4GMQA

Ribosome-binding domain of zuo1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
b'NAVKKNKRVLRGSVKEANYFVEGEASAATIDAVLNDVDLVITKIDADEIAALAGKLNGLTVADEIKNVWKEEVSRLVGAGKLKEGDIKALVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative ribosome associated protein
publication title Structural characterization of a eukaryotic chaperone-the ribosome-associated complex.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum dsm 1495
molecule tags Ribosome-binding protein
total genus 36
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.840 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gmqA00
2LWXA 4GMQA
chains in the Genus database with same CATH superfamily
3GLHB 1IY1A 5KO3A 2LVOC 1ORYB 3CGWA 3H4JA 4AKHA 1AIPC 2WSFF 2V1UA 4QHTA 2OOBA 1WJ7A 3GO8A 1JB0F 4LJ9A 1XHBA 1MX0A 2F5OA 1NO1A 3KOXE 2QCUA 4MGKE 1DGGA 1TR8A 1N77A 3L29A 3HX3A 4JI1M 1V33A 3U6OA 2OO9A 3IHPA 2UXBM 1IXSA 2CHQA 3KVWA 3U6SA 3TQSA 2DVWB 3KP1E 2JNHA 3W67A 5IREB 3FRHA 2DAIA 3LQQA 2JY7A 1FNNA 2C9CA 8CATA 4OX9M 1D0KA 2EO2A 4ITQA 1GVNA 3PVSA 1WIVA 3KOYE 3VLFB 2JWSA 5FTMA 3GRYA 1QAQA 4FW9A 4D80A 3HHZA 3SAWA 3HJ8A 3C3DA 3HU1A 4F1IA 3AOEA 3VKGA 3LCVB 3T6PA 3FTFA 1KYIA 4LFBM 1IN5A 3U6CA 1OJLA 1QDRA 5IZ7D 3KP0E 2N35A 2L2DA 4JI7M 1QQWA 2ZTDA 3W0FA 2UXDM 4GEWA 4B08A 2JUJA 1V92A 1XMOM 1F4IA 1TDZA 1KSFX 4DR1M 1IXSB 1DO2A 2DNAA 3FE3A 2YNMD 3NWLA 5GKNA 3M7GA 4DR2M 3KFUG 3GPPA 4GH9A 4A3VB 4QNMA 3BOSA 4IBCA 2VQFM 3I04M 4KHPM 4NSRA 2Z4RA 4LJAA 2OQ4A 2MR9A 3L2AA 4I81A 1PM5A 4R3DA 1T3TA 2KA6B 2QZ4A 3FYCA 2VQEM 4I8OA 1AUAA 1D0LA 3GP1A 2R46A 3T1HM 4DR7M 4FWDA 5ITRA 2JY5A 2QP9X 2J5YA 3BXWA 3B7ZA 4JI4M 4M0DA 2CFOA 4DR5M 2ZBKB 5EQTA 1TGUA 2EKKA 1OFHA 2MH8A 4IIWA 1WXQA 5EXPA 1OIZA 3PFIA 4L6V6 4G6ZA 3EIHA 4Z8XA 3VK8A 1A5TA 2XFSA 3CF2A 4WP2A 3I4VA 4RNAA 1VDDA 1G3IA 2Z4SA 3E4RA 4LZJA 3JR4A 4NRVA 2ZM6M 3HJSA 3U5ZB 1OIPA 1EE8A 2O01F 3F92A 5ITXA 3L28A 4DV3M 4W5WA 3SAUA 4JV5M 4BLCA 2KRKA 4LY6A 5IT9S 1XC8A 2CHGA 1OQYA 5FTKA 3MMPA 2EJSA 4XGIA 2CP8A 3U6EA 2FNAA 2HL7A 3K8ZA 2HHHM 2KNZA 1TH3A 3B7NA 4JI3M 4OW0A 2Z7JA 4B7FA 2DXIA 4FCVA 3AKZA 4GKKM 1I4WA 1NVMA 2QPAA 1ZV1A 4X62M 1R2YA 2C9OA 2Y0TA 3J27B 4DV4M 2DI0A 2CEAA 1JR3D 3KSJA 3LMMA 1G59A 1OKSA 1ZAEA 2ZANA 2VIIA 4MM3B 2KW0A 4TUWA 3D8BA 2H1RA 1TTEA 3DZDA 4CGYB 2B3TA 3SC3A 2QSFX 4JN6A 3SBJA 2UUCM 1GLNA 1N32M 2HAKA 4I4LA 2FH0A 4LF7M 3NBXX 1HJPA 2DKLA 2DZLA 4L8RC 2L6OA 2WZJA 5ITTA 2DZNB 2JP7A 4PT5A 4ZPXA 3QYBA 4CJ6A 2CV2A 3GRVA 4MGIE 1CUKA 1XNRM 5EXXA 3KOWE 3GPUA 2C96A 3V76A 2DAMA 1XMQM 5EP2A 4LGYA 4JI6M 4AI6A 3GRRA 5BPVA 4JI8M 3ZQJA 3SFZA 3U61A 1HNWM 2LHGA 4R71A 1JR3A 1Z5BA 2DWZB 1TH2A 2NQ8C 3RFWA 2KXEA 3UGJA 1BVSA 2F5NA 2X8AA 3J2PB 4IBFA 1TH4A 3GLGA 3T1YM 2DAKA 4P17A 3VDPA 4QOZC 5C18A 4IBJA 3U6QA 3MHVC 2XZFA 4B3SM 2QBYA 2QQ8A 5EJCA 1GL6A 4B7GA 2XZUA 2UUAM 3KXEC 1IBMM 5ITUA 2LHCA 3GQ5A 1K3XA 1PJTA 4JI0M 3K9PA 2R4JA 3KW6A 4DV0M 1NY6A 5KPTA 3U6DA 2CHVA 1WHCA 3DA1A 4MH0E 4X65M 3PNVA 3U60A 4I5SA 2UXCM 5ITYA 1L2CA 2L4EA 3T15A 3UZUA 1HT2E 2A5YB 2R45A 2XF3A 4IBDA 4LJ4A 5L8RF 1JR3E 3WHLA 4OU7A 4DV2M 4B3MM 1NY5A 4JYAM 4AQYM 5E6JA 3FD9A 2KZUA 3GLGE 3TWKA 4GITA 1SXJD 1IQPA 2BWEA 3JAMS 3UMMA 3OTOM 3GLGB 1Z5AA 1YSYA 3SYLA 1ZQ9A 2R62A 5C1BA 3M0EA 2CV1A 2QBYB 1W5TA 4DV1M 4XBOA 3B9PA 1WGLA 3PNYA 3THGA 3M6AA 2KNAA 3RGPA 4ANRA 1YLAA 2CE7A 4NL4H 4Q7JA 4HEOA 2UUBM 1QAMA 2LVAA 1GJSA 2BNKA 2ZTCA 1NJFA 3U60B 2FOIC 4D82A 3KOZE 4L16A 1VEGA 4MGZE 4NXMM 5JI3E 2F5SA 5FTNA 4IBKA 4LG2A 3SATA 3C58A 3HGIA 3IG8A 1NNJA 2DWMA 3J7BA 4KLNA 3VK7A 2G3QA 1L8QA 1R5LA 1S3SA 1SXJA 1GL7A 3I51A 3HHYA 2J7NA 4GIPA 4IBGA 4II7A 4LF8M 1NHWC 5DFLA 3DFZA 2QENA 1RU3A 1Z6TA 1HNXM 3HZJA 3PXGA 2DENA 2ZAMA 1PGYA 2ZAOA 4X66M 4BB9A 1QAOA 5F3WA 1FJGM 2HCBA 2K47A 3IG5A 4NSOB 3ZH9B 3KS8A 3GLIA 1XXHA 2C99A 4FD2A 4DUYM 2G5GX 1MJGM 3SMPA 1R7RA 1L2DA 1XWIA 4Z6YA 4NRWA 3AV0A 3FYDA 1QYRA 2K9DA 4GHLA 2DHYA 3U6LA 3MK6A 3FUXA 3Q8GA 4GC5A 4HLQA 2M5ZA 1SXJE 1VEJA 3RGSA 1QZMA 2JA2A 4CIZA 1SXJB 3GLFA 2C98A 2DAGA 4REZA 4R7GA 3W0LB 4JI2M 2L7IA 4LJ5A 3GPYA 2CRUA 2Y21A 3J80S 1ZMVA 4LF6M 1G4AE 4YY3M 1OAIA 1J7KA 3W68A 3SARA 1Y8GA 2G8LA 2KZSA 1VEKA 3TPZA 4LZZA 1E9SA 4DV6M 2KHHA 3ZCBB 3D8LA 5FTJA 3GLIE 1XXHE 3C9PA 2BWBA 3GLIB 1XXHB 4IBBA 4AG5A 2RKOA 3HJQA 1G41A 3BBZA 1NNUC 2DHRA 2FE8A 2LVPC 5ITXE 3K92A 2XH9A 3EIEA 3K9OA 3AOEC 4JXJA 4CISA 3R8FA 1UFZA 1PRBA 4Y28F 3GLFE 4B7HA 3FTEA 2FFJA 1NV8A 1NV9A 4QOSA 1HQYE 2K0BX 2QNJA 2GQFA 3FRIA 3GLFB 4JI5M 4XK8F 4M9ZA 3SASA 2CV0A 3J81S 1J09A 5BR8M 1QDTA 4B3TM 1YUBA 2W82A 3AFHA 3HHWA 4GKJM 4RF1A 3J7AS 2HWJA 2D7HA 1HT1E 2LH0A 2EUCA 4KODA 5EP1A 5FLXS 5LMNM 4LF4M 1QUTA 2Y0QA 1IXRC 2D7EA 2LTUA 3I01M 3LCUA 4NC6A 1HR0M 4LF9M 4M9SA 3A98B 1JQJC 2X4AA 4LCBA 5KQDA 3JR5A 4KO8A 1LV7A 2KEBA 1L2BA 3UJNA 1E94E 4L78A 3QYEA 5KQ8A 4BBAA 4IBEA 2LXEA 1VQ1A 3TE6A 4DR6M 1N36M 4G4OA 2YQZA 3DOAA 3GLHA 2I7PA 3Q8XA 2CUZA 2LBCA 2DWLA 4S12A 5DNYA 5A2QS 1IN4A 2LVQD 4G4NA 1QVRA 4FCTA 1DGHA 1PJJA 1ZMWA 3QAUA 4PDGA 1X37A 2OPFA 3L26A 3R9XB 1VDLA 4X64M 2VF8A 3KS4A 4MB7A 1SG9A 1XNQM 2XSZD 1UM8A 1D0MA 3LW5F 1NSFA 4DBGB 3FUUA 4FVMA 3UK6A 3GPXA 3AL0C 1GO5A 1IBKM 3TL4X 1E9RA 4P16A 2FS1A 2H5XA 4LJ7A 2V6ZM 2DZOB 7CATA 2JZ0A 3U61B 1N33M 5EP3A 1K3WA 4RF0A 1D2NA 2QHOB 3L27A 5EXTA 3K1JA 3SMSA 1DO0A 4WW0A 1G71A 4AZFA 1EIJA 2YFQA 2R4EA 4DUZM 1K82A 4LF5M 3C3EA 4B3RM 3HU2A 1OFIA 3GQ4A 3L25A 2AHMA 1DGHB 3MJ5A 3HY5A 2RRUA 1T43A 2LWXA 5DYGA 4DR3M 1HNZM 4AG6A 1LTMA 4M0WA 4AW4A 2L7HA 3KDSE 2DAEA 3KSXA 2O25A 2R18A 1R4GA 2XSZA 1GJTA 1Q3CA 2K6BA 2JY8A 3NBIA 4K0KM 1IY0A 1C7YA 2JY6B 4WURA 2V1CA 4LJ8A 3GQ3A 2ERCA 4F2LA 4QNRA 2E5LM 1H6UA 2XEPA 3FUTA 2RGHA 2RGOA 2WSCF 4OVZA 2EKFA 1DGBA 2F5PA 3GRUA 2JXNA 1GKIA 3HHXA 2YR0A 1IN7A 1QUSA 4PD2A 1E32A 4DR4M 4IJFA 3I4YA 1IXZA 2MROB 1MN3A 1IN6A 5ITQA 2EA0A 3U6MA 5EP4A 2UU9M 1DV0A 2XLJA 4AKIA 3SYKA 4L15A 1Z59A 3U5ZA 5FSWA 3FUWA 3E9SA 4LRTA 4MGHA 1TF0B 2R6FA 2Z8YM 4M9XA 4CHTB 1R2ZA 1PJIA 3ILKA 3VDUA 1W5SA 2XFTA 3CTWB 1NJGA 3CF6E 3K2LA 2L4FA 2D7GA 4OVZB 5E26A 1R6BX 1QZEA 2APLA 3A45A 4DV7M 1TDHA 1YE9A 1WR1B 2L09A 2XGNA 3AJIB 3B7QA 4G4RA 3FKEA 4FWHA 2O5RA 2GNOA 4LFAM 4PDIA 3TWLA 2Z3XA 5JI2E 3U6PA 1N34M 2BJVA 5FTLA 5KPZA 1DGFA 1IM2A 2VDBB 4DV5M 2J7OA 3A42A 3VKHA 2KDLA 2Y20A 4PCZA 2F4VM 1GABA 5DYIA 2BJWA 3VFDA 4NOOB 1PJSA 2X49A 1PJQA 2LVNC 3CF0A 1OAOC 1HQCA 3HKPA 4LRSA 1G8PA 4IJEA 1Z5CA 3A46A 2C5RA 4D81A 4AKGA 2R44A 3LVVA 3SHGB 5KPRA 3WHKA 2LNHC 2KRUA 2MJ5B 1NHGC 4KT0F 3QWLA 4G4QA 3FUVA 2OOAA 3H4MA 1KFVA 4GRIA 3SHFA 2MGWA 3LQRA 4QHSA 2KNVA 4GHAA 2CWBA 1Q39A 1MU5A 1V34A 3HU3A 2M60A 4EIWA 2P5TA 3ZC7B 4UN2B 3TWMA 1I94M 4RKUF 1VG5A 4YHHM 3E21A 5H37D 1SXJC 3E46A 3LVWA 2R65A 1P3QQ 1OTRA 4GC9A 4LJ6A 3SAVA 2F5QA 1WGNA 2VF7A 1Q02A 1EFUB 4FWGA 4IBIA 1XB2B 5EXSA 1IN8A 4G3OA 2JZ1A 1N75A 3AOGA 1N78A 1L1ZA 1IY2A 3GLHE 4GMQA 1IFYA 1C1KA 1L1TA 3T38A 3RE8A 3IECA 4NXNM 3FTDA 2I7NA 5IWAM 4LGMA 1ZMUA 4FCWA 5LMUM 3HWSA 4LFCM 2HKJA 1Q3BA 2R0IA 3FTCA 4HL4A 2Q2EB 1J5EM 1IBLM 4L4UA 1QANA 1T6OA 2DWNA 3B74A 3B89A 4MGYE 2WSEF
chains in the Genus database with same CATH topology
3GLHB 1IY1A 5KO3A 4AKHA 1ORYB 2V1UA 4QHTA 3GO8A 4LJ9A 1XHBA 1MX0A 2F5OA 3KOXE 2QCUA 4MGKE 1DGGA 1N77A 4JI1M 3U6OA 2UXBM 2CHQA 3KVWA 3U6SA 3TQSA 2DVWB 3KP1E 5IREB 8CATA 3LQQA 1FNNA 2C9CA 4OX9M 2EO2A 4ITQA 1GVNA 3PVSA 3KOYE 3VLFB 5FTMA 3GRYA 1QAQA 4FW9A 4D80A 3HHZA 3SAWA 3HJ8A 3HU1A 3VKGA 3AOEA 3FTFA 1KYIA 4LFBM 1IN5A 3U6CA 1OJLA 5IZ7D 3KP0E 4JI7M 1QQWA 3W0FA 2UXDM 4B08A 1XMOM 1TDZA 1KSFX 4DR1M 1IXSB 1DO2A 2YNMD 3NWLA 5GKNA 3M7GA 4DR2M 3KFUG 3GPPA 4GH9A 4A3VB 4QNMA 3BOSA 4IBCA 2VQFM 4KHPM 4NSRA 2Z4RA 4LJAA 2OQ4A 3L2AA 4I81A 1PM5A 4R3DA 1T3TA 2KA6B 2QZ4A 3FYCA 2VQEM 4I8OA 3GP1A 2R46A 3T1HM 4DR7M 4FWDA 5ITRA 2QP9X 4M0DA 2CFOA 4DR5M 2ZBKB 5EQTA 1TGUA 1OFHA 4IIWA 1WXQA 5EXPA 3PFIA 4G6ZA 3EIHA 4Z8XA 2XFSA 3CF2A 3I4VA 4RNAA 1VDDA 1G3IA 2Z4SA 3E4RA 4LZJA 3JR4A 4NRVA 2ZM6M 3HJSA 3U5ZB 1EE8A 5ITXA 4DV3M 3SAUA 3L28A 4JV5M 4W5WA 4BLCA 2KRKA 4LY6A 5IT9S 1XC8A 2CHGA 5FTKA 4XGIA 3U6EA 2FNAA 2HL7A 3K8ZA 2HHHM 1TH3A 4JI3M 4OW0A 2Z7JA 4B7FA 2DXIA 4FCVA 3AKZA 4GKKM 1I4WA 1NVMA 2QPAA 4X62M 1R2YA 2C9OA 2Y0TA 3J27B 4DV4M 2CEAA 1JR3D 3KSJA 3LMMA 1G59A 1ZAEA 2ZANA 2VIIA 4MM3B 2KW0A 4TUWA 3D8BA 2H1RA 3DZDA 4CGYB 3SC3A 3SBJA 4JN6A 2UUCM 1N32M 1GLNA 4I4LA 4LF7M 4L8RC 2L6OA 5ITTA 2DZNB 4PT5A 4ZPXA 2CV2A 3GRVA 4MGIE 1XNRM 5EXXA 3KOWE 3GPUA 2C96A 1XMQM 5EP2A 4LGYA 4JI6M 4AI6A 3GRRA 5BPVA 4JI8M 3SFZA 3U61A 1HNWM 1JR3A 1Z5BA 2DWZB 1TH2A 2NQ8C 3RFWA 2KXEA 3UGJA 2F5NA 2X8AA 3J2PB 4IBFA 1TH4A 3GLGA 3T1YM 3VDPA 4QOZC 5C18A 4IBJA 3U6QA 3MHVC 2XZFA 4B3SM 2QBYA 5EJCA 1GL6A 4B7GA 2XZUA 2UUAM 3KXEC 1IBMM 5ITUA 3GQ5A 1K3XA 4JI0M 3KW6A 2R4JA 4DV0M 1NY6A 5KPTA 3U6DA 2CHVA 3DA1A 4MH0E 4X65M 3PNVA 3U60A 4I5SA 2UXCM 5ITYA 1L2CA 3T15A 3UZUA 1HT2E 2A5YB 2R45A 2XF3A 4IBDA 4LJ4A 4OU7A 4DV2M 3WHLA 4JYAM 4B3MM 1NY5A 4AQYM 5E6JA 3FD9A 2KZUA 3TWKA 4GITA 1SXJD 1IQPA 3JAMS 3UMMA 3OTOM 3GLGB 1Z5AA 1YSYA 3SYLA 1ZQ9A 2R62A 5C1BA 3M0EA 2CV1A 2QBYB 1W5TA 4DV1M 4XBOA 3B9PA 3PNYA 3THGA 3M6AA 3RGPA 2CE7A 4NL4H 2UUBM 1QAMA 2BNKA 1NJFA 3U60B 2FOIC 4D82A 3KOZE 4L16A 4MGZE 4NXMM 5JI3E 2F5SA 5FTNA 4IBKA 4LG2A 3SATA 3C58A 3HGIA 3IG8A 1NNJA 2DWMA 3J7BA 4KLNA 3VK7A 1L8QA 1S3SA 1SXJA 1GL7A 3I51A 3HHYA 2J7NA 4GIPA 4IBGA 4II7A 4LF8M 1NHWC 3DFZA 2QENA 1Z6TA 1HNXM 3PXGA 2ZAMA 2ZAOA 4X66M 4BB9A 1QAOA 5F3WA 1FJGM 2HCBA 2K47A 3IG5A 4NSOB 3ZH9B 3KS8A 3GLIA 1XXHA 2C99A 4FD2A 4DUYM 2G5GX 3SMPA 1R7RA 1L2DA 1XWIA 4Z6YA 4NRWA 3AV0A 3FYDA 1QYRA 4GHLA 3U6LA 3MK6A 3FUXA 4GC5A 4HLQA 2M5ZA 1SXJE 3RGSA 1QZMA 2JA2A 3GLFA 1SXJB 2C98A 4REZA 4R7GA 3W0LB 4JI2M 2L7IA 4LJ5A 3GPYA 2Y21A 3J80S 4LF6M 1G4AE 4YY3M 1J7KA 3SARA 2G8LA 2KZSA 3TPZA 4LZZA 1E9SA 4DV6M 3ZCBB 3D8LA 5FTJA 3GLIB 1XXHB 4IBBA 4AG5A 2RKOA 3HJQA 1G41A 1NNUC 2DHRA 2FE8A 5ITXE 3K92A 2XH9A 3EIEA 4JXJA 3AOEC 4CISA 3R8FA 4B7HA 3FTEA 2FFJA 4QOSA 3GLFB 4JI5M 1HQYE 4M9ZA 3SASA 2CV0A 3J81S 1J09A 5BR8M 4B3TM 1YUBA 2W82A 3AFHA 3HHWA 4GKJM 4RF1A 3J7AS 2D7HA 1HT1E 2LH0A 2EUCA 4KODA 5EP1A 5FLXS 5LMNM 4LF4M 2Y0QA 1IXRC 2D7EA 4LF9M 4B3RM 1HR0M 4M9SA 3A98B 1JQJC 2X4AA 4LCBA 5KQDA 3JR5A 4KO8A 1LV7A 2KEBA 1L2BA 3UJNA 1E94E 4L78A 5KQ8A 4BBAA 4IBEA 2LXEA 3TE6A 4DR6M 1N36M 4G4OA 2YQZA 3DOAA 3GLHA 2I7PA 3Q8XA 2CUZA 2DWLA 4S12A 5DNYA 5A2QS 1IN4A 4G4NA 1QVRA 4FCTA 1DGHA 1PJJA 3QAUA 4PDGA 1X37A 2OPFA 3L26A 3R9XB 4X64M 3KS4A 4MB7A 1XNQM 2XSZD 1UM8A 1NSFA 3FUUA 4FVMA 3UK6A 3GPXA 3AL0C 1IBKM 3TL4X 1E9RA 4P16A 4LJ7A 2V6ZM 2DZOB 7CATA 3U61B 1N33M 5EP3A 1K3WA 4RF0A 1D2NA 3L27A 5EXTA 3K1JA 3SMSA 1DO0A 4WW0A 4AZFA 2YFQA 2R4EA 4DUZM 1K82A 4LF5M 3HU2A 1OFIA 3GQ4A 3L25A 2AHMA 1DGHB 3MJ5A 4DR3M 2LWXA 5DYGA 1HNZM 4AG6A 4M0WA 4AW4A 2L7HA 3KDSE 3KSXA 2R18A 2XSZA 1Q3CA 3NBIA 4K0KM 1IY0A 4WURA 2V1CA 4LJ8A 3GQ3A 2ERCA 4QNRA 2E5LM 1H6UA 2XEPA 3FUTA 2RGHA 2RGOA 4OVZA 1DGBA 2F5PA 3GRUA 1GKIA 3HHXA 2YR0A 1IN7A 4PD2A 1E32A 4DR4M 4IJFA 3I4YA 1IXZA 5ITQA 1IN6A 3U6MA 2EA0A 2UU9M 5EP4A 4AKIA 2XLJA 3SYKA 4L15A 1Z59A 3U5ZA 5FSWA 3FUWA 3E9SA 4LRTA 4MGHA 4M9XA 4CHTB 1R2ZA 1PJIA 3ILKA 3VDUA 1W5SA 2XFTA 3CTWB 1NJGA 3CF6E 3K2LA 5E26A 2D7GA 4OVZB 1R6BX 3A45A 4DV7M 4G4RA 1TDHA 1YE9A 2L09A 2XGNA 3AJIB 3VK8A 3FKEA 4FWHA 2O5RA 2Z3XA 4LFAM 4PDIA 3TWLA 3U6PA 5JI2E 1N34M 4JI4M 2BJVA 5FTLA 5KPZA 1DGFA 1IM2A 4DV5M 2J7OA 3A42A 3VKHA 2Y20A 4PCZA 2F4VM 5DYIA 2BJWA 3VFDA 4NOOB 2X49A 3CF0A 1HQCA 3HKPA 4LRSA 1G8PA 4IJEA 1Z5CA 3A46A 2C5RA 4D81A 4AKGA 3LVVA 3SHGB 5KPRA 3WHKA 2LNHC 2KRUA 1NHGC 3QWLA 4G4QA 3FUVA 3H4MA 1KFVA 4GRIA 3SHFA 3LQRA 4QHSA 4GHAA 1Q39A 1MU5A 3HU3A 2M60A 4EIWA 2P5TA 3ZC7B 3TWMA 1I94M 4YHHM 5H37D 1SXJC 3LVWA 2R65A 4GC9A 4LJ6A 3SAVA 2F5QA 4FWGA 4IBIA 5EXSA 1IN8A 1N75A 3AOGA 1N78A 1L1ZA 1IY2A 4GMQA 1C1KA 1L1TA 3T38A 3RE8A 4NXNM 3FTDA 2I7NA 5IWAM 4LGMA 4FCWA 5LMUM 3HWSA 4LFCM 2HKJA 1Q3BA 3FTCA 4HL4A 2Q2EB 1J5EM 1IBLM 4L4UA 1QANA 2DWNA 4MGYE 3L29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LWX A;  4GMQ A; 
#chains in the Genus database with same CATH topology
 3GLH B;  1IY1 A;  5KO3 A;  2LVO C;  1ORY B;  3CGW A;  3H4J A;  4AKH A;  1AIP C;  2WSF F;  2V1U A;  4QHT A;  2OOB A;  1WJ7 A;  3GO8 A;  1JB0 F;  4LJ9 A;  1XHB A;  1MX0 A;  2F5O A;  1NO1 A;  3KOX E;  2QCU A;  4MGK E;  1DGG A;  1TR8 A;  1N77 A;  3L29 A;  3HX3 A;  4JI1 M;  1V33 A;  3U6O A;  2OO9 A;  3IHP A;  2UXB M;  1IXS A;  2CHQ A;  3KVW A;  3U6S A;  3TQS A;  2DVW B;  3KP1 E;  2JNH A;  3W67 A;  5IRE B;  3FRH A;  2DAI A;  3LQQ A;  2JY7 A;  1FNN A;  2C9C A;  8CAT A;  4OX9 M;  1D0K A;  2EO2 A;  4ITQ A;  1GVN A;  3PVS A;  1WIV A;  3KOY E;  3VLF B;  2JWS A;  5FTM A;  3GRY A;  1QAQ A;  4FW9 A;  4D80 A;  3HHZ A;  3SAW A;  3HJ8 A;  3C3D A;  3HU1 A;  4F1I A;  3AOE A;  3VKG A;  3LCV B;  3T6P A;  3FTF A;  1KYI A;  4LFB M;  1IN5 A;  3U6C A;  1OJL A;  1QDR A;  5IZ7 D;  3KP0 E;  2N35 A;  2L2D A;  4JI7 M;  1QQW A;  2ZTD A;  3W0F A;  2UXD M;  4GEW A;  4B08 A;  2JUJ A;  1V92 A;  1XMO M;  1F4I A;  1TDZ A;  1KSF X;  4DR1 M;  1IXS B;  1DO2 A;  2DNA A;  3FE3 A;  2YNM D;  3NWL A;  5GKN A;  3M7G A;  4DR2 M;  3KFU G;  3GPP A;  4GH9 A;  4A3V B;  4QNM A;  3BOS A;  4IBC A;  2VQF M;  3I04 M;  4KHP M;  4NSR A;  2Z4R A;  4LJA A;  2OQ4 A;  2MR9 A;  3L2A A;  4I81 A;  1PM5 A;  4R3D A;  1T3T A;  2KA6 B;  2QZ4 A;  3FYC A;  2VQE M;  4I8O A;  1AUA A;  1D0L A;  3GP1 A;  2R46 A;  3T1H M;  4DR7 M;  4FWD A;  5ITR A;  2JY5 A;  2QP9 X;  2J5Y A;  3BXW A;  3B7Z A;  4JI4 M;  4M0D A;  2CFO A;  4DR5 M;  2ZBK B;  5EQT A;  1TGU A;  2EKK A;  1OFH A;  2MH8 A;  4IIW A;  1WXQ A;  5EXP A;  1OIZ A;  3PFI A;  4L6V 6;  4G6Z A;  3EIH A;  4Z8X A;  3VK8 A;  1A5T A;  2XFS A;  3CF2 A;  4WP2 A;  3I4V A;  4RNA A;  1VDD A;  1G3I A;  2Z4S A;  3E4R A;  4LZJ A;  3JR4 A;  4NRV A;  2ZM6 M;  3HJS A;  3U5Z B;  1OIP A;  1EE8 A;  2O01 F;  3F92 A;  5ITX A;  3L28 A;  4DV3 M;  4W5W A;  3SAU A;  4JV5 M;  4BLC A;  2KRK A;  4LY6 A;  5IT9 S;  1XC8 A;  2CHG A;  1OQY A;  5FTK A;  3MMP A;  2EJS A;  4XGI A;  2CP8 A;  3U6E A;  2FNA A;  2HL7 A;  3K8Z A;  2HHH M;  2KNZ A;  1TH3 A;  3B7N A;  4JI3 M;  4OW0 A;  2Z7J A;  4B7F A;  2DXI A;  4FCV A;  3AKZ A;  4GKK M;  1I4W A;  1NVM A;  2QPA A;  1ZV1 A;  4X62 M;  1R2Y A;  2C9O A;  2Y0T A;  3J27 B;  4DV4 M;  2DI0 A;  2CEA A;  1JR3 D;  3KSJ A;  3LMM A;  1G59 A;  1OKS A;  1ZAE A;  2ZAN A;  2VII A;  4MM3 B;  2KW0 A;  4TUW A;  3D8B A;  2H1R A;  1TTE A;  3DZD A;  4CGY B;  2B3T A;  3SC3 A;  2QSF X;  4JN6 A;  3SBJ A;  2UUC M;  1GLN A;  1N32 M;  2HAK A;  4I4L A;  2FH0 A;  4LF7 M;  3NBX X;  1HJP A;  2DKL A;  2DZL A;  4L8R C;  2L6O A;  2WZJ A;  5ITT A;  2DZN B;  2JP7 A;  4PT5 A;  4ZPX A;  3QYB A;  4CJ6 A;  2CV2 A;  3GRV A;  4MGI E;  1CUK A;  1XNR M;  5EXX A;  3KOW E;  3GPU A;  2C96 A;  3V76 A;  2DAM A;  1XMQ M;  5EP2 A;  4LGY A;  4JI6 M;  4AI6 A;  3GRR A;  5BPV A;  4JI8 M;  3ZQJ A;  3SFZ A;  3U61 A;  1HNW M;  2LHG A;  4R71 A;  1JR3 A;  1Z5B A;  2DWZ B;  1TH2 A;  2NQ8 C;  3RFW A;  2KXE A;  3UGJ A;  1BVS A;  2F5N A;  2X8A A;  3J2P B;  4IBF A;  1TH4 A;  3GLG A;  3T1Y M;  2DAK A;  4P17 A;  3VDP A;  4QOZ C;  5C18 A;  4IBJ A;  3U6Q A;  3MHV C;  2XZF A;  4B3S M;  2QBY A;  2QQ8 A;  5EJC A;  1GL6 A;  4B7G A;  2XZU A;  2UUA M;  3KXE C;  1IBM M;  5ITU A;  2LHC A;  3GQ5 A;  1K3X A;  1PJT A;  4JI0 M;  3K9P A;  2R4J A;  3KW6 A;  4DV0 M;  1NY6 A;  5KPT A;  3U6D A;  2CHV A;  1WHC A;  3DA1 A;  4MH0 E;  4X65 M;  3PNV A;  3U60 A;  4I5S A;  2UXC M;  5ITY A;  1L2C A;  2L4E A;  3T15 A;  3UZU A;  1HT2 E;  2A5Y B;  2R45 A;  2XF3 A;  4IBD A;  4LJ4 A;  5L8R F;  1JR3 E;  3WHL A;  4OU7 A;  4DV2 M;  4B3M M;  1NY5 A;  4JYA M;  4AQY M;  5E6J A;  3FD9 A;  2KZU A;  3GLG E;  3TWK A;  4GIT A;  1SXJ D;  1IQP A;  2BWE A;  3JAM S;  3UMM A;  3OTO M;  3GLG B;  1Z5A A;  1YSY A;  3SYL A;  1ZQ9 A;  2R62 A;  5C1B A;  3M0E A;  2CV1 A;  2QBY B;  1W5T A;  4DV1 M;  4XBO A;  3B9P A;  1WGL A;  3PNY A;  3THG A;  3M6A A;  2KNA A;  3RGP A;  4ANR A;  1YLA A;  2CE7 A;  4NL4 H;  4Q7J A;  4HEO A;  2UUB M;  1QAM A;  2LVA A;  1GJS A;  2BNK A;  2ZTC A;  1NJF A;  3U60 B;  2FOI C;  4D82 A;  3KOZ E;  4L16 A;  1VEG A;  4MGZ E;  4NXM M;  5JI3 E;  2F5S A;  5FTN A;  4IBK A;  4LG2 A;  3SAT A;  3C58 A;  3HGI A;  3IG8 A;  1NNJ A;  2DWM A;  3J7B A;  4KLN A;  3VK7 A;  2G3Q A;  1L8Q A;  1R5L A;  1S3S A;  1SXJ A;  1GL7 A;  3I51 A;  3HHY A;  2J7N A;  4GIP A;  4IBG A;  4II7 A;  4LF8 M;  1NHW C;  5DFL A;  3DFZ A;  2QEN A;  1RU3 A;  1Z6T A;  1HNX M;  3HZJ A;  3PXG A;  2DEN A;  2ZAM A;  1PGY A;  2ZAO A;  4X66 M;  4BB9 A;  1QAO A;  5F3W A;  1FJG M;  2HCB A;  2K47 A;  3IG5 A;  4NSO B;  3ZH9 B;  3KS8 A;  3GLI A;  1XXH A;  2C99 A;  4FD2 A;  4DUY M;  2G5G X;  1MJG M;  3SMP A;  1R7R A;  1L2D A;  1XWI A;  4Z6Y A;  4NRW A;  3AV0 A;  3FYD A;  1QYR A;  2K9D A;  4GHL A;  2DHY A;  3U6L A;  3MK6 A;  3FUX A;  3Q8G A;  4GC5 A;  4HLQ A;  2M5Z A;  1SXJ E;  1VEJ A;  3RGS A;  1QZM A;  2JA2 A;  4CIZ A;  1SXJ B;  3GLF A;  2C98 A;  2DAG A;  4REZ A;  4R7G A;  3W0L B;  4JI2 M;  2L7I A;  4LJ5 A;  3GPY A;  2CRU A;  2Y21 A;  3J80 S;  1ZMV A;  4LF6 M;  1G4A E;  4YY3 M;  1OAI A;  1J7K A;  3W68 A;  3SAR A;  1Y8G A;  2G8L A;  2KZS A;  1VEK A;  3TPZ A;  4LZZ A;  1E9S A;  4DV6 M;  2KHH A;  3ZCB B;  3D8L A;  5FTJ A;  3GLI E;  1XXH E;  3C9P A;  2BWB A;  3GLI B;  1XXH B;  4IBB A;  4AG5 A;  2RKO A;  3HJQ A;  1G41 A;  3BBZ A;  1NNU C;  2DHR A;  2FE8 A;  2LVP C;  5ITX E;  3K92 A;  2XH9 A;  3EIE A;  3K9O A;  3AOE C;  4JXJ A;  4CIS A;  3R8F A;  1UFZ A;  1PRB A;  4Y28 F;  3GLF E;  4B7H A;  3FTE A;  2FFJ A;  1NV8 A;  1NV9 A;  4QOS A;  1HQY E;  2K0B X;  2QNJ A;  2GQF A;  3FRI A;  3GLF B;  4JI5 M;  4XK8 F;  4M9Z A;  3SAS A;  2CV0 A;  3J81 S;  1J09 A;  5BR8 M;  1QDT A;  4B3T M;  1YUB A;  2W82 A;  3AFH A;  3HHW A;  4GKJ M;  4RF1 A;  3J7A S;  2HWJ A;  2D7H A;  1HT1 E;  2LH0 A;  2EUC A;  4KOD A;  5EP1 A;  5FLX S;  5LMN M;  4LF4 M;  1QUT A;  2Y0Q A;  1IXR C;  2D7E A;  2LTU A;  3I01 M;  3LCU A;  4NC6 A;  1HR0 M;  4LF9 M;  4M9S A;  3A98 B;  1JQJ C;  2X4A A;  4LCB A;  5KQD A;  3JR5 A;  4KO8 A;  1LV7 A;  2KEB A;  1L2B A;  3UJN A;  1E94 E;  4L78 A;  3QYE A;  5KQ8 A;  4BBA A;  4IBE A;  2LXE A;  1VQ1 A;  3TE6 A;  4DR6 M;  1N36 M;  4G4O A;  2YQZ A;  3DOA A;  3GLH A;  2I7P A;  3Q8X A;  2CUZ A;  2LBC A;  2DWL A;  4S12 A;  5DNY A;  5A2Q S;  1IN4 A;  2LVQ D;  4G4N A;  1QVR A;  4FCT A;  1DGH A;  1PJJ A;  1ZMW A;  3QAU A;  4PDG A;  1X37 A;  2OPF A;  3L26 A;  3R9X B;  1VDL A;  4X64 M;  2VF8 A;  3KS4 A;  4MB7 A;  1SG9 A;  1XNQ M;  2XSZ D;  1UM8 A;  1D0M A;  3LW5 F;  1NSF A;  4DBG B;  3FUU A;  4FVM A;  3UK6 A;  3GPX A;  3AL0 C;  1GO5 A;  1IBK M;  3TL4 X;  1E9R A;  4P16 A;  2FS1 A;  2H5X A;  4LJ7 A;  2V6Z M;  2DZO B;  7CAT A;  2JZ0 A;  3U61 B;  1N33 M;  5EP3 A;  1K3W A;  4RF0 A;  1D2N A;  2QHO B;  3L27 A;  5EXT A;  3K1J A;  3SMS A;  1DO0 A;  4WW0 A;  1G71 A;  4AZF A;  1EIJ A;  2YFQ A;  2R4E A;  4DUZ M;  1K82 A;  4LF5 M;  3C3E A;  4B3R M;  3HU2 A;  1OFI A;  3GQ4 A;  3L25 A;  2AHM A;  1DGH B;  3MJ5 A;  3HY5 A;  2RRU A;  1T43 A;  2LWX A;  5DYG A;  4DR3 M;  1HNZ M;  4AG6 A;  1LTM A;  4M0W A;  4AW4 A;  2L7H A;  3KDS E;  2DAE A;  3KSX A;  2O25 A;  2R18 A;  1R4G A;  2XSZ A;  1GJT A;  1Q3C A;  2K6B A;  2JY8 A;  3NBI A;  4K0K M;  1IY0 A;  1C7Y A;  2JY6 B;  4WUR A;  2V1C A;  4LJ8 A;  3GQ3 A;  2ERC A;  4F2L A;  4QNR A;  2E5L M;  1H6U A;  2XEP A;  3FUT A;  2RGH A;  2RGO A;  2WSC F;  4OVZ A;  2EKF A;  1DGB A;  2F5P A;  3GRU A;  2JXN A;  1GKI A;  3HHX A;  2YR0 A;  1IN7 A;  1QUS A;  4PD2 A;  1E32 A;  4DR4 M;  4IJF A;  3I4Y A;  1IXZ A;  2MRO B;  1MN3 A;  1IN6 A;  5ITQ A;  2EA0 A;  3U6M A;  5EP4 A;  2UU9 M;  1DV0 A;  2XLJ A;  4AKI A;  3SYK A;  4L15 A;  1Z59 A;  3U5Z A;  5FSW A;  3FUW A;  3E9S A;  4LRT A;  4MGH A;  1TF0 B;  2R6F A;  2Z8Y M;  4M9X A;  4CHT B;  1R2Z A;  1PJI A;  3ILK A;  3VDU A;  1W5S A;  2XFT A;  3CTW B;  1NJG A;  3CF6 E;  3K2L A;  2L4F A;  2D7G A;  4OVZ B;  5E26 A;  1R6B X;  1QZE A;  2APL A;  3A45 A;  4DV7 M;  1TDH A;  1YE9 A;  1WR1 B;  2L09 A;  2XGN A;  3AJI B;  3B7Q A;  4G4R A;  3FKE A;  4FWH A;  2O5R A;  2GNO A;  4LFA M;  4PDI A;  3TWL A;  2Z3X A;  5JI2 E;  3U6P A;  1N34 M;  2BJV A;  5FTL A;  5KPZ A;  1DGF A;  1IM2 A;  2VDB B;  4DV5 M;  2J7O A;  3A42 A;  3VKH A;  2KDL A;  2Y20 A;  4PCZ A;  2F4V M;  1GAB A;  5DYI A;  2BJW A;  3VFD A;  4NOO B;  1PJS A;  2X49 A;  1PJQ A;  2LVN C;  3CF0 A;  1OAO C;  1HQC A;  3HKP A;  4LRS A;  1G8P A;  4IJE A;  1Z5C A;  3A46 A;  2C5R A;  4D81 A;  4AKG A;  2R44 A;  3LVV A;  3SHG B;  5KPR A;  3WHK A;  2LNH C;  2KRU A;  2MJ5 B;  1NHG C;  4KT0 F;  3QWL A;  4G4Q A;  3FUV A;  2OOA A;  3H4M A;  1KFV A;  4GRI A;  3SHF A;  2MGW A;  3LQR A;  4QHS A;  2KNV A;  4GHA A;  2CWB A;  1Q39 A;  1MU5 A;  1V34 A;  3HU3 A;  2M60 A;  4EIW A;  2P5T A;  3ZC7 B;  4UN2 B;  3TWM A;  1I94 M;  4RKU F;  1VG5 A;  4YHH M;  3E21 A;  5H37 D;  1SXJ C;  3E46 A;  3LVW A;  2R65 A;  1P3Q Q;  1OTR A;  4GC9 A;  4LJ6 A;  3SAV A;  2F5Q A;  1WGN A;  2VF7 A;  1Q02 A;  1EFU B;  4FWG A;  4IBI A;  1XB2 B;  5EXS A;  1IN8 A;  4G3O A;  2JZ1 A;  1N75 A;  3AOG A;  1N78 A;  1L1Z A;  1IY2 A;  3GLH E;  4GMQ A;  1IFY A;  1C1K A;  1L1T A;  3T38 A;  3RE8 A;  3IEC A;  4NXN M;  3FTD A;  2I7N A;  5IWA M;  4LGM A;  1ZMU A;  4FCW A;  5LMU M;  3HWS A;  4LFC M;  2HKJ A;  1Q3B A;  2R0I A;  3FTC A;  4HL4 A;  2Q2E B;  1J5E M;  1IBL M;  4L4U A;  1QAN A;  1T6O A;  2DWN A;  3B74 A;  3B89 A;  4MGY E;  2WSE F; 
#chains in the Genus database with same CATH homology
 3GLH B;  1IY1 A;  5KO3 A;  4AKH A;  1ORY B;  2V1U A;  4QHT A;  3GO8 A;  4LJ9 A;  1XHB A;  1MX0 A;  2F5O A;  3KOX E;  2QCU A;  4MGK E;  1DGG A;  1N77 A;  4JI1 M;  3U6O A;  2UXB M;  2CHQ A;  3KVW A;  3U6S A;  3TQS A;  2DVW B;  3KP1 E;  5IRE B;  8CAT A;  3LQQ A;  1FNN A;  2C9C A;  4OX9 M;  2EO2 A;  4ITQ A;  1GVN A;  3PVS A;  3KOY E;  3VLF B;  5FTM A;  3GRY A;  1QAQ A;  4FW9 A;  4D80 A;  3HHZ A;  3SAW A;  3HJ8 A;  3HU1 A;  3VKG A;  3AOE A;  3FTF A;  1KYI A;  4LFB M;  1IN5 A;  3U6C A;  1OJL A;  5IZ7 D;  3KP0 E;  4JI7 M;  1QQW A;  3W0F A;  2UXD M;  4B08 A;  1XMO M;  1TDZ A;  1KSF X;  4DR1 M;  1IXS B;  1DO2 A;  2YNM D;  3NWL A;  5GKN A;  3M7G A;  4DR2 M;  3KFU G;  3GPP A;  4GH9 A;  4A3V B;  4QNM A;  3BOS A;  4IBC A;  2VQF M;  4KHP M;  4NSR A;  2Z4R A;  4LJA A;  2OQ4 A;  3L2A A;  4I81 A;  1PM5 A;  4R3D A;  1T3T A;  2KA6 B;  2QZ4 A;  3FYC A;  2VQE M;  4I8O A;  3GP1 A;  2R46 A;  3T1H M;  4DR7 M;  4FWD A;  5ITR A;  2QP9 X;  4M0D A;  2CFO A;  4DR5 M;  2ZBK B;  5EQT A;  1TGU A;  1OFH A;  4IIW A;  1WXQ A;  5EXP A;  3PFI A;  4G6Z A;  3EIH A;  4Z8X A;  2XFS A;  3CF2 A;  3I4V A;  4RNA A;  1VDD A;  1G3I A;  2Z4S A;  3E4R A;  4LZJ A;  3JR4 A;  4NRV A;  2ZM6 M;  3HJS A;  3U5Z B;  1EE8 A;  5ITX A;  4DV3 M;  3SAU A;  3L28 A;  4JV5 M;  4W5W A;  4BLC A;  2KRK A;  4LY6 A;  5IT9 S;  1XC8 A;  2CHG A;  5FTK A;  4XGI A;  3U6E A;  2FNA A;  2HL7 A;  3K8Z A;  2HHH M;  1TH3 A;  4JI3 M;  4OW0 A;  2Z7J A;  4B7F A;  2DXI A;  4FCV A;  3AKZ A;  4GKK M;  1I4W A;  1NVM A;  2QPA A;  4X62 M;  1R2Y A;  2C9O A;  2Y0T A;  3J27 B;  4DV4 M;  2CEA A;  1JR3 D;  3KSJ A;  3LMM A;  1G59 A;  1ZAE A;  2ZAN A;  2VII A;  4MM3 B;  2KW0 A;  4TUW A;  3D8B A;  2H1R A;  3DZD A;  4CGY B;  3SC3 A;  3SBJ A;  4JN6 A;  2UUC M;  1N32 M;  1GLN A;  4I4L A;  4LF7 M;  4L8R C;  2L6O A;  5ITT A;  2DZN B;  4PT5 A;  4ZPX A;  2CV2 A;  3GRV A;  4MGI E;  1XNR M;  5EXX A;  3KOW E;  3GPU A;  2C96 A;  1XMQ M;  5EP2 A;  4LGY A;  4JI6 M;  4AI6 A;  3GRR A;  5BPV A;  4JI8 M;  3SFZ A;  3U61 A;  1HNW M;  1JR3 A;  1Z5B A;  2DWZ B;  1TH2 A;  2NQ8 C;  3RFW A;  2KXE A;  3UGJ A;  2F5N A;  2X8A A;  3J2P B;  4IBF A;  1TH4 A;  3GLG A;  3T1Y M;  3VDP A;  4QOZ C;  5C18 A;  4IBJ A;  3U6Q A;  3MHV C;  2XZF A;  4B3S M;  2QBY A;  5EJC A;  1GL6 A;  4B7G A;  2XZU A;  2UUA M;  3KXE C;  1IBM M;  5ITU A;  3GQ5 A;  1K3X A;  4JI0 M;  3KW6 A;  2R4J A;  4DV0 M;  1NY6 A;  5KPT A;  3U6D A;  2CHV A;  3DA1 A;  4MH0 E;  4X65 M;  3PNV A;  3U60 A;  4I5S A;  2UXC M;  5ITY A;  1L2C A;  3T15 A;  3UZU A;  1HT2 E;  2A5Y B;  2R45 A;  2XF3 A;  4IBD A;  4LJ4 A;  4OU7 A;  4DV2 M;  3WHL A;  4JYA M;  4B3M M;  1NY5 A;  4AQY M;  5E6J A;  3FD9 A;  2KZU A;  3TWK A;  4GIT A;  1SXJ D;  1IQP A;  3JAM S;  3UMM A;  3OTO M;  3GLG B;  1Z5A A;  1YSY A;  3SYL A;  1ZQ9 A;  2R62 A;  5C1B A;  3M0E A;  2CV1 A;  2QBY B;  1W5T A;  4DV1 M;  4XBO A;  3B9P A;  3PNY A;  3THG A;  3M6A A;  3RGP A;  2CE7 A;  4NL4 H;  2UUB M;  1QAM A;  2BNK A;  1NJF A;  3U60 B;  2FOI C;  4D82 A;  3KOZ E;  4L16 A;  4MGZ E;  4NXM M;  5JI3 E;  2F5S A;  5FTN A;  4IBK A;  4LG2 A;  3SAT A;  3C58 A;  3HGI A;  3IG8 A;  1NNJ A;  2DWM A;  3J7B A;  4KLN A;  3VK7 A;  1L8Q A;  1S3S A;  1SXJ A;  1GL7 A;  3I51 A;  3HHY A;  2J7N A;  4GIP A;  4IBG A;  4II7 A;  4LF8 M;  1NHW C;  3DFZ A;  2QEN A;  1Z6T A;  1HNX M;  3PXG A;  2ZAM A;  2ZAO A;  4X66 M;  4BB9 A;  1QAO A;  5F3W A;  1FJG M;  2HCB A;  2K47 A;  3IG5 A;  4NSO B;  3ZH9 B;  3KS8 A;  3GLI A;  1XXH A;  2C99 A;  4FD2 A;  4DUY M;  2G5G X;  3SMP A;  1R7R A;  1L2D A;  1XWI A;  4Z6Y A;  4NRW A;  3AV0 A;  3FYD A;  1QYR A;  4GHL A;  3U6L A;  3MK6 A;  3FUX A;  4GC5 A;  4HLQ A;  2M5Z A;  1SXJ E;  3RGS A;  1QZM A;  2JA2 A;  3GLF A;  1SXJ B;  2C98 A;  4REZ A;  4R7G A;  3W0L B;  4JI2 M;  2L7I A;  4LJ5 A;  3GPY A;  2Y21 A;  3J80 S;  4LF6 M;  1G4A E;  4YY3 M;  1J7K A;  3SAR A;  2G8L A;  2KZS A;  3TPZ A;  4LZZ A;  1E9S A;  4DV6 M;  3ZCB B;  3D8L A;  5FTJ A;  3GLI B;  1XXH B;  4IBB A;  4AG5 A;  2RKO A;  3HJQ A;  1G41 A;  1NNU C;  2DHR A;  2FE8 A;  5ITX E;  3K92 A;  2XH9 A;  3EIE A;  4JXJ A;  3AOE C;  4CIS A;  3R8F A;  4B7H A;  3FTE A;  2FFJ A;  4QOS A;  3GLF B;  4JI5 M;  1HQY E;  4M9Z A;  3SAS A;  2CV0 A;  3J81 S;  1J09 A;  5BR8 M;  4B3T M;  1YUB A;  2W82 A;  3AFH A;  3HHW A;  4GKJ M;  4RF1 A;  3J7A S;  2D7H A;  1HT1 E;  2LH0 A;  2EUC A;  4KOD A;  5EP1 A;  5FLX S;  5LMN M;  4LF4 M;  2Y0Q A;  1IXR C;  2D7E A;  4LF9 M;  4B3R M;  1HR0 M;  4M9S A;  3A98 B;  1JQJ C;  2X4A A;  4LCB A;  5KQD A;  3JR5 A;  4KO8 A;  1LV7 A;  2KEB A;  1L2B A;  3UJN A;  1E94 E;  4L78 A;  5KQ8 A;  4BBA A;  4IBE A;  2LXE A;  3TE6 A;  4DR6 M;  1N36 M;  4G4O A;  2YQZ A;  3DOA A;  3GLH A;  2I7P A;  3Q8X A;  2CUZ A;  2DWL A;  4S12 A;  5DNY A;  5A2Q S;  1IN4 A;  4G4N A;  1QVR A;  4FCT A;  1DGH A;  1PJJ A;  3QAU A;  4PDG A;  1X37 A;  2OPF A;  3L26 A;  3R9X B;  4X64 M;  3KS4 A;  4MB7 A;  1XNQ M;  2XSZ D;  1UM8 A;  1NSF A;  3FUU A;  4FVM A;  3UK6 A;  3GPX A;  3AL0 C;  1IBK M;  3TL4 X;  1E9R A;  4P16 A;  4LJ7 A;  2V6Z M;  2DZO B;  7CAT A;  3U61 B;  1N33 M;  5EP3 A;  1K3W A;  4RF0 A;  1D2N A;  3L27 A;  5EXT A;  3K1J A;  3SMS A;  1DO0 A;  4WW0 A;  4AZF A;  2YFQ A;  2R4E A;  4DUZ M;  1K82 A;  4LF5 M;  3HU2 A;  1OFI A;  3GQ4 A;  3L25 A;  2AHM A;  1DGH B;  3MJ5 A;  4DR3 M;  2LWX A;  5DYG A;  1HNZ M;  4AG6 A;  4M0W A;  4AW4 A;  2L7H A;  3KDS E;  3KSX A;  2R18 A;  2XSZ A;  1Q3C A;  3NBI A;  4K0K M;  1IY0 A;  4WUR A;  2V1C A;  4LJ8 A;  3GQ3 A;  2ERC A;  4QNR A;  2E5L M;  1H6U A;  2XEP A;  3FUT A;  2RGH A;  2RGO A;  4OVZ A;  1DGB A;  2F5P A;  3GRU A;  1GKI A;  3HHX A;  2YR0 A;  1IN7 A;  4PD2 A;  1E32 A;  4DR4 M;  4IJF A;  3I4Y A;  1IXZ A;  5ITQ A;  1IN6 A;  3U6M A;  2EA0 A;  2UU9 M;  5EP4 A;  4AKI A;  2XLJ A;  3SYK A;  4L15 A;  1Z59 A;  3U5Z A;  5FSW A;  3FUW A;  3E9S A;  4LRT A;  4MGH A;  4M9X A;  4CHT B;  1R2Z A;  1PJI A;  3ILK A;  3VDU A;  1W5S A;  2XFT A;  3CTW B;  1NJG A;  3CF6 E;  3K2L A;  5E26 A;  2D7G A;  4OVZ B;  1R6B X;  3A45 A;  4DV7 M;  4G4R A;  1TDH A;  1YE9 A;  2L09 A;  2XGN A;  3AJI B;  3VK8 A;  3FKE A;  4FWH A;  2O5R A;  2Z3X A;  4LFA M;  4PDI A;  3TWL A;  3U6P A;  5JI2 E;  1N34 M;  4JI4 M;  2BJV A;  5FTL A;  5KPZ A;  1DGF A;  1IM2 A;  4DV5 M;  2J7O A;  3A42 A;  3VKH A;  2Y20 A;  4PCZ A;  2F4V M;  5DYI A;  2BJW A;  3VFD A;  4NOO B;  2X49 A;  3CF0 A;  1HQC A;  3HKP A;  4LRS A;  1G8P A;  4IJE A;  1Z5C A;  3A46 A;  2C5R A;  4D81 A;  4AKG A;  3LVV A;  3SHG B;  5KPR A;  3WHK A;  2LNH C;  2KRU A;  1NHG C;  3QWL A;  4G4Q A;  3FUV A;  3H4M A;  1KFV A;  4GRI A;  3SHF A;  3LQR A;  4QHS A;  4GHA A;  1Q39 A;  1MU5 A;  3HU3 A;  2M60 A;  4EIW A;  2P5T A;  3ZC7 B;  3TWM A;  1I94 M;  4YHH M;  5H37 D;  1SXJ C;  3LVW A;  2R65 A;  4GC9 A;  4LJ6 A;  3SAV A;  2F5Q A;  4FWG A;  4IBI A;  5EXS A;  1IN8 A;  1N75 A;  3AOG A;  1N78 A;  1L1Z A;  1IY2 A;  4GMQ A;  1C1K A;  1L1T A;  3T38 A;  3RE8 A;  4NXN M;  3FTD A;  2I7N A;  5IWA M;  4LGM A;  4FCW A;  5LMU M;  3HWS A;  4LFC M;  2HKJ A;  1Q3B A;  3FTC A;  4HL4 A;  2Q2E B;  1J5E M;  1IBL M;  4L4U A;  1QAN A;  2DWN A;  4MGY E;  3L29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...