4GMP1

Crystal structure of enterovirus 71 strain 1095 procapsid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
225
structure length
218
Chain Sequence
HSTAETTLDSFFSRAGLVGEIDLPLEGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGGVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTKDLEYGACPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the procapsid and mature virion of enterovirus 71 strain 1095.
pubmed doi rcsb
molecule tags Virus
molecule keywords capsid protein VP0
total genus 31
structure length 218
sequence length 225
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4gmp100
1BEV1 1ND2C 4CDUA 1PO21 4RHV1 1PVC2 4RS5A 2R041 4JGYB 4Q4X1 4GH4A 5BNOA 2R073 1R082 1NCQC 1MEC1 2BPA2 1ZBA2 3VBHB 1MQTA 2RM22 5JZGC 1HRV3 2WZR2 4PDWB 5L7OA 4Q4W1 3J8F3 3ZFFB 1FOD3 5C4WB 1GFF2 3FBMA 4GH4B 5FMOL 1VBC2 2FZ1A 1HQNA 1VBD1 5CFDA 3JB8A 4QPGA 3NAPB 4FSJA 1NA1B 2FZ2A 1HRV2 1ND3A 4CDUC 1BBT1 1FOD2 1R081 1QJX3 1AR62 2TBVA 5A33B 5C8CB 3CJIA 5K0UB 1PVC1 4WM7B 5C8CC 1QJY3 2RR12 5C9AC 1F8VA 1VBA3 5GKAC 4Y4YA 4N43A 1DDLA 1AL21 3J8F1 1EAH1 1COV2 2RS13 1PGW2 1B35C 5JZGB 1VBD3 3JBG2 1QJU1 5ABJB 1BBT3 5FMOS 3VBUA 1HRI3 1QQP3 2HWE3 3ZFGB 5BNPB 3VBSB 2HWE1 4RS5B 1RUI1 3VBUB 1QJX1 3DPRA 2HWE2 1K5MB 2RMU3 4Q4V3 2HWC1 5JZGA 1A6CA 1AR81 5ACA1 1NCQB 1QJZA 1B35B 1AR83 2MEV2 4Q4X3 1OPOA 2R071 4GMP0 3VDDC 2MEV1 1AL23 5AC92 1R1A1 2RS53 2MEV3 4Q4X2 1RUF1 3VBFC 5C4WC 4JGZC 1RUG1 1PIV2 2WZR3 1V9U2 1ASJ1 1VBC3 2R061 3NAPA 5CFCB 1PIV3 1ZBA3 1RVF2 1ND2B 4Q4Y2 3CJIB 5K0UA 1BEV3 1V9U3 1HXS1 3J8F2 2DF7A 3ZFFC 3DPRB 1R093 1RVF1 5D8AA 1COV1 1FPN2 4Q4W3 1D4M3 5CFDB 5FOJB 2RR13 1R1A3 5BNOC 1RVF3 4BCUA 3VBOC 1VBA2 4JGYA 1MQTC 2BFUL 2HWF1 1TMF2 1OOPC 4WM8C 3NAPC 1D4M2 2WFF3 1EV12 1MQTB 5ACA2 1RUH3 4CDQC 3JBG3 1TMF3 4QPGC 2WZR1 1BBT2 3JD73 1RUF2 1EAH2 5D8AB 1RUD1 1QQP2 1POV3 4N43B 4Y5Z0 1MEC2 1NCRA 4CEYA 4RR3C 1COV3 4N53A 2X5IA 5C9AA 4WM7A 4CDXC 1OOPA 2IZWA 2ZTNA 1RUJ1 2RR11 1H8TB 3VBFB 1VB4A 1B35A 1SMVA 3JBG1 3ZFFA 3JD71 1NCRC 4CEYC 1HRI1 1NCRB 4CEYB 2RMU2 4Q4V2 2XPJA 1IHMA 1PGW1 1RUH1 3VBOA 4NWWA 4YVWC 1NY72 2HWC3 1F2NA 2GSYA 4CDWA 3ZFGA 5BNPA 1NOVA 4LLFA 4IV1C 1TME1 1VAKA 2RS52 1V9U1 1VBB3 1RUJ2 1QJU2 4AEDC 2ZAHA 3VDDB 1VBB1 4YVSB 1R092 1EV11 5CFCA 3VBOB 1VBB2 1R1A2 1QJU3 4CEWB 2WS93 2RS31 4IV1A 4YVWB 4RQPA 1AR92 3VBSC 1RHI1 2PLV3 4IV3C 1ASJ3 1TME2 5DDJ1 1RUD3 2XBO2 2RMU1 1ZBA1 4Q4V1 1PGL1 2PLV2 1ASJ2 1HXS3 1TME3 1HX6A 1MEC3 2WFF2 4GMP1 1HRI2 1RUD2 2XBO3 1RUH2 3VBHA 4CDWC 1WCDJ 4GH4C 4RQPC 1C8NA 1HXS2 2HWF3 1AYM1 4WM8B 3VBSA 3JD72 1RUF3 2QQPA 1VB2A 3M8LA 5C4WA 4N43C 4PDWA 5L7OB 5L7OC 1NY71 1OHFA 1POV1 2HWF2 5DDJ2 4RHV3 4CDQB 2HWD3 1FMD2 2WWSA 4NWVA 4AEDA 1RB8G 5DDJ3 4FTBA 1ND3C 4N53C 5ABJC 4Z92B 1D4M1 1AYN1 3JB4C 1PO22 1AR91 4N53B 4GMP3 3LOBA 1VRH1 2HWB3 1RUJ3 5J96B 5A32A 2HWC2 1PGL2 4Q4Y3 2HWB2 5C9AB 4Q4Y1 4FTEA 1VRH2 2HWD1 1RUC1 4QPIC 3VBRB 4CDWB 1BMV1 1EV13 3S6PA 1PO11 2HWB1 4QPIB 3VBRC 1AR72 1X36A 4FTSA 2XBO1 4PDWC 1VBE1 3TN91 1AYN3 2RM23 1AR93 1RMU2 5K0UC 1ZBE1 2Y26A 1AR73 4EJRA 4CDUB 1Z7S1 4IV3B 5ABJA 5A32B 4RS5C 4RR3B 2WS91 3ZFGC 5BNPC 1RUC3 3ZFEC 2VQ0A 1AR63 1QJX2 4IV1B 4YVWA 3TN92 3VBFA 1AUYA 1PO12 4SBVA 1C8M2 1ND3B 1FMD3 4YVSC 3TN93 1Z7S2 4AEDB 1OOPB 2GH8A 2R062 2X5IB 1ZBE3 1C8M1 1PO13 1RUE3 2WLPA 1W39A 1C8M3 3ZXAC 2R042 4RR3A 1VBE3 1Z7S3 1RHI2 2HWD2 1NG0A 1AYM3 4QPIA 1VBC1 2R063 4WM7C 4CDXA 5BNNC 1TMF1 5AC91 3CJIC 4WM8A 1VBA1 4CDXB 4RFT0 2PLV1 4JGYC 1RUG2 3HAGA 2ZZQA 1PO23 1FMD1 1RMU1 1HRV1 1VRH3 3IDEA 1RUE1 3VBHC 1M06G 2R072 1E57A 4GB33 2WFF1 2WS92 2X5IC 1QQP1 1FOD1 2BUKA 5LK7B 4RQPB 1X33A 1FPN1 5AC93 3ZFEA 1PVC3 1H8TA 1AR71 1AYN2 4CEWA 1R083 1BMV2 3DPRC 4QPGB 3ZFEB 4YVSA 3VDDA 4CDQA 1POV0 1QJY2 1RUC2 1RMU3 1NA1A 1BEV2 5BNNA 4JGZA 2BFUS 2RM21 1RUI2 5BNOB 1NCQA 1H8TC 1FPN3 4Q4W2 3VBRA 4CEWC 4JGZB 4RHV2 1VBD2 2BBVA 1RUI3 1ZBE2 1PIV1 5J98B 5CFCC 2R043 1VBE2 5ACA3 1RHI3 5BNNB 5D8AC 2RS12 1R091 5CFDC 1K5MC 1AR61 1EAH3 1ND2A 2RS11 1RUE2 1CJDA 2RS32 5A33A 1AR82 1AYM2 5C8CA 4IV3A 4GB31 1AL0G 2RS51 1AL22 2RS33 4GB32 1CD3G 1RUG3 1K5MA 1QJY1 3VBUC 1NA1C
chains in the Genus database with same CATH superfamily
4LMFA 3PUQA 3QD6A 4G3YC 4LOSA 4FXGB 3RQ0A 3WG3A 4M3CB 4RS5A 2PAKA 2V5YA 1OKOA 2R041 4JGYB 4Q4X1 3ZPYA 4GH4A 2A75A 2NM1A 4XFFA 2Y6JA 5FYTA 1NCQC 1MEC1 1UZWA 1FT9A 4IEWA 4COZA 2GNDA 3KQRA 1LKNA 1RGSA 3E6CC 4PDWB 3AM2A 4Q4W1 5T52A 1OUXA 3VZLA 2UU8A 5A1LA 4HBNA 5IJRA 1C3HA 2O8OA 3S7IA 1O4ZA 3LEMA 4SLIA 4GIQA 1LNSA 1VBC2 3NVCA 4NIDA 4FVVA 2YV8A 4QXBA 1HQNA 1VBD1 3EXUA 3PNAA 1N47A 3KQ4B 4H7LA 4QPGA 4Y20A 4KWKA 1ND3A 2DUQA 3WQ1A 4CDUC 2BVVA 4MG2A 1R081 1SLBA 2WAAA 5C8CB 2HYKA 3AZWA 4QGMA 1W6NB 4NIIA 1UOBA 1YQCA 4Y26A 2VBBA 3PJQA 3V0BB 2JWPA 2WT0A 3GALA 1QJY3 5FZLA 5C8CC 4AI1A 5C9AC 2DYCA 1VBA3 2JD9A 2Y64A 4H7MA 1QOTA 2ZPXA 3QH6A 2KD7A 3MF6A 3J8F1 1EAH1 4XTMA 3SITA 5A1AA 3V0BA 4FCAA 2DBNA 1UMHA 2A73B 1UMIA 2YZ4A 4XACA 5CNAA 2Q8CA 2XL7A 5LEKA 1W8WA 2VVDA 1J3RA 4B3NA 5KHJA 3BB6A 5EYXA 4D7TA 4DXZA 2D40A 3FHIB 4XBQA 5ABJB 2DFCA 4YGDA 1I1EA 2V5DA 2Y6GA 2DTWA 2EF6A 1N1TA 3AFKA 3ETPA 4CUGA 4Q2FA 3ZM8A 3VBSB 5L19A 4E9KA 4AAPA 3WZ1A 2E7TA 2EAAA 4BLJA 4CCDA 2GH2A 5BUVA 2A7AA 3W9AA 4I30A 4UWDA 1O8SA 3OPZA 5FZGA 4Q4V3 2HWC1 5GLVA 1A6CA 1AR81 3O1VA 2W1QA 1FATA 4XQDA 2DVAA 2IXCA 2XMLA 5GZFA 1NCQB 1PX3A 3WF1A 4NOTA 5JMOA 3POSA 4ISQA 2Q5TA 2QNKA 3BYWA 4YRDA 1QY4A 3OUIA 2MPFA 1VPHA 4YW2A 3USUA 3D82A 2WA3A 1OA2A 3E6BA 3N9LA 3ZX7A 4DEQA 5AC92 2RS53 5LA0A 5CISA 2P5BA 3B9IA 3LB9A 4LBOA 1Q8QA 1WLTA 1DYKA 1UO9A 4AVVA 2XKOA 4BXSV 5C4WC 5JDBA 1DLCA 4LK7A 1RUG1 4PI2A 1NE6A 2WZR3 4TTGA 4LULA 3T09A 3CZUA 3I2FA 3USUB 5A3PA 4A7YA 4DY3A 1V9U2 2ZJCA 2OYZA 3NAPA 5JIAA 2R6QA 2E32A 1WA6X 3U75A 4BQ2A 3IDAA 3NV2A 4O9GA 5FCCA 5FLHA 4XCBA 4Q4Y2 3CJIB 3KGLA 1LOBA 1JZ5A 4QX0A 3UJOA 1BEV3 2VCMA 4AI8A 3FLPA 1BJQA 2E9QA 3AZVA 2DF7A 3N9QA 2YGMA 5A1FA 1V0AA 2VZPA 2JG8C 3W20A 4YW4A 1FPN2 2D6OX 5FOJB 5FMDA 1R1A3 3B69A 3I3DA 5FZ4A 4BCUA 3VN4A 4HT1T 2BFUL 2HWF1 2QVSB 1W90A 2YB7A 2BERA 4QQPA 4Y22A 2OUHA 4MGKE 3NW4A 4PJYA 2Z42A 2WFF3 4LO6B 2VCBA 5I8YA 3FHQA 3SC7X 1J84A 5ACA2 5JOZA 3O12A 4MYEA 2MHFA 1CZSA 2E33A 1QXPA 4O7XA 4BQ3A 3WNXA 3QH7A 3MW4A 2EXJA 3TRSB 2WA4A 4BQ5A 2WO3A 5HI0A 4EWAA 5EXOA 1RUF2 1OBNA 2R1DA 1RUD1 1QQP2 5FTTC 3RWKX 1SEFA 5F2WA 1MEC2 4CEYA 1PZ7A 4LTAA 3RFRA 4QB1A 4COYA 5H9RA 4MH0E 1GNZA 4MVTA 3GHMA 3THDA 4N53A 1JUIA 1I9RA 4LJHA 1QMJA 2PTMA 2WSUA 5LBCA 3SCGA 1ZM1A 3N7MA 4ZU5A 2XHKA 2ZTNA 1H4GA 5EV7A 5DXDA 2X53S 3B02A 3FHAA 1H4HA 1KFXL 1Q8SA 4HN1A 1L7RA 2RR11 2YBPA 5A7WA 3MPPG 1CGPA 2XWJB 5LA2A 5A3OA 1NXMA 1MS3A 2J1UA 2YFZA 3BIWE 3AB0A 5K7PA 1P8JA 5FV3A 4FOQA 4YLZA 4EN9B 5F37A 4XYXA 5FYCA 2OZ6A 4Q4V2 3RZGA 1YEWA 1IHMA 1PGW1 4LBQB 1LB2A 3VBOA 2XQRA 4YVWC 1NY72 2HWC3 2VOKA 4N8MA 4AI2A 4BIOA 3MUZ1 2GSYA 2JECA 2XVGA 4AGVA 4CDWA 3C7EA 4ZPIA 1OA3A 5F6LB 5FRAA 3ZFGA 1NOVA 4LLFA 3LEIA 3LOIA 3MGUA 3UT0A 4IEOA 5JUVA 2P34A 2WYSA 3PMEA 2TUNA 5F39A 3UKNA 1US2A 3VKFC 2RS52 4N9IA 1V9U1 3MLJA 3U07A 1VBB3 2VOWA 3J26N 3M4FA 1N3QA 4I0BA 5IVYA 1YFWA 2LM3A 5FZ9A 5C3RA 5F9TA 5FZ1A 1S55A 2IXIA 4XJWA 3MW2A 3KV9A 1MR5A 4FPKA 5CFCA 3SH5A 4I2OA 3ZN5A 2OQ6A 2WNOA 3NO8A 3ZN6B 2VUJA 5I93A 3VD4A 3JCIA 4CEWB 1QWRA 1Q3EA 1DGLA 2DCJA 2Y38A 4YM0A 5A3NA 1H1IA 1NT0A 1X8EA 4ARXA 4CP0A 1DQ0A 2RS31 3A0KA 4CUCA 3B5LB 4ET7A 4RQPA 4E4ZA 3WHUA 5JOWA 2ATFA 3VBSC 5FZHA 2EAKA 4JX0A 1L3JA 2PLV3 3HQXA 1AX1A 5IWFA 1O3TA 1OSGA 2DCKA 3O1UA 1W2TA 1W04A 1AXYA 5E88A 5HCFA 1YQ8A 1J3PA 5FYHA 4OHZA 2OKXA 2RMU1 1PGL1 5LBEA 3HNYM 3WDVA 4AEKA 3IN9A 5F8PA 1HXS3 1TE1B 1WW5A 1HX6A 2PQSA 4XAAA 2WFF2 3WEZA 4PQQA 4JAAA 3I7DA 4XUOA 1F9KA 5DUXA 2FDHA 2D3PA 4KG0A 2QQIA 4MHRA 1AYM1 1CR7A 1H8VA 1V70A 1RUF3 5FUNA 4HPKA 3GZAA 1XE7A 3M3EA 2D3SA 4XPVA 3LDKA 5L7OB 4L92A 2XWBB 4AQSA 1LCLA 3GDBA 1RIRA 5JOYA 2SBAA 2UY9A 2CWSA 2W1UA 5IYYA 4GKXA 4P08A 3WNPA 3J7HA 3DKQA 3NNFA 3WSOA 1XC6A 3GF6A 4YFWA 4NRPA 1VAMA 4W6YA 4AI9A 4CXXA 4INDA 3H1WA 1DIWA 2OXBA 5A6QA 1WGPA 2JB8A 3ZYIB 3R4UA 4YGEA 3T30A 3WX5A 4FTBA 3ENRA 1UIKA 4UW5A 4Z92B 3HNMA 3E5QA 1D4M1 3MIBA 2RVAA 3ON7A 4QU1A 3AMHA 1NZCA 3ZYBA 4KNCA 1AR91 3LKJA 1ZYBA 3OJBA 4GMP3 4R52A 1HJGA 3IIAA 5F1RA 3FBYA 1HW5A 1UIJA 2VZ3A 4B1MA 4EN8B 5A32A 3KMHA 2HWC2 1LECA 3BU7A 5TSWA 4NPLA 4AEJA 4CU9A 5DG2A 4BK4A 1OQEA 4NE9A 4MUVA 2PXJA 4QXHA 1KITA 5C9AB 5DUUA 4XVHA 3GNEA 3PURA 4MGZE 1NLRA 1MS1A 2GC3A 1UXXX 2OA2A 3KB5A 4PHZA 1XNAA 3EJKA 4QM9A 1W28A 2HWD1 2XJUA 2XUEA 4XF1A 3VBRB 2ZABA 4PIYA 4DB5A 2VOXA 3QLQA 1FYUA 3RGBA 4B7EA 1UYXA 2HWB1 3VBRC 1AR72 3ZXFA 4FTSA 4QM8A 2QQLA 1VBE1 4TSVA 2GN3A 1AYN3 5DUWA 3TN91 3HWJA 4AFBA 2RM23 4K20A 4BQWA 1RMU2 1YIFA 4Q0SA 4XDOA 2XJQA 2G9FA 5FPXA 1YFYA 5E89A 1O5LA 3O1SA 2Y26A 3I2GA 3J7MA 2BNNA 2VPVA 3D6EA 3DKWA 5EP9A 1G9FA 4EJRA 3KHBA 2WT2A 4LEJA 1YC61 2RE9A 5J3UA 1Z7S1 5FZ8A 5DZGA 4BH9A 3K4DA 4LBMA 2ZGLA 3KCXA 5EFUA 5FP3A 3GGLA 1HV0A 1AR63 3ATGA 1Y3TA 3JUUA 4QHZA 2QZ2A 2KXLA 4WZFA 3AYDA 1NYWA 2VECA 3PLQA 5T54A 4ASLA 3RZKA 4ZHNA 4IEYA 1PNFA 1KS4A 3TEZA 4MSVA 4R9AA 5IFPA 1WCUA 4YG0A 5HCHA 2ZXQA 4AL9A 5FMBA 3H50A 4IE5A 4DS0A 2ZHKA 2X5IB 3GCWA 1LHNA 3N7LA 1PO13 3Q8FA 1RUE3 3LF7A 2CAUA 2F6BA 1UU6A 3LQCA 3NV4A 2JDKA 1ZRIA 2R042 1DBNA 1VBE3 1MPXA 3KV6A 1Z7S3 3H8RA 4ARYA 3RZHA 1RHI2 1LODA 1NG0A 2VY0A 3NSTA 4WM7C 1EPZA 4IEZA 3NNJA 1MZ5A 4M0NA 5AC91 4KH9A 3CJIC 5GZGA 2W91A 4I09A 1SPPB 1TQ5A 3ZIXA 1O3RA 1W3XA 4RFT0 4EYUA 1A78A 4JGYC 2JD4A 2Q1MA 2WNUA 4YNIA 4WV8A 1SLAA 2OZJA 4NHXA 3VKLA 1EUUA 1YCIA 1GP4A 3HAGA 5EYYA 4A3XA 5A3TA 2VZOA 1HRV1 3WV6A 4QX2A 2YGLA 4CYDA 3D8CA 1M4WA 5J09A 1ULCA 1VRH3 4EN0A 3BPZA 4RD7A 4ES8A 4RGAA 3POYA 5LATA 3VBHC 2DDUA 3RI8A 4GB33 1LENA 1MZFA 2WS92 5C70A 4YGBA 1DQ2A 4UAPA 3W59A 2W95A 2XLGA 5DQ0A 1JYTA 2EA7A 1WW7A 2E7QA 4F7ZA 1W9FA 1H8TA 3CJXA 2Q8OA 3I2DA 3ZXJA 1AR71 1PHMA 2NMOA 3WDXA 1C4RA 5HXMA 1YFUA 3WUCA 5CKMA 5A6XA 4GWJA 4N7IA 1X82A 4W8JA 5APAA 4XFGA 3OGVA 1DYOA 1W6QB 4BDVB 1UCXA 4YZ1A 4DINB 1D0GA 2JDZA 1POV0 1WUVA 1SDDB 2HEWF 1H9WA 4UT5A 5FY1A 3NJXA 1RMU3 1NA1A 5FY8A 4YM3A 2VMFA 2VMEA 4XURA 2CSGA 1RUI2 1W9SA 1WLWA 4E2SA 4ZZ5A 1V00A 1DHKB 1QIQA 4NPMA 2R30A 5CB7A 4COVA 1CJPA 4QWNA 4P5HA 3MZHA 4I01A 1VBD2 1XNDA 3AMNA 3VHOA 5I0DA 5FYVA 5JMCA 4HFSA 1D4VB 1F35A 3HJRA 3CDZB 3LGRA 2R0FA 1NE4A 1PIV1 3QACA 4D6RA 5CFCC 4D7YA 1QNYA 3IIIA 3O0VA 4GA9A 4RSUA 3KZ4C 2FDJA 5EJ1B 5BNNB 4AI0A 5D8AC 4K40A 2IXHA 4Z2AA 4OI4A 5FZOA 3TEWA 1GYKA 5F5IA 3AKPA 4M4RA 4B4QA 1IQDC 4FI9A 3ZSLA 2O1QA 1RUE2 2DCTA 2LW8A 1PVXA 4FBFA 5KXEA 1JN2P 4MADA 5FY5A 4AVAA 1UZ0A 1QF3A 4A7ZA 4FQ4A 4QKNA 4GB31 1N1YA 1RXGA 1UYPA 4P9GA 4J6GA 1UPSA 4P9XA 1AL22 4QX8A 3WP5A 2RS33 4OQ9A 2P37A 2WL1A 1CAUA 3MIDA 1DGWX 1N3OA 2FCUA 3P1IA 4UW4A 2UY8A 1REDA 3ZXLA 1NLQA 3GBFA 4K1ZA 1ZX5A 1RL3A 4X8PA 3WLUA 5KC5A 2QDRA 2W2IA 4NRMA 3AJZA 2RJ2A 1T2XA 3VD5A 2DTYA 2PHWA 3OGSA 5FFOC 3U78A 5CEHA 4IESA 3CO2A 3E1F1 4MOAA 3U14A 2E53A 1ZBA2 2DU1A 1YQ5A 3UJQA 4ATEA 1DZRA 3V64A 1HRV3 1XYNA 2WZR2 4H2AA 4QX1A 3J8F3 1FOD3 2VMGA 4Y1ZA 4YW6A 2KM2A 2JE7A 3ZR5A 5C4WB 1UY4A 3LE0A 3Q8BA 5BYNA 5FMOL 3UL2A 5E8AA 3K4ZA 4XF0A 5CFDA 1URXA 4X6QB 2V4VA 2ZX0A 1BK0A 1OH4A 2ETEA 3A0NA 5B4XA 1G9CA 2XVLA 3SKJE 4YZ5A 5A33B 3CJIA 3AXEA 3IPVA 1JYXA 1PVC1 3POWA 4LHKA 4NVPA 1B09A 2EIDA 3KT7A 4AGRA 4KBBA 3SLIA 3WVJA 3B93A 4JCKA 2ARCA 2G1MA 1L7QA 3IT8A 1UZZA 2XJPA 4ZXEA 4A2UA 4BMEA 4BWOA 3POJA 2E63A 3MICA 4U2AA 1ZVFA 1OVSA 2PA7A 4Q29A 2J1VA 4Z1VA 1DDLA 1FNYA 3R6SA 5DN2A 1HB4A 1NX9A 2R0HA 3OEAA 4EE2A 2V72A 1PGW2 2E6VA 1DQ6A 3H8UA 5JZGB 5DAXA 1HB3A 1VBD3 3OPWA 1BQPA 1Q5OA 4DOUA 1WA4A 5DG1A 2CY6A 2VTFA 1F5FA 1XNTA 1HRI3 2D7FA 2GNBA 2ZGNA 3POBA 3VBUA 4CE8A 1QQP3 1SPPA 2A6WA 5DZEA 1SLLA 2HWE3 1IZ3A 1YIPA 2BNMA 3ZYRA 4RS5B 3NJVA 4NHYA 5JOXA 5BY5A 4Y1XA 3G7DA 3PMSA 1H30A 5A70A 1QHDA 4LHNA 2C4XA 3O1RA 3I8TA 3ILRA 2ID4A 5HPOA 5CG8A 2MEV2 1Q8VA 2W1WA 4Q4X3 5GZDA 2BOJA 4BYYA 1OPOA 4W6WA 3VZOA 2QZ3A 4LIUA 1HQLA 3VZKA 4S2GA 1AL23 3EO6A 2Q8EA 1R1A1 1ZA4A 1K3IA 1OXCA 1QJEA 5JSRA 2VZTA 1GWMA 3GYDA 1G86A 1U12A 3M2MA 1YQ2A 4L99A 4DPNA 4ZKTB 5C8WA 4C0BA 1C28A 3KD4A 3TWIA 3AP7A 3ZN4A 1RC6A 1O4TA 1PIV2 1W6PA 4KGQA 2BZDA 3AKQA 3CF6E 2I2SA 2ZMLA 4QDQA 3URFA 4BQYA 4Y33A 3I2HA 1UY1A 2VUDA 4QU2A 2AGSA 3MV01 2WO7A 3KCYA 2YMZA 3R4SA 3MUY1 5A7OA 3VUOA 1WWYA 1YJLA 4YWAA 1ZBA3 1ND2B 2ZGTA 1KDKA 3GXUA 2GC2A 1XYPA 4NROA 2VNOA 1T6BX 3D3AA 1IG3A 3J8F2 3SH3A 4A6SA 3Q8EA 4HSLA 1GLHA 5M0TA 1D4M3 5CFDB 1X9TA 4CUAA 1RVF3 1UYYA 1JYVA 3LEGA 1UN1A 3CL1A 1TMF2 5JR7B 1OOPC 4KWUA 2CU5A 2Y0OA 3PDQA 5G04L 3MDPA 1OURA 1EV12 3WDWA 5C3OA 4YSFA 1OVPA 1ULEA 1OF4A 1F4AA 2D5HA 2RDSA 1QOSA 3JBG3 1OI6A 4QPGC 4R9CA 4NHLA 3PIGA 1FX5A 3OBAA 1YJKA 5IAXA 4RN5A 5FY0A 2WC2A 5A3WA 1XU1A 3AFGA 1EUTA 2Y0IA 4N43B 1H6XA 5IVJA 3CU7A 5IK4A 1AVBA 3JXSA 4IEUA 4LKFA 1LGNA 2WJSA 4MGSA 4XJ9A 3POEA 1SFNA 1QEXA 4JDMA 4WM7A 1C57A 4CCMA 4LUMA 2IZWA 1YFXA 4A44A 1O6UA 4FAGA 1N3PA 1REEA 2C24A 1PK6B 2WZEA 3BALA 1K42A 3FFQA 1W0NA 2BWAA 4MO3M 3M3QA 5JR2A 2A6ZA 1RUJ1 3ES4A 2E51A 3RDIA 4L0PA 2A6YA 3ZMNA 1VB4A 2Q30A 4KL1A 1SMVA 4XF4A 4NN0A 3WDTA 3U0ZA 3JBG1 3U4XA 3M7AA 4WVVA 3H7JA 3TYJA 4CEYC 1OPMA 5FPVA 2VVFA 3GZEA 4PT6A 2QBXA 1TZOA 5CAZA 3RJRA 2VMCA 2QQMA 4FFGA 4XQ4A 4ZU7A 1F2NA 4QDRA 3MFCA 2NN8A 3ALQA 3P3NA 2A70A 2BGPA 2SLIA 2AZ5A 4HZFA 4WVWA 3C2UA 3WP6A 2C1FA 2WAOA 4ISRA 3MLKA 3E6DA 4R9BA 3ZLIA 5LY2A 2WKKA 1VAKA 4MGIE 1JW6A 4D6SA 3KM5A 3P5BA 2GC0A 2P2KA 2BP6A 3I97A 1NXD1 3K4AA 3KV4A 1U5ZA 4D94A 3IZOA 1DG6A 4A42A 3VHNA 4DNYA 1VBB1 2Z79A 3M70A 4QPYA 3SCFA 4YVSB 4UBGA 3WNOA 5LWBA 1UNBA 1WW6A 2WZPP 3TB0A 5ISLA 3LAGA 2D6KA 1QJU3 1W2AX 1IOAA 3POFA 4PF1A 2W5FA 2ZEXA 4JKMA 5FXXA 3OOXA 4GJYA 4IV1A 4W6XA 3BKZA 4BE3A 3DL3A 1WMXA 3DGTA 1KXGA 2G9GA 5JLVA 3VL8A 2CWMA 1RUD3 5JI9A 1ST8A 5IVCA 1ZBA1 4G9SB 4E4SA 4YW5A 4K6BA 1O91A 2PHDA 2ZX1A 2ERFA 1JBCA 3ZKYA 4XOGA 1H9PA 3BTYA 1ASJ2 1TME3 1ULPA 3LPFA 3AL6A 5GLUA 1IPJA 4GMP1 5GLZA 1E5SA 2XONA 2XBO3 4JC1A 1IQAA 1UWWA 4XTPA 2Q8DA 1E5HA 3NJZA 1OLRA 1POQA 5J37A 2W68A 2BYVE 4UW6A 4RQPC 1W2UA 2PYTA 1C8NA 3M3OA 2HWF3 3MF9A 3MV11 4Q1RA 2Q1FA 2W52A 3U37A 5BXXA 1TVGA 2C26A 2H6CA 3M8LA 1V6LA 1BVVA 2GNTA 3PIJA 3EHKA 5L7OC 1NY71 1OHFA 1U0AA 2G9ZA 2ILMA 1GZWA 2ZGSA 3Q8CA 4FFHA 4L97A 1I6XA 3LSDA 5DDJ2 3ABZA 1ENXA 1DQ4A 3RS6A 4BOWA 4XHBA 4RHV3 4CDQB 1F4HA 1S2BA 4RGGA 3O1OA 1CQ9A 4I02A 1OD3A 4C1XA 4DIQA 5CA6A 3I54A 3I2KA 4CCNA 4YW3A 2JG9B 3SNMA 3I3BA 5FJHA 2VCAA 3ZR6A 4N53C 1YHFA 2IFWA 2ZGMA 4HSJA 3MIEA 1LGCA 5FPLA 5L73A 4URAA 3AZYA 1UAIA 1YI7A 3JB4C 1PO22 3AK0A 1K5JA 3BU0A 4M4PA 4N53B 1XE0A 4AE2A 1VRH1 3DXTA 2R16A 3DYMA 4Q8LA 5GZEA 1AX2A 1CIWA 2XH6A 1T6GC 2D98A 3POIA 4Q4Y3 1DLLA 2B5HA 5BV6A 2NP0A 2FMYA 1ONAA 4JV4A 2HWB2 4QB2A 4DZGA 4RA0A 4EWDA 2RDRA 5I0RA 3PHMA 2HKXA 2ADEA 2RG4A 1SBEA 4P9LA 1LU1A 2ZX4A 4Q0QA 4DUWA 4KG8A 2JDNA 3UGHA 1TG7A 4JDNA 1VRH2 3LWCA 3UGGA 3OUHA 4AFCA 3KWVA 2VJXA 1OFSA 2HJIA 3OF1A 3DXUA 4LA2A 4QKBA 4GXLA 4ZU4A 4TLFA 5EQUA 1MS0A 3S6PA 1NZIA 1PO11 3ETQA 4C91A 4DO0A 1J83A 3WUDA 3CHXA 3K46A 3FWEA 3T2TA 1W8ZA 1JI6A 4HN0A 3VHRA 3PJYA 2AENA 1SLCA 2CDPA 4LUKA 3H0OA 1ZBE1 1S2EA 3RZZA 3TAYA 1SLIA 3ELNA 1S0CA 4XEZA 1DYPA 3TOJA 3WCRA 3R05A 3ZSEA 4JKKA 1GQGA 3C7HA 2J22A 2P1BA 3A21A 5A32B 2BTVC 4RR3B 5FP8A 5GJ6A 1U5IA 2WS91 3A7QA 3APBA 5AVAA 1W6PB 4MGQA 3ZOIA 1XRUA 2OQ7A 4FPHA 1ZREA 3ZFEC 1QJX2 1CAUB 4YVWA 1CESA 2VW0A 5FZIA 3EBRA 3HBZA 4AHYA 3AJYA 4OUSA 5FLIA 2VH9A 3OSDA 2B4KA 4J25A 4QKDA 1C8M2 1ND3B 2GNMA 4LO8A 1FMD3 4LR4A 3TN93 1H2NA 5KBFA 1WW4A 1FV2A 2W87A 1KJRA 2GH8A 3DV8A 4EZHA 2R062 3K48A 1C8M1 1Y4WA 2BU9A 2D93A 1Z78A 1GANA 1A3KA 4RR3A 1GOGA 2IVJA 3CLPA 1E5RA 4XABA 1HN1A 2Z4FA 5ERLA 1JHJA 2RDNA 2ZEWA 3OYWB 2J1RA 4FP2A 5F3IA 1TMF1 3K2OA 4LBLA 4B4PA 4P9IA 3I59B 3PL0A 1Y43B 3JQWA 3WW4A 2XDVA 4KQ7A 2VQUA 3DN7A 4IE7A 4LBQA 2Y6FA 5IFTA 1SCSA 1XNKA 3OB8A 1SCRA 3VDBA 2VCCA 2I45A 2TNFA 3MW3A 4D6QA 1PO23 1FMD1 2VNRA 4E2GA 1VJ2A 4AXOA 3SH4A 3PVEA 5JXJA 1QGLA 3VLBB 3AP9A 5F2SA 3H8XA 4P9WA 1MACA 3I2IA 4ZS2A 3FN9A 1LHOA 2VW1A 2F17A 4E4HA 2R072 1E57A 3PVBB 1S0GA 2WFF1 3P3PA 2B9VA 4H3WA 4AAXA 1QQP1 5I91A 4JKLA 3IB3A 5FY4A 4RQPB 3CQOA 3X29B 2W3JA 2QQOA 1LHVA 1UY2A 4DEVA 1UKRA 4N9HA 3FUOA 2V73A 4J1WA 4XC9A 1UD1A 4E27A 4CEWA 4Y5SA 1UOGA 2P6CA 1YI9A 1BMV2 1RYYA 1WBFA 1PK6A 3EB7A 4QPGB 4XZUG 4Y20B 4Q0PA 2ZKNA 1UYZA 2LALA 4YVSA 3USSA 3T08A 4NRQA 2VUCA 3FE5A 5I8SA 3T2QA 2ZHLA 1BCXA 2X8KA 2A6VA 3LZZA 3WP3A 1W9TA 1Q8PA 2QFEA 1JS9A 1BK1A 3AL5A 4UFMA 1KFUL 3WF4A 4DRRA 1ULDA 2BFUS 5BNNA 1D7PM 1DGRN 1H6YA 3HNBM 3WXPA 1XQNA 1G9DA 4GD4A 1H8TC 2GMEA 4XCAA 4Q4W2 1FAYA 3VBRA 5JXHA 4BK5A 3VDCA 1XBFA 3A22A 4JGZB 1GZ9A 4CPBD 1V6JA 3T2PA 3A4UA 4NAOA 3O1TA 2FDGA 3HD8B 4MLOA 5FK7A 1EY2A 3BUCA 3NNMA 1ULFA 3MHZA 2VE1A 3LSEA 5IUQA 1IKQA 4OULA 4K1YA 3HMYA 3WDYA 5JWPA 2D44A 1DF0A 1LU2A 1EYBA 4FOWA 1R091 1PMHX 3N7KA 1K5MC 4HK8A 4LORA 2VG9A 2ORXA 1EAH3 4LKDA 1SFYA 3LEKA 3MO4A 1GQHA 2B42B 2HLEA 4Q1PA 3C7FA 4S2FA 2AC1A 5ANNA 2C5DA 5FXWA 5JXGA 1MZ6A 4XUPA 2QQUA 2VW2A 2XQXA 5FP7A 5LW9A 4BPZA 2QDNA 1GNHA 1AR82 3AP4A 1IS6A 3AZXA 3R0RA 3WG4A 2W92A 5FYYA 1AL0G 1QNWA 2RV9A 2VXRA 2ZHMA 4YYOA 3WP4A 1JHNA 1TNFA 1JU3A 3M3CA 3THPA 4HMZA 1QDOA 4XUNA 1CD3G 2P6HA 3JQXA 1RUNA 3TBDA 2K0GA 5FZCA 1LHUA 1QJY1 4W4ZA 1QJFA 5KR7A 2A1XA 1YYNA 1W6MA 4HK9A 2JG9A 4CU7A 4O65A 1ND2C 4M3CE 1OUSA 3ZXKA 4NR1A 4XJZA 3VB9A 2QQJA 1PVC2 4ATFA 3GHNA 1DGRA 3VL9A 5EWSA 2WDBA 4OHYA 3MI8A 4BQ4A 5BNOA 2R073 2A3XA 3CKHA 4PLNA 2JIJA 1H2LA 5T3NA 5FUIA 2DURA 5JAXA 5LY1A 3ACLA 2RM22 5CKNA 3S5QA 3UESA 5GLTA 1LR5A 4XMAA 3ZFFB 2B9UA 1YNAA 1GFF2 1ZRFA 1CZVA 3FBMA 5C7GA 4GH4B 4XDPA 1PZ8A 3WF0A 3TNQA 3O5SA 3NL1A 2CDOA 3JB8A 2JXAA 1I5ZA 3WNNA 1DZTA 4FQZA 4UFLA 2WFPA 1BBT1 4OZXA 2VTXA 1AR62 3OD0A 1W05A 4O9EA 1ACCA 2XOMA 2ET7A 1JOPA 2ARBA 1XE8A 4J1XA 3DUIA 5FDBA 2VVEA 4LHLA 1QKQA 4X6RB 3TEXA 4WBBA 4XF3A 3RPQA 3V56A 3LDBA 5IVEA 2HBUA 1W06A 1S4CA 1F8VA 1OF3A 1WMEA 1W8NA 1VALA 2JDUA 3LDRA 2FD8A 5EPAA 4Q0VA 1UZYA 2H0BA 3ZPOA 2Y60A 4HOOA 1AL21 2GDFA 2OT7A 3BPSA 3W21A 4CUBA 2NLRA 2ZACA 4JTOA 4PLMA 1COV2 4O61A 2RS13 5AFBA 4LKSA 1HIXA 1B35C 2P3IA 2D3RA 3JBG2 4UBHA 1QJU1 3E5XA 3WQ0A 3Q8AA 5EJ3A 4CRQA 5I0SA 1VP6A 2EIGA 2PHXA 2WLQA 3ZFGB 4ZZ8A 1LESA 1BKZA 2A5ZA 4QMAA 3UYJA 2YU2A 2WSVA 1RUI1 2XJTA 3VBUB 1QJX1 2D97A 3SMHA 3DPRA 1XU2A 4IE4A 3ACHA 4AQ2A 3GZTB 1UZVA 1K5MB 3SEPA 1YUDA 2ARAA 5JZGA 2IXKA 5FKCA 1QJZA 1B35B 4EN7B 1AR83 1ODNA 1R1ZA 1YXWA 1W99A 1R64A 2ES3A 1AXZA 4LT5A 1IS5A 2R071 1VRBA 2PN5A 2OUJA 1ZRDA 1O4YA 4Y1UA 5LA9A 4BQ1A 4TZDA 1RUF1 4IERA 4BMBA 5FQ0A 2W46A 4M3CF 3IPVB 2NMNA 4AGGA 2J7MA 3Q9OA 2VM9A 4OUMA 4YW1A 3N4MA 2YBKA 5H9PA 1DU3D 2PAEA 2VNGA 3KVBA 3LD8A 1YO8A 3BN6A 5CFCB 4GALA 4RFRB 1WMFA 4Y24A 4QGNA 2VZSA 4XJUA 4META 5FZ6A 4CP1A 2ET1A 1UOJA 4S2HA 4D3WA 5K0UA 2D6PA 4KWJA 1W6OA 1Q43A 1V9U3 1HXS1 2BDRA 4JDOA 3SEEA 4OI0A 1RVF1 5D8AA 2WNUB 5J48A 3AXDA 3DYPA 1COV1 1RJ7A 1AJKA 2RR13 3UGFA 3PU8A 3TEYA 4XMIA 3D0SA 2XGXA 5EZWA 3VBOC 5A6YA 5FZEA 3BTZA 4AR2A 1W8TA 1MQTC 2ZBJA 2WINB 3FFZA 3QOPA 2HH9A 5B2GB 2NQYA 4ZS3A 1LOAA 2XLFA 4ASMB 1IPKA 1MQTB 4CP9A 2I07B 4G4FA 1XNCA 3ILFA 1RUH3 1IKPA 3ZSKA 1AJOA 4DFSA 3FUQA 3S5AA 1BBT2 2DWRA 2PFWA 3CNAA 3N35A 2JX9A 2ADDA 4I3GA 3WQ7A 4M01A 5D8AB 2JE8A 1EPWA 1POV3 4Y5Z0 1XB9A 5FPBA 1GP5A 1GICA 5CIRA 3U4SA 1ENSA 4RR3C 2BNOA 1COV3 2Y6HA 3BOPA 4P5YA 2Y33A 2X5IA 3H3LA 5FPUA 3RZLA 1UL9A 1OOPA 2PHFA 1OQDA 3L9JT 5F6KA 1UY3A 4MGTA 3WNLA 2AYHA 1S0DA 5FYZA 1S1AA 5G05L 1JZ7A 1J3QA 2RHPA 5C6CA 1XOYA 3OTFA 4GWNA 4P00B 4IETA 5DPNA 4OVEA 1H8TB 5LBBA 1K45A 4A6OA 1Z0HA 2LUWA 5T5JA 3O14A 3VKOA 4C1WA 4Q8KA 3BGAA 3IDBB 5IVVA 1QH6A 3THCA 2J42A 3J9SA 1C5HA 3JD71 1NCRC 3L2YA 4CEYB 1PX4A 2XPJA 4Z07A 4PBPA 1CX4A 3RYPA 2YY1A 3RSJA 3A23A 3WDUA 4DUXA 2B7YA 5A7NA 1A8DA 1UU4A 5IVFA 1CPMA 3N9PA 2VMHA 1REFA 3D0JA 3VKMA 4YG3A 2D43A 4IV1C 5EJZB 1TME1 4AFMA 3RZMA 1OC1A 3S57A 1GSLA 1W6MB 3CIHA 3RWNA 3HN3A 4XFCA 3ZKUA 1XNBA 1OA4A 4Y5TA 5LCWL 4K21A 4XDQA 5L36A 2YUEA 3D4KA 4EROA 4Y1YA 3VDDB 4XETA 4CCLA 3VGIA 4OMCA 2HEVF 3J7NA 3OGJA 5D21A 1R092 3AMPA 1VBB2 2IFRA 2WN3A 2XJVA 4PCRA 4RGKA 2UWBA 1NQJA 1I3HA 3R4DB 4GQ7A 3I2JA 4Y3OA 2QQKA 4GKYA 4BZ4A 3W5NA 3KT4A 2GU9A 2JDYA 5FAXA 1BXHA 1BHGA 1OLQA 5FP9A 4LE3A 2YXSA 1AR92 1GP6A 3H1YA 5FBZA 4FPCA 1HN0A 1RHI1 2C6SA 4CA9A 4IV3C 1H1MA 1PGSA 4HETA 4LIVA 1QU0A 2HYXA 1ZZBA 2VQTA 1FXZA 3OBTA 4B29A 1JZ6A 4AFDA 4Z82A 2ORZA 4LO7A 3WOGA 5LRRA 4XFHA 2PLV2 2YROA 2JG9C 1DQ5A 1HRI2 1XSQA 1LTEA 3AYAA 5L9BA 3ZXDA 4BHPA 2AACA 1LOGA 1A34A 4EN6B 1GNYA 3BTXA 1RUH2 4FPYA 3VBHA 4CDWC 4AF9A 3FJSA 1WCDJ 4GWMA 2JB4A 4CVUA 4GH4C 3U1XA 1UQXA 3GZUC 1HXS2 2G4IA 4WM8B 4XF9A 5F3CA 2XL9A 3ASIA 2ZGOA 5E16A 2QQPA 1IGOA 1AHSA 1CAXA 3KT1A 3INAA 4N43C 1RITA 5I0TA 1POV1 4ITCA 5KHGA 1LEDA 4HL0A 1W6OB 2XJSA 3FLTA 4IQPA 1F31A 5I8TA 2FCTA 2R49A 5BNQA 1STMA 3N9OA 3J7LA 3BIEA 1JTZX 1FMD2 4AEDA 4NWVA 3ILNA 1C1LA 5FZDA 3PUSA 3MPBA 4LQRA 1RB8G 2C9KA 1W9YA 3AP5A 3NNLA 1LOEA 4BLIA 5A3MA 1U5XA 1W0OA 2WO1A 4KU7A 1ZZ9A 3SISA 4DXRA 5DAPA 4UXAA 1J1TA 3GCXA 1HDKA 3DECA 3IWZA 4LA3A 4ORFA 2UWAA 3LOBA 1KGYA 5EHDA 5AVPA 1RUJ3 2BVBA 4KBZA 3RYRA 4WVZA 5J96B 2WRAA 1V6KA 2R7EB 3M3IA 5C3QA 3UETA 3EQEA 2VMDA 4PIZA 4R4ZA 2DU0A 1QH7A 1PGL2 4UYBA 2BV4A 5LB6A 3ZSJA 4IEQA 2BW8A 1HV1A 1RTVA 4FOVA 1JU4A 4FXKB 3K3NA 4P9YA 1XXNA 2BQPA 4FFIA 4EZ4A 4WZCA 5CVRA 3T0DA 2W94A 4L2NA 1VLNA 4QPIC 4DMIA 4YFZA 2FDIA 2Z5WA 4D8MA 2DUPA 1KRIA 4OHVA 4UI9L 1EV13 1CWPA 2ZOEB 4LE4A 4JVAA 2ZEZA 4QPIB 5BPXA 3KVAA 1X36A 2WBKA 1JUHA 2GN7A 3CEWA 4GULA 4NAMA 2XBO1 2WN2A 2VZUA 4PDWC 3U11A 5J36A 2CAVA 3RZJA 5LRSA 1AR93 1SLTA 3GBGA 4DUVA 5FY9A 5JI7A 1AR73 2WNVA 1SBFA 1UX7A 2YPJA 1O7FA 4CDUB 1IPSA 3G6JB 2NPIA 4AVBA 4IV3B 4LXLA 1BVP1 4JQTA 4OLLA 4RS5C 3PVNA 2YBSA 3HPNA 5EIYB 2W1SA 3H8OA 2QTWB 3ZFGC 2X10A 4UW3A 3MIGA 4MXWA 4CCOA 1SFPA 5KXBA 4HG6B 2D6NA 4AQ6A 4B7KA 3THTA 4CCKA 1UU5A 4FO9A 4IGPA 1JXNA 3VBFA 1PZ9A 3IBMA 1V6NA 2IC1A 1AUYA 1PO12 1PK6C 2JKXA 4C90A 4N90A 1UPIA 5D2AA 4Q0UA 1KS5A 2VGDA 4YVSC 1UX6A 1Z7S2 3FZ3A 3PUAA 3ZDVA 4E4DX 2KA3A 3HN1A 2C9AA 4QHOA 3VZMA 5LBFA 2ZCWA 4Y4RA 1BZWA 4OUEA 1W8OA 2WLPA 3BOWA 4QPWA 5FZ3A 3ZXAC 3IKWA 5LASA 5IATA 2VZ1A 1AYM3 2QUOA 2ENRA 4QPIA 3FL7A 4CDXA 1ZNPA 4HVQA 2RDQA 2Y6KA 2YC4A 1VR3A 1QDCA 2HEYF 1WKYA 1W8HA 3FMGA 2NZ9A 2GP3A 3PUHA 4BA6A 3ORJA 5DABA 4CDXB 2PHTA 3HVDA 3ECQA 3SQOA 4LITA 1IS4A 2LTNA 4QD2A 2PAMA 2K46A 4WVMA 5A7QA 1CPNA 2ZZQA 3MIFA 2EXKA 2UYAA 3N36A 1RMU1 3PTRB 3HT2A 5JPMB 1Q56A 3I59A 1YRZA 2WNVC 1PMIA 3GBWA 3C7GA 2VQAA 1W6QA 1OMIA 1JZ3A 2HBTA 3KS7A 4XAEA 5HV4A 1BYHA 2PMWB 3WY6A 4OFGA 5T5OA 1W2OA 2VU9A 4K8FA 2X5IC 1FV3A 4IEVA 5H9SA 1AZDA 4BQXA 1FOD1 5FR3A 4FT8A 3K75B 2VD7A 1X33A 1C5IA 1FPN1 5IT6A 5AC93 3HQRA 4NHKA 1PVC3 4LKEA 1G7YA 3ZFEA 3WT3A 1IG0A 1GOFA 4Q27A 2CNAA 2VUAA 5A7SA 1MS4A 4XXPA 3DYOA 4V2VA 1ALYA 3BI3A 2WR9A 4QAWA 4QX7A 2XXZA 2J1EA 2WNVB 3IM0A 4XBNA 4ZONA 1LHWA 2EICA 2ZGPA 5FYBA 3IAQA 5F32A 4CCCA 3WNKA 2IXJA 2XKPA 1SG3A 4R9DA 3DCQA 3S7EA 1RUC2 3MEPA 5T55A 3F95A 3I49A 2FBEA 1BEV2 2JICA 3S30A 1CAXB 2Y6LA 3CBNA 1ZZ7A 4Y1VA 1NCQA 4W65A 1FPN3 4QX3A 3WHTA 1S0FA 2VR4A 3C7OA 1GOHA 4XE9A 4CEWC 5A80A 4NPRA 2BGCA 2VZVA 2WO2A 1J1LA 1NKGA 4PBOA 4RHV2 3U10A 1AXKA 4CP2A 2GMMA 4CTEA 3H1MA 1OKQA 5E6HA 5IAVA 1SHWB 1RUI3 5CG9A 2BBVA 2N7GA 4BM8A 1ZBE2 1UY0A 3H42B 2K9ZA 1XSRA 3LA3A 4FPEA 3V65A 1LGBA 1O3QA 5J98B 5T5LA 1SQ4A 1C1FA 3T1MA 3IMMA 2ZA9A 4C0HA 5ACA3 1OFNA 5JCTA 2BRTA 3BCWA 4QKFA 1CONA 2RJLA 4JHTA 2RS12 1G9AA 5FO9B 5K4LA 2Z2SB 3ZXEA 2AEYA 5CFDC 2EXIA 5A3LA 1AR61 3WNMA 3EMRA 1XYOA 1ND2A 4MXVA 1HB2A 2RS11 3O0XA 1VMFA 2CGNA 2QQVA 3VHPA 2ZS6B 4B1LA 1X50A 3OG2A 4DRVA 4COWA 3F2ZA 1D2SA 5F5CA 2YG0A 1LULA 3MLLA 1WD3A 2RS32 1H2MA 4L11A 4UF0B 5A33A 1AYM2 1UW8A 1SZBA 4F3JA 2JKBA 1KEXA 4NHMA 5H9QA 4A3ZA 4UFIA 3KF5A 5F5QA 4QQLA 2OIIA 2ZEYA 1K12A 2JDAA 4QXKA 4NO4A 3ZYGA 3E5UA 3OUJA 2O8QA 3OGGA 1K5MA 2IUWA 4AHWA 4I0AA 1NA1C 4PF5A 1BEV1 4CDUA 1PO21 2GC1A 4RHV1 3ROUA 4IEXA 1WLCA 1LRHA 1O3SA 2F4PA 1Y9QA 1HB1A 3H9AA 4P14A 4Q5OA 5KHIA 2UURA 2QJVA 3OYWA 1LOFA 2GALA 1R082 2BPA2 4TLGA 3VBHB 1MQTA 1WBLA 5T50A 1H0BA 1UKGA 3GJAA 3NV1A 5JZGC 4BJ0A 5L7OA 4C8DA 1DZQA 2G19A 5IVBA 5FZFA 4R8HA 2FZ1A 1LJ7A 3C3VA 2X09A 2DUOA 3JU9A 3NAPB 4FSJA 1NA1B 2YU1A 4COUA 3MFAA 1HRV2 4XJAA 2FZ2A 1FOD2 1QJX3 2MNGA 2IWGB 2CHHA 2BOIA 1UF2C 2TBVA 2ZX2A 4JRLA 4QQ2A 4YGCA 4CPBA 1W9WA 5K0UB 5FWJA 1LOCA 2CGOA 4WM7B 3ST7A 2CGPA 1GWKA 2RR12 4LOTA 2XR4A 1SBDA 4K9SA 4TYSA 5GKAC 3T4VA 4TN7A 4Y4YA 4K3UA 1XJAA 4N43A 4IL7A 2DFBA 4AYUA 1DP0A 3LCPA 2XVKA 1KDMA 2GZWA 4FPJA 3OCPA 2WQZC 1S0JA 4XXAA 5DUVA 4M00A 2B39A 5FQ0B 5FREA 1SDWA 3H3ZA 1CX1A 2W9XA 1RJ8A 3T0AA 2ZMKA 4OQ8A 2E7AA 1BBT3 2PELA 5FMOS 3VV1A 1KD7A 5HCAA 1MVQA 4YZ3A 2GAUA 1PM7A 1WCQA 4CCJA 5DAQA 5BNPB 1VAVA 5GALA 4A7KA 5CBLA 3L2HA 2HWE1 3NQHA 3ZYFA 1GZTA 2D5FA 3AVRA 5A6ZA 1JYNA 1MS8A 3IAPA 2YC0A 1S0IA 3O0WA 2HWE2 5CYYA 2OX0A 1FI2A 2RMU3 4YZ4A 2DVFA 1KJLA 3CMGA 5K9YA 2Y34A 4KI5M 5ACA1 1ENQA 2D6LX 5IK5A 1V6MA 1JMUB 1YLLA 5FXVA 4M3CA 2NYYA 1DGWA 3WG1A 3N9MA 2DVBA 4GMP0 3VDDC 2XG3A 1QOOA 4HKOA 3T1LA 2CL2A 5LA1A 2MEV1 3HEIA 1ZRCA 2EXHA 4I0WB 4RYDA 2JG8A 2MEV3 2VBDA 4Q4X2 1DQ1A 4IUGA 4TWTA 3RJ2X 3UK9A 1W2NA 4JGZC 3VBFC 3V0AA 3VDAA 1ZZCA 1W03A 4MXWB 2E31A 1W8UA 4BIFA 4MV2A 3KCCA 5A7WB 1JYWA 1G6NA 1ZZ8A 3HR9A 3B94A 1VMHA 3MBWA 1WZXA 4EQVA 1PM4A 1NAEA 2H6BA 3ZN6A 5JVVA 1ASJ1 1OH3A 3LIGA 1GU3A 1VBC3 2R061 3ZDSA 4AOCA 2WZ8A 4A4AA 2R32A 3V0AB 1PIV3 5J7MA 5KHKA 5FLJA 1RVF2 4BISA 2UYBA 1RXFA 2AEZA 4CXYA 2YYOA 4HONA 4D0QA 5KXCA 1RINA 3ZFFC 2WYFA 3DPRB 1R093 4A41A 4CXWA 3ACFA 2A3YA 4Q4W3 4H55A 2VZRA 3WCSA 2FHRA 5BNOC 3RMXA 1XPWA 1VBA2 2LROA 4Z2WA 4JGYA 3E97A 3CZJA 1D0HA 3AYCA 3T2OA 1Y9MA 3VZJA 1HQWA 4WM8C 3NAPC 1D4M2 2BBAA 1JODA 4W50A 2O14A 3AMQA 3AC0A 5FO7B 2DBIA 2W0XA 1OD5A 4FPGA 3B9CA 4PIXA 4HLTA 4CDQC 1TMF3 3WD5A 4ZXKA 3OY8B 4JZRA 5LZ6A 2WZR1 5CZKA 4AQTA 3D5OA 4FPOB 2ZGQA 2YC2A 1CIYA 3JD73 3VD7A 4TXWA 1EAH2 2WUHA 2JIGA 5DZFA 4AWDA 1NCRA 1VIWB 3ITQA 5FPAA 2WIIB 3OBZA 1PNGA 3OBRA 3WW3A 3ZYJB 1WLDA 5C9AA 4S2DA 4CDXC 4E8CA 1E5IA 3HQUA 5LK5A 2XUMA 4YARA 5F5AA 2P3JA 4MX3A 1JH5A 2ZKLA 4XIOA 3W5MA 4D69A 5HBAA 1CAWB 3OD4A 5KC6A 3FC0A 2WNUC 3ZMOA 1MZEA 2QKDA 5FIXA 3VBFB 2FQPA 3LPGA 3OY8A 1B35A 1QXRA 2JE9A 1LEMA 2WQ4A 5DAWA 4YW7A 5FYSA 3IDCB 4ZY9A 3WR0A 5F3EA 5CADA 5L9RA 2WWUA 1G8WA 1F5JA 3ZFFA 4AHZA 3SHRA 4AK3A 5L9VA 1HRI1 1NCRB 4BU2A 4BXFA 1JZ2A 2RMU2 4HANA 1UOFA 3RRDA 3WQBA 3LA7A 1TNRA 1RUH1 3GM8A 4NWWA 3WW2A 2YDEA 2P4EA 2ZGRA 5CKQA 2JDPA 5FZKA 4KGGA 4JQRA 3EYPA 5BNPA 1X8MA 4IE6A 2RJKA 4DXTA 4ASKA 5HV0A 5IK8A 1EP0A 4AZZA 3I3QA 2ZHNA 2EVXA 3AX4A 4HKLA 5T5PA 3HOBA 2OS2A 1V6IA 2W39A 4LO5B 2WWJA 2J1TA 4IW3A 5FP4A 1RUJ2 5GLWA 3WG2A 3WW1A 3RMYA 1O8PA 1QJU2 2QE3A 3NKTA 4AEDC 2YFUA 1L7LA 2ZAHA 5DAVA 5IK7A 4HPKB 3AYEA 2WABA 3QCWA 4FOYA 2FDFA 3B01A 4OZOA 2OPWA 2ZZJA 5FUPA 1EV11 4AFAA 3N3HA 2Z69A 3VBOB 4JRAA 5SV8A 5HXVA 2ZMNA 1R1A2 1WCSA 4UOJA 4UFKA 1GV9A 4MHUA 4E2QA 2ZAAA 1OLME 4P02B 3TNPB 2LRPA 4K7JA 2J1AA 2WS93 4XZPA 5FBJA 1HKDA 4YVWB 1U5YA 5FO8B 1H2KA 1AX0A 2DV9A 3KSCA 3KV5A 4DXSA 3NNGA 4QQOA 5K8SA 3DF0A 2XLAA 1ASJ3 1TME2 3HT1A 4QB6A 2JDHA 3RI9A 5C5UA 3IMNA 5DDJ1 2XBO2 4UF0A 4B4RA 1D2QA 4Q4V1 2H0VA 5FMCA 3HIFA 4XJ8A 3C8XA 4LBKA 4V1PA 2JG8B 1UMZA 4DQAA 1MEC3 2DCYA 4R4XA 1RUD2 4CP9B 3ACGA 4Z8BA 2EALA 2Q4SA 1S0BA 1ZRRA 2ZGUA 3N9NA 4HXCA 5I0UA 3I2OA 3MIHA 4V2WA 4UFHA 4L8QA 4XUTA 5SV5A 3VBSA 3JD72 3AMMA 1CN1A 3KF3A 4BB3A 1VB2A 4XIKA 3T3YA 2J1SA 4PQ9A 5C4WA 4AI3A 4D7SA 5C5TA 1YWKA 3LFIA 4U36A 4PDWA 2V09A 3S0MA 4WVMB 5C71A 3T4HB 3RYKA 4QGLA 5C3PA 2HWF2 2B46X 2I74A 2F4LA 1MS5A 5FZBA 2HWD3 2A71A 4KU8A 5HCBA 3SXWA 3O1PA 4Q26A 3RNSA 5FZ0A 2VOVA 4AW7A 2WWSA 4URTA 5C33A 1AF9A 4RL7A 1CZTA 1ENRA 3GJBA 4QX5A 5DDJ3 4IE0A 3LFMA 1CAWA 1VE0A 5KHHA 2BJSA 5FZMA 1ND3C 5FYMA 5ABJC 1IS3A 1F15A 4M0HA 4EWEA 1AYN1 2ARXA 2FCVA 1CAVA 4XBLA 1A8MA 2GMPA 4IXLA 5JSOA 5IW0A 3DEMA 1V6OA 3BTAA 2EIBA 2HWB3 3H3UA 4CCEA 5KWRA 1WCKA 4IGQA 4FPFA 2K2SA 2WNEA 2CV6A 4UFJA 5E1RA 1ULOA 1GUIA 4XFBA 4HKWA 1DCSA 1FNZA 4DY5A 1J58A 1O5UA 2PHUA 2C0ZA 4KMQA 4QT6A 4Q4Y1 4YPJA 3I4IA 1ZA7A 4CZSA 3KLSA 3PTYA 5JXIA 1S0EA 2VBPA 4FTEA 5FYIA 3AKTA 1N1VA 5FJKA 5FOBB 1GBGA 3LA2A 3WF3A 4NIAA 4B8EA 2QCSB 1RUC1 5IHRA 3POGA 4FP3A 1SACA 2JDMA 3SKVA 2ZX3A 2VC9A 3FLRA 4ES9A 5FK8A 2VAUA 2BGOA 2FMDA 1DFQA 4CDWB 4CU6A 1G9BA 1BMV1 3KHCA 4MGYE 1JZ4A 3ZIWA 2BEOA 3N7JA 1OQ1A 5D1IA 2WQ8A 2XJRA 3ME2A 3ZXGA 4F83A 2L9LA 4NMIA 5F7UA 2Q0AA 5J1XA 3PUIA 4OCTA 4AHXA 5K0UC 1VMJA 2A3WA 3UKVA 1GKBA 2AH2A 2P17A 2UWCA 4XUQA 2IXLA 4LLOA 4QHBA 1HJFA 2VMIA 4AEMA 5ABJA 5GZCA 4QXCA 2AREA 4GAZA 5BNPC 1RUC3 1US3A 4H14A 2VQ0A 3O7OA 2CTVA 4IV1B 4L9BA 3TN92 5FXZA 2DCZA 3AKSA 1LAJA 4NIHA 2GP5A 5FZ7A 2BWCA 2B8MA 4XW3A 5JPNB 3SCHA 5JSPA 3M1HA 4OHWA 4SBVA 5FYUA 4QQHA 3WINE 1O59A 5AFEA 1W8FA 4LO4B 1JYIA 4LBJA 4CSWA 1Y9GA 2E26A 3JZVA 4P9JA 4ONUA 3ACIA 2X05A 1OOPB 4AEDB 2LS6A 5DMYA 4HVRA 1ZBE3 1WD4A 1X9PA 3PU3A 5B4NA 3AVSA 2JJ6A 1JOJA 1W39A 1C8M3 4K8RB 3NJYA 4LK6A 4FFFA 3K51A 3K3OA 2HWD2 2PQQA 4GZ9A 5FPZA 3B7MA 1VBC1 2R063 3P6BA 4NJ4A 4Y22B 2R1BA 1JYCA 4FAHA 5BNNC 3ZVXA 3NMBA 5KXDA 4F8AA 4WM8A 4YG6A 1VBA1 3AZZA 2PLV1 2KR2A 3RG0A 3I3MA 1LOFC 1GZWB 1RUG2 4LNVA 1BLZA 4XILA 4QDSA 2VZQA 4OMDA 2YPDA 3VKNA 2DVGA 2O0OA 2OVUA 3RVHA 4OI2A 2VL4A 2AR6A 3PVOA 1WMDA 3IDEA 2W08A 4GWIA 2OPKA 1RUE1 2JENA 5LEJA 5FWEA 1M06G 4LPLA 1APNA 1YQ6A 5GM0A 4IEPA 3B3QE 2BUKA 4E8DA 3NRUA 5LK7B 3VD3A 3B00A 3KGZA 2VOTA 4PI0A 5FZAA 1GZCA 5CU1A 1NLSA 1AYN2 5ANQA 4CU8A 5FZOB 3UNPA 5FY7A 1R083 1RUOA 4OI1A 4PLOA 2VTXJ 4KWLA 3DPRC 1QXJA 2PHRA 3BVCA 1MVEA 2B45X 3ZFEB 3VD9A 3K77A 4OHXA 4AVTA 3VDDA 4CDQA 1W6NA 1TEIA 4YM1A 4OYUA 3OGRA 1QJY2 2Q1ZB 2VO5A 4AVCA 2P3KA 2A6XA 2YHJA 1ZZ6A 2CYFA 4JGZA 1GQPA 2D6MA 2RM21 2QQWA 3H7YA 3AP6A 4JHZA 1W3VA 5BNOB 4NUBA 1NQDA 1NUKA 4A45A 4HVOA 1OT5A 2VXJA 3T0BA 4AG4A 4LBQD 1GWLA 4IGOA 3W58A 1JZ8A 1OLMA 1UXZA 1ODMA 3ZYPA 1JOBA 2P3YA 4XFAA 5C3SA 3QBQA 2JEMA 3NKGA 4MZUA 3BODA 5F3GA 1J59A 1S2KA 1W0PA 1GMMA 1HLCA 3ZYHA 2R043 3HBKA 1I5PA 1H1AA 1PMJX 1VBE2 2PHLA 2IVIB 4LBNA 5A3UA 1RHI3 3UKTA 2X29A 4XQWA 2VNVA 3MYXA 3OPTA 4YM2A 2TEPA 4JTNA 2W47A 3I3EA 2QQNA 3FX3A 1MS9A 1GR3A 1N1SA 2DVDA 3OEBA 4LHSA 2V4AA 3AKRA 4AVSA 5A7PA 3O1MA 3NWKA 3ZSMA 2XB6C 4IDZA 1CJDA 1Q8OA 4FPLA 4X8NA 3WF2A 5JIUA 3J4UH 5FKBA 5C8CA 4EV0A 2XHNA 4IV3A 3VZNA 2AUYA 2RS51 3ZO0B 2FDKA 2OW4A 2ZGKA 2WT1A 4XFIA 4NIGA 3ES1A 3LIHA 4GJZA 4N7UA 1CAVB 4GB32 3NV3A 1RUG3 4XHXA 1X7NA 4YZ2A 1ULGA 2VULA 3VBUC 2EIEA 1CVNA 2Y8KA 3UV9A 4I3PA 1Y7BA 1KQRA
chains in the Genus database with same CATH topology
3QD6A 4G3YC 3RQ0A 3WG3A 4FXGB 4M3CB 4RS5A 2PAKA 2V5YA 2R041 4JGYB 4Q4X1 3ZPYA 4GH4A 2A75A 2NM1A 4XFFA 1NCQC 1MEC1 1FT9A 4IEWA 4COZA 2GNDA 3KQRA 1LKNA 1RGSA 3E6CC 4PDWB 3AM2A 4Q4W1 5T52A 3VZLA 2UU8A 4HBNA 1C3HA 2O8OA 3S7IA 1O4ZA 4SLIA 4GIQA 1VBC2 3NVCA 4FVVA 2YV8A 1HQNA 1VBD1 3EXUA 3PNAA 1N47A 4H7LA 4QPGA 4Y20A 3WQ1A 4KWKA 1ND3A 2DUQA 4CDUC 2BVVA 1R081 1SLBA 5C8CB 2HYKA 3AZWA 4QGMA 1W6NB 4Y26A 3PJQA 3V0BB 2WT0A 3GALA 5C8CC 1QJY3 4AI1A 5C9AC 2DYCA 1VBA3 4H7MA 1QOTA 2ZPXA 3QH6A 3MF6A 3J8F1 1EAH1 4XTMA 3SITA 3V0BA 4FCAA 2YZ4A 2A73B 5CNAA 5LEKA 2XL7A 2VVDA 1J3RA 4B3NA 5KHJA 3BB6A 5EYXA 4D7TA 4DXZA 2D40A 3FHIB 4XBQA 5ABJB 2DFCA 4YGDA 1I1EA 2DTWA 2EF6A 1N1TA 3AFKA 4Q2FA 3VBSB 5L19A 4E9KA 3WZ1A 2E7TA 2EAAA 4BLJA 2GH2A 5BUVA 2A7AA 3W9AA 4I30A 3OPZA 4Q4V3 2HWC1 5GLVA 1A6CA 1AR81 4XQDA 1FATA 2DVAA 2IXCA 5GZFA 1NCQB 4NOTA 3POSA 4ISQA 2Q5TA 2QNKA 4YRDA 1QY4A 2MPFA 4YW2A 3USUA 3D82A 2WA3A 1OA2A 3E6BA 5AC92 3ZX7A 2RS53 4LBOA 3B9IA 3LB9A 1Q8QA 1WLTA 1DYKA 4AVVA 5C4WC 2XKOA 5JDBA 1RUG1 1NE6A 2WZR3 4LULA 3USUB 4A7YA 4DY3A 1V9U2 2ZJCA 2OYZA 3NAPA 5JIAA 2R6QA 3NV2A 4O9GA 5FCCA 5FLHA 4Q4Y2 3CJIB 3KGLA 1LOBA 3UJOA 1BEV3 4AI8A 3FLPA 1BJQA 2E9QA 3AZVA 2DF7A 2YGMA 2JG8C 4YW4A 1FPN2 2D6OX 5FOJB 1R1A3 3B69A 4BCUA 3VN4A 4HT1T 2BFUL 2HWF1 2QVSB 4Y22A 4QQPA 2OUHA 4MGKE 3NW4A 4PJYA 2Z42A 2WFF3 4LO6B 5I8YA 5ACA2 5JOZA 3O12A 4MYEA 2MHFA 1QXPA 3WNXA 3QH7A 3MW4A 2EXJA 3TRSB 2WA4A 5HI0A 4EWAA 5EXOA 1RUF2 2R1DA 1RUD1 1QQP2 5FTTC 1SEFA 1MEC2 4CEYA 1PZ7A 4LTAA 4COYA 5H9RA 4MH0E 1GNZA 4MVTA 3GHMA 4N53A 1JUIA 1I9RA 1QMJA 2PTMA 2WSUA 3SCGA 1ZM1A 3N7MA 4ZU5A 2XHKA 2ZTNA 1H4GA 5EV7A 5DXDA 2X53S 3B02A 4HN1A 1H4HA 1KFXL 1Q8SA 2RR11 3MPPG 1CGPA 2XWJB 1NXMA 1MS3A 3BIWE 3AB0A 5K7PA 4EN9B 4FOQA 4YLZA 4XYXA 2OZ6A 4Q4V2 4LBQB 1IHMA 1PGW1 1LB2A 3VBOA 4YVWC 1NY72 2HWC3 2VOKA 4AI2A 4BIOA 2GSYA 2JECA 2XVGA 4AGVA 4CDWA 5FRAA 1OA3A 5F6LB 3ZFGA 1NOVA 4LLFA 3LOIA 3MGUA 4IEOA 2P34A 3PMEA 2TUNA 3UKNA 3VKFC 2RS52 4N9IA 1V9U1 3MLJA 3U07A 1VBB3 2VOWA 3J26N 3M4FA 1N3QA 4I0BA 1YFWA 2LM3A 5F9TA 1S55A 2IXIA 4XJWA 3MW2A 1MR5A 4FPKA 5CFCA 3SH5A 4I2OA 3ZN5A 3NO8A 3ZN6B 2VUJA 5I93A 3JCIA 4CEWB 1QWRA 1Q3EA 1DGLA 2DCJA 2Y38A 4YM0A 1H1IA 1X8EA 4CP0A 1DQ0A 2RS31 3A0KA 3B5LB 4RQPA 4E4ZA 3WHUA 5JOWA 2ATFA 3VBSC 1O3TA 2EAKA 1L3JA 2PLV3 3HQXA 1AX1A 1OSGA 2DCKA 1AXYA 5E88A 5HCFA 4OHZA 1J3PA 2RMU1 1PGL1 3WDVA 4AEKA 3IN9A 1HXS3 1TE1B 1WW5A 1HX6A 2WFF2 4JAAA 3I7DA 1F9KA 5DUXA 2D3PA 4KG0A 1AYM1 1CR7A 1H8VA 1V70A 1RUF3 4HPKA 3GZAA 1XE7A 3M3EA 2D3SA 4XPVA 5L7OB 4L92A 2XWBB 4AQSA 1LCLA 1RIRA 5JOYA 2SBAA 2UY9A 2CWSA 4GKXA 3GF6A 4YFWA 1VAMA 4W6YA 4INDA 3H1WA 1DIWA 1WGPA 3ZYIB 3R4UA 4YGEA 3WX5A 4FTBA 3ENRA 1UIKA 4UW5A 4Z92B 3E5QA 1D4M1 3MIBA 3AMHA 1NZCA 4KNCA 1AR91 3LKJA 1ZYBA 3OJBA 4GMP3 4R52A 3IIAA 5F1RA 3FBYA 1HW5A 1UIJA 4EN8B 5A32A 3KMHA 2HWC2 1LECA 3BU7A 5TSWA 4AEJA 5DG2A 1OQEA 4MUVA 1KITA 5C9AB 5DUUA 3GNEA 4MGZE 1NLRA 1MS1A 2GC3A 3KB5A 2OA2A 3EJKA 4QM9A 2HWD1 2XJUA 4XF1A 3VBRB 2ZABA 4PIYA 4DB5A 2VOXA 3QLQA 1FYUA 4B7EA 2HWB1 3VBRC 1AR72 3ZXFA 4FTSA 4QM8A 1VBE1 4TSVA 2GN3A 1AYN3 5DUWA 3TN91 3HWJA 4AFBA 2RM23 4K20A 1RMU2 1YIFA 4Q0SA 2XJQA 2G9FA 5FPXA 1YFYA 5E89A 1O5LA 2Y26A 2BNNA 3DKWA 3D6EA 2VPVA 4EJRA 1G9FA 2WT2A 4LEJA 5J3UA 2RE9A 1Z7S1 5DZGA 4BH9A 4LBMA 2ZGLA 3KCXA 5EFUA 1AR63 1HV0A 3ATGA 1Y3TA 3JUUA 5T54A 2QZ2A 2KXLA 4WZFA 3AYDA 1NYWA 2VECA 3PLQA 4ASLA 4IEYA 1PNFA 1KS4A 4MSVA 4R9AA 4YG0A 3H50A 4DS0A 2ZHKA 2X5IB 1LHNA 3N7LA 1PO13 1RUE3 2CAUA 2F6BA 1UU6A 3NV4A 2R042 1DBNA 1VBE3 1Z7S3 1RHI2 1LODA 1NG0A 2VY0A 3NSTA 4WM7C 1EPZA 4IEZA 1MZ5A 4M0NA 5AC91 4KH9A 3CJIC 5GZGA 4I09A 1O3RA 1TQ5A 3ZIXA 4RFT0 1A78A 4JGYC 2JD4A 2Q1MA 2WNUA 4YNIA 4WV8A 1SLAA 2OZJA 3VKLA 1YCIA 3HAGA 5EYYA 4A3XA 1HRV1 3WV6A 2YGLA 4CYDA 3D8CA 1M4WA 5J09A 1ULCA 1VRH3 4EN0A 3BPZA 4RD7A 4ES8A 4RGAA 3POYA 3VBHC 3RI8A 4GB33 1LENA 1MZFA 2WS92 4YGBA 1DQ2A 3W59A 2XLGA 2EA7A 1WW7A 2E7QA 4F7ZA 3CJXA 1H8TA 2Q8OA 3I2DA 3ZXJA 1AR71 1PHMA 2NMOA 3WDXA 1C4RA 1YFUA 3WUCA 4N7IA 1X82A 4XFGA 1W6QB 1UCXA 4YZ1A 4DINB 1D0GA 2JDZA 1POV0 1WUVA 2HEWF 1H9WA 1RMU3 1NA1A 4YM3A 1RUI2 1WLWA 4E2SA 1V00A 1DHKB 2R30A 5CB7A 4COVA 1CJPA 4P5HA 3MZHA 4I01A 1VBD2 1XNDA 3AMNA 3VHOA 5JMCA 4HFSA 1D4VB 3LGRA 2R0FA 1NE4A 1PIV1 3QACA 5CFCC 4D7YA 1QNYA 3O0VA 4GA9A 4RSUA 3KZ4C 5BNNB 4AI0A 5D8AC 4K40A 2IXHA 4OI4A 1GYKA 3AKPA 4B4QA 3ZSLA 2O1QA 1RUE2 2DCTA 1PVXA 4FBFA 5KXEA 1JN2P 4AVAA 1QF3A 4A7ZA 4FQ4A 4GB31 1N1YA 4P9GA 4J6GA 1UPSA 4P9XA 1AL22 3WP5A 2RS33 2P37A 2WL1A 1CAUA 3MIDA 1DGWX 1N3OA 4UW4A 2UY8A 1REDA 3ZXLA 3GBFA 4K1ZA 1ZX5A 1RL3A 4X8PA 3WLUA 5KC5A 2QDRA 3AJZA 2DTYA 2PHWA 5FFOC 4IESA 3CO2A 2E53A 1ZBA2 2DU1A 3UJQA 4ATEA 1DZRA 3V64A 1HRV3 1XYNA 2WZR2 3J8F3 1FOD3 2VMGA 4Y1ZA 5C4WB 2KM2A 2JE7A 5BYNA 5FMOL 3UL2A 5E8AA 4XF0A 5CFDA 1URXA 4X6QB 2ZX0A 2ETEA 3A0NA 1G9CA 2XVLA 4YZ5A 5A33B 3CJIA 3AXEA 3IPVA 1PVC1 3POWA 4LHKA 4NVPA 1B09A 3KT7A 4AGRA 4KBBA 3SLIA 3WVJA 3B93A 4JCKA 4BWOA 3IT8A 1UZZA 2XJPA 4A2UA 4BMEA 2E63A 3MICA 4U2AA 1ZVFA 2PA7A 4Q29A 4Z1VA 1DDLA 1FNYA 3R6SA 2R0HA 1PGW2 2E6VA 1DQ6A 3H8UA 5JZGB 1VBD3 1BQPA 1Q5OA 4DOUA 1WA4A 5DG1A 2CY6A 1F5FA 2GNBA 1HRI3 2D7FA 2ZGNA 3VBUA 1QQP3 2A6WA 5DZEA 1SLLA 2HWE3 1IZ3A 1YIPA 2BNMA 3ZYRA 4RS5B 5JOXA 5BY5A 4Y1XA 3G7DA 3PMSA 1H30A 1QHDA 4LHNA 3I8TA 3ILRA 5CG8A 1Q8VA 2MEV2 4Q4X3 5GZDA 4BYYA 1OPOA 4W6WA 3VZOA 2QZ3A 1HQLA 3VZKA 4S2GA 1AL23 3EO6A 1R1A1 1ZA4A 5JSRA 3GYDA 1G86A 1U12A 3M2MA 4L99A 4DPNA 4ZKTB 5C8WA 4C0BA 1C28A 3KD4A 3TWIA 3AP7A 3ZN4A 1RC6A 1O4TA 1PIV2 1W6PA 4KGQA 3AKQA 3CF6E 2I2SA 2ZMLA 3URFA 4QU2A 2AGSA 3KCYA 2YMZA 3R4SA 3VUOA 1YJLA 1ZBA3 1ND2B 2ZGTA 1KDKA 2GC2A 1XYPA 2VNOA 3J8F2 3SH3A 4HSLA 1GLHA 1D4M3 5CFDB 1RVF3 1UN1A 3CL1A 1TMF2 5JR7B 1OOPC 2Y0OA 3MDPA 1EV12 3WDWA 4YSFA 1ULEA 2D5HA 1QOSA 3JBG3 1OI6A 4QPGC 4R9CA 4NHLA 1FX5A 1YJKA 2WC2A 1XU1A 3AFGA 4N43B 2Y0IA 3CU7A 5IK4A 1AVBA 4IEUA 1LGNA 2WJSA 4XJ9A 1SFNA 4JDMA 4WM7A 1C57A 4LUMA 2IZWA 1YFXA 4FAGA 1N3PA 1REEA 1PK6B 3BALA 3FFQA 2BWAA 3M3QA 2A6ZA 1RUJ1 3ES4A 2E51A 3RDIA 2A6YA 3ZMNA 1VB4A 2Q30A 4KL1A 1SMVA 4XF4A 4NN0A 3WDTA 3U0ZA 3JBG1 3U4XA 3M7AA 4WVVA 3H7JA 3TYJA 4CEYC 1OPMA 2VVFA 5CAZA 3RJRA 4XQ4A 1F2NA 3MFCA 2NN8A 3ALQA 3P3NA 2A70A 2SLIA 2AZ5A 4HZFA 4WVWA 3C2UA 3WP6A 2C1FA 4ISRA 3MLKA 3E6DA 4R9BA 2WKKA 1VAKA 4MGIE 1JW6A 3KM5A 2GC0A 2P2KA 1NXD1 1U5ZA 4D94A 1DG6A 3VHNA 4DNYA 1VBB1 2Z79A 3M70A 4QPYA 3SCFA 4YVSB 4UBGA 1WW6A 2WZPP 3TB0A 3LAGA 2D6KA 1QJU3 1IOAA 4IV1A 4W6XA 4BE3A 3DL3A 3DGTA 1KXGA 2G9GA 5JLVA 3VL8A 2CWMA 1RUD3 5JI9A 1ZBA1 4G9SB 4E4SA 4YW5A 4K6BA 1O91A 2PHDA 2ZX1A 2ERFA 1JBCA 4XOGA 1H9PA 1ASJ2 1TME3 5GLUA 1IPJA 4GMP1 5GLZA 2XBO3 4JC1A 1IQAA 4XTPA 3NJZA 1OLRA 5J37A 2W68A 2BYVE 4UW6A 4RQPC 1W2UA 2PYTA 1C8NA 3M3OA 2HWF3 3MF9A 4Q1RA 2W52A 5BXXA 2H6CA 3M8LA 1V6LA 1BVVA 2GNTA 3EHKA 5L7OC 1NY71 1OHFA 1U0AA 2ILMA 2ZGSA 1GZWA 4L97A 1I6XA 3LSDA 5DDJ2 3RS6A 1ENXA 1DQ4A 4BOWA 4XHBA 4RHV3 4CDQB 1S2BA 4RGGA 1CQ9A 4I02A 4C1XA 5CA6A 3I54A 4YW3A 2JG9B 3SNMA 4N53C 1YHFA 2IFWA 2ZGMA 4HSJA 3MIEA 1LGCA 5L73A 3AZYA 1UAIA 1YI7A 3JB4C 1PO22 3AK0A 4N53B 4AE2A 1VRH1 2R16A 4Q8LA 5GZEA 1AX2A 1CIWA 2XH6A 1T6GC 2D98A 4Q4Y3 1DLLA 2B5HA 5BV6A 2NP0A 2FMYA 1ONAA 4JV4A 2HWB2 4DZGA 4EWDA 4RA0A 5I0RA 3PHMA 2HKXA 1SBEA 4P9LA 1LU1A 2ZX4A 4Q0QA 4KG8A 4JDNA 1VRH2 3LWCA 4AFCA 1OFSA 2HJIA 3OF1A 4LA2A 4GXLA 4ZU4A 4TLFA 1MS0A 3S6PA 1PO11 3ETQA 4C91A 3WUDA 3FWEA 3T2TA 4HN0A 3VHRA 3PJYA 2AENA 1SLCA 4LUKA 3H0OA 1ZBE1 3TAYA 3RZZA 1SLIA 3ELNA 1S0CA 4XEZA 1DYPA 3TOJA 3WCRA 3R05A 3ZSEA 1GQGA 5A32B 2BTVC 4RR3B 5GJ6A 1U5IA 2WS91 3APBA 5AVAA 1W6PB 1XRUA 4FPHA 1ZREA 3ZFEC 1QJX2 1CAUB 4YVWA 1CESA 2VW0A 3EBRA 3HBZA 4AHYA 3AJYA 4OUSA 5FLIA 2VH9A 1C8M2 1ND3B 2GNMA 4LO8A 1FMD3 4LR4A 3TN93 1H2NA 5KBFA 1WW4A 1FV2A 1KJRA 2GH8A 3DV8A 2R062 3K48A 1C8M1 2D93A 1Z78A 1GANA 1A3KA 4RR3A 3CLPA 3OYWB 4FP2A 1TMF1 4LBLA 4B4PA 4P9IA 3I59B 1Y43B 3JQWA 3WW4A 4KQ7A 3DN7A 4LBQA 1SCSA 1XNKA 1SCRA 2I45A 2TNFA 3MW3A 1PO23 1FMD1 2VNRA 4E2GA 1VJ2A 4AXOA 3SH4A 3PVEA 1QGLA 3VLBB 3AP9A 4P9WA 1MACA 1LHOA 2VW1A 2R072 1E57A 3PVBB 1S0GA 2WFF1 3P3PA 4H3WA 5I91A 1QQP1 4RQPB 3X29B 1LHVA 1UKRA 4N9HA 3FUOA 2V73A 4J1WA 1UD1A 4E27A 4CEWA 1YI9A 1BMV2 1WBFA 1PK6A 4QPGB 4Y20B 4Q0PA 2ZKNA 2LALA 4YVSA 3USSA 3FE5A 5I8SA 2ZHLA 1BCXA 2X8KA 2A6VA 3LZZA 3WP3A 1Q8PA 2QFEA 1BK1A 5BNNA 1KFUL 4DRRA 1ULDA 2BFUS 1DGRN 1G9DA 3WXPA 1XQNA 1H8TC 2GMEA 4Q4W2 1FAYA 3VBRA 4JGZB 1GZ9A 1V6JA 3A4UA 3HD8B 4MLOA 1EY2A 1ULFA 3LSEA 5IUQA 1IKQA 4OULA 4K1YA 3HMYA 3WDYA 5JWPA 2D44A 1DF0A 1LU2A 1EYBA 4FOWA 1R091 3N7KA 4HK8A 1K5MC 2VG9A 1EAH3 1SFYA 4Q1PA 1GQHA 2B42B 4S2FA 2C5DA 1MZ6A 2VW2A 4BPZA 2QDNA 1GNHA 1AR82 3AP4A 1IS6A 3AZXA 3R0RA 3WG4A 1AL0G 1QNWA 2VXRA 2ZHMA 4YYOA 3WP4A 1JHNA 1TNFA 3M3CA 3THPA 4HMZA 1QDOA 1CD3G 3JQXA 1RUNA 3TBDA 2K0GA 1LHUA 1QJY1 1YYNA 1W6MA 4HK9A 2JG9A 1ND2C 4M3CE 3ZXKA 4NR1A 4XJZA 1PVC2 4ATFA 3GHNA 1DGRA 3VL9A 5EWSA 4OHYA 3MI8A 5BNOA 2R073 2A3XA 4PLNA 5JAXA 1H2LA 5T3NA 2DURA 3ACLA 2RM22 5GLTA 1LR5A 4XMAA 3ZFFB 2B9UA 1YNAA 1GFF2 1ZRFA 3FBMA 4GH4B 1PZ8A 3TNQA 3O5SA 3NL1A 3JB8A 2JXAA 1I5ZA 1DZTA 4FQZA 2WFPA 1BBT1 4OZXA 1AR62 3OD0A 4O9EA 2ET7A 2ARBA 1XE8A 4J1XA 3DUIA 5FDBA 2VVEA 4LHLA 1QKQA 4X6RB 4WBBA 4XF3A 3RPQA 3V56A 1F8VA 1WMEA 1VALA 4Q0VA 1UZYA 2H0BA 1AL21 2GDFA 2NLRA 2ZACA 4JTOA 4PLMA 1COV2 5AFBA 2RS13 1HIXA 1B35C 2P3IA 2D3RA 3JBG2 4UBHA 1QJU1 3E5XA 3WQ0A 5EJ3A 4CRQA 5I0SA 1VP6A 2EIGA 2PHXA 2WLQA 3ZFGB 1LESA 1BKZA 2A5ZA 4QMAA 2WSVA 1RUI1 2XJTA 3VBUB 1QJX1 2D97A 3SMHA 3DPRA 1XU2A 4AQ2A 3GZTB 1K5MB 1YUDA 5JZGA 2IXKA 1QJZA 1B35B 4EN7B 1AR83 1R1ZA 1YXWA 2ES3A 1AXZA 4LT5A 1IS5A 2R071 2PN5A 2OUJA 1ZRDA 1O4YA 4Y1UA 4BQ1A 4TZDA 1RUF1 4IERA 4BMBA 5FQ0A 4M3CF 3IPVB 2NMNA 4AGGA 3Q9OA 4OUMA 4YW1A 3N4MA 5H9PA 1DU3D 2PAEA 2VNGA 1YO8A 5CFCB 4GALA 1WMFA 4Y24A 4QGNA 4XJUA 4META 4CP1A 2ET1A 4S2HA 4D3WA 5K0UA 2D6PA 4KWJA 1W6OA 1Q43A 1V9U3 1HXS1 4JDOA 4OI0A 1RVF1 5D8AA 2WNUB 5J48A 3AXDA 1COV1 1RJ7A 1AJKA 2RR13 4XMIA 3D0SA 2XGXA 5EZWA 3VBOC 1MQTC 2ZBJA 2WINB 3FFZA 3QOPA 5B2GB 2NQYA 1LOAA 2XLFA 4ASMB 1IPKA 1MQTB 2I07B 4G4FA 1XNCA 3ILFA 1RUH3 1IKPA 3ZSKA 1AJOA 4DFSA 3FUQA 1BBT2 2DWRA 2PFWA 3CNAA 3N35A 2JX9A 4I3GA 3WQ7A 4M01A 5D8AB 1EPWA 1POV3 4Y5Z0 1GICA 5CIRA 1ENSA 4RR3C 2BNOA 1COV3 3BOPA 2X5IA 1UL9A 1OOPA 2PHFA 1OQDA 3L9JT 5F6KA 2AYHA 1S0DA 1S1AA 1J3QA 2RHPA 5C6CA 3OTFA 4GWNA 4IETA 4OVEA 1H8TB 1Z0HA 2LUWA 5T5JA 3O14A 3VKOA 4C1WA 4Q8KA 3IDBB 1QH6A 3J9SA 1C5HA 3JD71