4GMQA

Ribosome-binding domain of zuo1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
NAVKKNKRVLRGSVKEANYFVEGEASAATIDAVLNDVDLVITKIDADEIAALAGKLNGLTVADEIKNVWKEEVSRLVGAGKLKEGDIKALVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of a eukaryotic chaperone-the ribosome-associated complex.
pubmed doi rcsb
source organism Chaetomium thermophilum var. thermophilum dsm 1495
molecule tags Ribosome-binding protein
molecule keywords Putative ribosome associated protein
total genus 36
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.840 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gmqA00
4GMQA 2LWXA
chains in the Genus database with same CATH superfamily
1D0LA 3FUUA 3UJNA 5JI2E 5A2QS 3Q8GA 4NL4H 4FWGA 3V76A 4DV0M 2QBYB 2F5OA 2DHYA 3U6PA 3J2PB 2FE8A 3RGSA 3L28A 1DGGA 1Z59A 4CGYB 1Q39A 3AFHA 4L78A 1IBKM 1IBMM 1IN5A 2DWLA 4LFAM 4NRWA 2YQZA 2Z3XA 3I01M 4QNRA 4MM3B 3FUTA 4LGYA 4NC6A 3TWLA 2L2DA 3NWLA 2O5RA 4B3RM 4GKKM 1C1KA 2DVWB 1ZMVA 1TDHA 1IFYA 5EP3A 2KW0A 2L4FA 3I4YA 4DV4M 3KSXA 3GQ3A 1SXJC 1YUBA 4LRSA 2H1RA 1KSFX 2UXCM 3AOGA 4AG5A 3VFDA 3DA1A 2ZTCA 2APLA 3DFZA 2DWZB 4CHTB 1ZQ9A 2EKKA 2VF7A 3C3EA 5ITTA 4DR5M 1TDZA 1VEKA 2CV0A 2YR0A 1OIZA 4DR3M 4RF1A 1HT2E 3L27A 1VG5A 1V33A 4WP2A 3EIHA 5IREB 2LWXA 3KOWE 2DXIA 1IY2A 4FVMA 1AUAA 1W5TA 3HZJA 4I5SA 1G59A 2BWEA 4RKUF 3UGJA 2Q2EB 4OX9M 1NJFA 3DZDA 4LF4M 1CUKA 1NNUC 1Q3BA 2OO9A 3KOZE 3VKHA 4GRIA 2MJ5B 3B7QA 2ZAMA 3B7ZA 5FLXS 4LFCM 3QWLA 3B7NA 1XNRM 4REZA 4AQYM 5EP2A 1NSFA 1XMOM 1L8QA 4GC9A 1QAQA 3LVWA 2UU9M 4I81A 2LNHC 1R2ZA 2K0BX 2FOIC 5KQDA 3LMMA 4M0DA 3FKEA 1J09A 4JI4M 3NBXX 2XZUA 3FYCA 5E6JA 4D80A 3SC3A 1QANA 2OPFA 4F2LA 2C96A 3FYDA 3U6MA 4FCVA 3TL4X 1MU5A 2JY8A 1TR8A 3KVWA 3A45A 4BB9A 4OU7A 4Z8XA 1NNJA 3H4MA 1WHCA 2L7HA 4G4QA 4MGZE 4FCTA 4PD2A 1R6BX 2KEBA 2X4AA 3C9PA 4G4RA 2KDLA 3K2LA 4ITQA 4RNAA 2X8AA 3IHPA 3CGWA 1IXZA 2V1CA 3SAWA 1WGLA 3T1HM 4DR7M 1PJSA 1P3QQ 2CEAA 5BPVA 4BLCA 4M9XA 3L26A 2JP7A 5EXTA 2AHMA 2EJSA 2FH0A 3HHYA 3VLFB 4BBAA 3KDSE 3U6CA 4II7A 4PCZA 1OIPA 1VEJA 2YFQA 1OFHA 4X66M 3AJIB 3GLFA 3GRVA 1OJLA 2BNKA 1AIPC 4ZPXA 5EXXA 3GLIA 3J7AS 5ITXE 4GIPA 4LF7M 1OQYA 3FRIA 4S12A 2XLJA 4AW4A 1L2DA 4LF9M 1PJJA 4WURA 3SHFA 1R7RA 2EO2A 4PDGA 4R71A 4DV7M 5JI3E 4DR6M 1R4GA 2DZLA 1QDTA 2JUJA 2DWMA 1VQ1A 2UXDM 5FTKA 2A5YB 5GKNA 4CISA 3GPUA 4NOOB 2HCBA 2B3TA 1DGHA 3MK6A 4LJ7A 2JXNA 1K82A 2LTUA 3GRYA 3HHXA 1IY1A 1D0KA 3GRUA 3LVVA 4HL4A 2Z4SA 4B7GA 1XXHE 2QNJA 1TH2A 3C3DA 3ZH9B 1N77A 3E21A 1QZMA 5EXPA 5KO3A 1T3TA 2FFJA 4JI0M 2K47A 3QAUA 5F3WA 3GRRA 3D8LA 3U6EA 2NQ8C 1G8PA 4JXJA 1DGHB 2R45A 3SYKA 2UUAM 2R65A 4I8OA 5ITQA 4DUYM 1DO0A 1XXHB 2L4EA 1OFIA 3TWMA 4LJ9A 2HAKA 1IM2A 5EQTA 2D7GA 3LCVB 3U60B 4DV1M 4IIWA 4DBGB 4P17A 1NO1A 1E94E 2K6BA 2XGNA 3VDUA 4LF6M 1TGUA 4QOZC 1ZAEA 3F92A 4DV2M 4DR1M 3T38A 2XH9A 3JAMS 2QQ8A 3K92A 1NY5A 3A42A 3OTOM 4DR2M 2XZFA 2WZJA 4AZFA 2VIIA 4R3DA 3SAVA 1PM5A 3AOEA 4DV3M 1WR1B 4I4LA 3FTDA 3SMSA 3GQ4A 2OQ4A 3J80S 4GEWA 4G4OA 5EP4A 3B89A 2M5ZA 1IXRC 1N36M 2C99A 4GH9A 1V34A 4LJAA 4LRTA 2G5GX 2RKOA 3U61B 2VDBB 1KFVA 4JYAM 1GJTA 4X64M 2L6OA 4IJEA 3SMPA 1XNQM 1RU3A 3T6PA 3DOAA 2F5PA 3IECA 4XGIA 3NBIA 2ZBKB 4NSOB 3I51A 4QHSA 3JR4A 4JI3M 1G3IA 1VDLA 1QAOA 1QDRA 2GQFA 4DUZM 2D7HA 5ITRA 4QNMA 4G6ZA 5IZ7D 2X49A 5KQ8A 2RGOA 1PJTA 5EJCA 1FJGM 3U61A 1K3WA 3FTEA 1J5EM 2O01F 4FWHA 2UUBM 5KPZA 3FE3A 2CFOA 2LVPC 1TF0B 2KRKA 3KP1E 4MH0E 1I94M 1ZMWA 2GNOA 4CJ6A 3R9XB 2QHOB 2HL7A 4RF0A 2G8LA 1W5SA 1WGNA 3U6OA 3FUWA 3MHVC 4ANRA 1R2YA 1N34M 3GPYA 5FTMA 2LVOC 4L4UA 2LXEA 3SATA 3BOSA 2R6FA 4Y28F 4LF5M 2CV2A 2DNAA 2UXBM 3CF0A 4F1IA 3KW6A 4FCWA 4IBCA 4M9SA 4JI1M 3PXGA 1SXJD 2RRUA 1L1TA 1PRBA 1JR3A 1GKIA 1NY6A 2V6ZM 1R5LA 4IBBA 4QHTA 2HHHM 4M0WA 4LGMA 1HQYE 2JZ0A 3HJ8A 4QOSA 2R46A 4B7FA 4LCBA 3VKGA 4MGIE 3TE6A 3AKZA 1ORYB 2CHQA 2L7IA 1I4WA 3IG5A 3C58A 4G4NA 4W5WA 2DAKA 1DGFA 2ERCA 2QP9X 2XFSA 3J7BA 4IBGA 1SXJE 1IY0A 1Z6TA 4IJFA 3HHWA 1Q02A 1NHGC 2WSFF 4PDIA 1TH3A 1Z5CA 4JI2M 3KP0E 2JY7A 2LBCA 4MGHA 3LCUA 2KRUA 3U6LA 1XC8A 4FWDA 1HQCA 2C9OA 3B9PA 1D2NA 2CE7A 4L15A 3LQQA 2KA6B 1N75A 3UK6A 2EUCA 1IN7A 2CUZA 5EXSA 1JB0F 4A3VB 2JWSA 2DI0A 5DYIA 4JN6A 1HR0M 3UZUA 4X62M 4OW0A 4GHLA 3AOEC 1NV9A 5KPTA 2QSFX 3U5ZA 2L09A 4IBKA 1UFZA 4AG6A 5L8RF 1OKSA 1SXJB 4PT5A 3R8FA 1GO5A 4GMQA 4Q7JA 2DZNB 5LMNM 5LMUM 1NHWC 2QBYA 1J7KA 4D81A 2FNAA 2R18A 4B7HA 1IN8A 2Z4RA 3L29A 1HNXM 1PJQA 2XF3A 1EIJA 1Z5BA 1QZEA 1ZV1A 2C9CA 2MR9A 1Y8GA 1XB2B 3E9SA 3SBJA 3SYLA 3FUXA 1JQJC 1MJGM 3IG8A 3HU2A 3EIEA 4OVZA 3CTWB 5FTJA 1Z5AA 2WSCF 4LZJA 3GLFE 2F5QA 4WW0A 1T6OA 3ZC7B 5ITUA 3GLGB 1BVSA 2QCUA 4AKHA 3BXWA 5ITXA 3SAUA 1E32A 3GPPA 4YHHM 3AL0C 2I7PA 1IN6A 1UM8A 1V92A 3VK7A 1MN3A 3QYEA 4NSRA 3HHZA 1YLAA 3MJ5A 3GLGE 2ZAOA 5DFLA 3ZQJA 1OTRA 4Z6YA 2CHVA 2Y20A 4KT0F 4L8RC 1L2CA 2J7NA 1XXHA 4GITA 2BWBA 4B08A 4GC5A 4HEOA 4B3MM 4IBDA 3ZCBB 3GO8A 3HY5A 2W82A 3ILKA 4OVZB 3HJQA 2JA2A 3E46A 2HWJA 2LVQD 2LH0A 2WSEF 3WHKA 3BBZA 3KSJA 5DNYA 1TH4A 3HGIA 2EA0A 3KXEC 4IBFA 4NXMM 1F4IA 5DYGA 2OOAA 1XHBA 4M9ZA 2KZUA 1YE9A 3MMPA 2LHCA 1GLNA 1YSYA 2VF8A 1E9SA 3I04M 2JZ1A 4G3OA 3HU3A 5E26A 2ZTDA 2CV1A 1HNWM 1HJPA 3PFIA 2J7OA 1D0MA 3UMMA 2HKJA 2KNAA 4XK8F 3I4VA 2DAMA 4B3TM 4FW9A 2RGHA 2Z8YM 1ZMUA 4LJ5A 2E5LM 4XBOA 4JI7M 3LW5F 2KXEA 2QENA 1N78A 4AI6A 3L2AA 3A46A 4B3SM 4KHPM 5BR8M 3QYBA 1WIVA 4LZZA 3CF2A 3PVSA 3FD9A 3L25A 1GVNA 2QPAA 2P5TA 1IQPA 3AV0A 3U6QA 4TUWA 1H6UA 1NV8A 3HU1A 3J27B 3M7GA 4L6V6 3U60A 2KZSA 4JI5M 4DR4M 1N32M 1S3SA 2LVNC 4IBJA 1X37A 3LQRA 5FSWA 4AKGA 1IBLM 1QUSA 3U6SA 2C98A 4X65M 4IBIA 4GKJM 3T15A 1QQWA 2ZANA 3FUVA 4LF8M 1IXSA 2O25A 3HKPA 4LY6A 2D7EA 2EKFA 7CATA 2LVAA 8CATA 1L2BA 4KO8A 3E4RA 2Y21A 1QYRA 2CHGA 3GLFB 2XFTA 3GP1A 1WXQA 1MX0A 4EIWA 4JI6M 5FTNA 2VQFM 3HWSA 3B74A 2M60A 3VDPA 1N33M 2F5NA 2CWBA 2VQEM 1T43A 2F5SA 3K9PA 3GLHA 4YY3M 2I7NA 1GJSA 1PGYA 2CRUA 2Z7JA 1LTMA 4MB7A 1DV0A 1JR3D 2JY6B 3KFUG 1K3XA 1IXSB 4D82A 3D8BA 3VK8A 3HX3A 3SASA 5C18A 3H4JA 1XMQM 4NXNM 4K0KM 3RFWA 1DO2A 3K9OA 2H5XA 3PNVA 4LJ8A 1QAMA 2XSZD 2G3QA 2MH8A 3RGPA 3THGA 1IN4A 2R4EA 1WJ7A 2ZM6M 3GLIE 2KNVA 2R0IA 3SHGB 1NJGA 4CIZA 3GLHB 4LJ4A 1JR3E 4DV5M 5FTLA 2DAIA 2Y0TA 1EE8A 3FRHA 4NRVA 1OAIA 2KNZA 4KLNA 3W67A 2DKLA 2K9DA 1NVMA 4KODA 1TTEA 1VEGA 2CP8A 3GLHE 3KOXE 3HJSA 1SG9A 2N35A 3Q8XA 5IWAM 2BJWA 3GLIB 1G41A 3PNYA 4R7GA 2KHHA 4MGKE 3KOYE 3M6AA 5C1BA 3U5ZB 1C7YA 1QUTA 2DWNA 2XSZA 2UUCM 2DHRA 2FS1A 3K8ZA 1SXJA 2BJVA 2V1UA 1LV7A 4L16A 3FTCA 4HLQA 1QVRA 2DENA 2J5YA 3W0LB 3WHLA 1GABA 1DGBA 5IT9S 3TWKA 1G4AE 4FD2A 1GL7A 2XEPA 1HNZM 3KS8A 5ITYA 3TQSA 3U6DA 4GHAA 2YNMD 2MGWA 1EFUB 4IBEA 2JNHA 4LG2A 1OAOC 4JV5M 1A5TA 3CF6E 2JY5A 3SARA 3GLGA 2DAGA 2QZ4A 3GPXA 3KS4A 2LHGA 1E9RA 2R4JA 3W68A 1PJIA 1G71A 2Y0QA 3A98B 1XWIA 2F4VM 4DV6M 1Q3CA 3RE8A 1KYIA 1L1ZA 2DZOB 3JR5A 2DAEA 3GQ5A 1FNNA 4AKIA 1HT1E 3M0EA 5EP1A 4P16A 3W0FA 3J81S 2C5RA 4JI8M 2R62A 3FTFA 2MROB 3TPZA 4LJ6A 2OOBA 4MGYE 3T1YM 3K1JA 1GL6A 2R44A 4UN2B 3SFZA 1VDDA 4LFBM 5H37D 5KPRA
chains in the Genus database with same CATH topology
3FUUA 3UJNA 5JI2E 5A2QS 2QBYB 4NL4H 4FWGA 4DV0M 2F5OA 3U6PA 3J2PB 2FE8A 3RGSA 3L28A 1DGGA 1Z59A 4CGYB 1Q39A 3AFHA 4L78A 1IBKM 1IBMM 1IN5A 2DWLA 4LFAM 4NRWA 2YQZA 2Z3XA 4QNRA 4MM3B 3FUTA 4LGYA 3TWLA 3NWLA 2O5RA 4B3RM 4GKKM 1C1KA 2DVWB 1TDHA 5EP3A 2KW0A 3I4YA 4DV4M 3KSXA 3GQ3A 1SXJC 1YUBA 4LRSA 2H1RA 1KSFX 2UXCM 3AOGA 4AG5A 3VFDA 3DA1A 4CHTB 3DFZA 2DWZB 5ITTA 1ZQ9A 4DR5M 1TDZA 2CV0A 2YR0A 4DR3M 4RF1A 1HT2E 3L27A 3EIHA 5IREB 2LWXA 3KOWE 2DXIA 1IY2A 4FVMA 4I5SA 1W5TA 1G59A 3UGJA 4OX9M 2Q2EB 1NJFA 3DZDA 4LF4M 1NNUC 1Q3BA 3KOZE 3VKHA 4GRIA 2ZAMA 5FLXS 4LFCM 3QWLA 1XNRM 4REZA 4AQYM 5EP2A 1NSFA 1XMOM 1L8QA 4GC9A 1QAQA 3LVWA 2UU9M 4I81A 2LNHC 1R2ZA 2FOIC 5KQDA 3LMMA 4M0DA 3FKEA 1J09A 4JI4M 2XZUA 3FYCA 5E6JA 4D80A 3SC3A 1QANA 2OPFA 2C96A 3FYDA 3U6MA 4FCVA 3TL4X 1MU5A 3KVWA 3A45A 4BB9A 4OU7A 4Z8XA 1NNJA 3H4MA 2L7HA 4G4QA 4MGZE 4FCTA 4PD2A 1R6BX 2KEBA 2X4AA 4G4RA 3K2LA 4ITQA 4RNAA 2X8AA 1IXZA 2V1CA 3SAWA 3T1HM 4DR7M 2CEAA 5BPVA 3L26A 4BLCA 4M9XA 5EXTA 2AHMA 3VLFB 4BBAA 3HHYA 3KDSE 3U6CA 4II7A 4PCZA 2YFQA 1OFHA 4X66M 3AJIB 3GLFA 3GRVA 1OJLA 2BNKA 4ZPXA 5EXXA 3GLIA 3J7AS 5ITXE 4GIPA 4LF7M 4S12A 2XLJA 4AW4A 1L2DA 4LF9M 1PJJA 4WURA 3SHFA 1R7RA 2EO2A 4PDGA 4DV7M 5JI3E 4DR6M 2DWMA 2UXDM 5FTKA 2A5YB 5GKNA 4CISA 3GPUA 4NOOB 2HCBA 3MK6A 1DGHA 4LJ7A 1K82A 3GRYA 3HHXA 1IY1A 3LVVA 3GRUA 4HL4A 2Z4SA 4B7GA 1TH2A 3ZH9B 1N77A 1QZMA 5EXPA 5KO3A 1T3TA 2FFJA 4JI0M 2K47A 3QAUA 5F3WA 3GRRA 3D8LA 3U6EA 2NQ8C 1G8PA 4JXJA 1DGHB 2R45A 3SYKA 2UUAM 2R65A 4I8OA 5ITQA 4DUYM 1DO0A 1XXHB 1OFIA 3TWMA 4LJ9A 1IM2A 5EQTA 2D7GA 3U60B 4DV1M 4IIWA 1E94E 2XGNA 3VDUA 4LF6M 4QOZC 1TGUA 1ZAEA 4DV2M 4DR1M 3T38A 2XH9A 3JAMS 3K92A 1NY5A 3A42A 3OTOM 4DR2M 2XZFA 4AZFA 2VIIA 4R3DA 3SAVA 1PM5A 3AOEA 4DV3M 4I4LA 3FTDA 3SMSA 3GQ4A 2OQ4A 3J80S 4G4OA 5EP4A 2M5ZA 1IXRC 1N36M 2C99A 4GH9A 4LJAA 4LRTA 2G5GX 2RKOA 3U61B 1KFVA 4JYAM 4X64M 2L6OA 4IJEA 3SMPA 1XNQM 2F5PA 3DOAA 4XGIA 3NBIA 2ZBKB 4NSOB 3I51A 4QHSA 3JR4A 4JI3M 1G3IA 1QAOA 4DUZM 2D7HA 5ITRA 4QNMA 4G6ZA 5IZ7D 2X49A 5KQ8A 2RGOA 5EJCA 1FJGM 3U61A 1K3WA 3FTEA 1J5EM 4FWHA 2UUBM 5KPZA 2CFOA 2KRKA 3KP1E 4MH0E 1I94M 3R9XB 2HL7A 4RF0A 2G8LA 1W5SA 3U6OA 3FUWA 3MHVC 1R2YA 1N34M 3GPYA 5FTMA 4L4UA 2LXEA 3SATA 3BOSA 4LF5M 2CV2A 2UXBM 3CF0A 3KW6A 4FCWA 4IBCA 4M9SA 4JI1M 3PXGA 1SXJD 1L1TA 1JR3A 1GKIA 1NY6A 2V6ZM 4IBBA 4QHTA 2HHHM 4M0WA 4LGMA 1HQYE 3HJ8A 4QOSA 2R46A 4B7FA 4LCBA 3VKGA 4MGIE 3TE6A 3AKZA 1ORYB 2CHQA 2L7IA 1I4WA 3IG5A 3C58A 4G4NA 4W5WA 2QP9X 1DGFA 2ERCA 2XFSA 3J7BA 4IBGA 1SXJE 1IY0A 1Z6TA 4IJFA 3HHWA 1NHGC 4PDIA 1TH3A 1Z5CA 4JI2M 3KP0E 4MGHA 2KRUA 3U6LA 1XC8A 4FWDA 1HQCA 2C9OA 3B9PA 1D2NA 2CE7A 4L15A 3LQQA 2KA6B 1N75A 3UK6A 2EUCA 1IN7A 2CUZA 5EXSA 4A3VB 5DYIA 1HR0M 4JN6A 3UZUA 4X62M 4OW0A 4GHLA 3AOEC 5KPTA 3U5ZA 2L09A 4IBKA 4AG6A 1SXJB 4PT5A 3R8FA 4GMQA 2DZNB 5LMNM 5LMUM 1NHWC 2QBYA 1J7KA 4D81A 2FNAA 2R18A 4B7HA 1IN8A 2Z4RA 3L29A 1HNXM 2XF3A 1Z5BA 2C9CA 3E9SA 3SBJA 3SYLA 3FUXA 1JQJC 3IG8A 4OVZA 3HU2A 3EIEA 5FTJA 3CTWB 1Z5AA 4LZJA 2F5QA 4WW0A 3ZC7B 5ITUA 3GLGB 2QCUA 4AKHA 5ITXA 3SAUA 1E32A 3GPPA 4YHHM 3AL0C 2I7PA 1IN6A 1UM8A 3VK7A 4NSRA 3HHZA 3MJ5A 2ZAOA 4Z6YA 2CHVA 2Y20A 4L8RC 1L2CA 2J7NA 1XXHA 4GITA 4B08A 4B3MM 4GC5A 4IBDA 3ZCBB 3GO8A 2W82A 3ILKA 4OVZB 3HJQA 2JA2A 3WHKA 2LH0A 3KSJA 5DNYA 1TH4A 3HGIA 2EA0A 3KXEC 4IBFA 4NXMM 5DYGA 1XHBA 4M9ZA 2KZUA 1YE9A 1GLNA 1YSYA 1E9SA 3HU3A 5E26A 2CV1A 1HNWM 3PFIA 2J7OA 3UMMA 2HKJA 3I4VA 4B3TM 4FW9A 2RGHA 4LJ5A 2E5LM 4XBOA 4JI7M 2KXEA 2QENA 1N78A 4AI6A 3L2AA 3A46A 4B3SM 4KHPM 5BR8M 4LZZA 3CF2A 3PVSA 3FD9A 3L25A 1GVNA 2QPAA 2P5TA 1IQPA 3AV0A 3U6QA 4TUWA 1H6UA 3HU1A 3U60A 3J27B 3M7GA 4JI5M 2KZSA 4DR4M 1N32M 1S3SA 4IBJA 1X37A 3LQRA 5FSWA 4AKGA 1IBLM 3U6SA 2C98A 4X65M 4IBIA 4GKJM 3T15A 1QQWA 2ZANA 3FUVA 4LF8M 3HKPA 4LY6A 2D7EA 7CATA 8CATA 1L2BA 4KO8A 3E4RA 2Y21A 1QYRA 2CHGA 3GLFB 2XFTA 3GP1A 1WXQA 1MX0A 4EIWA 4JI6M 5FTNA 2VQFM 3HWSA 3VDPA 2M60A 1N33M 2F5NA 2VQEM 2F5SA 3GLHA 4YY3M 2I7NA 2Z7JA 4MB7A 1JR3D 3KFUG 1K3XA 1IXSB 4D82A 3D8BA 3VK8A 3SASA 5C18A 1XMQM 4NXNM 4K0KM 3RFWA 1DO2A 3RGPA 3PNVA 4LJ8A 1QAMA 2XSZD 3THGA 1IN4A 2R4EA 2ZM6M 3SHGB 1NJGA 3GLHB 4LJ4A 4DV5M 5FTLA 2Y0TA 1EE8A 4NRVA 4KLNA 1NVMA 4KODA 3KOXE 3HJSA 3Q8XA 5IWAM 2BJWA 3GLIB 1G41A 3PNYA 4R7GA 4MGKE 3KOYE 3M6AA 5C1BA 3U5ZB 2DWNA 2XSZA 2UUCM 2DHRA 3K8ZA 1SXJA 2BJVA 2V1UA 1LV7A 4L16A 3FTCA 4HLQA 1QVRA 3W0LB 3WHLA 1DGBA 5IT9S 3TWKA 1G4AE 4FD2A 1GL7A 2XEPA 1HNZM 3KS8A 5ITYA 3TQSA 3U6DA 4GHAA 2YNMD 4IBEA 4LG2A 4JV5M 3CF6E 3SARA 3GLGA 2QZ4A 3GPXA 3KS4A 1E9RA 2R4JA 1PJIA 2Y0QA 3A98B 2F4VM 1XWIA 4DV6M 1Q3CA 3RE8A 1KYIA 1L1ZA 2DZOB 3JR5A 3GQ5A 1FNNA 4AKIA 1HT1E 3M0EA 5EP1A 4P16A 3W0FA 3J81S 2C5RA 4JI8M 2R62A 3FTFA 3TPZA 4LJ6A 4MGYE 3T1YM 3K1JA 1GL6A 3SFZA 1VDDA 4LFBM 5H37D 5KPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMQ A;  2LWX A; 
#chains in the Genus database with same CATH topology
 1D0L A;  3FUU A;  3UJN A;  5JI2 E;  5A2Q S;  3Q8G A;  4NL4 H;  4FWG A;  3V76 A;  4DV0 M;  2QBY B;  2F5O A;  2DHY A;  3U6P A;  3J2P B;  2FE8 A;  3RGS A;  3L28 A;  1DGG A;  1Z59 A;  4CGY B;  1Q39 A;  3AFH A;  4L78 A;  1IBK M;  1IBM M;  1IN5 A;  2DWL A;  4LFA M;  4NRW A;  2YQZ A;  2Z3X A;  3I01 M;  4QNR A;  4MM3 B;  3FUT A;  4LGY A;  4NC6 A;  3TWL A;  2L2D A;  3NWL A;  2O5R A;  4B3R M;  4GKK M;  1C1K A;  2DVW B;  1ZMV A;  1TDH A;  1IFY A;  5EP3 A;  2KW0 A;  2L4F A;  3I4Y A;  4DV4 M;  3KSX A;  3GQ3 A;  1SXJ C;  1YUB A;  4LRS A;  2H1R A;  1KSF X;  2UXC M;  3AOG A;  4AG5 A;  3VFD A;  3DA1 A;  2ZTC A;  2APL A;  3DFZ A;  2DWZ B;  4CHT B;  1ZQ9 A;  2EKK A;  2VF7 A;  3C3E A;  5ITT A;  4DR5 M;  1TDZ A;  1VEK A;  2CV0 A;  2YR0 A;  1OIZ A;  4DR3 M;  4RF1 A;  1HT2 E;  3L27 A;  1VG5 A;  1V33 A;  4WP2 A;  3EIH A;  5IRE B;  2LWX A;  3KOW E;  2DXI A;  1IY2 A;  4FVM A;  1AUA A;  1W5T A;  3HZJ A;  4I5S A;  1G59 A;  2BWE A;  4RKU F;  3UGJ A;  2Q2E B;  4OX9 M;  1NJF A;  3DZD A;  4LF4 M;  1CUK A;  1NNU C;  1Q3B A;  2OO9 A;  3KOZ E;  3VKH A;  4GRI A;  2MJ5 B;  3B7Q A;  2ZAM A;  3B7Z A;  5FLX S;  4LFC M;  3QWL A;  3B7N A;  1XNR M;  4REZ A;  4AQY M;  5EP2 A;  1NSF A;  1XMO M;  1L8Q A;  4GC9 A;  1QAQ A;  3LVW A;  2UU9 M;  4I81 A;  2LNH C;  1R2Z A;  2K0B X;  2FOI C;  5KQD A;  3LMM A;  4M0D A;  3FKE A;  1J09 A;  4JI4 M;  3NBX X;  2XZU A;  3FYC A;  5E6J A;  4D80 A;  3SC3 A;  1QAN A;  2OPF A;  4F2L A;  2C96 A;  3FYD A;  3U6M A;  4FCV A;  3TL4 X;  1MU5 A;  2JY8 A;  1TR8 A;  3KVW A;  3A45 A;  4BB9 A;  4OU7 A;  4Z8X A;  1NNJ A;  3H4M A;  1WHC A;  2L7H A;  4G4Q A;  4MGZ E;  4FCT A;  4PD2 A;  1R6B X;  2KEB A;  2X4A A;  3C9P A;  4G4R A;  2KDL A;  3K2L A;  4ITQ A;  4RNA A;  2X8A A;  3IHP A;  3CGW A;  1IXZ A;  2V1C A;  3SAW A;  1WGL A;  3T1H M;  4DR7 M;  1PJS A;  1P3Q Q;  2CEA A;  5BPV A;  4BLC A;  4M9X A;  3L26 A;  2JP7 A;  5EXT A;  2AHM A;  2EJS A;  2FH0 A;  3HHY A;  3VLF B;  4BBA A;  3KDS E;  3U6C A;  4II7 A;  4PCZ A;  1OIP A;  1VEJ A;  2YFQ A;  1OFH A;  4X66 M;  3AJI B;  3GLF A;  3GRV A;  1OJL A;  2BNK A;  1AIP C;  4ZPX A;  5EXX A;  3GLI A;  3J7A S;  5ITX E;  4GIP A;  4LF7 M;  1OQY A;  3FRI A;  4S12 A;  2XLJ A;  4AW4 A;  1L2D A;  4LF9 M;  1PJJ A;  4WUR A;  3SHF A;  1R7R A;  2EO2 A;  4PDG A;  4R71 A;  4DV7 M;  5JI3 E;  4DR6 M;  1R4G A;  2DZL A;  1QDT A;  2JUJ A;  2DWM A;  1VQ1 A;  2UXD M;  5FTK A;  2A5Y B;  5GKN A;  4CIS A;  3GPU A;  4NOO B;  2HCB A;  2B3T A;  1DGH A;  3MK6 A;  4LJ7 A;  2JXN A;  1K82 A;  2LTU A;  3GRY A;  3HHX A;  1IY1 A;  1D0K A;  3GRU A;  3LVV A;  4HL4 A;  2Z4S A;  4B7G A;  1XXH E;  2QNJ A;  1TH2 A;  3C3D A;  3ZH9 B;  1N77 A;  3E21 A;  1QZM A;  5EXP A;  5KO3 A;  1T3T A;  2FFJ A;  4JI0 M;  2K47 A;  3QAU A;  5F3W A;  3GRR A;  3D8L A;  3U6E A;  2NQ8 C;  1G8P A;  4JXJ A;  1DGH B;  2R45 A;  3SYK A;  2UUA M;  2R65 A;  4I8O A;  5ITQ A;  4DUY M;  1DO0 A;  1XXH B;  2L4E A;  1OFI A;  3TWM A;  4LJ9 A;  2HAK A;  1IM2 A;  5EQT A;  2D7G A;  3LCV B;  3U60 B;  4DV1 M;  4IIW A;  4DBG B;  4P17 A;  1NO1 A;  1E94 E;  2K6B A;  2XGN A;  3VDU A;  4LF6 M;  1TGU A;  4QOZ C;  1ZAE A;  3F92 A;  4DV2 M;  4DR1 M;  3T38 A;  2XH9 A;  3JAM S;  2QQ8 A;  3K92 A;  1NY5 A;  3A42 A;  3OTO M;  4DR2 M;  2XZF A;  2WZJ A;  4AZF A;  2VII A;  4R3D A;  3SAV A;  1PM5 A;  3AOE A;  4DV3 M;  1WR1 B;  4I4L A;  3FTD A;  3SMS A;  3GQ4 A;  2OQ4 A;  3J80 S;  4GEW A;  4G4O A;  5EP4 A;  3B89 A;  2M5Z A;  1IXR C;  1N36 M;  2C99 A;  4GH9 A;  1V34 A;  4LJA A;  4LRT A;  2G5G X;  2RKO A;  3U61 B;  2VDB B;  1KFV A;  4JYA M;  1GJT A;  4X64 M;  2L6O A;  4IJE A;  3SMP A;  1XNQ M;  1RU3 A;  3T6P A;  3DOA A;  2F5P A;  3IEC A;  4XGI A;  3NBI A;  2ZBK B;  4NSO B;  3I51 A;  4QHS A;  3JR4 A;  4JI3 M;  1G3I A;  1VDL A;  1QAO A;  1QDR A;  2GQF A;  4DUZ M;  2D7H A;  5ITR A;  4QNM A;  4G6Z A;  5IZ7 D;  2X49 A;  5KQ8 A;  2RGO A;  1PJT A;  5EJC A;  1FJG M;  3U61 A;  1K3W A;  3FTE A;  1J5E M;  2O01 F;  4FWH A;  2UUB M;  5KPZ A;  3FE3 A;  2CFO A;  2LVP C;  1TF0 B;  2KRK A;  3KP1 E;  4MH0 E;  1I94 M;  1ZMW A;  2GNO A;  4CJ6 A;  3R9X B;  2QHO B;  2HL7 A;  4RF0 A;  2G8L A;  1W5S A;  1WGN A;  3U6O A;  3FUW A;  3MHV C;  4ANR A;  1R2Y A;  1N34 M;  3GPY A;  5FTM A;  2LVO C;  4L4U A;  2LXE A;  3SAT A;  3BOS A;  2R6F A;  4Y28 F;  4LF5 M;  2CV2 A;  2DNA A;  2UXB M;  3CF0 A;  4F1I A;  3KW6 A;  4FCW A;  4IBC A;  4M9S A;  4JI1 M;  3PXG A;  1SXJ D;  2RRU A;  1L1T A;  1PRB A;  1JR3 A;  1GKI A;  1NY6 A;  2V6Z M;  1R5L A;  4IBB A;  4QHT A;  2HHH M;  4M0W A;  4LGM A;  1HQY E;  2JZ0 A;  3HJ8 A;  4QOS A;  2R46 A;  4B7F A;  4LCB A;  3VKG A;  4MGI E;  3TE6 A;  3AKZ A;  1ORY B;  2CHQ A;  2L7I A;  1I4W A;  3IG5 A;  3C58 A;  4G4N A;  4W5W A;  2DAK A;  1DGF A;  2ERC A;  2QP9 X;  2XFS A;  3J7B A;  4IBG A;  1SXJ E;  1IY0 A;  1Z6T A;  4IJF A;  3HHW A;  1Q02 A;  1NHG C;  2WSF F;  4PDI A;  1TH3 A;  1Z5C A;  4JI2 M;  3KP0 E;  2JY7 A;  2LBC A;  4MGH A;  3LCU A;  2KRU A;  3U6L A;  1XC8 A;  4FWD A;  1HQC A;  2C9O A;  3B9P A;  1D2N A;  2CE7 A;  4L15 A;  3LQQ A;  2KA6 B;  1N75 A;  3UK6 A;  2EUC A;  1IN7 A;  2CUZ A;  5EXS A;  1JB0 F;  4A3V B;  2JWS A;  2DI0 A;  5DYI A;  4JN6 A;  1HR0 M;  3UZU A;  4X62 M;  4OW0 A;  4GHL A;  3AOE C;  1NV9 A;  5KPT A;  2QSF X;  3U5Z A;  2L09 A;  4IBK A;  1UFZ A;  4AG6 A;  5L8R F;  1OKS A;  1SXJ B;  4PT5 A;  3R8F A;  1GO5 A;  4GMQ A;  4Q7J A;  2DZN B;  5LMN M;  5LMU M;  1NHW C;  2QBY A;  1J7K A;  4D81 A;  2FNA A;  2R18 A;  4B7H A;  1IN8 A;  2Z4R A;  3L29 A;  1HNX M;  1PJQ A;  2XF3 A;  1EIJ A;  1Z5B A;  1QZE A;  1ZV1 A;  2C9C A;  2MR9 A;  1Y8G A;  1XB2 B;  3E9S A;  3SBJ A;  3SYL A;  3FUX A;  1JQJ C;  1MJG M;  3IG8 A;  3HU2 A;  3EIE A;  4OVZ A;  3CTW B;  5FTJ A;  1Z5A A;  2WSC F;  4LZJ A;  3GLF E;  2F5Q A;  4WW0 A;  1T6O A;  3ZC7 B;  5ITU A;  3GLG B;  1BVS A;  2QCU A;  4AKH A;  3BXW A;  5ITX A;  3SAU A;  1E32 A;  3GPP A;  4YHH M;  3AL0 C;  2I7P A;  1IN6 A;  1UM8 A;  1V92 A;  3VK7 A;  1MN3 A;  3QYE A;  4NSR A;  3HHZ A;  1YLA A;  3MJ5 A;  3GLG E;  2ZAO A;  5DFL A;  3ZQJ A;  1OTR A;  4Z6Y A;  2CHV A;  2Y20 A;  4KT0 F;  4L8R C;  1L2C A;  2J7N A;  1XXH A;  4GIT A;  2BWB A;  4B08 A;  4GC5 A;  4HEO A;  4B3M M;  4IBD A;  3ZCB B;  3GO8 A;  3HY5 A;  2W82 A;  3ILK A;  4OVZ B;  3HJQ A;  2JA2 A;  3E46 A;  2HWJ A;  2LVQ D;  2LH0 A;  2WSE F;  3WHK A;  3BBZ A;  3KSJ A;  5DNY A;  1TH4 A;  3HGI A;  2EA0 A;  3KXE C;  4IBF A;  4NXM M;  1F4I A;  5DYG A;  2OOA A;  1XHB A;  4M9Z A;  2KZU A;  1YE9 A;  3MMP A;  2LHC A;  1GLN A;  1YSY A;  2VF8 A;  1E9S A;  3I04 M;  2JZ1 A;  4G3O A;  3HU3 A;  5E26 A;  2ZTD A;  2CV1 A;  1HNW M;  1HJP A;  3PFI A;  2J7O A;  1D0M A;  3UMM A;  2HKJ A;  2KNA A;  4XK8 F;  3I4V A;  2DAM A;  4B3T M;  4FW9 A;  2RGH A;  2Z8Y M;  1ZMU A;  4LJ5 A;  2E5L M;  4XBO A;  4JI7 M;  3LW5 F;  2KXE A;  2QEN A;  1N78 A;  4AI6 A;  3L2A A;  3A46 A;  4B3S M;  4KHP M;  5BR8 M;  3QYB A;  1WIV A;  4LZZ A;  3CF2 A;  3PVS A;  3FD9 A;  3L25 A;  1GVN A;  2QPA A;  2P5T A;  1IQP A;  3AV0 A;  3U6Q A;  4TUW A;  1H6U A;  1NV8 A;  3HU1 A;  3J27 B;  3M7G A;  4L6V 6;  3U60 A;  2KZS A;  4JI5 M;  4DR4 M;  1N32 M;  1S3S A;  2LVN C;  4IBJ A;  1X37 A;  3LQR A;  5FSW A;  4AKG A;  1IBL M;  1QUS A;  3U6S A;  2C98 A;  4X65 M;  4IBI A;  4GKJ M;  3T15 A;  1QQW A;  2ZAN A;  3FUV A;  4LF8 M;  1IXS A;  2O25 A;  3HKP A;  4LY6 A;  2D7E A;  2EKF A;  7CAT A;  2LVA A;  8CAT A;  1L2B A;  4KO8 A;  3E4R A;  2Y21 A;  1QYR A;  2CHG A;  3GLF B;  2XFT A;  3GP1 A;  1WXQ A;  1MX0 A;  4EIW A;  4JI6 M;  5FTN A;  2VQF M;  3HWS A;  3B74 A;  2M60 A;  3VDP A;  1N33 M;  2F5N A;  2CWB A;  2VQE M;  1T43 A;  2F5S A;  3K9P A;  3GLH A;  4YY3 M;  2I7N A;  1GJS A;  1PGY A;  2CRU A;  2Z7J A;  1LTM A;  4MB7 A;  1DV0 A;  1JR3 D;  2JY6 B;  3KFU G;  1K3X A;  1IXS B;  4D82 A;  3D8B A;  3VK8 A;  3HX3 A;  3SAS A;  5C18 A;  3H4J A;  1XMQ M;  4NXN M;  4K0K M;  3RFW A;  1DO2 A;  3K9O A;  2H5X A;  3PNV A;  4LJ8 A;  1QAM A;  2XSZ D;  2G3Q A;  2MH8 A;  3RGP A;  3THG A;  1IN4 A;  2R4E A;  1WJ7 A;  2ZM6 M;  3GLI E;  2KNV A;  2R0I A;  3SHG B;  1NJG A;  4CIZ A;  3GLH B;  4LJ4 A;  1JR3 E;  4DV5 M;  5FTL A;  2DAI A;  2Y0T A;  1EE8 A;  3FRH A;  4NRV A;  1OAI A;  2KNZ A;  4KLN A;  3W67 A;  2DKL A;  2K9D A;  1NVM A;  4KOD A;  1TTE A;  1VEG A;  2CP8 A;  3GLH E;  3KOX E;  3HJS A;  1SG9 A;  2N35 A;  3Q8X A;  5IWA M;  2BJW A;  3GLI B;  1G41 A;  3PNY A;  4R7G A;  2KHH A;  4MGK E;  3KOY E;  3M6A A;  5C1B A;  3U5Z B;  1C7Y A;  1QUT A;  2DWN A;  2XSZ A;  2UUC M;  2DHR A;  2FS1 A;  3K8Z A;  1SXJ A;  2BJV A;  2V1U A;  1LV7 A;  4L16 A;  3FTC A;  4HLQ A;  1QVR A;  2DEN A;  2J5Y A;  3W0L B;  3WHL A;  1GAB A;  1DGB A;  5IT9 S;  3TWK A;  1G4A E;  4FD2 A;  1GL7 A;  2XEP A;  1HNZ M;  3KS8 A;  5ITY A;  3TQS A;  3U6D A;  4GHA A;  2YNM D;  2MGW A;  1EFU B;  4IBE A;  2JNH A;  4LG2 A;  1OAO C;  4JV5 M;  1A5T A;  3CF6 E;  2JY5 A;  3SAR A;  3GLG A;  2DAG A;  2QZ4 A;  3GPX A;  3KS4 A;  2LHG A;  1E9R A;  2R4J A;  3W68 A;  1PJI A;  1G71 A;  2Y0Q A;  3A98 B;  1XWI A;  2F4V M;  4DV6 M;  1Q3C A;  3RE8 A;  1KYI A;  1L1Z A;  2DZO B;  3JR5 A;  2DAE A;  3GQ5 A;  1FNN A;  4AKI A;  1HT1 E;  3M0E A;  5EP1 A;  4P16 A;  3W0F A;  3J81 S;  2C5R A;  4JI8 M;  2R62 A;  3FTF A;  2MRO B;  3TPZ A;  4LJ6 A;  2OOB A;  4MGY E;  3T1Y M;  3K1J A;  1GL6 A;  2R44 A;  4UN2 B;  3SFZ A;  1VDD A;  4LFB M;  5H37 D;  5KPR A; 
#chains in the Genus database with same CATH homology
 3FUU A;  3UJN A;  5JI2 E;  5A2Q S;  2QBY B;  4NL4 H;  4FWG A;  4DV0 M;  2F5O A;  3U6P A;  3J2P B;  2FE8 A;  3RGS A;  3L28 A;  1DGG A;  1Z59 A;  4CGY B;  1Q39 A;  3AFH A;  4L78 A;  1IBK M;  1IBM M;  1IN5 A;  2DWL A;  4LFA M;  4NRW A;  2YQZ A;  2Z3X A;  4QNR A;  4MM3 B;  3FUT A;  4LGY A;  3TWL A;  3NWL A;  2O5R A;  4B3R M;  4GKK M;  1C1K A;  2DVW B;  1TDH A;  5EP3 A;  2KW0 A;  3I4Y A;  4DV4 M;  3KSX A;  3GQ3 A;  1SXJ C;  1YUB A;  4LRS A;  2H1R A;  1KSF X;  2UXC M;  3AOG A;  4AG5 A;  3VFD A;  3DA1 A;  4CHT B;  3DFZ A;  2DWZ B;  5ITT A;  1ZQ9 A;  4DR5 M;  1TDZ A;  2CV0 A;  2YR0 A;  4DR3 M;  4RF1 A;  1HT2 E;  3L27 A;  3EIH A;  5IRE B;  2LWX A;  3KOW E;  2DXI A;  1IY2 A;  4FVM A;  4I5S A;  1W5T A;  1G59 A;  3UGJ A;  4OX9 M;  2Q2E B;  1NJF A;  3DZD A;  4LF4 M;  1NNU C;  1Q3B A;  3KOZ E;  3VKH A;  4GRI A;  2ZAM A;  5FLX S;  4LFC M;  3QWL A;  1XNR M;  4REZ A;  4AQY M;  5EP2 A;  1NSF A;  1XMO M;  1L8Q A;  4GC9 A;  1QAQ A;  3LVW A;  2UU9 M;  4I81 A;  2LNH C;  1R2Z A;  2FOI C;  5KQD A;  3LMM A;  4M0D A;  3FKE A;  1J09 A;  4JI4 M;  2XZU A;  3FYC A;  5E6J A;  4D80 A;  3SC3 A;  1QAN A;  2OPF A;  2C96 A;  3FYD A;  3U6M A;  4FCV A;  3TL4 X;  1MU5 A;  3KVW A;  3A45 A;  4BB9 A;  4OU7 A;  4Z8X A;  1NNJ A;  3H4M A;  2L7H A;  4G4Q A;  4MGZ E;  4FCT A;  4PD2 A;  1R6B X;  2KEB A;  2X4A A;  4G4R A;  3K2L A;  4ITQ A;  4RNA A;  2X8A A;  1IXZ A;  2V1C A;  3SAW A;  3T1H M;  4DR7 M;  2CEA A;  5BPV A;  3L26 A;  4BLC A;  4M9X A;  5EXT A;  2AHM A;  3VLF B;  4BBA A;  3HHY A;  3KDS E;  3U6C A;  4II7 A;  4PCZ A;  2YFQ A;  1OFH A;  4X66 M;  3AJI B;  3GLF A;  3GRV A;  1OJL A;  2BNK A;  4ZPX A;  5EXX A;  3GLI A;  3J7A S;  5ITX E;  4GIP A;  4LF7 M;  4S12 A;  2XLJ A;  4AW4 A;  1L2D A;  4LF9 M;  1PJJ A;  4WUR A;  3SHF A;  1R7R A;  2EO2 A;  4PDG A;  4DV7 M;  5JI3 E;  4DR6 M;  2DWM A;  2UXD M;  5FTK A;  2A5Y B;  5GKN A;  4CIS A;  3GPU A;  4NOO B;  2HCB A;  3MK6 A;  1DGH A;  4LJ7 A;  1K82 A;  3GRY A;  3HHX A;  1IY1 A;  3LVV A;  3GRU A;  4HL4 A;  2Z4S A;  4B7G A;  1TH2 A;  3ZH9 B;  1N77 A;  1QZM A;  5EXP A;  5KO3 A;  1T3T A;  2FFJ A;  4JI0 M;  2K47 A;  3QAU A;  5F3W A;  3GRR A;  3D8L A;  3U6E A;  2NQ8 C;  1G8P A;  4JXJ A;  1DGH B;  2R45 A;  3SYK A;  2UUA M;  2R65 A;  4I8O A;  5ITQ A;  4DUY M;  1DO0 A;  1XXH B;  1OFI A;  3TWM A;  4LJ9 A;  1IM2 A;  5EQT A;  2D7G A;  3U60 B;  4DV1 M;  4IIW A;  1E94 E;  2XGN A;  3VDU A;  4LF6 M;  4QOZ C;  1TGU A;  1ZAE A;  4DV2 M;  4DR1 M;  3T38 A;  2XH9 A;  3JAM S;  3K92 A;  1NY5 A;  3A42 A;  3OTO M;  4DR2 M;  2XZF A;  4AZF A;  2VII A;  4R3D A;  3SAV A;  1PM5 A;  3AOE A;  4DV3 M;  4I4L A;  3FTD A;  3SMS A;  3GQ4 A;  2OQ4 A;  3J80 S;  4G4O A;  5EP4 A;  2M5Z A;  1IXR C;  1N36 M;  2C99 A;  4GH9 A;  4LJA A;  4LRT A;  2G5G X;  2RKO A;  3U61 B;  1KFV A;  4JYA M;  4X64 M;  2L6O A;  4IJE A;  3SMP A;  1XNQ M;  2F5P A;  3DOA A;  4XGI A;  3NBI A;  2ZBK B;  4NSO B;  3I51 A;  4QHS A;  3JR4 A;  4JI3 M;  1G3I A;  1QAO A;  4DUZ M;  2D7H A;  5ITR A;  4QNM A;  4G6Z A;  5IZ7 D;  2X49 A;  5KQ8 A;  2RGO A;  5EJC A;  1FJG M;  3U61 A;  1K3W A;  3FTE A;  1J5E M;  4FWH A;  2UUB M;  5KPZ A;  2CFO A;  2KRK A;  3KP1 E;  4MH0 E;  1I94 M;  3R9X B;  2HL7 A;  4RF0 A;  2G8L A;  1W5S A;  3U6O A;  3FUW A;  3MHV C;  1R2Y A;  1N34 M;  3GPY A;  5FTM A;  4L4U A;  2LXE A;  3SAT A;  3BOS A;  4LF5 M;  2CV2 A;  2UXB M;  3CF0 A;  3KW6 A;  4FCW A;  4IBC A;  4M9S A;  4JI1 M;  3PXG A;  1SXJ D;  1L1T A;  1JR3 A;  1GKI A;  1NY6 A;  2V6Z M;  4IBB A;  4QHT A;  2HHH M;  4M0W A;  4LGM A;  1HQY E;  3HJ8 A;  4QOS A;  2R46 A;  4B7F A;  4LCB A;  3VKG A;  4MGI E;  3TE6 A;  3AKZ A;  1ORY B;  2CHQ A;  2L7I A;  1I4W A;  3IG5 A;  3C58 A;  4G4N A;  4W5W A;  2QP9 X;  1DGF A;  2ERC A;  2XFS A;  3J7B A;  4IBG A;  1SXJ E;  1IY0 A;  1Z6T A;  4IJF A;  3HHW A;  1NHG C;  4PDI A;  1TH3 A;  1Z5C A;  4JI2 M;  3KP0 E;  4MGH A;  2KRU A;  3U6L A;  1XC8 A;  4FWD A;  1HQC A;  2C9O A;  3B9P A;  1D2N A;  2CE7 A;  4L15 A;  3LQQ A;  2KA6 B;  1N75 A;  3UK6 A;  2EUC A;  1IN7 A;  2CUZ A;  5EXS A;  4A3V B;  5DYI A;  1HR0 M;  4JN6 A;  3UZU A;  4X62 M;  4OW0 A;  4GHL A;  3AOE C;  5KPT A;  3U5Z A;  2L09 A;  4IBK A;  4AG6 A;  1SXJ B;  4PT5 A;  3R8F A;  4GMQ A;  2DZN B;  5LMN M;  5LMU M;  1NHW C;  2QBY A;  1J7K A;  4D81 A;  2FNA A;  2R18 A;  4B7H A;  1IN8 A;  2Z4R A;  3L29 A;  1HNX M;  2XF3 A;  1Z5B A;  2C9C A;  3E9S A;  3SBJ A;  3SYL A;  3FUX A;  1JQJ C;  3IG8 A;  4OVZ A;  3HU2 A;  3EIE A;  5FTJ A;  3CTW B;  1Z5A A;  4LZJ A;  2F5Q A;  4WW0 A;  3ZC7 B;  5ITU A;  3GLG B;  2QCU A;  4AKH A;  5ITX A;  3SAU A;  1E32 A;  3GPP A;  4YHH M;  3AL0 C;  2I7P A;  1IN6 A;  1UM8 A;  3VK7 A;  4NSR A;  3HHZ A;  3MJ5 A;  2ZAO A;  4Z6Y A;  2CHV A;  2Y20 A;  4L8R C;  1L2C A;  2J7N A;  1XXH A;  4GIT A;  4B08 A;  4B3M M;  4GC5 A;  4IBD A;  3ZCB B;  3GO8 A;  2W82 A;  3ILK A;  4OVZ B;  3HJQ A;  2JA2 A;  3WHK A;  2LH0 A;  3KSJ A;  5DNY A;  1TH4 A;  3HGI A;  2EA0 A;  3KXE C;  4IBF A;  4NXM M;  5DYG A;  1XHB A;  4M9Z A;  2KZU A;  1YE9 A;  1GLN A;  1YSY A;  1E9S A;  3HU3 A;  5E26 A;  2CV1 A;  1HNW M;  3PFI A;  2J7O A;  3UMM A;  2HKJ A;  3I4V A;  4B3T M;  4FW9 A;  2RGH A;  4LJ5 A;  2E5L M;  4XBO A;  4JI7 M;  2KXE A;  2QEN A;  1N78 A;  4AI6 A;  3L2A A;  3A46 A;  4B3S M;  4KHP M;  5BR8 M;  4LZZ A;  3CF2 A;  3PVS A;  3FD9 A;  3L25 A;  1GVN A;  2QPA A;  2P5T A;  1IQP A;  3AV0 A;  3U6Q A;  4TUW A;  1H6U A;  3HU1 A;  3U60 A;  3J27 B;  3M7G A;  4JI5 M;  2KZS A;  4DR4 M;  1N32 M;  1S3S A;  4IBJ A;  1X37 A;  3LQR A;  5FSW A;  4AKG A;  1IBL M;  3U6S A;  2C98 A;  4X65 M;  4IBI A;  4GKJ M;  3T15 A;  1QQW A;  2ZAN A;  3FUV A;  4LF8 M;  3HKP A;  4LY6 A;  2D7E A;  7CAT A;  8CAT A;  1L2B A;  4KO8 A;  3E4R A;  2Y21 A;  1QYR A;  2CHG A;  3GLF B;  2XFT A;  3GP1 A;  1WXQ A;  1MX0 A;  4EIW A;  4JI6 M;  5FTN A;  2VQF M;  3HWS A;  3VDP A;  2M60 A;  1N33 M;  2F5N A;  2VQE M;  2F5S A;  3GLH A;  4YY3 M;  2I7N A;  2Z7J A;  4MB7 A;  1JR3 D;  3KFU G;  1K3X A;  1IXS B;  4D82 A;  3D8B A;  3VK8 A;  3SAS A;  5C18 A;  1XMQ M;  4NXN M;  4K0K M;  3RFW A;  1DO2 A;  3RGP A;  3PNV A;  4LJ8 A;  1QAM A;  2XSZ D;  3THG A;  1IN4 A;  2R4E A;  2ZM6 M;  3SHG B;  1NJG A;  3GLH B;  4LJ4 A;  4DV5 M;  5FTL A;  2Y0T A;  1EE8 A;  4NRV A;  4KLN A;  1NVM A;  4KOD A;  3KOX E;  3HJS A;  3Q8X A;  5IWA M;  2BJW A;  3GLI B;  1G41 A;  3PNY A;  4R7G A;  4MGK E;  3KOY E;  3M6A A;  5C1B A;  3U5Z B;  2DWN A;  2XSZ A;  2UUC M;  2DHR A;  3K8Z A;  1SXJ A;  2BJV A;  2V1U A;  1LV7 A;  4L16 A;  3FTC A;  4HLQ A;  1QVR A;  3W0L B;  3WHL A;  1DGB A;  5IT9 S;  3TWK A;  1G4A E;  4FD2 A;  1GL7 A;  2XEP A;  1HNZ M;  3KS8 A;  5ITY A;  3TQS A;  3U6D A;  4GHA A;  2YNM D;  4IBE A;  4LG2 A;  4JV5 M;  3CF6 E;  3SAR A;  3GLG A;  2QZ4 A;  3GPX A;  3KS4 A;  1E9R A;  2R4J A;  1PJI A;  2Y0Q A;  3A98 B;  2F4V M;  1XWI A;  4DV6 M;  1Q3C A;  3RE8 A;  1KYI A;  1L1Z A;  2DZO B;  3JR5 A;  3GQ5 A;  1FNN A;  4AKI A;  1HT1 E;  3M0E A;  5EP1 A;  4P16 A;  3W0F A;  3J81 S;  2C5R A;  4JI8 M;  2R62 A;  3FTF A;  3TPZ A;  4LJ6 A;  4MGY E;  3T1Y M;  3K1J A;  1GL6 A;  3SFZ A;  1VDD A;  4LFB M;  5H37 D;  5KPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...