAC 3VBRA 2FZ1A 3FBMA 1AR81 4CEWA 1V9U2 5JZGC 4PDWA 5C4WC 1AUYA 2R071 3JBG3 2RMU2 5DDJ3 1PGL2 1TME3 1NA1B 4CDQA 2BBVA 1ND2B 1ZBE3 1R082 1OOPC 5AC92 4GH4B 5AC91 1RVF1 5FMOL 2ZAHA 1QJX3 1K5MA 1DDLA 3ZFFC 1K5MB 5JZGB 4YVWC 5ACA2 3VBRB 4CEYC 1AL21 4EJRA 1FPN3 1PVC3 2WLPA 4CEWC 1HX6A 1RUJ3 1RUD3 4RHV2 1BEV3 2RM21 4Q4X3 1E57A 4QPIA 3VBHA 1C8M1 3VBHC 1X33A 2TBVA 3VBOC 1EV12 1VBD1 4Q4Y2 1POV3 4LLFA 3J8F3 5C9AB 4FTSA 4RQPA 2RS31 4CDWC 5DDJ1 1V9U3 3VBUC 4Q4W2 4YVWA 5BNNC 2WWSA 2RM23 1BEV1 1PGW1 3JBG1 4Q4X1 4NWVA 3TN91 3JBG2 3DPRA 1BBT3 3VBSB 4Q4Y1 2WS92 1ASJ1 5DDJ2 1D4M2 1SMVA 5BNOA 1VBE1 2HWC2 1NA1C 1VBC1 4QPIB 5AC93 3JB8A 2R043 4RHV1 1ND2A 4CDXA 1Z7S2 1TMF3 1RMU3 1BBT1 1NOVA 4FTEA 1HRV1 1QJZA 1MQTC 1C8NA 4GH4C 5K0UB 2XPJA 5BNNA 4Y5Z0 1VBC2 2R062 4WM8C 4WM7C 1RUG2 4GMP3 2WS91 3CJIA 5L7OC 2VQ0A 1FMD3 4N53A 1RUI2 3VDDB 1QJU3 4CEWB 4JGZB 4Y4YA 1RUC2 4BCUA 2RR11 5K0UC 4CDQB 1BBT2 1HXS2 1R083 4IV3C 2WS93 1Z7S1 1B35A 1C8M2 2RS53 1PIV3 5BNPA 1TME1 5C8CC 4CDUC 1HRV3 2GSYA 3HAGA 2PLV1 1RUC1 1R081 2WFF3 4RR3A 1PVC2 3JB4C 4JGYA 2RS11 3S6PA 2RS12 1BEV2 4Q4X2 4CDQC 3NAPA 2RMU1 1NY72 4AEDC 1MEC1 2PLV2 4RS5B 1R091 5FMOS 2R063 1NG0A 1F8VA 2FZ2A 1IHMA 5CFDA 4N43B 1ZBA1 1PO12 1EAH2 2ZZQA 1RB8G 1NA1A 1AR91 4GB31 1PIV1 4IV1A 1RHI3 4PDWB 1HRI1 2XBO2 1VBB3 5CFCC 5GKAC 1ASJ2 1RUE1 1OOPB 1ZBA3 2R042 1AR71 4JGZC 1RUJ1 1K5MC 1PO21 3JD71 1MQTA 1FOD3 1VBD2 3ZFEB 2HWF2 4YVSA 5BNPC 2HWE2 4CEYB 3ZFGC 1AR63 1H8TB 5JZGA 1QJY1 2HWB2 4N53B 1AR82 1RMU1 1NCRA 1RUF1 1FMD2 3NAPC 1RUI3 1NCQC 1RUC3 1VBE2 4CDWB 5D8AB 5A33B 1CD3G 4RQPB 1QJY3 1PGW2 3TN92 5C8CA 3JD73 3VBFB 4CDUA 2RS52 1VB2A 1ZBE2 1AR92 2IZWA 1VBB2 4PDWC 4IV1C 4QPIC 1ZBA2 2HWD3 1NCQB 1QJX1 1PO23 1RUH2 2WZR1 1RUH1 1COV2 1BMV2 1AYN2 4GMP1 4CDXC 1QQP2 1ND3A 2GH8A 2WFF2 1ND3C 5ACA3 1W39A 1M06G 1CJDA 5J98B 2QQPA 2Y26A 1AR62 1RUD2 2PLV3 1VBA2 2HWD1 1H8TC 3DPRC 4RFT0 4WM8A 1EV13 3VDDC 4FSJA 1F2NA 5L7OA 2RMU3 5ABJB 2R061 5C4WA 2ZTNA 1PGL1 2BFUL 4Q4W3 1ND2C 1QJX2 1RHI2 5D8AC 3TN93 2RR12 1POV0 1AYM3 2WFF1 1ASJ3 4IV3A 3ZFFB 1POV1 4CEYA 1FOD2 1VBD3 1R1A2 4N43A 3ZFGA 4CDUB 1RUJ2 4RHV3 2HWC1 1VRH2 3VDDA 5A32A 1OHFA 1TMF2 1RUG1 2HWB3 1FOD1 4Q4Y3 2RS32 3VBOB 5CFCA 3IDEA 4AEDB 1AL23 2X5IB 1QJU1 1FPN1 3ZFEA 1MQTB 1RHI1 1X36A 4QPGA 1AR73 1RVF3 1QJU2 5ABJC 3VBRC 2RM22 1OPOA 4GMP0 4Q4V2 3JD72 3J8F1 4RR3C 1AYM1 2X5IC 4AEDA 1AR61 1NCQA 2BFUS 1R1A3 5C9AC 4RQPC 4CDWA 1GFF2 1H8TA 1B35C 1VBC3 1VBA1 1VAKA 5ABJA 1MEC3 5C8CB 4Q4V1 2R072 2MEV1 4SBVA 1RUE3 1V9U1 2RS33 5C4WB 1QQP1 4N53C 1AL22 2RS51 4GB33 1D4M3 2BUKA 2HWC3 4JGZA 1PVC1 1HXS3 1B35B 1RVF2 1VRH1 2XBO1 4YVSB 1C8M3 1NY71 3ZFFA 1WCDJ 4GH4A 2BPA2 1FMD1 1AYM2 1TMF1 1HRV2 1PIV2 1R093 3VBSA 1RMU2 1AL0G 4WM8B 1EAH1 4RR3B 5J96B 2MEV2 2DF7A 2WZR2 1VRH3 2HWF3 4CDXB
chains in the Genus database with same CATH superfamily
1XNAA 1RUOA 3L2YA 4YW3A 4FPJA 3N3HA 1JYCA 3N9MA 1IPKA 2R073 5F32A 3BI3A 2ZGQA 4Y4RA 1HRI3 4YPJA 1OA4A 3HMYA 3ZXJA 2V73A 2X8KA 1F35A 4Q4W1 5ISLA 1SHWB 2XHKA 1OXCA 1AX2A 4FOYA 1X8EA 1GKBA 2D3SA 1OD5A 2PHTA 5LATA 3W21A 2N7GA 3CJIC 3WNPA 3NMBA 1OBNA 1RIRA 4QPGB 4HXCA 2UURA 2C4XA 2P3IA 3PIGA 3IAPA 2Z4FA 1N1TA 1QKQA 3KGZA 3DF0A 4AFAA 5J36A 2ILMA 4Q4V3 2J1AA 2VTFA 4YSFA 3K4DA 3BCWA 4M3CF 5FYZA 5FZCA 4CP0A 1VB4A 4CUCA 5CFCB 5LCWL 4A4AA 2VZ1A 3B01A 3PL0A 5LA1A 5K0UA 3SQOA 5FY9A 3VLBB 4IEWA 1OVPA 1R092 5DAVA 3ZDSA 2EALA 4X6RB 2DCKA 3FFQA 1VAVA 5T50A 2LUWA 3RS6A 3PTRB 5FIXA 2O8QA 4JX0A 4Y1VA 4UBGA 2EIEA 1FPN2 2P37A 3BALA 2WZR3 3PHMA 1DLLA 1JN2P 4DUWA 1SZBA 2VCMA 4PIZA 4AI8A 3C7GA 4GA9A 5E1RA 4A7KA 2GP3A 4IESA 2RDSA 2VVDA 5LY2A 4PIYA 2Q8OA 3CIHA 3SCGA 1GOHA 4AWDA 1PGSA 4QDQA 3ZX7A 3OUJA 5A1LA 4DIQA 3T4VA 2PN5A 1N3QA 5FZEA 3LFMA 3DYMA 2FDIA 4MGZE 4YM1A 1VBE3 2D6PA 4IGPA 5EJ3A 4DPNA 5A7QA 4NHXA 1PK6A 3TEWA 4QX1A 4XF0A 5FP8A 1QDOA 3NQHA 4M00A 5FCCA 4RS5A 1H6YA 2HKXA 3WY6A 1EY2A 4QDSA 1SDWA 3IDAA 1T6BX 5ACA1 2VGDA 3IPVB 1JUIA 5IATA 1QJFA 3J4UH 3N7JA 4QM9A 3KM5A 3QH7A 3GXUA 1T2XA 4QDRA 4OFGA 2ZEWA 4Y20A 2B8MA 2IXLA 1RJ8A 4ONUA 3AKSA 3ILFA 2ZX4A 1Z7S3 1AXKA 3B00A 1W99A 4CCNA 1W6MA 2JDAA 1UOBA 2GMMA 2GNTA 2PHXA 3MEPA 4LBOA 4CXXA 4MXWA 3PU3A 2JDHA 2GU9A 4GKYA 3ON7A 3WNKA 3ZN6B 1RUD1 1X82A 4R4ZA 4QHOA 1COV1 3P1IA 4CUGA 3M3IA 1HXS1 3MV11 1DF0A 2ET1A 4N43C 4H7LA 3LOIA 2OT7A 4M3CA 1MS1A 3RYKA 4NN0A 5I0DA 3KHCA 1JYTA 3CDZB 1WW6A 5T5PA 2QBXA 1GICA 1WD3A 3DKQA 2RMU2 3AZXA 3WCSA 4NUBA 5T52A 3PMEA 2B39A 4Y26A 4HN0A 1NA1B 4CDQA 4K7JA 3RFRA 1OKOA 3GNEA 4XDOA 4IEUA 4AVBA 1C4RA 3V0BB 4NE9A 2GMEA 3KF5A 2IFRA 2JG9A 5FMOL 2ZAHA 4K8RB 4NAOA 5FZLA 2VXRA 1PM4A 2I2SA 5IK8A 3AB0A 4JVAA 1LNSA 2WNOA 5FUIA 1FI2A 1R1ZA 2XR4A 1OLMA 4FPOB 1EPWA 2JB4A 3WR0A 3CMGA 1POQA 2RV9A 2PHRA 4EJRA 2X05A 3ABZA 1DHKB 1W6NA 2Z2SB 3AYEA 1RUD3 4UFLA 4ARYA 1BHGA 3THDA 1UU4A 2G4IA 2RDRA 1C8M1 2ZKNA 1QNYA 2G9FA 1AJOA 3OBAA 4MVTA 4Q29A 4UFMA 2TBVA 5A3OA 2NMNA 3LA3A 1EV12 2WJSA 3KT7A 3ZXFA 4AQ2A 3SEEA 3HIFA 1POV3 3FHIB 3AK0A 1W28A 5T5JA 3K77A 2VOXA 1QGLA 4LHSA 1V0AA 4CDWC 4FTSA 2VH9A 1V9U3 2H6CA 4XE9A 4DZGA 1PGW1 2D98A 3O5SA 3TN91 2J1SA 3JBG2 3RYPA 4Q4Y1 2I45A 1ASJ1 2EXHA 3B02A 2AH2A 4LBKA 3V0AA 1I5PA 3KD4A 5I8SA 1S2BA 2ORXA 1H2MA 1NXMA 3ALQA 4LKDA 3CHXA 4DINB 5JI7A 3D3AA 1JYXA 2ZMNA 3NKGA 1W8NA 1JHNA 3DN7A 2YFUA 4EN0A 2FDKA 3INAA 1BBT1 3ITQA 4FPHA 1YEWA 1XYOA 2A73B 2R30A 4M3CE 2ZMKA 3BU0A 1JU3A 1L7LA 2R062 3FBYA 4YARA 2YXSA 2A3WA 4D7SA 4GAZA 4GMP3 3ZVXA 1IPJA 4J25A 2DYCA 1IKQA 1NKGA 3VDAA 4N9HA 1UX6A 4LXLA 3E5UA 2EF6A 1O4TA 2DUQA 4Q1PA 5BUVA 3A23A 2WNVC 2O1QA 2E9QA 4CU7A 3FHQA 3A22A 2Z79A 5GZEA 3O0WA 2RR11 5K0UC 2BNMA 4CDQB 5FYYA 1R083 1CX1A 2DFBA 1ZRRA 4UW4A 3FLTA 4I0WB 4Q1RA 5JXGA 1C8M2 3N4MA 4EWDA 1DCSA 4ISQA 1XSRA 2KM2A 2PHUA 3WDVA 4AHZA 1H4HA 2GSYA 3W20A 3WOGA 3HAGA 3ZXGA 1Y9MA 2PLV1 5JIAA 3BTYA 5IK4A 4G4FA 2BRTA 1MZ6A 1QDCA 2WFF3 2H0VA 1LJ7A 3S6PA 3FE5A 2L9LA 5L36A 1JYNA 1BQPA 4FOVA 4AEDC 3LIHA 1GP5A 5FY5A 2JG8C 1N3PA 1ZZ6A 4ASLA 1W2OA 2PLV2 3UKVA 4GULA 4QX2A 4XQWA 3JQWA 5I0TA 2B46X 5FZ8A 3RJRA 4CP9A 4P5YA 2YHJA 1OPMA 1IHMA 3N7KA 5F5QA 3H9AA 4BM8A 4NRPA 1H8VA 1GZCA 2V5YA 3POIA 4XILA 5CFDA 4MADA 2BERA 4AE2A 4LITA 1UY3A 1DZTA 1UZ0A 1MZEA 4XIKA 1JUHA 1WA4A 1Q8QA 3WDTA 2B4KA 1NA1A 2Q8CA 4B7KA 2NP0A 1TQ5A 4AGRA 4EE2A 3C7OA 4UW5A 3M7AA 2XLAA 2VQAA 1RHI3 3ETQA 3HQRA 4PDWB 1UIJA 3V65A 4BLJA 1JOBA 5J37A 5JOYA 3I8TA 1ASJ2 1OOPB 3QBQA 2RVAA 1RUJ1 1KS5A 1S0JA 2Q4SA 1PO21 3KQRA 4ASMB 2VVEA 1FOD3 2RDQA 1XRUA 3O12A 2E53A 1JZ8A 1S0IA 4YVSA 3LQCA 5LA0A 1X7NA 4A6SA 2ZPXA 1OI6A 1NXD1 1REEA 3OOXA 3HT1A 2ZKLA 2OIIA 4FPEA 3BODA 1UZWA 3LWCA 4XC9A 5DABA 1RMU1 4Q0PA 4Y20B 2GDFA 1NCRA 1GZ9A 4L92A 2CGPA 1FMD2 4LO7A 3MIEA 3VD3A 5KXDA 3UGGA 4CCCA 4F8AA 3FZ3A 1VBE2 4DFSA 1NT0A 4WV8A 4CUBA 5CG8A 4CA9A 2VZUA 4TYSA 4JAAA 2YGMA 1QJY3 4BE3A 2F4PA 4D94A 1XNKA 1LB2A 4BXSV 2P34A 3MW3A 3VBFB 2WIIB 1AR92 1TZOA 2A6VA 4QPIC 1DBNA 3VV1A 1NCQB 2WZR1 1PO23 2YPDA 2P6CA 3VL9A 2G9ZA 4ATEA 1ST8A 3DGTA 5BXXA 1BMV2 1PMIA 3UK9A 2AYHA 4XAAA 3NV3A 2ZGNA 3M70A 5LEKA 2JG8A 5ACA3 3IBMA 5LBCA 4A45A 4ZU7A 1DGRA 5FWJA 2OX0A 4YGEA 1LOAA 1IQAA 2ARCA 4LBMA 2Y26A 3RZJA 3VZJA 1ULOA 1GYKA 1CAUA 2D6MA 4FP3A 1J1TA 3MO4A 1RUD2 3MF9A 4HVRA 3EYPA 2HWD1 4D6RA 4QX8A 1BYHA 4ARXA 2ZBJA 1WMDA 4XYXA 3FUOA 2GP5A 4RFT0 4DO0A 3PVBB 2IFWA 5CNAA 4Q0SA 3VDDC 2EXIA 4IEVA 3WW4A 5FYBA 3OBZA 3D4KA 4XW3A 4AVTA 1HV1A 2E26A 2JE7A 4QMAA 1JW6A 2JEMA 3HN3A 1U5IA 4P9LA 3H1YA 1O3RA 2O0OA 1VAMA 5L73A 1JYIA 4ITCA 2IXCA 4K6BA 2GALA 1SEFA 5L9BA 1LULA 5FY1A 1QOTA 5GJ6A 3WSOA 2XKPA 3WP5A 2IUWA 3MV01 4XETA 4MGKE 1OMIA 1ASJ3 2P17A 2W0XA 2JX9A 2WNEA 4IV3A 3H50A 3FWEA 4NIDA 1F31A 5GLTA 1V00A 3SNMA 2AGSA 5A3TA 1W03A 5IHRA 2NQYA 3USSA 3LA2A 2XOMA 3AC0A 3OUHA 2BDRA 2ZGMA 1VRH2 3I2HA 4KBZA 3TOJA 3VDDA 4COZA 4JDMA 4QHZA 3RZKA 2IXHA 1HLCA 2VUAA 2YDEA 2F17A 3WDWA 1S2KA 2VZTA 1BJQA 5GZCA 2JJ6A 3NRUA 3CBNA 2X53S 2AEYA 2VCAA 1XB9A 4JRAA 1WD4A 4AEDB 4LULA 1KFUL 5J7MA 1NZCA 2V5DA 1O8SA 2X5IB 3KT1A 1QJU1 3MYXA 3ZFEA 1MQTB 3B9IA 5CG9A 2Y6JA 5FPBA 1U5XA 4XCBA 3AP5A 5FZBA 1K45A 5K7PA 4P9XA 3LD8A 1UZZA 4XCAA 4ZHNA 4MYEA 2QCSB 3VBRC 4LTAA 1D2SA 1JZ5A 4EN7B 2WABA 4ZXKA 4Z8BA 1OPOA 2C0ZA 2JDUA 5CADA 1OA2A 4B7EA 4AOCA 4URAA 4M4PA 2GZWA 5EYYA 1DYOA 1C5HA 1MR5A 1TNRA 2X5IC 3NSTA 2EA7A 3VD7A 1W0OA 2ZGTA 4AEDA 2A6WA 1AR61 3IAQA 1PMJX 4D69A 1NCQA 3O1OA 1JODA 3ZSLA 1ENSA 3RI8A 5IVJA 1R1A3 4N9IA 2DVDA 4XACA 5EQUA 2BTVC 1CAVB 2R0FA 3ZSEA 3ZSMA 4CDWA 3H8RA 4NIHA 3OYWA 1B35C 1VBC3 1VBA1 3I4IA 4ZXEA 1GQPA 1QEXA 1WZXA 3UV9A 3U37A 4M3CB 1ZX5A 5K4LA 3AM2A 2PYTA 4SBVA 1V9U1 5FY8A 4HSLA 3RWKX 1WLCA 3I3DA 3QLQA 4D8MA 5LBFA 1DQ6A 1AL22 5E88A 1AZDA 2UWBA 4QXKA 4YW4A 5IFPA 5EP9A 4P5HA 1UYZA 2K2SA 1EUTA 1D4M3 1W8UA 5EPAA 3RGBA 1CIYA 2BUKA 4IE0A 4S2FA 1PVC1 2JG8B 1FV2A 1XXNA 3AXEA 1O59A 1RVF2 3BIEA 1VRH1 3PTYA 3HOBA 5HXMA 3WF2A 2K46A 2DV9A 2RDNA 4FOQA 4P9JA 3AKRA 5FOBB 1LAJA 4KWUA 2JIGA 2VMGA 1BZWA 4FFFA 1FMD1 1YQ2A 2E51A 1AYM2 2W1SA 3MFCA 4FPLA 4Y1ZA 1B09A 4WM8B 1EAH1 1FX5A 4X8NA 1JZ6A 1HJFA 4TWTA 3ZN5A 3ZYJB 4COWA 1OF3A 1O5LA 1VRH3 3VKFC 4OVEA 5C70A 3U14A 1ZZ7A 2HWF3 3M2MA 4LK7A 4YZ1A 4CDXB 4XUNA 1GZTA 4XTMA 3LA7A 3AP6A 2YBKA 5M0TA 3O1TA 3AYCA 2HWE3 3WINE 3TAYA 1IKPA 3AYAA 2QTWB 1L3JA 2VG9A 1W6QB 5A33A 3WX5A 5IT6A 1IPSA 2WAAA 4FTBA 4AAPA 5FZFA 2Z5WA 4CCMA 4A6OA 4AHYA 3BGAA 2QZ2A 1KS4A 4A2UA 5FRAA 4BQWA 1V6JA 3ZXEA 4BIFA 2V09A 2EIGA 3R05A 4LBQB 4W6WA 4E4ZA 4HMZA 1JZ7A 1SLLA 1BK1A 5FP3A 3O1SA 4A7ZA 5FYHA 1SPPA 2ZAAA 3ZYFA 1W0PA 2CYFA 2P1BA 5DG2A 2W1QA 3NAPB 2HLEA 3LEIA 2E63A 3LOBA 4R9BA 3D0SA 3OPTA 4XHBA 4YW7A 1G9DA 4AGVA 4CP1A 5C9AA 3LDRA 3VD5A 3I54A 2GNMA 1OURA 1UU5A 2RS13 4ZZ8A 1WMFA 1QU0A 1RUI1 5DAWA 4Y1XA 2ES3A 1RGSA 3KV5A 4AVSA 2DVBA 3AKQA 3C7HA 5D1IA 2HWE1 3AP4A 3TBDA 3I2KA 3VN4A 1RJ7A 2BOJA 3CQOA 2HWF1 2LS6A 3WZ1A 4FQZA 3LSDA 4PLMA 5LBEA 5L9VA 4F7ZA 4E8DA 3C7EA 1R1A1 1DYPA 5C6CA 1WW7A 1RUE2 1U5ZA 4B1LA 3V0BA 1AR83 3MHZA 4DRRA 4W50A 1PO13 3I2FA 3I2GA 1VBA3 1HRI2 1UKGA 4KU7A 2EXKA 1EAH3 1H2NA 4AQSA 4CP2A 4DUXA 1I5ZA 2BVBA 4JGYB 4GJYA 3S5QA 5CA6A 2BYVE 5JSRA 4HOOA 1OQEA 4LO4B 4E9KA 2Z42A 3B5LB 4I09A 2NZ9A 2XQXA 4UF0B 1EV11 1CAVA 1I3HA 5FKBA 5LRSA 2BU9A 5F9TA 1SACA 1NUKA 3BN6A 4MH0E 2VC9A 2XL7A 5IVYA 2HWB1 3USUB 4JDOA 1D4M1 2Q5TA 3LEMA 1HKDA 1Q8PA 1VBB1 4V1PA 1ZZCA 4ATFA 1UF2C 3NNLA 5KR7A 2ZS6B 3M3CA 1COV3 1XPWA 4LOSA 2IXKA 4AQTA 4D6SA 2MEV3 1I6XA 4V2WA 4MHUA 4XAEA 1AYN3 2DFCA 1LHNA 3NNFA 4YZ2A 3NO8A 5FOJB 4UAPA 2DVFA 3FX3A 2BGPA 2W1UA 5DQ0A 2VM9A 4V2VA 1VIWB 4LE3A 3BYWA 3ZYPA 2W9XA 2WT2A 3VDCA 3D8CA 1GSLA 3RJ2X 4JQTA 5BYNA 1XU1A 3WG1A 4P08A 1LGBA 5CYYA 3VBRA 2P2KA 1T6GC 3FBMA 1AR81 5JOXA 2UY9A 2VR4A 2R6QA 1DGWA 2Y38A 1MS8A 3PNAA 1LOCA 2VO5A 1CESA 4PF5A 2Y6KA 3AKPA 1PM7A 1AUYA 2R071 5C3OA 5C3SA 1SFNA 3GCXA 5FZHA 5JUVA 5FZMA 4XFHA 1TME3 4KI5M 4C1WA 4EYUA 5A7WB 2BBVA 2WYSA 4AK3A 1ZBE3 1PVXA 2WR9A 3POYA 2JE9A 2GN7A 2QJVA 1TNFA 4K1YA 1S2EA 5FFOC 2ZX0A 1I9RA 4RFRB 5AC91 4CCLA 4KBBA 4O9EA 4UFHA 4CCEA 2CV6A 3MZHA 5LASA 3AZVA 5J48A 1CN1A 4AZZA 1CR7A 3O1MA 1K5MB 2E6VA 5FZ1A 5T55A 2JKBA 4D3WA 4CEYC 1W3VA 2X10A 2D6OX 1ULGA 4Z1VA 3K46A 1FPN3 1YFUA 4U36A 1WA6X 1GANA 2WLPA 2Y0OA 4YG0A 1CZSA 3RVHA 3Q8EA 1NE4A 5DUWA 1H2KA 3TRSB 1K3IA 1JHJA 4JRLA 3KVAA 5FLHA 4L2NA 5FXWA 3VBHC 3LKJA 3VBHA 5JOZA 1GOGA 2VQUA 3Q8AA 3RZGA 1LCLA 4S2GA 3WCRA 3U10A 1VBD1 3WQ1A 1ULCA 4EWEA 4L9BA 1NAEA 3N35A 1Q8VA 4YLZA 3VKMA 3WNLA 2FDHA 1W9YA 3BKZA 1BKZA 5F37A 1RXFA 5C9AB 3DV8A 2AUYA 4MV2A 2XJSA 1RC6A 2Q30A 3LGRA 4R9DA 2JD4A 2JDKA 3B7MA 4YVWA 4XBLA 5BNNC 2V72A 1R64A 3SEPA 4TTGA 1BBT3 3VBSB 1D2QA 2PAKA 2Y6FA 4C0HA 3TEZA 2E31A 2IWGB 4HSJA 5FPAA 1Y9QA 5DDJ2 3T0DA 3PJYA 3ZR6A 1VBE1 4P00B 3OSDA 5H9SA 4RD7A 3IB3A 3IM0A 5C33A 1QH6A 4BDVB 1GQHA 1SCSA 3V0AB 3DXUA 1Y7BA 2VXJA 4AVVA 5FZIA 1A34A 2CWMA 1YFXA 3H42B 2R32A 2A71A 2BEOA 4AL9A 3EHKA 2HJIA 3HT2A 4FTEA 1HRV1 2WFPA 4I0BA 5IW0A 4GH4C 2ZGRA 5T54A 2VE1A 4Z2WA 5KHIA 2XPJA 2CDOA 2QQLA 5FO9B 1JOJA 1US2A 3HVDA 3NNJA 4Y5Z0 1VBC2 4MO3M 1Y9GA 4KG0A 2EXJA 2WA3A 3K4AA 1LESA 3KF3A 4A44A 3T08A 2WS91 2QDRA 4YW6A 5CEHA 5A1AA 1YJLA 2P5BA 1HN0A 1Z78A 2VQ0A 3HQXA 3RRDA 3LE0A 3PUSA 2XJTA 3O0VA 5HBAA 3VDDB 4JGZB 5CVRA 4Q5OA 1G8WA 4GALA 1UMIA 2J1TA 2IXIA 1LU2A 2TNFA 1IG3A 3ZYIB 4QB6A 4BCUA 3K75B 3SMHA 3KCCA 4BISA 1AX1A 1GU3A 1RL3A 5FUNA 4BMBA 2WS93 4AHWA 4KH9A 1B35A 2PELA 2XWJB 2YMZA 2RS53 1PIV3 1UWWA 3CU7A 5FZKA 1ZZ8A 5EJZB 3RYRA 2OPWA 1TME1 4PT6A 3MFAA 3OBTA 2VL4A 1OLRA 5JDBA 3JCIA 2WZPP 3VB9A 4MSVA 1W8ZA 5AVPA 1RUC1 1V6OA 3W9AA 2JIJA 1AF9A 5DZGA 3GZTB 3JB4C 2XJQA 1REDA 4A7YA 3H8UA 2RS12 2YYOA 3ZOIA 3KV4A 1RYYA 4NHMA 5IYYA 1W6PB 2WKKA 2JG9C 1R091 1WKYA 1XNTA 4F83A 2R063 2CWSA 3VKNA 2UWCA 4YGBA 3WNNA 1F8VA 3ES1A 3Q8CA 4PBOA 4Z2AA 5FY4A 1DFQA 3U1XA 5HV4A 1Q3EA 2AACA 2WO7A 2D7FA 2IC1A 3EJKA 4XUPA 3E5XA 1AR91 4Q2FA 4RGGA 3WLUA 3WUCA 1D4VB 1UMHA 3ASIA 1YIFA 4WVMB 1W8OA 2RHPA 3GBFA 2QKDA 3NJYA 4AFBA 5KXEA 5KXBA 3WNOA 3RNSA 4HKLA 5GKAC 1FV3A 1RUE1 1ZBA3 3IN9A 3ZKUA 5FQ0B 1K5MC 1KFXL 2C9KA 1MS9A 4A41A 4P9YA 2BNOA 4MGIE 1VBD2 1W2AX 4XBNA 5GZDA 1QF3A 2HWF2 2WINB 2PHWA 4UF0A 4TXWA 2JDPA 4FOWA 3TNQA 1RITA 4GWNA 3KV6A 5BNPC 1VPHA 3A0NA 3I49A 2CGOA 2RE9A 4Y1UA 4MGTA 4CEYB 4FQ4A 3WG3A 4BQ3A 2HBTA 2NMOA 5JSOA 2UYAA 1V6NA 4FVVA 4B4QA 1WCUA 4XXAA 2E7TA 4CVUA 5JR2A 3NJZA 5FDBA 5JZGA 1QJY1 4UOJA 4N53B 1Z0HA 2Y6GA 5FV3A 4CTEA 3SC7X 3UNPA 3U4SA 2VY0A 4FAGA 1RUF1 4CPBD 2P6HA 1WWYA 1IS3A 1W6PA 3IKWA 2CAUA 5DUXA 5IVVA 5J1XA 3DYOA 2FD8A 2WNUB 1RUC3 2DURA 4HKWA 3AFGA 4DS0A 3ZO0B 3POBA 4LEJA 1CD3G 1JMUB 3OEAA 4FPGA 4NHYA 4DY3A 1PGW2 2GC1A 5E89A 5GM0A 3TN92 4LPLA 2BV4A 3VGIA 2GNBA 4CDUA 3K4ZA 4E2GA 1OF4A 1LRHA 2FCUA 4GKXA 3BU7A 4PQQA 1NYWA 4PDWC 2SLIA 5K8SA 4XJ8A 1AVBA 2XUEA 2C1FA 3ZSKA 1QJX1 3CNAA 1GNHA 2YC0A 4PHZA 4BA6A 3MUY1 1AYN2 1W2NA 3PVNA 1XNDA 4GWIA 3CKHA 5DZFA 2B45X 5GALA 5KHHA 1JZ4A 3H7YA 3QD6A 1YIPA 4Q0VA 5A3LA 1VRBA 1W39A 2VQTA 2JD9A 4LBNA 1M06G 3T2TA 3MIHA 1DP0A 3OF1A 4EN6B 1NLQA 3AP7A 3KCYA 3HBKA 4LJHA 3I7DA 4B3NA 1FNYA 1SQ4A 3M3OA 3WEZA 4P9GA 2GC3A 1TE1B 5GLZA 4AW7A 4AVCA 1HB1A 1D0GA 5CKNA 1KXGA 1QXRA 1YLLA 3C8XA 4IL7A 4G9SB 1LECA 2CY6A 4EROA 4CRQA 1EV13 4Y24A 4HPKA 5DAXA 5L7OA 5FXZA 1XQNA 4HK8A 1LU1A 4GXLA 2R061 4YM2A 1D0HA 1O6UA 2ZTNA 3H1MA 4K1ZA 5C4WA 3RMYA 3RQ0A 3SKVA 1C3HA 2PHLA 1CONA 2VW1A 1PX4A 3N7MA 3UJOA 1ND2C 3AZZA 3U07A 3T30A 1LEDA 1QJX2 1W05A 3ZMOA 1IOAA 2ARBA 3ME2A 4DEVA 1SBFA 2RR12 2BGOA 1X9PA 1W8FA 4UW3A 2IXJA 2ID4A 1OLQA 2WFF1 3VZKA 1UXXX 4XZPA 2FMYA 2QDNA 4QQ2A 4BIOA 3ACLA 3EMRA 1GNYA 4AEJA 3VL8A 1POV1 1XJAA 2CTVA 1VBD3 2Q8DA 4BWOA 1R1A2 5KBFA 3HJRA 4CDUB 4QGMA 5D21A 4DOUA 4BB3A 2I07B 4XFAA 2MPFA 1U0AA 5A32A 2VZQA 1OHFA 2DTWA 4U2AA 1TMF2 5FKCA 3VZLA 1YC61 1TVGA 3SH5A 5HCAA 5IVEA 5F2SA 3EBRA 3KHBA 1CZTA 1VMFA 4Q8LA 3SLIA 3RWNA 4DY5A 3G6JB 5I0SA 1W8HA 4UBHA 3I2OA 3VBOB 5CFCA 3IDEA 1WMXA 1SBDA 1UQXA 1AL23 2Y60A 4FPYA 3ZSJA 1MZ5A 2E33A 3GBWA 1FPN1 3VZNA 3L9JT 3KQ4B 4XFFA 3DCQA 4IE4A 5LA9A 3AVRA 1W8TA 2OQ6A 1UPSA 2EVXA 4FP2A 1IG0A 1Q43A 1RVF3 1QJU2 2HH9A 2W52A 3DEMA 2XVGA 2ARAA 3AMNA 3AJZA 1OFNA 3MIBA 4NPLA 1AXZA 3SHRA 4GMP0 3FUQA 3JD72 1Q8SA 4C1XA 2GC0A 4OI4A 5KXCA 1YFYA 5CISA 1YHFA 2ZXQA 1C1FA 4YW2A 1IS5A 2BFUS 3ES4A 4PCRA 5JOWA 4HL0A 2DVAA 4RGKA 2AC1A 4A3XA 2XJUA 4XJUA 1K5JA 4XJWA 3BOWA 5HCHA 2VW0A 3S0MA 4RQPC 4YYOA 1GFF2 4OQ8A 4URTA 5JPMB 1MEC3 4LE4A 4XMIA 1W06A 2P3JA 2R072 3KB5A 4LBQA 3B3QE 2WL1A 1JU4A 5LA2A 3BVCA 1AHSA 5EFUA 2P4EA 2EIDA 1FAYA 3OD0A 1DGWX 4M4RA 3SCFA 1WGPA 1DQ0A 4ZU4A 3ZYHA 1G7YA 2RS51 4FCAA 3WG2A 1UMZA 1W6NB 2WNUA 3FC0A 4WBBA 4XF9A 4AG4A 4DMIA 2ZGPA 1VMJA 4J1WA 5ANNA 2OVUA 3THPA 4QU2A 5HCFA 4O61A 4WVZA 1US3A 2OXBA 4AGGA 3PUAA 2A7AA 3OGRA 2XBO1 2R16A 3FFZA 3VHRA 3WQ0A 1C8M3 1LOFC 3ZFFA 2LROA 4KG8A 1WCDJ 4HT1T 2VOTA 3IT8A 4GH4A 3C3VA 3EB7A 5GLUA 3WUDA 4M0HA 2BPA2 5EYXA 2ZEZA 1PIV2 2PQSA 2XB6C 4FFGA 1AL0G 2SBAA 3LEKA 5C7GA 4QGNA 1ZRIA 1ZYBA 4FPCA 2ZHNA 4PI0A 5I0RA 5J96B 3LB9A 3R0RA 3T1MA 3KSCA 5F7UA 4Z07A 2WZR2 1RTVA 5FZ4A 2WO3A 4QB1A 3VHNA 2NM1A 1F9KA 1STMA 4N8MA 2B9VA 1KRIA 3I3EA 1H2LA 2VBDA 2DDUA 4LKFA 3OGVA 4XUTA 5F6LB 3SKJE 2FDGA 2B42B 2ZEXA 2R041 1W6OA 5J3UA 2CGNA 1OH3A 5FP4A 4M01A 4CU6A 4QHBA 3ACIA 2ENRA 1MS0A 3NJXA 2VOWA 3I59B 3OEBA 2FDFA 3VBFA 4WM7A 1ODMA 5BV6A 1ENXA 1UYYA 3LIGA 1HQLA 4UFJA 1OFSA 1GUIA 4ZU5A 2VUJA 3QOPA 5FP7A 4JHZA 3K51A 1HV0A 1DGRN 5BNOB 1KDKA 4NHLA 3ZIXA 2D40A 1NCRC 2JDZA 2K0GA 1GR3A 4C8DA 5FQ0A 3GDBA 5FLJA 2B9UA 5JLVA 3VBOA 1IS6A 2FQPA 3M8LA 4XF3A 1ENQA 4NHKA 1S55A 3E5QA 3HD8B 1V6IA 4Y3OA 5A6QA 1AR93 4BMEA 1S0CA 4GZ9A 3WT3A 1BLZA 3MGUA 1HQNA 1ULFA 2WYFA 1J84A 4IW3A 4AQ6A 4AF9A 3T3YA 5FPVA 2ADEA 4P9IA 4YVSC 1PO22 2YPJA 4QD2A 5A3MA 5BNPB 5KHJA 4FXKB 4QKBA 3KZ4C 4XABA 3GHNA 1ZBE1 4GD4A 4XVHA 2VZRA 2VMIA 4JKMA 4OZOA 4MUVA 2DCZA 1DQ4A 1NCRB 4PIXA 3OGGA 5A32B 3ZYBA 2GNDA 4KQ7A 4PLOA 4OHVA 1GWKA 1UN1A 2X5IA 4H3WA 1F5JA 4NIIA 4OUSA 2A70A 2TUNA 2VBBA 4BLIA 2VTXJ 1DQ5A 4NWWA 5CIRA 2LRPA 2DCTA 1AXYA 5KHKA 1EP0A 4ES8A 4PI2A 3ZFEC 1KD7A 2WLQA 2PAMA 5BPXA 1H1IA 3JQXA 1W0NA 4LBQD 2JKXA 4JZRA 5A7SA 4AFMA 3OTFA 4LA2A 3VZMA 4AI3A 4E4SA 5CFDC 1L7RA 1VP6A 2WT0A 3POFA 3AMHA 4R9AA 1A6CA 4XFCA 5CKMA 4QGLA 4YVWB 3ORJA 5BNOC 4RL7A 4ZPIA 2CSGA 2D93A 3I97A 1NZIA 2PA7A 1OKQA 4JV4A 3D82A 4B4RA 3GYDA 3GJAA 4CCKA 5L7OB 4JGYC 4QWNA 1F4HA 5LZ6A 2HWD2 2OS2A 5AFBA 1UPIA 3OUIA 2A3XA 1ONAA 1JXNA 1H6XA 1WBLA 5CFDB 3UJQA 3U78A 2D3RA 3KT4A 4B1MA 1E5IA 1PO11 2C24A 4XF4A 1CPNA 4TLFA 4RS5C 3USUA 2XWBB 3OB8A 3QACA 3VZOA 2JE8A 1DLCA 2FZ1A 1PMHX 5GLVA 2OKXA 4QM8A 1CAWB 5F1RA 3GALA 4CEWA 1V9U2 3C7FA 3ATGA 2LW8A 3OD4A 4PDWA 4TLGA 4Q26A 3THCA 3ZKYA 4EN8B 4ZONA 5C4WC 3JBG3 4QU1A 4WVMA 5CZKA 1BVVA 3VUOA 3DYPA 4HFSA 3CZUA 5DMYA 2WNVA 5DDJ3 2V4VA 1PGL2 1UY4A 1Y4WA 2XG3A 5FBJA 5FMBA 3KVBA 4MLOA 3WDUA 1QXPA 4O65A 1A8DA 2KR2A 2HEVF 1OOPC 3TB0A 1J3QA 4GH4B 1RVF1 4TN7A 1AX0A 1QJX3 2BVVA 1LOFA 1UZVA 1UD1A 2A6YA 1U12A 4BQ2A 2VZ3A 3AL6A 3PDQA 2B5HA 3MF6A 4YGDA 1GZWA 4COYA 5JZGB 4YVWC 4LHLA 4KGGA 1U5YA 3VBRB 1AL21 3OBRA 4YG6A 3AMQA 3T2QA 1DU3D 2HEWF 4GIQA 4CEWC 1DQ2A 1HX6A 3PVOA 1BEV3 4Q4X3 5T5OA 1E57A 4QPIA 3UETA 3ZPYA 1X33A 4UT5A 2AREA 4NPMA 4OQ9A 4PBPA 5FZ9A 1UIKA 5T5LA 5FBZA 1N47A 3BTAA 5CKQA 3NW4A 3PUQA 3NV2A 2Y64A 3WP3A 2XVKA 4B8EA 5A70A 4KL1A 3BPSA 4QXBA 4Y22B 4Q4Y2 4UWDA 4WVVA 2J1VA 2W39A 2CL2A 3J8F3 1H4GA 3OPZA 5F2WA 3MI8A 5JIUA 5DDJ1 4QPYA 2BJSA 5FZ0A 3SCHA 3A21A 1A8MA 1BEV1 4Q4X1 3JBG1 4NWVA 1Q56A 2XJVA 3H3UA 4XIOA 2WS92 1XE0A 1A3KA 2EIBA 5BNOA 2BW8A 1VJ2A 2HWC2 2D6NA 4HK9A 1NA1C 5FK7A 2Q1FA 5SV5A 4LORA 2G19A 1XNBA 5AC93 4IERA 4H14A 1CAXA 2HBUA 2VNOA 3E6CC 2ERFA 3KWVA 4LO8A 4CDXA 1JOPA 4W6XA 5FP9A 5FTTC 1Z7S2 1UO9A 3N9OA 1TMF3 2DWRA 2ZX2A 1UY1A 4F3JA 1NOVA 1UOJA 2W68A 2H0BA 1S4CA 4R4XA 2JG9B 2OQ7A 1C8NA 3O7OA 1VALA 1LGCA 2PMWB 2JECA 1GBGA 2ZABA 3FLRA 4ORFA 5CAZA 2QQOA 3IDBB 5JMCA 4WM8C 4WM7C 1RUG2 1XE7A 2PAEA 2JXAA 3AFKA 3G7DA 3MW2A 4XQDA 3CJIA 1KJRA 5JAXA 4BJ0A 3LPGA 1FMD3 1SPPB 3LPFA 4IUGA 4N53A 4HG6B 4D0QA 1CAWA 1QJU3 2Z69A 4Y4YA 3MPPG 4CZSA 4LKEA 1OD3A 3P3NA 4CPBA 4PLNA 5B4NA 2QQJA 4XZUG 4FFIA 1HXS2 5F5IA 1VE0A 3JZVA 3WF4A 4E2SA 1KDMA 1DYKA 1Z7S1 3AX4A 5JWPA 4JQRA 3HBZA 4NOTA 4B4PA 1MVEA 2DUPA 1PK6B 2DCYA 4IXLA 4OHXA 1KITA 3APBA 5BNQA 1NQDA 3R4UA 4OMCA 5C8CC 3HN1A 1HRV3 1M4WA 4BZ4A 2JICA 1F4AA 2HYKA 2B7YA 2BP6A 3W59A 1H1MA 3ROUA 4FBFA 3AXDA 2VNGA 1YQ8A 1LOBA 1PVC2 2C26A 3ACFA 1S1AA 4C90A 1CQ9A 4ISRA 3VD9A 1BEV2 2F6BA 4Q4X2 4XF1A 2XQRA 4CDQC 1C57A 1ALYA 3NAPA 2RMU1 3NVCA 1NY72 3MPBA 2H6BA 3CL1A 3POEA 4NR1A 1YI7A 3KCXA 3PJQA 1NG0A 5E6HA 3BTZA 5IWFA 3S7EA 1J58A 2FZ2A 1Q5OA 4E2QA 4QKFA 2ZZJA 4BQ4A 1YQ6A 2O14A 2XDVA 3MBWA 1XNCA 4N43B 1ZBA1 5FJKA 5LBBA 4OHZA 3WDXA 3AZYA 2VNVA 1DG6A 2ZZQA 5EJ1B 2DBNA 3O14A 4GB31 4JKKA 3ACHA 4QXHA 5A7WA 1CGPA 4E4DX 3VKLA 4Y1YA 4DNYA 2IVIB 1WUVA 3GM8A 3N36A 4Q8KA 5LEJA 3MDPA 4AI9A 1OUSA 4QX5A 1HRI1 1QXJA 4XUOA 2XBO2 1VBB3 4IGOA 3UGHA 2OUJA 2VMDA 1ZRCA 2WA4A 2WQ4A 2YGLA 1W2UA 2ZHLA 1LOGA 4L11A 3JD71 5JPNB 1IS4A 2NLRA 3H0OA 3ZN6A 1H9PA 5A3WA 4XFIA 4BQ5A 4OMDA 2HWE2 5FYVA 3HNMA 3N9PA 4CSWA 1BVP1 4LR4A 5AVAA 3ZFGC 4QXCA 4PF1A 4NPRA 2HYXA 5KWRA 5C8WA 3FLPA 5AFEA 3N7LA 5IAXA 4LT5A 1SDDB 3BOPA 1AR82 3RZZA 4KWJA 4FPKA 3ZM8A 4BOWA 4PQ9A 3BB6A 3NAPC 4JCKA 4I30A 1FYUA 3E1F1 1EPZA 1NCQC 1CIWA 2YBSA 4MOAA 4NO4A 4XTPA 1G9CA 4AHXA 1WCQA 4IE5A 5L19A 3N9QA 2JB8A 4GJZA 5IAVA 1JYWA 1UYXA 4W8JA 5DAPA 4ZZ5A 3M3QA 5A3NA 3S57A 3V64A 1W6QA 2AENA 4RQPB 5A33B 5IFTA 2P3KA 4R9CA 5C8CA 1S0FA 3WDYA 1QJEA 1ZBE2 2E7QA 2IZWA 3T1LA 2HWD3 2WBKA 4N90A 1GOFA 1EYBA 2YUEA 3SITA 2LTNA 1F15A 2YU2A 4CDXC 1S0BA 2WDBA 1ND3A 1G9BA 1XE8A 2GH8A 4YZ4A 1G86A 1ND3C 1V6LA 4E4HA 1UU6A 4LUMA 1ZA4A 5FJHA 2D97A 1CJDA 3LAGA 2J22A 1FT9A 2QNKA 3BPZA 2EAKA 2D3PA 2A5ZA 4Y33A 5LRRA 2PLV3 1VBA2 3OY8B 1S0GA 4META 4QB2A 3B9CA 3B94A 1WMEA 4CYDA 4XXPA 2XHNA 3FJSA 3V56A 1TEIA 4K9SA 4FSJA 4IEQA 3LFIA 5ABJB 2PHDA 5DZEA 3RDIA 1H9WA 2BQPA 2VMCA 4LHNA 3FN9A 1W9SA 3OJBA 2UY8A 5GZGA 1PGL1 3WF0A 4XQ4A 2BFUL 4Q4W3 4KNCA 3ZXDA 2BBAA 1IGOA 4COVA 4CUAA 2ZEYA 1RHI2 2W95A 2VZOA 4H55A 3A4UA 4QPWA 2GAUA 4WZCA 5D8AC 2LM3A 5H9PA 1AYM3 4PJYA 3BUCA 1ZREA 3T09A 2D5HA 4CXYA 3ZFFB 1XYNA 1LKNA 3POSA 1WLTA 4KU8A 2XJRA 3WNMA 2W46A 4CCOA 1FOD2 3WF1A 1DZRA 3AL5A 2QQVA 3ZFGA 1VR3A 4N43A 1SLBA 1ODNA 2BGCA 1RUJ2 4RHV3 2A6ZA 2VU9A 1HB3A 3LSEA 3GGLA 3RG0A 5JCTA 3T0AA 3PUHA 4Q0QA 4J6GA 5FPXA 1W9TA 5DUVA 2C5DA 3TYJA 3NV4A 2HWB3 1FOD1 4BXFA 3BTXA 1SFYA 1DIWA 4DB5A 3Q9OA 3AKTA 1W3XA 1LEMA 3WXPA 3JXSA 4S2HA 2PFWA 4ET7A 3ZDVA 1PHMA 1RHI1 5C3PA 3TEYA 1UKRA 1C5IA 1GWLA 4XDQA 4QX0A 1J3RA 1OQDA 3LZZA 2YFZA 4DXTA 2RM22 2VMFA 4QQOA 3ST7A 4TSVA 3URFA 3ELNA 5KC6A 2JDMA 3F2ZA 4FPFA 3ILNA 3AYDA 3J8F1 5EZWA 3A0KA 4HVQA 1SBEA 4I01A 4LHKA 4Z82A 2VJXA 2VAUA 1G9AA 4YRDA 1SFPA 4DXRA 2WRAA 2PXJA 3I2IA 5HPOA 4XJ9A 3X29B 3EXUA 4AR2A 4FAHA 1H0BA 1RXGA 4AEKA 1H30A 5C9AC 4OI2A 1MS3A 1XU2A 3W58A 1A78A 2W08A 3HQUA 3S30A 1O3SA 5ABJA 3Q8BA 1YXWA 1LR5A 5C8CB 5JXIA 2Y6LA 4EV0A 3I59A 2YY1A 4DEQA 3GF6A 3KLSA 1F5FA 3C2UA 4B29A 2XXZA 3HNYM 2VBPA 3I2DA 5A6XA 3IWZA 1BXHA 4N53C 1IQDC 2A75A 4RSUA 1CWPA 3K3OA 1HN1A 3CZJA 1Y3TA 5I0UA 3NNMA 2IVJA 1OSGA 1UW8A 3OPWA 3ZXLA 5FO7B 5A3UA 3L2HA 1O8PA 4MXWB 2RJLA 1B35B 1UX7A 1UYPA 1YNAA 2VMHA 3ETPA 4OUMA 2GN3A 1O5UA 2WSUA 1NY71 4IE7A 1V6KA 2JENA 4YZ3A 1E5HA 1QWRA 2DCJA 1UNBA 2J7MA 3SH3A 3B93A 4MGSA 1JZ2A 1QY4A 1TMF1 3E97A 1HRV2 4IEPA 1R093 2I74A 2OUHA 4YFWA 2X09A 2VCCA 3Q8FA 5E8AA 2PTMA 1V6MA 1MZFA 5FMDA 2DF7A 1W04A 4HBNA 3ZPOA 1S0EA 4EQVA 3NV1A 2BWCA 4QX7A 1YUDA 3MW4A 1SLIA 1WLWA 5IJRA 2QQWA 4RYDA 2DUOA 5JXJA 4AYUA 1ND3B 3OY8A 3CEWA 4QT6A 4H2AA 2A6XA 5D8AA 4OUEA 4OCTA 5FZOB 3WVJA 2XLGA 3DECA 4LBLA 2WAOA 1RUF3 4CU8A 1MACA 3GZUC 2ZGUA 5A80A 2EICA 1NLRA 4IV3B 5C3QA 3H8XA 4HPKB 3OGJA 3UKNA 1LHUA 3VBUA 1HIXA 4AI1A 1QMJA 2HEYF 2Y34A 2VMEA 2WWUA 1AR72 2DTYA 2E32A 4Z92B 5JMOA 4GB32 1TME2 1JS9A 5F3IA 2R7EB 4AI2A 4BYYA 1LODA 4COUA 1QIQA 2KD7A 4IDZA 2XBO3 4E27A 4K3UA 3OG2A 4QQLA 2GH2A 2WSVA 3PURA 5F3GA 1JBCA 3W5NA 2VVFA 2ZJCA 5LK7B 1HQWA 4ZS3A 2Y0IA 1PZ8A 5IK5A 2ZOEB 4OI1A 4AI0A 5I8YA 1CAUB 2A3YA 4W4ZA 5FXXA 2W47A 3CJIB 3LF7A 5LB6A 5FYIA 5JVVA 3CLPA 1HJGA 1RUH3 4LBJA 4WM7B 3VBFC 3VBSC 2FBEA 3ZFGB 3DL3A 4EZHA 1LHOA 1MEC2 3TNPB 4IV1B 1ZZ9A 4LK6A 3K48A 3J26N 3E6DA 3H1WA 4I2OA 1PX3A 3I2JA 5HXVA 1ULDA 3R6SA 4MZUA 5LY1A 3WV6A 1OOPA 4QKNA 3J8F2 2XVLA 2AR6A 4HVOA 5G05L 5FZ3A 2KXLA 4XEZA 3T0BA 4NIGA 4IGQA 5I8TA 1GMMA 2FMDA 3HEIA 4CP9B 1MS4A 2OZ6A 2YG0A 1LTEA 3NJVA 4FI9A 4Y5SA 3H3ZA 2J1UA 2RJKA 3GZEA 1N1YA 4HLTA 1AYN1 4QPGC 1QJY2 2YU1A 3WNXA 1IZ3A 5LW9A 1X8MA 3ZLIA 2VZPA 1YYNA 5FZ6A 4M0NA 5FZ7A 2WUHA 3VBHB 3P6BA 3IDCB 2RR13 1ULEA 1UL9A 3I3QA 1ULPA 2D44A 2P3YA 4P14A 5FAXA 3CJXA 4IEOA 2C9AA 4FXGB 1WCSA 2CDPA 1QQP3 3VBUB 4WVWA 5BNNB 2KA3A 3GBGA 2YB7A 4LUKA 3U11A 1PZ9A 2C6SA 3J7HA 3GHMA 1RUG3 3O0XA 1BMV1 1N1SA 1CVNA 1RUF2 3AMPA 3DPRB 3ZXAC 3LCPA 4BQYA 1OUXA 1J3PA 4AEMA 1EUUA 2D6LX 2G1MA 3ILRA 1SCRA 5JZGC 1O3TA 4XMAA 3W5MA 1QOOA 3AMMA 3LDBA 3M3EA 5LK5A 2VUDA 5DPNA 3MICA 5FY0A 3RPQA 2WWJA 1BCXA 3M1HA 1ND2B 1URXA 2OPKA 4DXSA 3HWJA 1R082 3IIIA 5CBLA 2ZMLA 4L97A 1XYPA 2YC2A 3GZAA 5AC92 3P3PA 3N9NA 3VHOA 5ANQA 1K5MA 2OZJA 2QQNA 3FL7A 4RN5A 3SISA 1DDLA 5FY7A 4INDA 2XLFA 2J1RA 4YG3A 3ZFFC 1LGNA 3H8OA 2E7AA 2W94A 5ACA2 5JSPA 3MIGA 3PMSA 5JR7B 1YWKA 1GZWB 5FZAA 4IEXA 3ZMNA 3VKOA 5A6ZA 1PVC3 1C28A 3WQBA 3RMXA 5D2AA 3D6EA 1RUJ3 4RHV2 2VZVA 2RM21 1GLHA 3RSJA 2R0HA 1TG7A 5G04L 4N7UA 5F3CA 5IVBA 2VCBA 4I3GA 5IVFA 2W92A 4OHWA 5F39A 5FREA 5FR3A 2BZDA 3LDKA 5FXVA 3VBOC 3NNGA 3R4SA 5IUQA 4TZDA 5FPZA 4LLFA 3WHUA 3UGFA 4NRQA 4K8FA 5DN2A 5FZGA 3J7LA 2W2IA 3U4XA 2F4LA 1JZ3A 3POWA 3H3LA 2GMPA 1E5RA 2RS31 4RQPA 3AVSA 2QFEA 4FFHA 5F3EA 3VBUC 2ZX3A 4Q4W2 4CCDA 4N7IA 2WWSA 4IQPA 2RM23 4HN1A 3DPRA 3UL2A 4J1XA 3UYJA 1D4M2 1SMVA 4ZKTB 2UU8A 3D0JA 2WN3A 1LENA 1VBC1 4FO9A 4QPIB 3QCWA 4YW1A 3O1PA 1GQGA 1OT5A 2Q8EA 3JB8A 2R043 2BWAA 3ECQA 3JU9A 4RHV1 1ND2A 1W8WA 2ZGOA 4P02B 4Y22A 1YRZA 5B4XA 1LHWA 1W90A 4JHTA 5H9RA 1X50A 1RMU3 3CO2A 4I0AA 1UOGA 2ZHMA 4XURA 4K40A 1J59A 4D7TA 1QJZA 2XH6A 1MQTC 2WC2A 5FZDA 2JDYA 2ZACA 4IEZA 2J1EA 4O7XA 1HW5A 5K0UB 2QE3A 3CF6E 5BNNA 5DUUA 4R8HA 4YFZA 2QQUA 4JC1A 1HB2A 4KWKA 4HKOA 3S5AA 1YQCA 1MVQA 2G9GA 2VD7A 3N9LA 2MNGA 4UW6A 4ES9A 4I3PA 5L7OC 1CAXB 5FYSA 3PUIA 3WQ7A 1RUI2 2VOVA 2QQMA 4CEWB 1CX4A 4BQ1A 4O9GA 1RUC2 3DUIA 1ZVFA 1H1AA 1SLCA 1HDKA 3POGA 5F5AA 5DAQA 3UESA 3ZN4A 4BH9A 3RZLA 4FT8A 2V4AA 1BBT2 3AJYA 4NROA 4YWAA 5FYCA 5JXHA 4Y5TA 4YGCA 4IV3C 1S0DA 2ZHKA 3J9SA 4S2DA 3R4DB 2FHRA 3VD4A 2WZ8A 5BNPA 1ZNPA 3NKTA 4CDUC 1O4YA 3KMHA 3IPVA 2YZ4A 4K21A 2ARXA 4NJ4A 1QH7A 4D7YA 4NRMA 5SV8A 3DXTA 3MLLA 1VMHA 1FATA 2D6KA 4G3YC 5F5CA 4HANA 4SLIA 1R081 4LLOA 4RR3A 4UFKA 2VTXA 2ZX1A 1UY0A 4LQRA 4AFDA 2AEZA 2RS11 1UY2A 2RG4A 2XGXA 4JGYA 5FYUA 3FMGA 3MLKA 4ZS2A 1K12A 2WQZC 1MPXA 1K42A 3SXWA 5A7OA 4XJAA 1MEC1 4EZ4A 1XSQA 2Y33A 3ENRA 4RS5B 5EWSA 5FMOS 1NX9A 3PVEA 3TWIA 2YV8A 4MHRA 4D6QA 1ZRFA 5FK8A 4BK5A 2WN2A 3WHTA 1ENRA 5E16A 4L99A 5APAA 1UXZA 1UZYA 4AFCA 1J1LA 1PO12 4R52A 2PHFA 2VUCA 5F8PA 1EAH2 1RB8G 4C91A 4YNIA 1PIV1 1DZQA 1NQJA 4IV1A 3MIDA 4Q27A 3O1RA 1RUNA 3P5BA 1KGYA 1OQ1A 2Q1MA 3I3BA 3MIFA 4HETA 1N1VA 4JTOA 4UYBA 5CFCC 4JKLA 5EIYB 2VNRA 5C5TA 2R042 5EXOA 1AR71 4JGZC 4DRVA 2ADDA 2XONA 4JTNA 5FYMA 1QOSA 5C3RA 2K9ZA 1X9TA 4IE6A 3S7IA 4CXWA 1MQTA 3ZFEB 4YZ5A 2VECA 3UT0A 1SG3A 4AXOA 4RA0A 3ZYRA 5F6KA 1C1LA 3KV9A 5FUPA 3IMNA 2OA2A 4NMIA 1E5SA 3OGSA 1L7QA 1AR63 1H8TB 3T2OA 1GV9A 4UI9L 2HWB2 4X6QB 1ZM1A 3O1VA 1G9FA 2ETEA 4E8CA 5JI9A 3WG4A 2YC4A 4OYUA 4HONA 4Q0UA 1PNFA 2W1WA 3O1UA 1RUI3 1WLDA 4QAWA 1WCKA 5HV0A 1JH5A 1YQ5A 2W3JA 2UYBA 4NVPA 3HPNA 2CU5A 1I1EA 1PZ7A 2VOKA 1J83A 1UOFA 4LA3A 4WZFA 5D8AB 4CDWB 1NE6A 5FPLA 1AJKA 4LKSA 3AZWA 2EAAA 2WT1A 2R49A 4BK4A 3JD73 5TSWA 2NYYA 1O91A 2RS52 1VB2A 3H7JA 1ACCA 2VZSA 5C5UA 1VBB2 4IV1C 1NLSA 4K20A 1WBFA 4MX3A 4QQPA 1JYVA 5A6YA 4KGQA 1ZBA2 3FHAA 4OULA 3NWKA 2X29A 1W2TA 1RUH2 4LOTA 5K9YA 3F95A 1RUH1 1COV2 3IIAA 4BQXA 3BIWE 4GMP1 4NAMA 2Y8KA 3TEXA 4AVAA 1QQP2 1LOEA 1OLME 2WFF2 2R1DA 1XC6A 4MGYE 1W6MB 5FO8B 5J98B 1D7PM 1GP4A 2QQPA 2XL9A 1YO8A 3PIJA 3B69A 4X8PA 3U75A 4CU9A 1AR62 1REFA 4AAXA 2QQIA 5ERLA 1GNZA 5EV7A 1H8TC 4BHPA 3THTA 4EN9B 2OW4A 5FLIA 2XUMA 3DPRC 3LEGA 4LO5B 4WM8A 1JTZX 4LIUA 3T4HB 1F2NA 2A1XA 5KHGA 5CB7A 5A7NA 1PNGA 2ATFA 2RMU3 2JWPA 2WNVB 1FNZA 5I91A 4ZY9A 4QQHA 2WNUC 1ZRDA 2FCTA 3RI9A 1OVSA 4I02A 5IVCA 3POJA 2ZA9A 3WF3A 4DXZA 3EQEA 5I93A 4OLLA 4OHYA 1CJPA 3TN93 5T3NA 2J42A 1POV0 4HZFA 1PK6C 3ZYGA 5FYTA 3GCWA 1GP6A 4EWAA 4UFIA 2Q0AA 4LO6B 1MS5A 1WW5A 4NIAA 2TEPA 2XKOA 5C71A 3VDBA 4CEYA 5FPUA 2WO2A 1SLTA 5IK7A 3A7QA 3EO6A 4GQ7A 4XBQA 1KQRA 1APNA 2VULA 4GWMA 3D5OA 1Q8OA 3KGLA 2FDJA 2HWC1 4LMFA 4LNVA 4DQAA 5J09A 1W9FA 3I3MA 4W65A 3GJBA 3WD5A 4UXAA 1RUG1 2UWAA 4XFBA 1QHDA 2JDNA 4YM0A 3M4FA 2FCVA 2VPVA 3MLJA 4L0PA 5BY5A 4XOGA 1QNWA 2YBPA 3DKWA 3RZHA 4A3ZA 2LALA 2XJPA 3AP9A 2ET7A 2QVSB 2RS32 4Q4Y3 5LWBA 2BOIA 2D5FA 2XMLA 2ORZA 4W6YA 1G6NA 3OCPA 3ZIWA 1JI6A 3ZXKA 3T2PA 5EHDA 4ASKA 3PLQA 2ZGLA 4XPVA 5GZFA 4IEYA 1X36A 4QPGA 1N3OA 1GWMA 1YCIA 1AR73 1O4ZA 2QQKA 2QUOA 3VHPA 1DGLA 5ABJC 1YJKA 5FMCA 1XOYA 1DQ1A 4JDNA 3ZR5A 3J7NA 3HNBM 5DXDA 3IZOA 4Q4V2 2PQQA 5KC5A 2VW2A 3WW3A 1CPMA 1UCXA 4RR3C 3JUUA 1AYM1 3KS7A 5FZOA 2DBIA 2W5FA 1CZVA 4C0BA 2D43A 4MGQA 3NL1A 2BNNA 4XUQA 1SLAA 5FWEA 2W87A 1W6OB 4XDPA 4XFGA 3HR9A 3OYWB 5A7PA 3MUZ1 3K3NA 1HB4A 1V70A 2AZ5A 3QH6A 1OH4A 4P9WA 4CE8A 1RINA 1H8TA 3WW2A 4MG2A 1VAKA 2NN8A 4XHXA 5L9RA 2O8OA 4Q4V1 2CAVA 1ZZBA 2QZ3A 2MEV1 1O7FA 5GLWA 3WP6A 4YM3A 1FXZA 1YI9A 2Q1ZB 2CNAA 1RUE3 4KMQA 3UKTA 2RS33 2W91A 5C4WB 1QQP1 4LIVA 2WQ8A 2DU0A 5HI0A 2ZCWA 1UAIA 3J7MA 4CCJA 1KJLA 1ZA7A 5A3PA 1OA3A 2YROA 3K2OA 4XJZA 4MXVA 5B2GB 4QX3A 1Y43B 5A1FA 4GB33 3IMMA 4RGAA 4BPZA 3RZMA 2HWC3 1O3QA 4JGZA 4OZXA 3U0ZA 1HXS3 4DUVA 4YW5A 2CHHA 2GC2A 4YVSB 3WP4A 1VLNA 3WW1A 5CU1A 4IETA 3ACGA 2NPIA 1XBFA 2DVGA 2WZEA 2DU1A 1LHVA 2WO1A 3VBSA 1W9WA 4L8QA 1RMU2 3E6BA 5HCBA 1P8JA 4KWLA 5H9QA 1WW4A 4RR3B 1OC1A 1KEXA 1YFWA 1BK0A 4H7MA 2ZGKA 4GWJA 2MEV2 2MHFA 3PU8A 4A42A 2RJ2A 2OYZA 2Y6HA 3SH4A 4OI0A 2R1BA 2ZGSA 5DG1A 4BU2A 4QKDA
chains in the Genus database with same CATH topology
1RUOA 3L2YA 4YW3A 4FPJA 3N3HA 1JYCA 1IPKA 2R073 2ZGQA 1HRI3 1OA4A 3HMYA 3ZXJA 2V73A 2X8KA 4Q4W1 2XHKA 1AX2A 4FOYA 1X8EA 1GKBA 2D3SA 1OD5A 2PHTA 2N7GA 3CJIC 1RIRA 4QPGB 2UURA 2P3IA 1N1TA 1QKQA 3KGZA 3DF0A 4AFAA 5J36A 2ILMA 4Q4V3 4YSFA 3BCWA 4M3CF 4CP0A 1VB4A 5CFCB 3B01A 5K0UA 3VLBB 4IEWA 1R092 3ZDSA 2EALA 4X6RB 2DCKA 3FFQA 1VAVA 5T50A 2LUWA 3RS6A 2O8QA 4Y1VA 4UBGA 2P37A 1FPN2 3BALA 2WZR3 3PHMA 1DLLA 1JN2P 4PIZA 4AI8A 4GA9A 5E1RA 4A7KA 4IESA 2VVDA 4PIYA 2Q8OA 3SCGA 4AWDA 1PGSA 3ZX7A 2PN5A 1N3QA 4MGZE 4YM1A 1VBE3 2D6PA 5EJ3A 4DPNA 1PK6A 4XF0A 1QDOA 4M00A 5FCCA 4RS5A 3WY6A 2HKXA 1EY2A 1SDWA 5ACA1 2VGDA 3IPVB 1JUIA 3J4UH 3N7JA 4QM9A 3KM5A 3QH7A 4OFGA 4Y20A 2B8MA 2IXLA 1RJ8A 4ONUA 3AKSA 3ILFA 2ZX4A 1Z7S3 1AXKA 3B00A 1W6MA 2GMMA 4LBOA 2GNTA 2PHXA 3MEPA 4MXWA 2GU9A 4GKYA 3ZN6B 1RUD1 1X82A 4R4ZA 1COV1 3M3IA 1HXS1 1DF0A 2ET1A 4N43C 4H7LA 3LOIA 4M3CA 1MS1A 3RYKA 4NN0A 1WW6A 5T5PA 1GICA 1WD3A 2RMU2 3AZXA 3WCSA 5T52A 3PMEA 2B39A 4Y26A 4HN0A 1NA1B 4CDQA 4K7JA 3GNEA 4IEUA 4AVBA 1C4RA 3V0BB 2GMEA 2IFRA 2JG9A 5FMOL 2ZAHA 5IK8A 2VXRA 2I2SA 3AB0A 4JVAA 1FI2A 1R1ZA 4FPOB 1EPWA 3WR0A 2PHRA 4EJRA 1DHKB 1W6NA 2Z2SB 3AYEA 1RUD3 1UU4A 2G4IA 1C8M1 2ZKNA 1QNYA 2G9FA 1AJOA 4Q29A 4MVTA 2TBVA 2NMNA 3LA3A 1EV12 2WJSA 3KT7A 3ZXFA 4AQ2A 3HIFA 1POV3 3FHIB 3AK0A 5T5JA 2VOXA 1QGLA 4FTSA 4CDWC 2VH9A 1V9U3 2H6CA 4XE9A 4DZGA 1PGW1 2D98A 3O5SA 3TN91 3JBG2 3RYPA 4Q4Y1 3B02A 2I45A 1ASJ1 2EXHA 2AH2A 4LBKA 3V0AA 3KD4A 5I8SA 1S2BA 1H2MA 1NXMA 3ALQA 4DINB 5JI7A 2ZMNA 3NKGA 1JHNA 3DN7A 4EN0A 3INAA 1BBT1 4FPHA 1XYOA 2A73B 2R30A 4M3CE 2ZMKA 2R062 3FBYA 4YARA 2YXSA 2A3WA 4D7SA 4GMP3 3ZVXA 1IPJA 2DYCA 1IKQA 4N9HA 1UX6A 3E5UA 2EF6A 1O4TA 2DUQA 4Q1PA 5BUVA 2WNVC 2O1QA 2E9QA 2Z79A 5GZEA 3O0WA 2RR11 5K0UC 2BNMA 4CDQB 1R083 2DFBA 1ZRRA 4UW4A 3FLTA 4I0WB 4Q1RA 1C8M2 3N4MA 4EWDA 4ISQA 2KM2A 4AHZA 2PHUA 3WDVA 1H4HA 2GSYA 3WOGA 3HAGA 3ZXGA 2PLV1 5JIAA 5IK4A 4G4FA 1MZ6A 1QDCA 2WFF3 2H0VA 1LJ7A 3S6PA 3FE5A 5L36A 1BQPA 4FOVA 4AEDC 2JG8C 1N3PA 1ZZ6A 4ASLA 2PLV2 3UKVA 4GULA 4XQWA 3JQWA 5I0TA 2B46X 3RJRA 2YHJA 1OPMA 1IHMA 3N7KA 5F5QA 3H9AA 4BM8A 1H8VA 1GZCA 2V5YA 4XILA 5CFDA 4AE2A 1DZTA 4XIKA 1MZEA 1JUHA 1WA4A 1Q8QA 3WDTA 4B7KA 1NA1A 2NP0A 1TQ5A 4AGRA 4UW5A 3M7AA 2XLAA 2VQAA 1RHI3 3ETQA 4PDWB 1UIJA 3V65A 4BLJA 5J37A 5JOYA 3I8TA 1ASJ2 1OOPB 3QBQA 1RUJ1 1KS5A 1S0JA 2Q4SA 1PO21 3KQRA 4ASMB 2VVEA 1FOD3 1XRUA 3O12A 2E53A 1S0IA 4YVSA 1X7NA 2ZPXA 1OI6A 1NXD1 1REEA 3HT1A 2ZKLA 2OIIA 4FPEA 3BODA 3LWCA 1RMU1 4Q0PA 4Y20B 2GDFA 1NCRA 1GZ9A 4L92A 2CGPA 1FMD2 4LO7A 3MIEA 5KXDA 4F8AA 3FZ3A 1VBE2 4DFSA 4WV8A 5CG8A 4TYSA 4JAAA 2YGMA 1QJY3 4BE3A 2F4PA 4D94A 1XNKA 1LB2A 2P34A 3MW3A 3VBFB 2WIIB 1AR92 4QPIC 2A6VA 1DBNA 3VV1A 1NCQB 2WZR1 1PO23 4ATEA 3VL9A 3DGTA 1BMV2 5BXXA 1PMIA 3UK9A 2AYHA 3NV3A 2ZGNA 3M70A 5LEKA 2JG8A 5ACA3 3IBMA 4ZU7A 1DGRA 4YGEA 1LOAA 1IQAA 4LBMA 2Y26A 3VZJA 2D6MA 1GYKA 1CAUA 4FP3A 1J1TA 1RUD2 3MF9A 4HVRA 2HWD1 1BYHA 2ZBJA 1WMDA 4XYXA 3FUOA 4RFT0 3PVBB 2IFWA 5CNAA 4Q0SA 3VDDC 2EXIA 4IEVA 3WW4A 3D4KA 4XW3A 4AVTA 1HV1A 2JE7A 4QMAA 1JW6A 2JEMA 1U5IA 4P9LA 3H1YA 1O3RA 2O0OA 1VAMA 5L73A 1JYIA 4ITCA 2IXCA 4K6BA 2GALA 1SEFA 1LULA 1QOTA 5GJ6A 2XKPA 3WP5A 4XETA 4MGKE 1OMIA 1ASJ3 2P17A 2W0XA 2JX9A 2WNEA 4IV3A 3H50A 3FWEA 1F31A 5GLTA 1V00A 3SNMA 2AGSA 2NQYA 3USSA 3LA2A 4COZA 2ZGMA 3TOJA 1VRH2 3VDDA 4JDMA 2IXHA 1HLCA 2VUAA 2YDEA 3WDWA 1S2KA 1BJQA 5GZCA 2JJ6A 2X53S 4JRAA 1WD4A 4AEDB 4LULA 1KFUL 5J7MA 1NZCA 3KT1A 2X5IB 1QJU1 3MYXA 3ZFEA 1MQTB 3B9IA 5CG9A 1U5XA 3AP5A 5K7PA 4P9XA 1UZZA 4MYEA 2QCSB 3VBRC 4LTAA 1D2SA 4EN7B 4ZXKA 4Z8BA 1OPOA 2C0ZA 5CADA 1OA2A 4B7EA 2GZWA 5EYYA 1C5HA 1MR5A 1TNRA 2X5IC 3NSTA 2EA7A 1W0OA 2ZGTA 4AEDA 2A6WA 1AR61 4D69A 1NCQA 3ZSLA 1ENSA 3RI8A 1R1A3 4N9IA 2DVDA 3ZSMA 2BTVC 1CAVB 2R0FA 3ZSEA 4CDWA 3OYWA 1B35C 1VBC3 1VBA1 3I4IA 3UV9A 4M3CB 1ZX5A 3AM2A 2PYTA 4SBVA 1V9U1 4HSLA 1WLCA 3QLQA 1DQ6A 1AL22 5E88A 1AZDA 2UWBA 4QXKA 4YW4A 4P5HA 2K2SA 1D4M3 2BUKA 4S2FA 1PVC1 2JG8B 1FV2A 1XXNA 3AXEA 1RVF2 1VRH1 3PTYA 4FOQA 2DV9A 4P9JA 3AKRA 5FOBB 2VMGA 1BZWA 1FMD1 3MFCA 2E51A 1AYM2 4FPLA 4Y1ZA 1B09A 4WM8B 1EAH1 1FX5A 4X8NA 4TWTA 3ZN5A 3ZYJB 4COWA 1O5LA 1VRH3 3VKFC 4OVEA 1ZZ7A 2HWF3 3M2MA 4YZ1A 4CDXB 4XTMA 3LA7A 3AP6A 3AYCA 2HWE3 3WINE 3TAYA 1IKPA 3AYAA 1L3JA 2VG9A 1W6QB 5A33A 3WX5A 5IT6A 4FTBA 2Z5WA 4AHYA 2QZ2A 1KS4A 4A2UA 5FRAA 1V6JA 3ZXEA 4BIFA 2V09A 2EIGA 3R05A 4LBQB 4W6WA 4E4ZA 4HMZA 1SLLA 1BK1A 4A7ZA 2ZAAA 1W0PA 2CYFA 5DG2A 3NAPB 2E63A 3LOBA 4R9BA 3D0SA 4XHBA 1G9DA 4AGVA 4CP1A 5C9AA 3I54A 1UU5A 2GNMA 2RS13 1WMFA 1QU0A 1RUI1 4Y1XA 2ES3A 1RGSA 4AVSA 2DVBA 3AKQA 5D1IA 4C0HA 2HWE1 3AP4A 3TBDA 3VN4A 1RJ7A 2HWF1 3WZ1A 4FQZA 3LSDA 4PLMA 4F7ZA 1R1A1 1DYPA 5C6CA 1WW7A 1RUE2 1U5ZA 3V0BA 1AR83 4DRRA 1PO13 4KU7A 4AQSA 1VBA3 1HRI2 1UKGA 2EXKA 1EAH3 1H2NA 4CP2A 1I5ZA 2BVBA 4JGYB 5CA6A 2BYVE 5JSRA 1OQEA 4LO4B 4E9KA 2Z42A 3B5LB 4I09A 2NZ9A 1EV11 1CAVA 1I3HA 5LRSA 5F9TA 1SACA 4MH0E 2XL7A 2HWB1 3USUB 4JDOA 1D4M1 2Q5TA 1HKDA 1Q8PA 1VBB1 4V1PA 1ZZCA 4ATFA 1UF2C 2ZS6B 3M3CA 1COV3 2IXKA 4AQTA 2MEV3 1I6XA 1AYN3 2DFCA 1LHNA 4YZ2A 5FOJB 3NO8A 2DVFA 3FX3A 1VIWB 4LE3A 3ZYPA 2WT2A 3D8CA 1GSLA 3RJ2X 5BYNA 1XU1A 3WG1A 1LGBA 3VBRA 2P2KA 1T6GC 3FBMA 1AR81 5JOXA 2UY9A 2R6QA 1DGWA 2Y38A 1MS8A 3PNAA 1LOCA 1CESA 4PF5A 3AKPA 1PM7A 1AUYA 2R071 1SFNA 4XFHA 1TME3 4C1WA 2BBVA 4AK3A 1ZBE3 1PVXA 3POYA 2JE9A 2GN7A 2QJVA 1TNFA 4K1YA 5FFOC 2ZX0A 1I9RA 5AC91 4KBBA 4O9EA 2CV6A 3MZHA 3AZVA 5J48A 1CN1A 1CR7A 1K5MB 2E6VA 5T55A 2JKBA 4D3WA 4CEYC 2D6OX 1ULGA 4Z1VA 1FPN3 1YFUA 4U36A 2Y0OA 1GANA 2WLPA 4YG0A 1NE4A 5DUWA 1H2KA 3TRSB 3VBHA 4JRLA 5FLHA 4L2NA 3VBHC 3LKJA 5JOZA 1LCLA 4S2GA 3WCRA 3U10A 1VBD1 3WQ1A 1ULCA 4EWEA 4L9BA 4YLZA 3N35A 1Q8VA 3VKMA 1BKZA 5C9AB 3DV8A 2AUYA 4MV2A 2XJSA 1RC6A 2Q30A 3LGRA 4R9DA 2JD4A 4YVWA 3B7MA 5BNNC 4XBLA 1BBT3 3VBSB 1D2QA 2PAKA 2IWGB 4HSJA 1Y9QA 5DDJ2 3PJYA 1VBE1 5H9SA 4RD7A 3IM0A 5C33A 1QH6A 1GQHA 1SCSA 3V0AB 1Y7BA 4AVVA 2CWMA 1YFXA 2R32A 2A71A 2BEOA 3EHKA 2HJIA 3HT2A 4FTEA 1HRV1 2WFPA 4I0BA 4GH4C 2ZGRA 5T54A 4Z2WA 5KHIA 2XPJA 5FO9B 1JOJA 4Y5Z0 1VBC2 4KG0A 2EXJA 2WA3A 1LESA 2WS91 2QDRA 1YJLA 1Z78A 2VQ0A 3RRDA 3HQXA 5HBAA 2XJTA 3O0VA 3VDDB 4JGZB 5CVRA 1G8WA 4GALA 2IXIA 1LU2A 2TNFA 3ZYIB 4BCUA 3SMHA 3KCCA 1AX1A 1RL3A 4BMBA 2WS93 4AHWA 4KH9A 1B35A 2PELA 2XWJB 2YMZA 2RS53 1PIV3 3CU7A 1ZZ8A 3RYRA 1TME1 3MFAA 3OBTA 1OLRA 5JDBA 3JCIA 2WZPP 4MSVA 5AVPA 1RUC1 1V6OA 3W9AA 1AF9A 5DZGA 3GZTB 3JB4C 2XJQA 1REDA 4A7YA 3H8UA 2RS12 2YYOA 4NHMA 1W6PB 2WKKA 2JG9C 1R091 4F83A 2R063 2CWSA 3VKNA 2UWCA 4YGBA 1F8VA 3ES1A 4PBOA 1DFQA 1Q3EA 2D7FA 2IC1A 3EJKA 3E5XA 1AR91 4Q2FA 4RGGA 3WLUA 3WUCA 1D4VB 3ASIA 1YIFA 4WVMB 3GBFA 2RHPA 4AFBA 2QKDA 5KXEA 5KXBA 3RNSA 4HKLA 5GKAC 1FV3A 1RUE1 1ZBA3 3IN9A 5FQ0B 1K5MC 1KFXL 1MS9A 4P9YA 2BNOA 4MGIE 1VBD2 4XBNA 5GZDA 1QF3A 2HWF2 2WINB 2PHWA 4FOWA 3TNQA 1RITA 4GWNA 5BNPC 3A0NA 2CGOA 2RE9A 4Y1UA 4CEYB 4FQ4A 3WG3A 2NMOA 5JSOA 2UYAA 1V6NA 4FVVA 4B4QA 4XXAA 2E7TA 5JZGA 3NJZA 5FDBA 1QJY1 4N53B 1Z0HA 4CTEA 2VY0A 4FAGA 1RUF1 1IS3A 1W6PA 3IKWA 2CAUA 5DUXA 2WNUB 1RUC3 2DURA 4HKWA 3AFGA 4DS0A 3ZO0B 4LEJA 1CD3G 4FPGA 4DY3A 1PGW2 2GC1A 5E89A 5GM0A 3TN92 3VGIA 2GNBA 4CDUA 4E2GA 1LRHA 4GKXA 3BU7A 5K8SA 1NYWA 4PDWC 2SLIA 4XJ8A 1AVBA 3ZSKA 2C1FA 3CNAA 1QJX1 1GNHA 2YC0A 4BA6A 1AYN2 5KHHA 3PVNA 1XNDA 5DZFA 5GALA 2B45X 3H7YA 3QD6A 1YIPA 4Q0VA 5A3LA 1W39A 4LBNA 1M06G 3T2TA 3MIHA 3OF1A 4EN6B 3AP7A 3KCYA 4B3NA 3I7DA 1FNYA 1SQ4A 3M3OA 4P9GA 2GC3A 1TE1B 5GLZA 4AW7A 4AVCA 1D0GA 1KXGA 1QXRA 1YLLA 4IL7A 4G9SB 1LECA 2CY6A 4EROA 4CRQA 1EV13 4Y24A 4HPKA 5L7OA 1XQNA 4HK8A 1LU1A 4GXLA 2R061 4YM2A 1D0HA 2ZTNA 3H1MA 5C4WA 4K1ZA 3RMYA 3RQ0A 1C3HA 2PHLA 1CONA 2VW1A 3N7MA 3UJOA 1ND2C 3AZZA 3U07A 1LEDA 1QJX2 3ZMOA 1IOAA 2ARBA 3ME2A 1SBFA 2RR12 4UW3A 2IXJA 1OLQA 2WFF1 3VZKA 4XZPA 2FMYA 2QDNA 4QQ2A 4BIOA 3ACLA 4AEJA 3VL8A 1POV1 2CTVA 1VBD3 4BWOA 1R1A2 5KBFA 4CDUB 4QGMA 4DOUA 2I07B 4XFAA 2MPFA 1U0AA 5A32A 1OHFA 2DTWA 4U2AA 1TMF2 3VZLA 3SH5A 5HCAA 3SLIA 3EBRA 4Q8LA 3RWNA 4DY5A 3G6JB 5I0SA 4UBHA 3VBOB 5CFCA 3IDEA 3ZSJA 1SBDA 1AL23 4FPYA 1MZ5A 3GBWA 1FPN1 3VZNA 3L9JT 4XFFA 1UPSA 2EVXA 4FP2A 1Q43A 1RVF3 1QJU2 2W52A 2XVGA 3AMNA 3AJZA 1OFNA 3MIBA 1AXZA 3SHRA 4GMP0 3FUQA 3JD72 1Q8SA 4C1XA 2GC0A 4OI4A 5KXCA 1YFYA 1YHFA 1C1FA 4YW2A 1IS5A 2BFUS 3ES4A 4PCRA 5JOWA 4HL0A 2DVAA 4A3XA 2XJUA 4XJUA 4XJWA 3BOWA 2VW0A 3S0MA 4RQPC 4YYOA 1GFF2 4URTA 5JPMB 1MEC3 4LE4A 4XMIA 2P3JA 2R072 3KB5A 4LBQA 3B3QE 2WL1A 1AHSA 5EFUA 3OD0A 1FAYA 3SCFA 1DGWX 1WGPA 1DQ0A 4ZU4A 1G7YA 2RS51 4FCAA 3WG2A 1UMZA 1W6NB 2WNUA 3FC0A 4WBBA 4XF9A 4AG4A 4DMIA 2ZGPA 4J1WA 2OVUA 3THPA 4QU2A 5HCFA 4WVZA 4AGGA 2A7AA 2XBO1 2R16A 3FFZA 3VHRA 3WQ0A 1C8M3 1LOFC 3ZFFA 4KG8A 1WCDJ 4HT1T 3IT8A 4GH4A 5GLUA 3C3VA 3WUDA 2BPA2 4M0HA 5EYXA 1PIV2 2XB6C 1AL0G 2SBAA 4QGNA 1ZYBA 4FPCA 2ZHNA 5I0RA 5J96B 3LB9A 3R0RA 3T1MA 3KSCA 4Z07A 2WZR2 1RTVA 3VHNA 2NM1A 1F9KA 1KRIA 1H2LA 5F6LB 2B42B 2R041 1W6OA 5J3UA 2CGNA 4M01A 4QHBA 2ENRA 1MS0A 2VOWA 3I59B 3VBFA 4WM7A 5BV6A 1ENXA 1HQLA 1OFSA 4ZU5A 2VUJA 3QOPA 3K51A 1HV0A 1DGRN 5BNOB 1KDKA 4NHLA 3ZIXA 2D40A 1NCRC 2JDZA 2K0GA 1GR3A 5FQ0A 5FLJA 5JLVA 2B9UA 3VBOA 1IS6A 2FQPA 3M8LA 4XF3A 1ENQA 4NHKA 1S55A 3E5QA 3HD8B 1V6IA 1AR93 4BMEA 1S0CA 3WT3A 3MGUA 1HQNA 1ULFA 4AQ6A 4AF9A 4P9IA 4YVSC 5A3MA 1PO22 2YPJA 4QD2A 5BNPB 5KHJA 4FXKB 3KZ4C 3GHNA 1ZBE1 2VMIA 4MUVA 2DCZA 1DQ4A 1NCRB 4PIXA 3OGGA 5A32B 2GNDA 4KQ7A 4PLOA 4OHVA 1UN1A 2X5IA 4H3WA 1F5JA 4OUSA 2A70A 2TUNA 4BLIA 5CIRA 1DQ5A 4NWWA 2DCTA 1AXYA 5KHKA 1EP0A 4ES8A 3ZFEC 1KD7A 2WLQA 2PAMA 5BPXA 1H1IA 3JQXA 4LBQD 4AFMA 5CFDC 4AI3A 3OTFA 4LA2A 3VZMA 4E4SA 1VP6A 2WT0A 3AMHA 4R9AA 1A6CA 4XFCA 4QGLA 4YVWB 5BNOC 4RL7A 2D93A 2PA7A 4JV4A 1OKQA 5L7OB 3D82A 4B4RA 3GYDA 4JGYC 2HWD2 5AFBA 1UPIA 2A3XA 1ONAA 1JXNA 1WBLA 5CFDB 3UJQA 2D3RA 3KT4A 1PO11 4XF4A 1CPNA 4TLFA 4RS5C 3USUA 2XWBB 3VZOA 3QACA 2FZ1A 5GLVA 5F1RA 4QM8A 1CAWB 3GALA 4CEWA 1V9U2 3OD4A 3ATGA 4PDWA 4EN8B 4Q26A 5C4WC 3JBG3 4WVMA 1BVVA 3VUOA 4HFSA 2WNVA 5DDJ3 1PGL2 3WDUA 2XG3A 4MLOA 1QXPA 1A8DA 2HEVF 1OOPC 3TB0A 1J3QA 4GH4B 1RVF1 1AX0A 1QJX3 2BVVA 1LOFA 1UD1A 2A6YA 1U12A 2B5HA 3MF6A 4YGDA 1GZWA 4COYA 5JZGB 4YVWC 4LHLA 4KGGA 1U5YA 3VBRB 1AL21 3OBRA 4YG6A 3AMQA 1DU3D 2HEWF 4GIQA 4CEWC 1DQ2A 1HX6A 3PVOA 1BEV3 4Q4X3 5T5OA 1E57A 4QPIA 3ZPYA 1X33A 2AREA 4PBPA 1UIKA 5T5LA 5FBZA 1N47A 3BTAA 3NW4A 3NV2A 3WP3A 4B8EA 2XVKA 4KL1A 4Y22B 4Q4Y2 4WVVA 2W39A 2CL2A