4GMQA

Ribosome-binding domain of zuo1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
NAVKKNKRVLRGSVKEANYFVEGEASAATIDAVLNDVDLVITKIDADEIAALAGKLNGLTVADEIKNVWKEEVSRLVGAGKLKEGDIKALVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative ribosome associated protein
publication title Structural characterization of a eukaryotic chaperone-the ribosome-associated complex.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum dsm 1495
molecule tags Ribosome-binding protein
total genus 36
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.840 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gmqA00
4GMQA 2LWXA
chains in the Genus database with same CATH superfamily
1EE8A 2C99A 2L7HA 4RF1A 1QZEA 3CTWB 4PD2A 2M60A 3GLFA 5FTMA 1PGYA 5EXPA 3L27A 7CATA 3U6PA 1DGBA 4LJ9A 3TWKA 3RGSA 1G3IA 3TE6A 4X65M 2Z3XA 1IN4A 3NWLA 2QNJA 1AUAA 2LTUA 5F3WA 3FYDA 5FTLA 3HY5A 1XC8A 4DV5M 1JB0F 4L4UA 1ORYB 4KLNA 3U6LA 4DR4M 4KHPM 3U6EA 3FUUA 4L16A 4AG6A 1SXJA 2JWSA 4LCBA 1N75A 1J5EM 4L78A 5BR8M 1R6BX 5EXSA 4ANRA 5H37D 1HNZM 2QZ4A 4B3SM 2QENA 4LF5M 4CHTB 2YR0A 1XMOM 4IBFA 1TH4A 2QQ8A 1VDDA 4WURA 4B7FA 2HKJA 1XB2B 2KRUA 1KSFX 1PJSA 1HQYE 2UXCM 2EKFA 3NBXX 4AI6A 1JQJC 2CHGA 2QCUA 1EFUB 2R46A 5IZ7D 3GPUA 3HU1A 4L8RC 4NL4H 3Q8GA 2VF7A 1Z6TA 3K9PA 4DR2M 1Q3CA 1H6UA 2LVQD 2VF8A 4LJ8A 3GLGE 2KNAA 1MU5A 2KNZA 3I04M 2RRUA 2R18A 4IIWA 4F2LA 1IFYA 5EP3A 2QSFX 4Z6YA 1YSYA 3U60B 1IXZA 2V6ZM 2Y0QA 1NHGC 3FTDA 4OX9M 2OO9A 4LJAA 4JI8M 4QHTA 3GLHE 3KVWA 2XFSA 3J81S 2EKKA 5DNYA 3M0EA 4LJ5A 3GLIB 2JY7A 1N32M 2JXNA 2WZJA 1IQPA 2K47A 4NRWA 4F1IA 4LJ4A 1K82A 1OFHA 2KW0A 2X49A 1IBKM 2DXIA 2QP9X 5EP1A 2F5PA 2LHGA 4GMQA 2MROB 1I94M 3LVWA 4FCTA 2BJWA 4JI2M 4RNAA 3QWLA 5E6JA 3HHYA 4Q7JA 2XLJA 1VEGA 2WSEF 4FWHA 3GQ4A 3FD9A 2VIIA 5EP4A 1L1TA 4A3VB 2MR9A 2B3TA 1IN7A 2BNKA 3AOEC 1IXRC 3E46A 3FKEA 1OKSA 2DZOB 4LZJA 3L25A 1S3SA 2HL7A 3GRUA 3TWMA 3C3EA 3LQRA 5FLXS 4GC5A 3AJIB 1NO1A 2LVNC 2ZAOA 3ZQJA 1GL7A 1DGHA 4MGIE 2F4VM 1NHWC 1Z5AA 3E9SA 3C3DA 3J80S 4YY3M 2R45A 2RGHA 4MGKE 3A98B 1FJGM 5KQDA 1DO0A 3K8ZA 3UZUA 2XEPA 2EJSA 1ZAEA 3LW5F 3KP0E 1YLAA 5FTNA 1IXSB 2XH9A 1ZMUA 3HU3A 4KODA 4G4RA 3OTOM 1QAMA 2V1UA 3R8FA 3IG5A 5BPVA 3SYLA 2J7OA 2ZAMA 4EIWA 1N77A 1DV0A 1PJIA 4RKUF 2WSCF 3KOZE 3GRYA 4I81A 4DV6M 3KOWE 2YFQA 3B7QA 3HGIA 3U61A 5E26A 2QBYB 1VDLA 4R71A 2K0BX 2R6FA 1NJGA 3LCUA 4L6V6 4FW9A 3GO8A 4JI7M 1G59A 4BLCA 5C18A 1K3WA 1OIZA 2DWNA 2KRKA 3VKHA 2G5GX 2DWMA 3B7ZA 2L2DA 3W0FA 3JR4A 1V34A 4JN6A 2JY8A 3T1HM 5JI2E 1SXJC 4G4NA 4OVZB 4GKKM 2JZ1A 3SHGB 3H4MA 2FNAA 1NNUC 2LXEA 3I51A 2CP8A 4DBGB 4FCWA 2A5YB 1GJTA 5EP2A 2DWLA 4JYAM 4DV0M 2UUAM 2CRUA 3SASA 3D8LA 1GVNA 1GO5A 2LVPC 5EQTA 2APLA 4AZFA 3R9XB 4PCZA 4AKHA 2JP7A 2OOAA 4Y28F 1TDZA 1GABA 1HR0M 1IY2A 1PJJA 4LRTA 3TPZA 1T6OA 1XHBA 2H5XA 1WXQA 3LVVA 4D80A 3B9PA 4DV2M 2C5RA 2J5YA 3FUXA 4FD2A 1OTRA 1J7KA 2ZTCA 4LRSA 4REZA 1QAOA 3MJ5A 2Z4SA 2HAKA 3GP1A 1E9RA 2L6OA 3KP1E 3U6OA 4LF8M 3HJSA 3SATA 1ZV1A 3FUWA 4AKGA 1AIPC 3GQ5A 1E94E 2XSZA 4HEOA 1TTEA 2LNHC 1ZMWA 1Y8GA 2I7NA 5KO3A 5ITUA 4IJEA 3ZC7B 2Y20A 3U60A 2O25A 3A46A 3J2PB 4XBOA 1QZMA 1HJPA 1GL6A 4NSRA 4JXJA 5FTJA 3SYKA 5KPTA 4GC9A 2HWJA 3GLIE 1OQYA 3RE8A 3EIHA 3GLIA 2CUZA 1G4AE 3GPXA 3AOGA 3VK7A 4FWGA 1QYRA 3MK6A 3LCVB 4LY6A 4DV7M 1R2YA 2DZLA 2OOBA 3HKPA 2G3QA 4NSOB 3KS4A 2DNAA 3B7NA 5EXXA 4DR6M 4BBAA 4P16A 4D81A 1WGNA 3H4JA 4MM3B 3GLFB 4D82A 2XGNA 4JI3M 3GLGA 3LMMA 4LZZA 1OJLA 5LMUM 3SMSA 3AFHA 4FVMA 2XFTA 3FTEA 1W5SA 4LGMA 3GLHA 4FCVA 3A42A 3AV0A 3KFUG 3QYBA 1HT1E 3RFWA 4B7HA 1E9SA 2KEBA 5FTKA 3T15A 4X62M 3GPPA 1SXJB 1TH3A 3L26A 3UMMA 3VLFB 3CF2A 2E5LM 1YUBA 2QPAA 3SHFA 2C98A 4MGYE 1F4IA 3UGJA 4JI1M 2FFJA 1JR3D 3Q8XA 3HJQA 3WHKA 1N36M 4LF6M 2F5NA 4PT5A 3I4VA 2DHYA 2JNHA 1ZQ9A 2XF3A 3TWLA 1KYIA 4WP2A 1IXSA 4W5WA 4P17A 1SG9A 2Z7JA 3L28A 4B08A 2D7GA 2FS1A 3K9OA 2F5OA 1EIJA 2LVAA 3KOXE 4S12A 2O01F 5FSWA 2LBCA 3TQSA 1TH2A 3VDUA 3U5ZA 4TUWA 4AQYM 1E32A 2Y21A 3L29A 2DAGA 2UUBM 3SAUA 2D7HA 4CISA 1QDRA 2Y0TA 2CHVA 3GRRA 1VQ1A 1WJ7A 4ZPXA 5IT9S 2C96A 1OFIA 2RKOA 4I5SA 8CATA 1Z59A 2FH0A 4DR5M 2DHRA 2R62A 4NRVA 4LJ6A 5IWAM 1ZMVA 3PNVA 2CHQA 2BWEA 4KT0F 2GQFA 3ZCBB 4AKIA 1IY1A 2VDBB 4GITA 2XSZD 3VDPA 2LH0A 2CWBA 1HT2E 3EIEA 2KZSA 4X66M 4B7GA 1PM5A 4G4OA 4JI5M 2UXBM 3CF0A 3SAWA 4JV5M 3HHZA 2MJ5B 4II7A 2F5QA 4IBIA 2R44A 1JR3E 2JUJA 1QANA 1G71A 4JI0M 3UK6A 1JR3A 3SMPA 2CV0A 2JY5A 2EO2A 4NXMM 4GHLA 3VK8A 5DYIA 3NBIA 3T1YM 2KXEA 3SC3A 2R0IA 4G4QA 1OIPA 2ZANA 3GRVA 5A2QS 1T43A 5DFLA 1NVMA 1DGHB 1VEKA 3HHXA 3U6SA 2JA2A 1G8PA 3PFIA 1IBLM 4JI6M 4IBDA 1V92A 4R3DA 2UU9M 2BJVA 1L8QA 4GKJM 1TGUA 1LTMA 3T38A 3KDSE 2L09A 3FRHA 2CV1A 4DV4M 2QHOB 3E4RA 3SBJA 2LWXA 1L2BA 2HHHM 1D0KA 1Q3BA 4CJ6A 1R4GA 3KXEC 4X64M 1PJQA 4IBEA 1DO2A 1IN6A 3BOSA 4LFAM 3U61B 1DGGA 2DWZB 1D0MA 3DA1A 2J7NA 3W0LB 5KPZA 3TL4X 4PDGA 3FUTA 4I4LA 2ZM6M 1YE9A 1Q39A 3DOAA 2L7IA 3CGWA 3HX3A 3QAUA 3M6AA 3GLFE 3C58A 3KSJA 1J09A 2JY6B 2KA6B 3C9PA 4LFBM 3B74A 4DUYM 4XK8F 1NY5A 2DAIA 1WHCA 1CUKA 1UM8A 2YNMD 3MHVC 1KFVA 1Q02A 3U6CA 4QOSA 3HWSA 2ERCA 4OW0A 4RF0A 5ITQA 1N78A 2RGOA 2K6BA 2M5ZA 2CV2A 3IECA 4M9ZA 5IREB 4LJ7A 1XXHB 2EA0A 3RGPA 1D0LA 3J7BA 4GHAA 1SXJE 4I8OA 1L2DA 4G6ZA 1TF0B 2Z4RA 1NV8A 4ITQA 1MN3A 3QYEA 1QVRA 5DYGA 1R2ZA 3J7AS 4XGIA 4LF7M 2O5RA 1DGFA 1NSFA 3ZH9B 3FYCA 1IN8A 4Z8XA 2YQZA 4NXNM 4DR1M 2OPFA 4DR7M 4NOOB 4BB9A 4GEWA 2EUCA 5LMNM 3I4YA 1Z5BA 2CFOA 2DENA 2KZUA 1HNXM 4YHHM 3WHLA 4IBCA 4B3MM 2Z8YM 1QUSA 3K2LA 4GH9A 5GKNA 3FTCA 2D7EA 4UN2B 4QNRA 2VQFM 1QQWA 3FRIA 3U6MA 3B89A 3A45A 1T3TA 4DV1M 1R7RA 4M9SA 1QAQA 1V33A 1PRBA 4GRIA 2C9CA 2V1CA 5ITXE 5ITTA 5EXTA 3GPYA 3F92A 2R65A 2DAEA 2N35A 5ITXA 3T6PA 4AW4A 1HNWM 1C1KA 2ZTDA 4DR3M 1NJFA 2X8AA 4MH0E 1XNRM 2UXDM 3U6QA 1QUTA 1MX0A 1C7YA 1MJGM 2MGWA 1X37A 1Z5CA 2C9OA 4R7GA 4DUZM 5ITYA 3U6DA 4LF9M 2X4AA 2DI0A 4HL4A 1L2CA 4IJFA 3AKZA 2FOIC 3HU2A 4NC6A 5ITRA 3DFZA 4L15A 3GLGB 4LG2A 2LVOC 3J27B 4QHSA 3JAMS 1K3XA 3D8BA 4IBKA 2QBYA 3SARA 1NV9A 2CEAA 3PVSA 2G8LA 3PXGA 2DAKA 3FTFA 3K92A 1N34M 2AHMA 3JR5A 3CF6E 1GKIA 3GLHB 3IG8A 3KW6A 5KPRA 3DZDA 2DVWB 3HZJA 1UFZA 4LF4M 1OAOC 4LGYA 1LV7A 5C1BA 3W67A 5KQ8A 4MGZE 4OVZA 3KOYE 1OAIA 4M0WA 3FE3A 1WR1B 2W82A 2H1RA 3HJ8A 3UJNA 1PJTA 4CIZA 2R4JA 1NNJA 3IHPA 2ZBKB 1HQCA 2I7PA 2KNVA 4HLQA 3K1JA 2LHCA 2VQEM 1QDTA 2NQ8C 2DAMA 1P3QQ 4B3TM 3GQ3A 4M0DA 4DV3M 2L4FA 2JZ0A 4FWDA 5EJCA 2MH8A 1XMQM 4PDIA 2F5SA 3BXWA 2R4EA 3KS8A 1G41A 3MMPA 4QNMA 2Q2EB 4OU7A 1A5TA 2HCBA 2DKLA 4MB7A 1L1ZA 2P5TA 2CE7A 1VEJA 4AG5A 1W5TA 4IBGA 2L4EA 3KSXA 1IM2A 1SXJD 3U5ZB 4QOZC 1N33M 1BVSA 3SAVA 1RU3A 3AOEA 3LQQA 4LFCM 1GLNA 1XWIA 2BWBA 1IY0A 4JI4M 4CGYB 3E21A 4WW0A 4IBBA 1IBMM 4B3RM 3VFDA 2XZUA 5JI3E 2DZNB 1I4WA 3HHWA 3I01M 3THGA 4G3OA 4KO8A 3V76A 3AL0C 1FNNA 4IBJA 2KDLA 2FE8A 2XZFA 2OQ4A 2GNOA 1NY6A 4GIPA 1TR8A 2KHHA 1WGLA 3PNYA 3SFZA 4M9XA 1R5LA 2WSFF 3L2AA 3VKGA 4K0KM 4MGHA 2UUCM 1IN5A 1D2NA 1XXHE 3W68A 3FUVA 5L8RF 1GJSA 3BBZA 1XXHA 3M7GA 2K9DA 3ILKA 1XNQM 1VG5A 1WIVA 1TDHA
chains in the Genus database with same CATH topology
1EE8A 2C99A 2L7HA 4RF1A 4PD2A 3CTWB 2M60A 3GLFA 5FTMA 5EXPA 3L27A 7CATA 3U6PA 1DGBA 4LJ9A 3TWKA 3RGSA 1G3IA 3TE6A 4X65M 2Z3XA 1IN4A 3NWLA 5F3WA 3FYDA 5FTLA 1XC8A 4DV5M 4L4UA 1ORYB 4KLNA 3U6LA 4DR4M 4KHPM 3U6EA 3FUUA 4L16A 4AG6A 1SXJA 1J5EM 4LCBA 1N75A 4L78A 5BR8M 1R6BX 5EXSA 1HNZM 5H37D 2QZ4A 4B3SM 2QENA 4LF5M 4CHTB 2YR0A 1XMOM 4IBFA 1TH4A 4WURA 1VDDA 4B7FA 2HKJA 2KRUA 1KSFX 1HQYE 2UXCM 4AI6A 1JQJC 2CHGA 2QCUA 2R46A 5IZ7D 3GPUA 3HU1A 4L8RC 4NL4H 1Z6TA 4DR2M 1Q3CA 1H6UA 4LJ8A 1MU5A 2R18A 4IIWA 5EP3A 4Z6YA 3U60B 1YSYA 4OX9M 1IXZA 2V6ZM 2Y0QA 1NHGC 3FTDA 4LJAA 4JI8M 4QHTA 3KVWA 2XFSA 3J81S 5DNYA 3M0EA 4LJ5A 3GLIB 1N32M 1IQPA 2K47A 4NRWA 4LJ4A 1K82A 1OFHA 2KW0A 2X49A 1IBKM 2DXIA 2QP9X 5EP1A 2F5PA 4GMQA 1I94M 3LVWA 4FCTA 2BJWA 4JI2M 4RNAA 3QWLA 5E6JA 3HHYA 2XLJA 4FWHA 3GQ4A 3FD9A 2VIIA 5EP4A 1L1TA 4A3VB 1IN7A 2BNKA 3AOEC 1IXRC 3FKEA 2DZOB 4LZJA 3L25A 1S3SA 2HL7A 3GRUA 3TWMA 3LQRA 5FLXS 4GC5A 3AJIB 2ZAOA 1GL7A 1DGHA 4MGIE 2F4VM 1NHWC 1Z5AA 3E9SA 3J80S 4YY3M 2R45A 2RGHA 4MGKE 3A98B 1FJGM 5KQDA 1DO0A 3K8ZA 3UZUA 2XEPA 1ZAEA 3KP0E 5FTNA 1IXSB 2XH9A 3HU3A 4KODA 4G4RA 3OTOM 1QAMA 2V1UA 3R8FA 3IG5A 5BPVA 3SYLA 2J7OA 2ZAMA 4EIWA 1N77A 1PJIA 3KOZE 3GRYA 4I81A 4DV6M 3KOWE 2YFQA 3HGIA 3U61A 5E26A 2QBYB 1NJGA 4FW9A 3GO8A 4JI7M 1G59A 4BLCA 5C18A 1K3WA 2DWNA 2KRKA 3VKHA 2G5GX 2DWMA 3W0FA 3JR4A 4JN6A 3T1HM 5JI2E 1SXJC 4G4NA 4OVZB 4GKKM 3SHGB 3H4MA 2FNAA 1NNUC 2LXEA 4FCWA 2A5YB 5EP2A 2DWLA 4JYAM 4DV0M 2UUAM 3SASA 3D8LA 1GVNA 5EQTA 4AZFA 3R9XB 4PCZA 4AKHA 1TDZA 1HR0M 1IY2A 1PJJA 4LRTA 3TPZA 1XHBA 1WXQA 3LVVA 4D80A 3B9PA 4DV2M 2C5RA 3FUXA 4FD2A 1J7KA 4LRSA 4REZA 1QAOA 3MJ5A 2Z4SA 3GP1A 3U6OA 1E9RA 2L6OA 3KP1E 4LF8M 3HJSA 3SATA 3FUWA 4AKGA 3GQ5A 1E94E 2XSZA 2LNHC 5KO3A 2I7NA 5ITUA 4IJEA 3ZC7B 2Y20A 3U60A 3A46A 3J2PB 4XBOA 1QZMA 1GL6A 4NSRA 4JXJA 5FTJA 3SYKA 5KPTA 4GC9A 3RE8A 3EIHA 3GLIA 2CUZA 1G4AE 3GPXA 3AOGA 3VK7A 4FWGA 1QYRA 3MK6A 4LY6A 4DV7M 1R2YA 3HKPA 4NSOB 4DR6M 5EXXA 3KS4A 4BBAA 4P16A 4D81A 4MM3B 3GLFB 4D82A 2XGNA 4JI3M 3GLGA 3LMMA 4LZZA 1OJLA 5LMUM 3SMSA 3AFHA 4FVMA 2XFTA 3FTEA 1W5SA 4LGMA 3GLHA 4FCVA 3A42A 3AV0A 3KFUG 1HT1E 3RFWA 4B7HA 1E9SA 2KEBA 5FTKA 3T15A 4X62M 3GPPA 1SXJB 1TH3A 3L26A 3UMMA 3VLFB 1TDHA 2E5LM 1YUBA 2QPAA 3SHFA 2C98A 4MGYE 3UGJA 4JI1M 2FFJA 1JR3D 3Q8XA 3HJQA 3WHKA 1N36M 4LF6M 2F5NA 4PT5A 3I4VA 1ZQ9A 2XF3A 3TWLA 1KYIA 4W5WA 2Z7JA 3L28A 4B08A 2D7GA 2F5OA 3KOXE 4S12A 5FSWA 3TQSA 1TH2A 3VDUA 3U5ZA 4TUWA 4AQYM 1E32A 2Y21A 3L29A 2UUBM 3SAUA 2D7HA 4CISA 2Y0TA 2CHVA 3GRRA 4ZPXA 5IT9S 2C96A 1OFIA 2RKOA 4I5SA 8CATA 1Z59A 4DR5M 2DHRA 2R62A 4NRVA 4LJ6A 5IWAM 3PNVA 2CHQA 4AKIA 3ZCBB 1IY1A 3VDPA 4GITA 2XSZD 2LH0A 1HT2E 3EIEA 2KZSA 4X66M 4B7GA 1PM5A 4G4OA 4JI5M 2UXBM 3CF0A 3SAWA 4JV5M 3HHZA 4II7A 2F5QA 4IBIA 1QANA 4JI0M 3UK6A 1JR3A 3SMPA 2CV0A 4NXMM 2EO2A 4GHLA 3VK8A 5DYIA 3NBIA 3T1YM 2KXEA 3SC3A 4G4QA 2ZANA 3GRVA 5A2QS 1NVMA 1DGHB 3HHXA 3U6SA 2JA2A 1G8PA 3PFIA 1IBLM 4JI6M 4IBDA 4R3DA 2UU9M 2BJVA 1L8QA 4GKJM 1TGUA 3T38A 3KDSE 2L09A 2CV1A 4DV4M 3E4RA 3SBJA 2LWXA 1L2BA 2HHHM 1Q3BA 3KXEC 4X64M 4IBEA 1DO2A 1IN6A 3BOSA 4LFAM 3U61B 1DGGA 2DWZB 3DA1A 2J7NA 3W0LB 5KPZA 3TL4X 4PDGA 3FUTA 4I4LA 2ZM6M 1YE9A 1Q39A 3DOAA 2L7IA 3QAUA 3C58A 3M6AA 3KSJA 1J09A 2KA6B 4LFBM 4DUYM 1NY5A 2YNMD 1UM8A 3MHVC 1KFVA 3U6CA 4QOSA 3HWSA 2ERCA 4OW0A 4RF0A 5ITQA 1N78A 2RGOA 2M5ZA 2CV2A 4M9ZA 5IREB 4LJ7A 1XXHB 2EA0A 3RGPA 3J7BA 4GHAA 1SXJE 4I8OA 1L2DA 4G6ZA 2Z4RA 4ITQA 5DYGA 3J7AS 1QVRA 1R2ZA 4XGIA 4LF7M 2O5RA 1DGFA 1NSFA 3ZH9B 3FYCA 1IN8A 4Z8XA 2YQZA 4NXNM 4DR1M 2OPFA 4DR7M 4NOOB 4BB9A 5LMNM 2EUCA 3I4YA 1Z5BA 2CFOA 2KZUA 1HNXM 4YHHM 3WHLA 4IBCA 4B3MM 3K2LA 4GH9A 5GKNA 3FTCA 2D7EA 4QNRA 2VQFM 1QQWA 3U6MA 3A45A 1T3TA 4DV1M 1R7RA 4M9SA 1QAQA 4GRIA 2C9CA 2V1CA 5ITXE 5ITTA 5EXTA 3GPYA 2R65A 5ITXA 4AW4A 1HNWM 1C1KA 4DR3M 1NJFA 2X8AA 4MH0E 1XNRM 2UXDM 3U6QA 1MX0A 1X37A 1Z5CA 2C9OA 4R7GA 4DUZM 5ITYA 3U6DA 4LF9M 2X4AA 4HL4A 1L2CA 4IJFA 3AKZA 2FOIC 3HU2A 5ITRA 3DFZA 4L15A 3GLGB 4LG2A 3J27B 3JAMS 4QHSA 1K3XA 2QBYA 3D8BA 4IBKA 3SARA 2CEAA 3PVSA 2G8LA 3PXGA 3FTFA 3K92A 1N34M 2AHMA 3JR5A 3CF6E 1GKIA 3GLHB 3IG8A 3KW6A 5KPRA 3DZDA 2DVWB 4LF4M 4LGYA 1LV7A 5C1BA 5KQ8A 4MGZE 4OVZA 3KOYE 4M0WA 2W82A 2H1RA 3HJ8A 3UJNA 2R4JA 1NNJA 2ZBKB 1HQCA 2I7PA 4HLQA 3K1JA 2VQEM 2NQ8C 4B3TM 3GQ3A 4M0DA 4DV3M 4FWDA 5EJCA 1XMQM 4PDIA 2F5SA 2R4EA 3KS8A 1G41A 4QNMA 2Q2EB 4OU7A 2HCBA 1L1ZA 4MB7A 2P5TA 2CE7A 4AG5A 1W5TA 4IBGA 3KSXA 1IM2A 1SXJD 3U5ZB 4QOZC 1N33M 3SAVA 3AOEA 3LQQA 4LFCM 1GLNA 1XWIA 1IY0A 4JI4M 4CGYB 4WW0A 4IBBA 1IBMM 4B3RM 3VFDA 2XZUA 5JI3E 2DZNB 1I4WA 3HHWA 3THGA 4KO8A 3AL0C 1FNNA 4IBJA 2XZFA 2FE8A 2OQ4A 1NY6A 4GIPA 3PNYA 3SFZA 4M9XA 3L2AA 3VKGA 4K0KM 4MGHA 2UUCM 1IN5A 1D2NA 3FUVA 1XXHA 3M7GA 1XNQM 3ILKA 3I51A 3CF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMQ A;  2LWX A; 
#chains in the Genus database with same CATH topology
 1EE8 A;  2C99 A;  2L7H A;  4RF1 A;  1QZE A;  3CTW B;  4PD2 A;  2M60 A;  3GLF A;  5FTM A;  1PGY A;  5EXP A;  3L27 A;  7CAT A;  3U6P A;  1DGB A;  4LJ9 A;  3TWK A;  3RGS A;  1G3I A;  3TE6 A;  4X65 M;  2Z3X A;  1IN4 A;  3NWL A;  2QNJ A;  1AUA A;  2LTU A;  5F3W A;  3FYD A;  5FTL A;  3HY5 A;  1XC8 A;  4DV5 M;  1JB0 F;  4L4U A;  1ORY B;  4KLN A;  3U6L A;  4DR4 M;  4KHP M;  3U6E A;  3FUU A;  4L16 A;  4AG6 A;  1SXJ A;  2JWS A;  4LCB A;  1N75 A;  1J5E M;  4L78 A;  5BR8 M;  1R6B X;  5EXS A;  4ANR A;  5H37 D;  1HNZ M;  2QZ4 A;  4B3S M;  2QEN A;  4LF5 M;  4CHT B;  2YR0 A;  1XMO M;  4IBF A;  1TH4 A;  2QQ8 A;  1VDD A;  4WUR A;  4B7F A;  2HKJ A;  1XB2 B;  2KRU A;  1KSF X;  1PJS A;  1HQY E;  2UXC M;  2EKF A;  3NBX X;  4AI6 A;  1JQJ C;  2CHG A;  2QCU A;  1EFU B;  2R46 A;  5IZ7 D;  3GPU A;  3HU1 A;  4L8R C;  4NL4 H;  3Q8G A;  2VF7 A;  1Z6T A;  3K9P A;  4DR2 M;  1Q3C A;  1H6U A;  2LVQ D;  2VF8 A;  4LJ8 A;  3GLG E;  2KNA A;  1MU5 A;  2KNZ A;  3I04 M;  2RRU A;  2R18 A;  4IIW A;  4F2L A;  1IFY A;  5EP3 A;  2QSF X;  4Z6Y A;  1YSY A;  3U60 B;  1IXZ A;  2V6Z M;  2Y0Q A;  1NHG C;  3FTD A;  4OX9 M;  2OO9 A;  4LJA A;  4JI8 M;  4QHT A;  3GLH E;  3KVW A;  2XFS A;  3J81 S;  2EKK A;  5DNY A;  3M0E A;  4LJ5 A;  3GLI B;  2JY7 A;  1N32 M;  2JXN A;  2WZJ A;  1IQP A;  2K47 A;  4NRW A;  4F1I A;  4LJ4 A;  1K82 A;  1OFH A;  2KW0 A;  2X49 A;  1IBK M;  2DXI A;  2QP9 X;  5EP1 A;  2F5P A;  2LHG A;  4GMQ A;  2MRO B;  1I94 M;  3LVW A;  4FCT A;  2BJW A;  4JI2 M;  4RNA A;  3QWL A;  5E6J A;  3HHY A;  4Q7J A;  2XLJ A;  1VEG A;  2WSE F;  4FWH A;  3GQ4 A;  3FD9 A;  2VII A;  5EP4 A;  1L1T A;  4A3V B;  2MR9 A;  2B3T A;  1IN7 A;  2BNK A;  3AOE C;  1IXR C;  3E46 A;  3FKE A;  1OKS A;  2DZO B;  4LZJ A;  3L25 A;  1S3S A;  2HL7 A;  3GRU A;  3TWM A;  3C3E A;  3LQR A;  5FLX S;  4GC5 A;  3AJI B;  1NO1 A;  2LVN C;  2ZAO A;  3ZQJ A;  1GL7 A;  1DGH A;  4MGI E;  2F4V M;  1NHW C;  1Z5A A;  3E9S A;  3C3D A;  3J80 S;  4YY3 M;  2R45 A;  2RGH A;  4MGK E;  3A98 B;  1FJG M;  5KQD A;  1DO0 A;  3K8Z A;  3UZU A;  2XEP A;  2EJS A;  1ZAE A;  3LW5 F;  3KP0 E;  1YLA A;  5FTN A;  1IXS B;  2XH9 A;  1ZMU A;  3HU3 A;  4KOD A;  4G4R A;  3OTO M;  1QAM A;  2V1U A;  3R8F A;  3IG5 A;  5BPV A;  3SYL A;  2J7O A;  2ZAM A;  4EIW A;  1N77 A;  1DV0 A;  1PJI A;  4RKU F;  2WSC F;  3KOZ E;  3GRY A;  4I81 A;  4DV6 M;  3KOW E;  2YFQ A;  3B7Q A;  3HGI A;  3U61 A;  5E26 A;  2QBY B;  1VDL A;  4R71 A;  2K0B X;  2R6F A;  1NJG A;  3LCU A;  4L6V 6;  4FW9 A;  3GO8 A;  4JI7 M;  1G59 A;  4BLC A;  5C18 A;  1K3W A;  1OIZ A;  2DWN A;  2KRK A;  3VKH A;  2G5G X;  2DWM A;  3B7Z A;  2L2D A;  3W0F A;  3JR4 A;  1V34 A;  4JN6 A;  2JY8 A;  3T1H M;  5JI2 E;  1SXJ C;  4G4N A;  4OVZ B;  4GKK M;  2JZ1 A;  3SHG B;  3H4M A;  2FNA A;  1NNU C;  2LXE A;  3I51 A;  2CP8 A;  4DBG B;  4FCW A;  2A5Y B;  1GJT A;  5EP2 A;  2DWL A;  4JYA M;  4DV0 M;  2UUA M;  2CRU A;  3SAS A;  3D8L A;  1GVN A;  1GO5 A;  2LVP C;  5EQT A;  2APL A;  4AZF A;  3R9X B;  4PCZ A;  4AKH A;  2JP7 A;  2OOA A;  4Y28 F;  1TDZ A;  1GAB A;  1HR0 M;  1IY2 A;  1PJJ A;  4LRT A;  3TPZ A;  1T6O A;  1XHB A;  2H5X A;  1WXQ A;  3LVV A;  4D80 A;  3B9P A;  4DV2 M;  2C5R A;  2J5Y A;  3FUX A;  4FD2 A;  1OTR A;  1J7K A;  2ZTC A;  4LRS A;  4REZ A;  1QAO A;  3MJ5 A;  2Z4S A;  2HAK A;  3GP1 A;  1E9R A;  2L6O A;  3KP1 E;  3U6O A;  4LF8 M;  3HJS A;  3SAT A;  1ZV1 A;  3FUW A;  4AKG A;  1AIP C;  3GQ5 A;  1E94 E;  2XSZ A;  4HEO A;  1TTE A;  2LNH C;  1ZMW A;  1Y8G A;  2I7N A;  5KO3 A;  5ITU A;  4IJE A;  3ZC7 B;  2Y20 A;  3U60 A;  2O25 A;  3A46 A;  3J2P B;  4XBO A;  1QZM A;  1HJP A;  1GL6 A;  4NSR A;  4JXJ A;  5FTJ A;  3SYK A;  5KPT A;  4GC9 A;  2HWJ A;  3GLI E;  1OQY A;  3RE8 A;  3EIH A;  3GLI A;  2CUZ A;  1G4A E;  3GPX A;  3AOG A;  3VK7 A;  4FWG A;  1QYR A;  3MK6 A;  3LCV B;  4LY6 A;  4DV7 M;  1R2Y A;  2DZL A;  2OOB A;  3HKP A;  2G3Q A;  4NSO B;  3KS4 A;  2DNA A;  3B7N A;  5EXX A;  4DR6 M;  4BBA A;  4P16 A;  4D81 A;  1WGN A;  3H4J A;  4MM3 B;  3GLF B;  4D82 A;  2XGN A;  4JI3 M;  3GLG A;  3LMM A;  4LZZ A;  1OJL A;  5LMU M;  3SMS A;  3AFH A;  4FVM A;  2XFT A;  3FTE A;  1W5S A;  4LGM A;  3GLH A;  4FCV A;  3A42 A;  3AV0 A;  3KFU G;  3QYB A;  1HT1 E;  3RFW A;  4B7H A;  1E9S A;  2KEB A;  5FTK A;  3T15 A;  4X62 M;  3GPP A;  1SXJ B;  1TH3 A;  3L26 A;  3UMM A;  3VLF B;  3CF2 A;  2E5L M;  1YUB A;  2QPA A;  3SHF A;  2C98 A;  4MGY E;  1F4I A;  3UGJ A;  4JI1 M;  2FFJ A;  1JR3 D;  3Q8X A;  3HJQ A;  3WHK A;  1N36 M;  4LF6 M;  2F5N A;  4PT5 A;  3I4V A;  2DHY A;  2JNH A;  1ZQ9 A;  2XF3 A;  3TWL A;  1KYI A;  4WP2 A;  1IXS A;  4W5W A;  4P17 A;  1SG9 A;  2Z7J A;  3L28 A;  4B08 A;  2D7G A;  2FS1 A;  3K9O A;  2F5O A;  1EIJ A;  2LVA A;  3KOX E;  4S12 A;  2O01 F;  5FSW A;  2LBC A;  3TQS A;  1TH2 A;  3VDU A;  3U5Z A;  4TUW A;  4AQY M;  1E32 A;  2Y21 A;  3L29 A;  2DAG A;  2UUB M;  3SAU A;  2D7H A;  4CIS A;  1QDR A;  2Y0T A;  2CHV A;  3GRR A;  1VQ1 A;  1WJ7 A;  4ZPX A;  5IT9 S;  2C96 A;  1OFI A;  2RKO A;  4I5S A;  8CAT A;  1Z59 A;  2FH0 A;  4DR5 M;  2DHR A;  2R62 A;  4NRV A;  4LJ6 A;  5IWA M;  1ZMV A;  3PNV A;  2CHQ A;  2BWE A;  4KT0 F;  2GQF A;  3ZCB B;  4AKI A;  1IY1 A;  2VDB B;  4GIT A;  2XSZ D;  3VDP A;  2LH0 A;  2CWB A;  1HT2 E;  3EIE A;  2KZS A;  4X66 M;  4B7G A;  1PM5 A;  4G4O A;  4JI5 M;  2UXB M;  3CF0 A;  3SAW A;  4JV5 M;  3HHZ A;  2MJ5 B;  4II7 A;  2F5Q A;  4IBI A;  2R44 A;  1JR3 E;  2JUJ A;  1QAN A;  1G71 A;  4JI0 M;  3UK6 A;  1JR3 A;  3SMP A;  2CV0 A;  2JY5 A;  2EO2 A;  4NXM M;  4GHL A;  3VK8 A;  5DYI A;  3NBI A;  3T1Y M;  2KXE A;  3SC3 A;  2R0I A;  4G4Q A;  1OIP A;  2ZAN A;  3GRV A;  5A2Q S;  1T43 A;  5DFL A;  1NVM A;  1DGH B;  1VEK A;  3HHX A;  3U6S A;  2JA2 A;  1G8P A;  3PFI A;  1IBL M;  4JI6 M;  4IBD A;  1V92 A;  4R3D A;  2UU9 M;  2BJV A;  1L8Q A;  4GKJ M;  1TGU A;  1LTM A;  3T38 A;  3KDS E;  2L09 A;  3FRH A;  2CV1 A;  4DV4 M;  2QHO B;  3E4R A;  3SBJ A;  2LWX A;  1L2B A;  2HHH M;  1D0K A;  1Q3B A;  4CJ6 A;  1R4G A;  3KXE C;  4X64 M;  1PJQ A;  4IBE A;  1DO2 A;  1IN6 A;  3BOS A;  4LFA M;  3U61 B;  1DGG A;  2DWZ B;  1D0M A;  3DA1 A;  2J7N A;  3W0L B;  5KPZ A;  3TL4 X;  4PDG A;  3FUT A;  4I4L A;  2ZM6 M;  1YE9 A;  1Q39 A;  3DOA A;  2L7I A;  3CGW A;  3HX3 A;  3QAU A;  3M6A A;  3GLF E;  3C58 A;  3KSJ A;  1J09 A;  2JY6 B;  2KA6 B;  3C9P A;  4LFB M;  3B74 A;  4DUY M;  4XK8 F;  1NY5 A;  2DAI A;  1WHC A;  1CUK A;  1UM8 A;  2YNM D;  3MHV C;  1KFV A;  1Q02 A;  3U6C A;  4QOS A;  3HWS A;  2ERC A;  4OW0 A;  4RF0 A;  5ITQ A;  1N78 A;  2RGO A;  2K6B A;  2M5Z A;  2CV2 A;  3IEC A;  4M9Z A;  5IRE B;  4LJ7 A;  1XXH B;  2EA0 A;  3RGP A;  1D0L A;  3J7B A;  4GHA A;  1SXJ E;  4I8O A;  1L2D A;  4G6Z A;  1TF0 B;  2Z4R A;  1NV8 A;  4ITQ A;  1MN3 A;  3QYE A;  1QVR A;  5DYG A;  1R2Z A;  3J7A S;  4XGI A;  4LF7 M;  2O5R A;  1DGF A;  1NSF A;  3ZH9 B;  3FYC A;  1IN8 A;  4Z8X A;  2YQZ A;  4NXN M;  4DR1 M;  2OPF A;  4DR7 M;  4NOO B;  4BB9 A;  4GEW A;  2EUC A;  5LMN M;  3I4Y A;  1Z5B A;  2CFO A;  2DEN A;  2KZU A;  1HNX M;  4YHH M;  3WHL A;  4IBC A;  4B3M M;  2Z8Y M;  1QUS A;  3K2L A;  4GH9 A;  5GKN A;  3FTC A;  2D7E A;  4UN2 B;  4QNR A;  2VQF M;  1QQW A;  3FRI A;  3U6M A;  3B89 A;  3A45 A;  1T3T A;  4DV1 M;  1R7R A;  4M9S A;  1QAQ A;  1V33 A;  1PRB A;  4GRI A;  2C9C A;  2V1C A;  5ITX E;  5ITT A;  5EXT A;  3GPY A;  3F92 A;  2R65 A;  2DAE A;  2N35 A;  5ITX A;  3T6P A;  4AW4 A;  1HNW M;  1C1K A;  2ZTD A;  4DR3 M;  1NJF A;  2X8A A;  4MH0 E;  1XNR M;  2UXD M;  3U6Q A;  1QUT A;  1MX0 A;  1C7Y A;  1MJG M;  2MGW A;  1X37 A;  1Z5C A;  2C9O A;  4R7G A;  4DUZ M;  5ITY A;  3U6D A;  4LF9 M;  2X4A A;  2DI0 A;  4HL4 A;  1L2C A;  4IJF A;  3AKZ A;  2FOI C;  3HU2 A;  4NC6 A;  5ITR A;  3DFZ A;  4L15 A;  3GLG B;  4LG2 A;  2LVO C;  3J27 B;  4QHS A;  3JAM S;  1K3X A;  3D8B A;  4IBK A;  2QBY A;  3SAR A;  1NV9 A;  2CEA A;  3PVS A;  2G8L A;  3PXG A;  2DAK A;  3FTF A;  3K92 A;  1N34 M;  2AHM A;  3JR5 A;  3CF6 E;  1GKI A;  3GLH B;  3IG8 A;  3KW6 A;  5KPR A;  3DZD A;  2DVW B;  3HZJ A;  1UFZ A;  4LF4 M;  1OAO C;  4LGY A;  1LV7 A;  5C1B A;  3W67 A;  5KQ8 A;  4MGZ E;  4OVZ A;  3KOY E;  1OAI A;  4M0W A;  3FE3 A;  1WR1 B;  2W82 A;  2H1R A;  3HJ8 A;  3UJN A;  1PJT A;  4CIZ A;  2R4J A;  1NNJ A;  3IHP A;  2ZBK B;  1HQC A;  2I7P A;  2KNV A;  4HLQ A;  3K1J A;  2LHC A;  2VQE M;  1QDT A;  2NQ8 C;  2DAM A;  1P3Q Q;  4B3T M;  3GQ3 A;  4M0D A;  4DV3 M;  2L4F A;  2JZ0 A;  4FWD A;  5EJC A;  2MH8 A;  1XMQ M;  4PDI A;  2F5S A;  3BXW A;  2R4E A;  3KS8 A;  1G41 A;  3MMP A;  4QNM A;  2Q2E B;  4OU7 A;  1A5T A;  2HCB A;  2DKL A;  4MB7 A;  1L1Z A;  2P5T A;  2CE7 A;  1VEJ A;  4AG5 A;  1W5T A;  4IBG A;  2L4E A;  3KSX A;  1IM2 A;  1SXJ D;  3U5Z B;  4QOZ C;  1N33 M;  1BVS A;  3SAV A;  1RU3 A;  3AOE A;  3LQQ A;  4LFC M;  1GLN A;  1XWI A;  2BWB A;  1IY0 A;  4JI4 M;  4CGY B;  3E21 A;  4WW0 A;  4IBB A;  1IBM M;  4B3R M;  3VFD A;  2XZU A;  5JI3 E;  2DZN B;  1I4W A;  3HHW A;  3I01 M;  3THG A;  4G3O A;  4KO8 A;  3V76 A;  3AL0 C;  1FNN A;  4IBJ A;  2KDL A;  2FE8 A;  2XZF A;  2OQ4 A;  2GNO A;  1NY6 A;  4GIP A;  1TR8 A;  2KHH A;  1WGL A;  3PNY A;  3SFZ A;  4M9X A;  1R5L A;  2WSF F;  3L2A A;  3VKG A;  4K0K M;  4MGH A;  2UUC M;  1IN5 A;  1D2N A;  1XXH E;  3W68 A;  3FUV A;  5L8R F;  1GJS A;  3BBZ A;  1XXH A;  3M7G A;  2K9D A;  3ILK A;  1XNQ M;  1VG5 A;  1WIV A;  1TDH A; 
#chains in the Genus database with same CATH homology
 1EE8 A;  2C99 A;  2L7H A;  4RF1 A;  4PD2 A;  3CTW B;  2M60 A;  3GLF A;  5FTM A;  5EXP A;  3L27 A;  7CAT A;  3U6P A;  1DGB A;  4LJ9 A;  3TWK A;  3RGS A;  1G3I A;  3TE6 A;  4X65 M;  2Z3X A;  1IN4 A;  3NWL A;  5F3W A;  3FYD A;  5FTL A;  1XC8 A;  4DV5 M;  4L4U A;  1ORY B;  4KLN A;  3U6L A;  4DR4 M;  4KHP M;  3U6E A;  3FUU A;  4L16 A;  4AG6 A;  1SXJ A;  1J5E M;  4LCB A;  1N75 A;  4L78 A;  5BR8 M;  1R6B X;  5EXS A;  1HNZ M;  5H37 D;  2QZ4 A;  4B3S M;  2QEN A;  4LF5 M;  4CHT B;  2YR0 A;  1XMO M;  4IBF A;  1TH4 A;  4WUR A;  1VDD A;  4B7F A;  2HKJ A;  2KRU A;  1KSF X;  1HQY E;  2UXC M;  4AI6 A;  1JQJ C;  2CHG A;  2QCU A;  2R46 A;  5IZ7 D;  3GPU A;  3HU1 A;  4L8R C;  4NL4 H;  1Z6T A;  4DR2 M;  1Q3C A;  1H6U A;  4LJ8 A;  1MU5 A;  2R18 A;  4IIW A;  5EP3 A;  4Z6Y A;  3U60 B;  1YSY A;  4OX9 M;  1IXZ A;  2V6Z M;  2Y0Q A;  1NHG C;  3FTD A;  4LJA A;  4JI8 M;  4QHT A;  3KVW A;  2XFS A;  3J81 S;  5DNY A;  3M0E A;  4LJ5 A;  3GLI B;  1N32 M;  1IQP A;  2K47 A;  4NRW A;  4LJ4 A;  1K82 A;  1OFH A;  2KW0 A;  2X49 A;  1IBK M;  2DXI A;  2QP9 X;  5EP1 A;  2F5P A;  4GMQ A;  1I94 M;  3LVW A;  4FCT A;  2BJW A;  4JI2 M;  4RNA A;  3QWL A;  5E6J A;  3HHY A;  2XLJ A;  4FWH A;  3GQ4 A;  3FD9 A;  2VII A;  5EP4 A;  1L1T A;  4A3V B;  1IN7 A;  2BNK A;  3AOE C;  1IXR C;  3FKE A;  2DZO B;  4LZJ A;  3L25 A;  1S3S A;  2HL7 A;  3GRU A;  3TWM A;  3LQR A;  5FLX S;  4GC5 A;  3AJI B;  2ZAO A;  1GL7 A;  1DGH A;  4MGI E;  2F4V M;  1NHW C;  1Z5A A;  3E9S A;  3J80 S;  4YY3 M;  2R45 A;  2RGH A;  4MGK E;  3A98 B;  1FJG M;  5KQD A;  1DO0 A;  3K8Z A;  3UZU A;  2XEP A;  1ZAE A;  3KP0 E;  5FTN A;  1IXS B;  2XH9 A;  3HU3 A;  4KOD A;  4G4R A;  3OTO M;  1QAM A;  2V1U A;  3R8F A;  3IG5 A;  5BPV A;  3SYL A;  2J7O A;  2ZAM A;  4EIW A;  1N77 A;  1PJI A;  3KOZ E;  3GRY A;  4I81 A;  4DV6 M;  3KOW E;  2YFQ A;  3HGI A;  3U61 A;  5E26 A;  2QBY B;  1NJG A;  4FW9 A;  3GO8 A;  4JI7 M;  1G59 A;  4BLC A;  5C18 A;  1K3W A;  2DWN A;  2KRK A;  3VKH A;  2G5G X;  2DWM A;  3W0F A;  3JR4 A;  4JN6 A;  3T1H M;  5JI2 E;  1SXJ C;  4G4N A;  4OVZ B;  4GKK M;  3SHG B;  3H4M A;  2FNA A;  1NNU C;  2LXE A;  4FCW A;  2A5Y B;  5EP2 A;  2DWL A;  4JYA M;  4DV0 M;  2UUA M;  3SAS A;  3D8L A;  1GVN A;  5EQT A;  4AZF A;  3R9X B;  4PCZ A;  4AKH A;  1TDZ A;  1HR0 M;  1IY2 A;  1PJJ A;  4LRT A;  3TPZ A;  1XHB A;  1WXQ A;  3LVV A;  4D80 A;  3B9P A;  4DV2 M;  2C5R A;  3FUX A;  4FD2 A;  1J7K A;  4LRS A;  4REZ A;  1QAO A;  3MJ5 A;  2Z4S A;  3GP1 A;  3U6O A;  1E9R A;  2L6O A;  3KP1 E;  4LF8 M;  3HJS A;  3SAT A;  3FUW A;  4AKG A;  3GQ5 A;  1E94 E;  2XSZ A;  2LNH C;  5KO3 A;  2I7N A;  5ITU A;  4IJE A;  3ZC7 B;  2Y20 A;  3U60 A;  3A46 A;  3J2P B;  4XBO A;  1QZM A;  1GL6 A;  4NSR A;  4JXJ A;  5FTJ A;  3SYK A;  5KPT A;  4GC9 A;  3RE8 A;  3EIH A;  3GLI A;  2CUZ A;  1G4A E;  3GPX A;  3AOG A;  3VK7 A;  4FWG A;  1QYR A;  3MK6 A;  4LY6 A;  4DV7 M;  1R2Y A;  3HKP A;  4NSO B;  4DR6 M;  5EXX A;  3KS4 A;  4BBA A;  4P16 A;  4D81 A;  4MM3 B;  3GLF B;  4D82 A;  2XGN A;  4JI3 M;  3GLG A;  3LMM A;  4LZZ A;  1OJL A;  5LMU M;  3SMS A;  3AFH A;  4FVM A;  2XFT A;  3FTE A;  1W5S A;  4LGM A;  3GLH A;  4FCV A;  3A42 A;  3AV0 A;  3KFU G;  1HT1 E;  3RFW A;  4B7H A;  1E9S A;  2KEB A;  5FTK A;  3T15 A;  4X62 M;  3GPP A;  1SXJ B;  1TH3 A;  3L26 A;  3UMM A;  3VLF B;  1TDH A;  2E5L M;  1YUB A;  2QPA A;  3SHF A;  2C98 A;  4MGY E;  3UGJ A;  4JI1 M;  2FFJ A;  1JR3 D;  3Q8X A;  3HJQ A;  3WHK A;  1N36 M;  4LF6 M;  2F5N A;  4PT5 A;  3I4V A;  1ZQ9 A;  2XF3 A;  3TWL A;  1KYI A;  4W5W A;  2Z7J A;  3L28 A;  4B08 A;  2D7G A;  2F5O A;  3KOX E;  4S12 A;  5FSW A;  3TQS A;  1TH2 A;  3VDU A;  3U5Z A;  4TUW A;  4AQY M;  1E32 A;  2Y21 A;  3L29 A;  2UUB M;  3SAU A;  2D7H A;  4CIS A;  2Y0T A;  2CHV A;  3GRR A;  4ZPX A;  5IT9 S;  2C96 A;  1OFI A;  2RKO A;  4I5S A;  8CAT A;  1Z59 A;  4DR5 M;  2DHR A;  2R62 A;  4NRV A;  4LJ6 A;  5IWA M;  3PNV A;  2CHQ A;  4AKI A;  3ZCB B;  1IY1 A;  3VDP A;  4GIT A;  2XSZ D;  2LH0 A;  1HT2 E;  3EIE A;  2KZS A;  4X66 M;  4B7G A;  1PM5 A;  4G4O A;  4JI5 M;  2UXB M;  3CF0 A;  3SAW A;  4JV5 M;  3HHZ A;  4II7 A;  2F5Q A;  4IBI A;  1QAN A;  4JI0 M;  3UK6 A;  1JR3 A;  3SMP A;  2CV0 A;  4NXM M;  2EO2 A;  4GHL A;  3VK8 A;  5DYI A;  3NBI A;  3T1Y M;  2KXE A;  3SC3 A;  4G4Q A;  2ZAN A;  3GRV A;  5A2Q S;  1NVM A;  1DGH B;  3HHX A;  3U6S A;  2JA2 A;  1G8P A;  3PFI A;  1IBL M;  4JI6 M;  4IBD A;  4R3D A;  2UU9 M;  2BJV A;  1L8Q A;  4GKJ M;  1TGU A;  3T38 A;  3KDS E;  2L09 A;  2CV1 A;  4DV4 M;  3E4R A;  3SBJ A;  2LWX A;  1L2B A;  2HHH M;  1Q3B A;  3KXE C;  4X64 M;  4IBE A;  1DO2 A;  1IN6 A;  3BOS A;  4LFA M;  3U61 B;  1DGG A;  2DWZ B;  3DA1 A;  2J7N A;  3W0L B;  5KPZ A;  3TL4 X;  4PDG A;  3FUT A;  4I4L A;  2ZM6 M;  1YE9 A;  1Q39 A;  3DOA A;  2L7I A;  3QAU A;  3C58 A;  3M6A A;  3KSJ A;  1J09 A;  2KA6 B;  4LFB M;  4DUY M;  1NY5 A;  2YNM D;  1UM8 A;  3MHV C;  1KFV A;  3U6C A;  4QOS A;  3HWS A;  2ERC A;  4OW0 A;  4RF0 A;  5ITQ A;  1N78 A;  2RGO A;  2M5Z A;  2CV2 A;  4M9Z A;  5IRE B;  4LJ7 A;  1XXH B;  2EA0 A;  3RGP A;  3J7B A;  4GHA A;  1SXJ E;  4I8O A;  1L2D A;  4G6Z A;  2Z4R A;  4ITQ A;  5DYG A;  3J7A S;  1QVR A;  1R2Z A;  4XGI A;  4LF7 M;  2O5R A;  1DGF A;  1NSF A;  3ZH9 B;  3FYC A;  1IN8 A;  4Z8X A;  2YQZ A;  4NXN M;  4DR1 M;  2OPF A;  4DR7 M;  4NOO B;  4BB9 A;  5LMN M;  2EUC A;  3I4Y A;  1Z5B A;  2CFO A;  2KZU A;  1HNX M;  4YHH M;  3WHL A;  4IBC A;  4B3M M;  3K2L A;  4GH9 A;  5GKN A;  3FTC A;  2D7E A;  4QNR A;  2VQF M;  1QQW A;  3U6M A;  3A45 A;  1T3T A;  4DV1 M;  1R7R A;  4M9S A;  1QAQ A;  4GRI A;  2C9C A;  2V1C A;  5ITX E;  5ITT A;  5EXT A;  3GPY A;  2R65 A;  5ITX A;  4AW4 A;  1HNW M;  1C1K A;  4DR3 M;  1NJF A;  2X8A A;  4MH0 E;  1XNR M;  2UXD M;  3U6Q A;  1MX0 A;  1X37 A;  1Z5C A;  2C9O A;  4R7G A;  4DUZ M;  5ITY A;  3U6D A;  4LF9 M;  2X4A A;  4HL4 A;  1L2C A;  4IJF A;  3AKZ A;  2FOI C;  3HU2 A;  5ITR A;  3DFZ A;  4L15 A;  3GLG B;  4LG2 A;  3J27 B;  3JAM S;  4QHS A;  1K3X A;  2QBY A;  3D8B A;  4IBK A;  3SAR A;  2CEA A;  3PVS A;  2G8L A;  3PXG A;  3FTF A;  3K92 A;  1N34 M;  2AHM A;  3JR5 A;  3CF6 E;  1GKI A;  3GLH B;  3IG8 A;  3KW6 A;  5KPR A;  3DZD A;  2DVW B;  4LF4 M;  4LGY A;  1LV7 A;  5C1B A;  5KQ8 A;  4MGZ E;  4OVZ A;  3KOY E;  4M0W A;  2W82 A;  2H1R A;  3HJ8 A;  3UJN A;  2R4J A;  1NNJ A;  2ZBK B;  1HQC A;  2I7P A;  4HLQ A;  3K1J A;  2VQE M;  2NQ8 C;  4B3T M;  3GQ3 A;  4M0D A;  4DV3 M;  4FWD A;  5EJC A;  1XMQ M;  4PDI A;  2F5S A;  2R4E A;  3KS8 A;  1G41 A;  4QNM A;  2Q2E B;  4OU7 A;  2HCB A;  1L1Z A;  4MB7 A;  2P5T A;  2CE7 A;  4AG5 A;  1W5T A;  4IBG A;  3KSX A;  1IM2 A;  1SXJ D;  3U5Z B;  4QOZ C;  1N33 M;  3SAV A;  3AOE A;  3LQQ A;  4LFC M;  1GLN A;  1XWI A;  1IY0 A;  4JI4 M;  4CGY B;  4WW0 A;  4IBB A;  1IBM M;  4B3R M;  3VFD A;  2XZU A;  5JI3 E;  2DZN B;  1I4W A;  3HHW A;  3THG A;  4KO8 A;  3AL0 C;  1FNN A;  4IBJ A;  2XZF A;  2FE8 A;  2OQ4 A;  1NY6 A;  4GIP A;  3PNY A;  3SFZ A;  4M9X A;  3L2A A;  3VKG A;  4K0K M;  4MGH A;  2UUC M;  1IN5 A;  1D2N A;  3FUV A;  1XXH A;  3M7G A;  1XNQ M;  3ILK A;  3I51 A;  3CF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...