4GMQA

Ribosome-binding domain of zuo1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
b'NAVKKNKRVLRGSVKEANYFVEGEASAATIDAVLNDVDLVITKIDADEIAALAGKLNGLTVADEIKNVWKEEVSRLVGAGKLKEGDIKALVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative ribosome associated protein
molecule tags Ribosome-binding protein
source organism Chaetomium thermophilum var. thermophilum dsm 1495
publication title Structural characterization of a eukaryotic chaperone-the ribosome-associated complex.
pubmed doi rcsb
total genus 36
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.840 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gmqA00
4GMQA 2LWXA
chains in the Genus database with same CATH superfamily
1V33A 3RFWA 3I04M 1OTRA 1PJTA 1SXJC 4IBGA 4XGIA 4LJ7A 1WHCA 1FNNA 1J5EM 3L28A 2MJ5B 2X49A 1HQYE 2Q2EB 4I5SA 4I4LA 1IXSB 1OKSA 3U6LA 4DR7M 3VKGA 4W5WA 1IBLM 3DFZA 3KOXE 4NRVA 1K82A 2V6ZM 3SASA 4ITQA 4M9SA 1QUSA 5E6JA 4HLQA 3GRRA 1IXSA 4L6V6 3GPXA 3W0LB 3C3DA 1IN5A 2Z4SA 4I81A 3H4JA 5DNYA 3J81S 4LRTA 3JR5A 3GLFE 3GLGE 1DGBA 4NRWA 1GVNA 2KRKA 1W5SA 2QZ4A 4KO8A 2W82A 4M9ZA 1J09A 4FWGA 2EA0A 1Q39A 3KXEC 4DR5M 4LF5M 2QSFX 3HJQA 3FTCA 3L29A 4IBEA 2JY8A 3U6PA 2MR9A 4G4OA 2F5OA 3I51A 3HY5A 4X66M 1DGHB 4JI0M 4LJ6A 4WURA 3RE8A 3K92A 1PGYA 2JZ1A 2APLA 3A98B 3GLHE 3M7GA 3KP0E 1TR8A 4DV2M 5IT9S 4GHAA 2JZ0A 2R62A 4DV3M 1XXHA 3SFZA 3WHLA 3R8FA 3AFHA 4G4RA 4DR1M 2F5SA 4M9XA 1GL7A 1GJTA 4JI4M 1IN4A 2WSCF 1DGHA 2Y21A 1WR1B 2L09A 4OW0A 3U61B 1WGLA 3BOSA 3GRUA 1IY1A 1XHBA 3U60B 1HJPA 4NC6A 4G4NA 5ITXA 3RGSA 3D8LA 3LQQA 4NSRA 2BWEA 3TL4X 2M60A 1D0LA 2QP9X 1V34A 3GLHB 4KLNA 2L2DA 5FSWA 2F5NA 2LVQD 3E4RA 4P16A 1NV9A 1OQYA 2J5YA 2HL7A 3THGA 4TUWA 2WSEF 1TDHA 1R7RA 3LMMA 4LCBA 2JWSA 4MGKE 4D80A 2JNHA 2QENA 1QAOA 4LGMA 3GLGB 5JI2E 5DYGA 1Q3BA 2WZJA 4ZPXA 3KSXA 4QOZC 3GLFA 1GL6A 2EJSA 2HKJA 1WIVA 3SAUA 3HU1A 2R44A 3KOWE 1SXJD 4LZZA 5ITQA 2LH0A 4L8RC 4MGZE 2C99A 2KEBA 5KO3A 2BNKA 4QNMA 5ITXE 3UK6A 2CHGA 3F92A 3SAWA 2RGOA 3K8ZA 2G8LA 2C9CA 1PJSA 3MHVC 2R4EA 4FD2A 4M0WA 4BB9A 4LRSA 4K0KM 2O5RA 3TWKA 2DWZB 2HHHM 2RGHA 1IM2A 1LTMA 1YLAA 4LY6A 5FTMA 2FE8A 1IBMM 3HU2A 3HGIA 3B7ZA 2JY6B 1L1ZA 2V1CA 4PD2A 2QBYA 2R6FA 2CP8A 1TTEA 3HHWA 2ZANA 4FVMA 4D82A 4DR4M 2XFTA 2NQ8C 2LHCA 4LZJA 2DZNB 1GABA 4AKHA 5DYIA 3GPUA 5C18A 2F5PA 1HNXM 3E21A 1NHWC 4IIWA 3VFDA 3PVSA 1C1KA 1Z59A 3FTDA 3T1HM 3VK7A 1K3XA 1GLNA 2KNVA 4AKIA 4DBGB 3FYDA 5FTNA 3GLGA 3SAVA 2DAMA 4DV5M 3L25A 5KPZA 3HHXA 4AG5A 3KVWA 1PJIA 4CISA 2XSZD 1E9RA 3Q8GA 4FCVA 2I7PA 1QDRA 3VKHA 2J7OA 3HJ8A 1NNUC 1AUAA 4NL4H 3JR4A 1DO2A 4LJ5A 4AZFA 2AHMA 1Z5CA 4MGHA 1FJGM 2H1RA 4M0DA 3SYLA 3QAUA 4JI5M 2GQFA 1T43A 3IG5A 1NNJA 2H5XA 3U5ZA 3W67A 5LMUM 2UXCM 4GH9A 2LVPC 1GJSA 3B89A 2CV0A 3GLIB 2KNZA 2M5ZA 1NV8A 2YQZA 3FUTA 5F3WA 3B74A 2UUAM 2XF3A 3T38A 3CF2A 2DZOB 2DENA 4DR6M 1BVSA 2K47A 1EFUB 2P5TA 1I4WA 1TH4A 3J2PB 1XMOM 4GIPA 3D8BA 3J80S 4G3OA 1QZMA 4GMQA 1IBKM 3FE3A 4AKGA 2VQFM 3QWLA 4JI8M 1ZV1A 1VDLA 2CEAA 2QNJA 1OIPA 1VG5A 4S12A 3MMPA 1A5TA 4WW0A 3T15A 4OVZB 4X64M 3MK6A 5E26A 1EE8A 3E9SA 4KT0F 1QAMA 5EJCA 3U6QA 2O01F 1VEGA 1Z5AA 4DV6M 1XNRM 1E9SA 5A2QS 1IN8A 1HNZM 1HQCA 1OAIA 4IJFA 3GRYA 1PJJA 5FTLA 3VDPA 4A3VB 3IECA 1JR3A 5EXPA 2C5RA 3GLIE 3GQ4A 7CATA 3IG8A 2A5YB 3U5ZB 4LFAM 3ZCBB 2KW0A 4B08A 2BWBA 1WJ7A 2L7IA 4FWDA 4FCTA 4DV1M 2CWBA 4JN6A 1HT2E 4IBIA 4OU7A 2CHQA 2L6OA 4CJ6A 2V1UA 2ZAOA 4AI6A 1CUKA 1S3SA 2OOAA 3K9PA 3TWLA 2ZBKB 4IBCA 4LJ8A 4XK8F 2CE7A 2I7NA 2EO2A 2ZTDA 3I01M 4DUYM 1QDTA 2LVOC 3SHFA 3WHKA 2KA6B 1ORYB 3J7AS 3L27A 2CUZA 2ZTCA 1NHGC 4LF9M 2ZAMA 2XZUA 1PJQA 3E46A 1E94E 1H6UA 1SXJE 2ERCA 2N35A 5GKNA 4NXMM 5KPTA 2OQ4A 1XC8A 3HZJA 2JY7A 4GC9A 5KPRA 1K3WA 4LGYA 3SMPA 3GLHA 2XH9A 3FUVA 5ITYA 4BBAA 2DHYA 2EUCA 5EXTA 1R5LA 2DAKA 4OX9M 3FUXA 3OTOM 1IY0A 2K0BX 1L2BA 1IFYA 1IXZA 2R18A 3K9OA 2D7EA 2DWNA 2CV1A 1HR0M 1RU3A 4I8OA 4LF7M 3TPZA 5C1BA 2R45A 2DAGA 4JYAM 3U6CA 2L4EA 2Y0TA 3QYBA 3TE6A 4B3MM 3HX3A 1UM8A 2X8AA 2KDLA 1NVMA 4X62M 1IN6A 4QNRA 3C9PA 1XWIA 1R2YA 3HWSA 4IJEA 1ZMWA 3NWLA 2QCUA 1HNWM 4YHHM 2HCBA 3RGPA 3UGJA 5FLXS 3GQ3A 1OJLA 1VEKA 4DR3M 3IHPA 3GP1A 4WP2A 3TWMA 3VDUA 2J7NA 1T3TA 3AOEC 2KXEA 1Q02A 4LJ9A 2LVAA 3SATA 3GPYA 1G71A 1YUBA 5IWAM 4GHLA 2QBYB 3FKEA 5BR8M 1JQJC 3KFUG 3U6DA 2F5QA 3ZH9B 2D7GA 4OVZA 2Z7JA 1TGUA 3C58A 2XEPA 1JB0F 4AQYM 1N78A 2FNAA 2C98A 4XBOA 1YSYA 2FFJA 1QUTA 2R46A 2Y20A 4RF1A 1ZMVA 1KSFX 1L2DA 3A45A 3AOGA 4DUZM 2OOBA 1NSFA 1SG9A 3FRHA 2OPFA 3W0FA 3U6EA 2HWJA 1I94M 4GKKM 1VQ1A 5JI3E 2DI0A 2DKLA 4LFCM 2UU9M 4IBBA 3VLFB 5H37D 1R6BX 4PDIA 2DNAA 2UUCM 3U60A 2EKFA 4P17A 1WGNA 2OO9A 3LQRA 2VF7A 3NBXX 4Y28F 5LMNM 1G59A 1IY2A 4NXNM 3GO8A 4DV0M 4PCZA 2JP7A 3VK8A 2MROB 3H4MA 1MU5A 2XGNA 5EP4A 3FYCA 1N36M 1NJFA 1NY5A 1JR3E 4MH0E 4BLCA 3CF0A 1SXJB 4DV4M 4IBKA 5DFLA 3ZQJA 2G5GX 3A42A 1ZMUA 2X4AA 2B3TA 2DZLA 2LTUA 1W5TA 1OIZA 4PT5A 2Z8YM 3L2AA 5ITRA 2C9OA 2YR0A 3GRVA 1HT1E 2JUJA 3GLFB 3FTFA 3CGWA 3EIEA 1GO5A 2L7HA 2WSFF 3UZUA 2K6BA 4CHTB 2VQEM 3KOZE 3M6AA 3V76A 3AJIB 2JA2A 3SMSA 3FUWA 4UN2B 2Z3XA 2CV2A 1NJGA 1ZQ9A 1QANA 2FH0A 2KZSA 4LF6M 2YNMD 4GRIA 4AG6A 1QVRA 4F1IA 3SBJA 2GNOA 1QYRA 3L26A 3KS4A 2KZUA 2C96A 1D0MA 4F2LA 3K2LA 4REZA 1VDDA 2LVNC 1WXQA 4KODA 2LWXA 4FCWA 1IQPA 4EIWA 2ZM6M 3SARA 3AL0C 2CHVA 3T1YM 3FD9A 1ZAEA 4Z6YA 4GITA 4AW4A 1XMQM 3A46A 4B3RM 2DAIA 1T6OA 4L15A 2E5LM 1DO0A 4MB7A 2XZFA 1SXJA 3T6PA 1JR3D 3HHZA 4B7GA 1N33M 1C7YA 4R71A 1PRBA 4KHPM 2CFOA 2KNAA 2RKOA 1QAQA 3R9XB 1N75A 1XXHE 3U6SA 1L2CA 5KQ8A 3AV0A 1MN3A 2VF8A 4IBFA 5FTKA 1R2ZA 4L78A 5BPVA 1L1TA 4X65M 2MGWA 1MJGM 2BJWA 4R7GA 4QHSA 4JI1M 3LCUA 1OAOC 3LCVB 2VIIA 4RNAA 1TH2A 5ITTA 2MH8A 5KQDA 1QQWA 3KW6A 2D7HA 3W68A 1KFVA 3C3EA 3KSJA 8CATA 3HKPA 2LNHC 2FOIC 4GC5A 5EP2A 5IZ7D 3J7BA 1E32A 3FUUA 4CGYB 4L16A 1DGFA 2F4VM 4DV7M 3QYEA 1XXHB 1TDZA 4CIZA 2EKKA 4GKJM 3LW5F 2VDBB 4FW9A 3SHGB 4B7FA 1J7KA 4LG2A 2KHHA 1Q3CA 4B7HA 4YY3M 1DV0A 1AIPC 3I4VA 5EXXA 4NSOB 1NY6A 2JXNA 4PDGA 3FTEA 3B7QA 4JI3M 3AOEA 4LJAA 1GKIA 3GLIA 2BJVA 1F4IA 2QPAA 2K9DA 2YFQA 3B9PA 3PNYA 3U6MA 1NO1A 1R4GA 1IN7A 5EQTA 3SYKA 3HHYA 3TQSA 4JI6M 4IBDA 1P3QQ 4RF0A 1PM5A 4G4QA 3KS8A 5EP3A 1MX0A 3LVVA 5IREB 1N32M 4GEWA 1Y8GA 3KP1E 4JXJA 3MJ5A 4L4UA 2RRUA 3U61A 2DWMA 5ITUA 2FS1A 2QHOB 2LBCA 4II7A 2UUBM 1D2NA 1N77A 4QOSA 3ILKA 1N34M 1VEJA 4FWHA 1L8QA 1LV7A 3BXWA 2O25A 3DOAA 4IBJA 4R3DA 4LF4M 3KOYE 5EP1A 1KYIA 1QZEA 5L8RF 2DAEA 5EXSA 2XFSA 3J27B 2R65A 2CRUA 1G8PA 1X37A 3CTWB 4MGIE 3PNVA 3ZC7B 2XLJA 4LFBM 1G4AE 3HJSA 4MM3B 3GQ5A 1V92A 2R0IA 1G3IA 1IXRC 2DHRA 3BBZA 1YE9A 4G6ZA 3UMMA 2DXIA 3NBIA 1Z5BA 3GPPA 2XSZA 4RKUF 1XNQM 3PFIA 1EIJA 3JAMS 4MGYE 1D0KA 3EIHA 3HU3A 3I4YA 4HEOA 2UXBM 2DVWB 4LF8M 2JY5A 4QHTA 1DGGA 3U6OA 2DWLA 2QQ8A 3Q8XA 4LJ4A 1TF0B 4ANRA 1TH3A 4Z8XA 3KDSE 2KRUA 1OFHA 1UFZA 3DZDA 2Y0QA 4JV5M 3AKZA 4JI7M 1Z6TA 3M0EA 2UXDM 3K1JA 2HAKA 4DR2M 1G41A 4HL4A 4D81A 3DA1A 3B7NA 3LVWA 3FRIA 5FTJA 2LHGA 2L4FA 2Z4RA 3CF6E 3SC3A 4B3SM 4B3TM 1OFIA 1XB2B 2LXEA 2G3QA 4JI2M 4NOOB 2R4JA 3UJNA 3PXGA 4Q7JA
chains in the Genus database with same CATH topology
3RFWA 1SXJC 4IBGA 4XGIA 4LJ7A 1FNNA 1J5EM 3L28A 2X49A 4I5SA 1HQYE 2Q2EB 4I4LA 1IXSB 3U6LA 4DR7M 3VKGA 4W5WA 1IBLM 3DFZA 3KOXE 4NRVA 1K82A 2V6ZM 3SASA 4ITQA 4M9SA 5E6JA 4HLQA 3GRRA 3GPXA 3W0LB 1IN5A 2Z4SA 4I81A 5DNYA 3J81S 4LRTA 3JR5A 1DGBA 4NRWA 1GVNA 2KRKA 1W5SA 2QZ4A 4KO8A 2W82A 4M9ZA 1J09A 4FWGA 2EA0A 1Q39A 3KXEC 4DR5M 4LF5M 3HJQA 3FTCA 3L29A 4IBEA 3U6PA 4G4OA 2F5OA 3I51A 4X66M 1DGHB 4JI0M 4LJ6A 4WURA 3RE8A 3K92A 3A98B 3M7GA 3KP0E 4DV2M 5IT9S 4GHAA 4DV3M 2R62A 1XXHA 3SFZA 3WHLA 3R8FA 3AFHA 4G4RA 4DR1M 2F5SA 4M9XA 1GL7A 4JI4M 1IN4A 1DGHA 2Y21A 2L09A 4OW0A 3U61B 3BOSA 3GRUA 1IY1A 1XHBA 3U60B 4G4NA 5ITXA 3RGSA 3D8LA 3LQQA 4NSRA 3TL4X 2M60A 2QP9X 3GLHB 4KLNA 5FSWA 2F5NA 3E4RA 4P16A 2HL7A 3THGA 4TUWA 1TDHA 1R7RA 3LMMA 4LCBA 4MGKE 4D80A 2QENA 1QAOA 4LGMA 3GLGB 5JI2E 5DYGA 1Q3BA 4ZPXA 3KSXA 4QOZC 3GLFA 1GL6A 2HKJA 3SAUA 3HU1A 3KOWE 4LZZA 1SXJD 5ITQA 2LH0A 4L8RC 4MGZE 2C99A 2KEBA 5KO3A 2BNKA 4QNMA 5ITXE 3UK6A 2CHGA 3SAWA 2RGOA 3K8ZA 2G8LA 2C9CA 3MHVC 4FD2A 2R4EA 4M0WA 4BB9A 4LRSA 4K0KM 2O5RA 3TWKA 2DWZB 2HHHM 2RGHA 1IM2A 4LY6A 5FTMA 1IBMM 2FE8A 3HU2A 3HGIA 1L1ZA 2V1CA 4PD2A 2QBYA 3HHWA 4FVMA 4D82A 4DR4M 2ZANA 2XFTA 2NQ8C 4LZJA 2DZNB 4AKHA 5DYIA 3GPUA 5C18A 2F5PA 1HNXM 1NHWC 4IIWA 3VFDA 3PVSA 1C1KA 1Z59A 3FTDA 3T1HM 3VK7A 1K3XA 1GLNA 4AKIA 3FYDA 5FTNA 3GLGA 3SAVA 4DV5M 3L25A 5KPZA 3HHXA 4AG5A 3KVWA 1PJIA 4CISA 2XSZD 1E9RA 4FCVA 2I7PA 3VKHA 2J7OA 3HJ8A 1NNUC 4NL4H 3JR4A 1DO2A 4LJ5A 4AZFA 2AHMA 1Z5CA 4MGHA 1FJGM 2H1RA 4M0DA 3SYLA 3QAUA 4JI5M 3IG5A 1NNJA 2UXCM 3U5ZA 5LMUM 4GH9A 2CV0A 3GLIB 3FUTA 2M5ZA 2YQZA 5F3WA 2UUAM 2XF3A 3T38A 3CF2A 2DZOB 4DR6M 2K47A 2P5TA 1I4WA 1TH4A 3J2PB 1XMOM 4GIPA 3D8BA 3J80S 1QZMA 4GMQA 1IBKM 4AKGA 2VQFM 3QWLA 4JI8M 2CEAA 4WW0A 4S12A 3T15A 4OVZB 4X64M 3MK6A 5E26A 1EE8A 3E9SA 1QAMA 5EJCA 3U6QA 1Z5AA 4DV6M 1XNRM 1E9SA 5A2QS 1IN8A 1HNZM 1HQCA 4IJFA 3GRYA 1PJJA 5FTLA 3VDPA 4A3VB 1JR3A 5EXPA 2C5RA 3GQ4A 7CATA 3IG8A 2A5YB 3U5ZB 4LFAM 3ZCBB 2KW0A 4B08A 4FWDA 2L7IA 4FCTA 4DV1M 4JN6A 1HT2E 4IBIA 4OU7A 2CHQA 2L6OA 2V1UA 2ZAOA 4AI6A 1S3SA 3TWLA 2ZBKB 4IBCA 4LJ8A 4DUYM 2CE7A 2I7NA 2EO2A 3SHFA 3WHKA 2KA6B 1ORYB 3J7AS 3L27A 2CUZA 1NHGC 4LF9M 2ZAMA 2XZUA 1E94E 1H6UA 1SXJE 2ERCA 5GKNA 4NXMM 5KPTA 2OQ4A 1XC8A 4GC9A 5KPRA 1K3WA 4LGYA 3SMPA 3GLHA 2XH9A 3FUVA 5ITYA 4BBAA 2EUCA 5EXTA 4OX9M 3FUXA 3OTOM 1IY0A 1L2BA 1IXZA 2R18A 2D7EA 2DWNA 2CV1A 1HR0M 4I8OA 4LF7M 3TPZA 5C1BA 2R45A 4JYAM 3U6CA 2Y0TA 3TE6A 4B3MM 1UM8A 2X8AA 1NVMA 4X62M 1IN6A 4QNRA 1XWIA 1R2YA 3HWSA 4IJEA 3NWLA 2QCUA 1HNWM 4YHHM 2HCBA 3RGPA 3UGJA 5FLXS 3GQ3A 1OJLA 4DR3M 3GP1A 3TWMA 3VDUA 2J7NA 1T3TA 3AOEC 2KXEA 4LJ9A 3SATA 3GPYA 1YUBA 5IWAM 4GHLA 2QBYB 3FKEA 5BR8M 1JQJC 3KFUG 3U6DA 2F5QA 3ZH9B 2D7GA 4OVZA 2Z7JA 1TGUA 3C58A 2XEPA 4AQYM 1N78A 2FNAA 2C98A 4XBOA 1YSYA 2FFJA 2Y20A 2R46A 4RF1A 1L2DA 1KSFX 3A45A 3AOGA 4DUZM 1NSFA 2OPFA 3U6EA 4GKKM 3W0FA 1I94M 5JI3E 4LFCM 2UU9M 4IBBA 3VLFB 5H37D 1R6BX 4PDIA 2UUCM 3U60A 5LMNM 3LQRA 1G59A 1IY2A 4NXNM 3GO8A 4DV0M 4PCZA 3VK8A 3H4MA 1MU5A 2XGNA 5EP4A 3FYCA 1N36M 1NJFA 1NY5A 4MH0E 4BLCA 3CF0A 1SXJB 4DV4M 4IBKA 2G5GX 3A42A 2X4AA 1W5TA 4PT5A 3L2AA 5ITRA 2C9OA 2YR0A 3GRVA 1HT1E 3GLFB 3FTFA 3EIEA 2L7HA 3UZUA 2VQEM 4CHTB 3KOZE 3M6AA 3AJIB 2JA2A 3SMSA 3FUWA 2Z3XA 2CV2A 1NJGA 1ZQ9A 1QANA 2KZSA 4LF6M 2YNMD 4GRIA 4AG6A 1QVRA 3SBJA 1QYRA 3L26A 3KS4A 2KZUA 2C96A 3K2LA 4REZA 1VDDA 3SARA 1WXQA 4KODA 2LWXA 4FCWA 1IQPA 4EIWA 2ZM6M 3AL0C 2CHVA 3T1YM 3FD9A 1ZAEA 4Z6YA 4GITA 4AW4A 1XMQM 3A46A 4B3RM 4L15A 2E5LM 1DO0A 4MB7A 2XZFA 1SXJA 1JR3D 3HHZA 4B7GA 1N33M 4KHPM 2CFOA 2RKOA 1QAQA 3R9XB 1N75A 3U6SA 1L2CA 5KQ8A 3AV0A 4IBFA 5FTKA 1R2ZA 4L78A 5BPVA 1L1TA 4X65M 2BJWA 4R7GA 4QHSA 4JI1M 2VIIA 4RNAA 1TH2A 5ITTA 5KQDA 1QQWA 3KW6A 2D7HA 1KFVA 3KSJA 8CATA 3HKPA 2LNHC 2FOIC 4GC5A 5EP2A 5IZ7D 3J7BA 1E32A 3FUUA 4CGYB 4L16A 1DGFA 2F4VM 4DV7M 1XXHB 1TDZA 4GKJM 4FW9A 3SHGB 4B7FA 1J7KA 4LG2A 1Q3CA 4B7HA 4YY3M 5EXXA 3I4VA 4PDGA 4NSOB 1NY6A 3FTEA 4JI3M 3AOEA 4LJAA 1GKIA 3GLIA 2BJVA 2QPAA 2YFQA 3B9PA 3PNYA 3U6MA 1IN7A 5EQTA 3SYKA 3HHYA 3TQSA 4JI6M 4IBDA 4RF0A 1PM5A 3KS8A 4G4QA 5EP3A 1MX0A 3LVVA 5IREB 1N32M 3KP1E 4JXJA 3MJ5A 4L4UA 3U61A 2DWMA 5ITUA 4II7A 2UUBM 1D2NA 1N77A 4QOSA 3ILKA 1N34M 4FWHA 1L8QA 1LV7A 4IBJA 3DOAA 4R3DA 4LF4M 3KOYE 5EP1A 1KYIA 5EXSA 2XFSA 3J27B 2R65A 3CTWB 1G8PA 1X37A 4MGIE 3ZC7B 3PNVA 2XLJA 4LFBM 1G4AE 3HJSA 4MM3B 3GQ5A 1G3IA 1IXRC 2DHRA 4G6ZA 1YE9A 3UMMA 2DXIA 3NBIA 1Z5BA 3GPPA 2XSZA 1XNQM 3PFIA 3JAMS 4MGYE 3EIHA 3HU3A 3I4YA 2UXBM 2DVWB 4LF8M 4QHTA 1DGGA 3U6OA 2DWLA 3Q8XA 4LJ4A 1TH3A 4Z8XA 3KDSE 2KRUA 1OFHA 3DZDA 2Y0QA 4JV5M 3AKZA 4JI7M 1Z6TA 3M0EA 2UXDM 3K1JA 4DR2M 1G41A 4HL4A 4D81A 3DA1A 5FTJA 3LVWA 3SC3A 4B3TM 2Z4RA 3CF6E 4B3SM 1OFIA 2LXEA 4JI2M 4NOOB 2R4JA 3UJNA 3PXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMQ A;  2LWX A; 
#chains in the Genus database with same CATH topology
 1V33 A;  3RFW A;  3I04 M;  1OTR A;  1PJT A;  1SXJ C;  4IBG A;  4XGI A;  4LJ7 A;  1WHC A;  1FNN A;  1J5E M;  3L28 A;  2MJ5 B;  2X49 A;  1HQY E;  2Q2E B;  4I5S A;  4I4L A;  1IXS B;  1OKS A;  3U6L A;  4DR7 M;  3VKG A;  4W5W A;  1IBL M;  3DFZ A;  3KOX E;  4NRV A;  1K82 A;  2V6Z M;  3SAS A;  4ITQ A;  4M9S A;  1QUS A;  5E6J A;  4HLQ A;  3GRR A;  1IXS A;  4L6V 6;  3GPX A;  3W0L B;  3C3D A;  1IN5 A;  2Z4S A;  4I81 A;  3H4J A;  5DNY A;  3J81 S;  4LRT A;  3JR5 A;  3GLF E;  3GLG E;  1DGB A;  4NRW A;  1GVN A;  2KRK A;  1W5S A;  2QZ4 A;  4KO8 A;  2W82 A;  4M9Z A;  1J09 A;  4FWG A;  2EA0 A;  1Q39 A;  3KXE C;  4DR5 M;  4LF5 M;  2QSF X;  3HJQ A;  3FTC A;  3L29 A;  4IBE A;  2JY8 A;  3U6P A;  2MR9 A;  4G4O A;  2F5O A;  3I51 A;  3HY5 A;  4X66 M;  1DGH B;  4JI0 M;  4LJ6 A;  4WUR A;  3RE8 A;  3K92 A;  1PGY A;  2JZ1 A;  2APL A;  3A98 B;  3GLH E;  3M7G A;  3KP0 E;  1TR8 A;  4DV2 M;  5IT9 S;  4GHA A;  2JZ0 A;  2R62 A;  4DV3 M;  1XXH A;  3SFZ A;  3WHL A;  3R8F A;  3AFH A;  4G4R A;  4DR1 M;  2F5S A;  4M9X A;  1GL7 A;  1GJT A;  4JI4 M;  1IN4 A;  2WSC F;  1DGH A;  2Y21 A;  1WR1 B;  2L09 A;  4OW0 A;  3U61 B;  1WGL A;  3BOS A;  3GRU A;  1IY1 A;  1XHB A;  3U60 B;  1HJP A;  4NC6 A;  4G4N A;  5ITX A;  3RGS A;  3D8L A;  3LQQ A;  4NSR A;  2BWE A;  3TL4 X;  2M60 A;  1D0L A;  2QP9 X;  1V34 A;  3GLH B;  4KLN A;  2L2D A;  5FSW A;  2F5N A;  2LVQ D;  3E4R A;  4P16 A;  1NV9 A;  1OQY A;  2J5Y A;  2HL7 A;  3THG A;  4TUW A;  2WSE F;  1TDH A;  1R7R A;  3LMM A;  4LCB A;  2JWS A;  4MGK E;  4D80 A;  2JNH A;  2QEN A;  1QAO A;  4LGM A;  3GLG B;  5JI2 E;  5DYG A;  1Q3B A;  2WZJ A;  4ZPX A;  3KSX A;  4QOZ C;  3GLF A;  1GL6 A;  2EJS A;  2HKJ A;  1WIV A;  3SAU A;  3HU1 A;  2R44 A;  3KOW E;  1SXJ D;  4LZZ A;  5ITQ A;  2LH0 A;  4L8R C;  4MGZ E;  2C99 A;  2KEB A;  5KO3 A;  2BNK A;  4QNM A;  5ITX E;  3UK6 A;  2CHG A;  3F92 A;  3SAW A;  2RGO A;  3K8Z A;  2G8L A;  2C9C A;  1PJS A;  3MHV C;  2R4E A;  4FD2 A;  4M0W A;  4BB9 A;  4LRS A;  4K0K M;  2O5R A;  3TWK A;  2DWZ B;  2HHH M;  2RGH A;  1IM2 A;  1LTM A;  1YLA A;  4LY6 A;  5FTM A;  2FE8 A;  1IBM M;  3HU2 A;  3HGI A;  3B7Z A;  2JY6 B;  1L1Z A;  2V1C A;  4PD2 A;  2QBY A;  2R6F A;  2CP8 A;  1TTE A;  3HHW A;  2ZAN A;  4FVM A;  4D82 A;  4DR4 M;  2XFT A;  2NQ8 C;  2LHC A;  4LZJ A;  2DZN B;  1GAB A;  4AKH A;  5DYI A;  3GPU A;  5C18 A;  2F5P A;  1HNX M;  3E21 A;  1NHW C;  4IIW A;  3VFD A;  3PVS A;  1C1K A;  1Z59 A;  3FTD A;  3T1H M;  3VK7 A;  1K3X A;  1GLN A;  2KNV A;  4AKI A;  4DBG B;  3FYD A;  5FTN A;  3GLG A;  3SAV A;  2DAM A;  4DV5 M;  3L25 A;  5KPZ A;  3HHX A;  4AG5 A;  3KVW A;  1PJI A;  4CIS A;  2XSZ D;  1E9R A;  3Q8G A;  4FCV A;  2I7P A;  1QDR A;  3VKH A;  2J7O A;  3HJ8 A;  1NNU C;  1AUA A;  4NL4 H;  3JR4 A;  1DO2 A;  4LJ5 A;  4AZF A;  2AHM A;  1Z5C A;  4MGH A;  1FJG M;  2H1R A;  4M0D A;  3SYL A;  3QAU A;  4JI5 M;  2GQF A;  1T43 A;  3IG5 A;  1NNJ A;  2H5X A;  3U5Z A;  3W67 A;  5LMU M;  2UXC M;  4GH9 A;  2LVP C;  1GJS A;  3B89 A;  2CV0 A;  3GLI B;  2KNZ A;  2M5Z A;  1NV8 A;  2YQZ A;  3FUT A;  5F3W A;  3B74 A;  2UUA M;  2XF3 A;  3T38 A;  3CF2 A;  2DZO B;  2DEN A;  4DR6 M;  1BVS A;  2K47 A;  1EFU B;  2P5T A;  1I4W A;  1TH4 A;  3J2P B;  1XMO M;  4GIP A;  3D8B A;  3J80 S;  4G3O A;  1QZM A;  4GMQ A;  1IBK M;  3FE3 A;  4AKG A;  2VQF M;  3QWL A;  4JI8 M;  1ZV1 A;  1VDL A;  2CEA A;  2QNJ A;  1OIP A;  1VG5 A;  4S12 A;  3MMP A;  1A5T A;  4WW0 A;  3T15 A;  4OVZ B;  4X64 M;  3MK6 A;  5E26 A;  1EE8 A;  3E9S A;  4KT0 F;  1QAM A;  5EJC A;  3U6Q A;  2O01 F;  1VEG A;  1Z5A A;  4DV6 M;  1XNR M;  1E9S A;  5A2Q S;  1IN8 A;  1HNZ M;  1HQC A;  1OAI A;  4IJF A;  3GRY A;  1PJJ A;  5FTL A;  3VDP A;  4A3V B;  3IEC A;  1JR3 A;  5EXP A;  2C5R A;  3GLI E;  3GQ4 A;  7CAT A;  3IG8 A;  2A5Y B;  3U5Z B;  4LFA M;  3ZCB B;  2KW0 A;  4B08 A;  2BWB A;  1WJ7 A;  2L7I A;  4FWD A;  4FCT A;  4DV1 M;  2CWB A;  4JN6 A;  1HT2 E;  4IBI A;  4OU7 A;  2CHQ A;  2L6O A;  4CJ6 A;  2V1U A;  2ZAO A;  4AI6 A;  1CUK A;  1S3S A;  2OOA A;  3K9P A;  3TWL A;  2ZBK B;  4IBC A;  4LJ8 A;  4XK8 F;  2CE7 A;  2I7N A;  2EO2 A;  2ZTD A;  3I01 M;  4DUY M;  1QDT A;  2LVO C;  3SHF A;  3WHK A;  2KA6 B;  1ORY B;  3J7A S;  3L27 A;  2CUZ A;  2ZTC A;  1NHG C;  4LF9 M;  2ZAM A;  2XZU A;  1PJQ A;  3E46 A;  1E94 E;  1H6U A;  1SXJ E;  2ERC A;  2N35 A;  5GKN A;  4NXM M;  5KPT A;  2OQ4 A;  1XC8 A;  3HZJ A;  2JY7 A;  4GC9 A;  5KPR A;  1K3W A;  4LGY A;  3SMP A;  3GLH A;  2XH9 A;  3FUV A;  5ITY A;  4BBA A;  2DHY A;  2EUC A;  5EXT A;  1R5L A;  2DAK A;  4OX9 M;  3FUX A;  3OTO M;  1IY0 A;  2K0B X;  1L2B A;  1IFY A;  1IXZ A;  2R18 A;  3K9O A;  2D7E A;  2DWN A;  2CV1 A;  1HR0 M;  1RU3 A;  4I8O A;  4LF7 M;  3TPZ A;  5C1B A;  2R45 A;  2DAG A;  4JYA M;  3U6C A;  2L4E A;  2Y0T A;  3QYB A;  3TE6 A;  4B3M M;  3HX3 A;  1UM8 A;  2X8A A;  2KDL A;  1NVM A;  4X62 M;  1IN6 A;  4QNR A;  3C9P A;  1XWI A;  1R2Y A;  3HWS A;  4IJE A;  1ZMW A;  3NWL A;  2QCU A;  1HNW M;  4YHH M;  2HCB A;  3RGP A;  3UGJ A;  5FLX S;  3GQ3 A;  1OJL A;  1VEK A;  4DR3 M;  3IHP A;  3GP1 A;  4WP2 A;  3TWM A;  3VDU A;  2J7N A;  1T3T A;  3AOE C;  2KXE A;  1Q02 A;  4LJ9 A;  2LVA A;  3SAT A;  3GPY A;  1G71 A;  1YUB A;  5IWA M;  4GHL A;  2QBY B;  3FKE A;  5BR8 M;  1JQJ C;  3KFU G;  3U6D A;  2F5Q A;  3ZH9 B;  2D7G A;  4OVZ A;  2Z7J A;  1TGU A;  3C58 A;  2XEP A;  1JB0 F;  4AQY M;  1N78 A;  2FNA A;  2C98 A;  4XBO A;  1YSY A;  2FFJ A;  1QUT A;  2R46 A;  2Y20 A;  4RF1 A;  1ZMV A;  1KSF X;  1L2D A;  3A45 A;  3AOG A;  4DUZ M;  2OOB A;  1NSF A;  1SG9 A;  3FRH A;  2OPF A;  3W0F A;  3U6E A;  2HWJ A;  1I94 M;  4GKK M;  1VQ1 A;  5JI3 E;  2DI0 A;  2DKL A;  4LFC M;  2UU9 M;  4IBB A;  3VLF B;  5H37 D;  1R6B X;  4PDI A;  2DNA A;  2UUC M;  3U60 A;  2EKF A;  4P17 A;  1WGN A;  2OO9 A;  3LQR A;  2VF7 A;  3NBX X;  4Y28 F;  5LMN M;  1G59 A;  1IY2 A;  4NXN M;  3GO8 A;  4DV0 M;  4PCZ A;  2JP7 A;  3VK8 A;  2MRO B;  3H4M A;  1MU5 A;  2XGN A;  5EP4 A;  3FYC A;  1N36 M;  1NJF A;  1NY5 A;  1JR3 E;  4MH0 E;  4BLC A;  3CF0 A;  1SXJ B;  4DV4 M;  4IBK A;  5DFL A;  3ZQJ A;  2G5G X;  3A42 A;  1ZMU A;  2X4A A;  2B3T A;  2DZL A;  2LTU A;  1W5T A;  1OIZ A;  4PT5 A;  2Z8Y M;  3L2A A;  5ITR A;  2C9O A;  2YR0 A;  3GRV A;  1HT1 E;  2JUJ A;  3GLF B;  3FTF A;  3CGW A;  3EIE A;  1GO5 A;  2L7H A;  2WSF F;  3UZU A;  2K6B A;  4CHT B;  2VQE M;  3KOZ E;  3M6A A;  3V76 A;  3AJI B;  2JA2 A;  3SMS A;  3FUW A;  4UN2 B;  2Z3X A;  2CV2 A;  1NJG A;  1ZQ9 A;  1QAN A;  2FH0 A;  2KZS A;  4LF6 M;  2YNM D;  4GRI A;  4AG6 A;  1QVR A;  4F1I A;  3SBJ A;  2GNO A;  1QYR A;  3L26 A;  3KS4 A;  2KZU A;  2C96 A;  1D0M A;  4F2L A;  3K2L A;  4REZ A;  1VDD A;  2LVN C;  1WXQ A;  4KOD A;  2LWX A;  4FCW A;  1IQP A;  4EIW A;  2ZM6 M;  3SAR A;  3AL0 C;  2CHV A;  3T1Y M;  3FD9 A;  1ZAE A;  4Z6Y A;  4GIT A;  4AW4 A;  1XMQ M;  3A46 A;  4B3R M;  2DAI A;  1T6O A;  4L15 A;  2E5L M;  1DO0 A;  4MB7 A;  2XZF A;  1SXJ A;  3T6P A;  1JR3 D;  3HHZ A;  4B7G A;  1N33 M;  1C7Y A;  4R71 A;  1PRB A;  4KHP M;  2CFO A;  2KNA A;  2RKO A;  1QAQ A;  3R9X B;  1N75 A;  1XXH E;  3U6S A;  1L2C A;  5KQ8 A;  3AV0 A;  1MN3 A;  2VF8 A;  4IBF A;  5FTK A;  1R2Z A;  4L78 A;  5BPV A;  1L1T A;  4X65 M;  2MGW A;  1MJG M;  2BJW A;  4R7G A;  4QHS A;  4JI1 M;  3LCU A;  1OAO C;  3LCV B;  2VII A;  4RNA A;  1TH2 A;  5ITT A;  2MH8 A;  5KQD A;  1QQW A;  3KW6 A;  2D7H A;  3W68 A;  1KFV A;  3C3E A;  3KSJ A;  8CAT A;  3HKP A;  2LNH C;  2FOI C;  4GC5 A;  5EP2 A;  5IZ7 D;  3J7B A;  1E32 A;  3FUU A;  4CGY B;  4L16 A;  1DGF A;  2F4V M;  4DV7 M;  3QYE A;  1XXH B;  1TDZ A;  4CIZ A;  2EKK A;  4GKJ M;  3LW5 F;  2VDB B;  4FW9 A;  3SHG B;  4B7F A;  1J7K A;  4LG2 A;  2KHH A;  1Q3C A;  4B7H A;  4YY3 M;  1DV0 A;  1AIP C;  3I4V A;  5EXX A;  4NSO B;  1NY6 A;  2JXN A;  4PDG A;  3FTE A;  3B7Q A;  4JI3 M;  3AOE A;  4LJA A;  1GKI A;  3GLI A;  2BJV A;  1F4I A;  2QPA A;  2K9D A;  2YFQ A;  3B9P A;  3PNY A;  3U6M A;  1NO1 A;  1R4G A;  1IN7 A;  5EQT A;  3SYK A;  3HHY A;  3TQS A;  4JI6 M;  4IBD A;  1P3Q Q;  4RF0 A;  1PM5 A;  4G4Q A;  3KS8 A;  5EP3 A;  1MX0 A;  3LVV A;  5IRE B;  1N32 M;  4GEW A;  1Y8G A;  3KP1 E;  4JXJ A;  3MJ5 A;  4L4U A;  2RRU A;  3U61 A;  2DWM A;  5ITU A;  2FS1 A;  2QHO B;  2LBC A;  4II7 A;  2UUB M;  1D2N A;  1N77 A;  4QOS A;  3ILK A;  1N34 M;  1VEJ A;  4FWH A;  1L8Q A;  1LV7 A;  3BXW A;  2O25 A;  3DOA A;  4IBJ A;  4R3D A;  4LF4 M;  3KOY E;  5EP1 A;  1KYI A;  1QZE A;  5L8R F;  2DAE A;  5EXS A;  2XFS A;  3J27 B;  2R65 A;  2CRU A;  1G8P A;  1X37 A;  3CTW B;  4MGI E;  3PNV A;  3ZC7 B;  2XLJ A;  4LFB M;  1G4A E;  3HJS A;  4MM3 B;  3GQ5 A;  1V92 A;  2R0I A;  1G3I A;  1IXR C;  2DHR A;  3BBZ A;  1YE9 A;  4G6Z A;  3UMM A;  2DXI A;  3NBI A;  1Z5B A;  3GPP A;  2XSZ A;  4RKU F;  1XNQ M;  3PFI A;  1EIJ A;  3JAM S;  4MGY E;  1D0K A;  3EIH A;  3HU3 A;  3I4Y A;  4HEO A;  2UXB M;  2DVW B;  4LF8 M;  2JY5 A;  4QHT A;  1DGG A;  3U6O A;  2DWL A;  2QQ8 A;  3Q8X A;  4LJ4 A;  1TF0 B;  4ANR A;  1TH3 A;  4Z8X A;  3KDS E;  2KRU A;  1OFH A;  1UFZ A;  3DZD A;  2Y0Q A;  4JV5 M;  3AKZ A;  4JI7 M;  1Z6T A;  3M0E A;  2UXD M;  3K1J A;  2HAK A;  4DR2 M;  1G41 A;  4HL4 A;  4D81 A;  3DA1 A;  3B7N A;  3LVW A;  3FRI A;  5FTJ A;  2LHG A;  2L4F A;  2Z4R A;  3CF6 E;  3SC3 A;  4B3S M;  4B3T M;  1OFI A;  1XB2 B;  2LXE A;  2G3Q A;  4JI2 M;  4NOO B;  2R4J A;  3UJN A;  3PXG A;  4Q7J A; 
#chains in the Genus database with same CATH homology
 3RFW A;  1SXJ C;  4IBG A;  4XGI A;  4LJ7 A;  1FNN A;  1J5E M;  3L28 A;  2X49 A;  4I5S A;  1HQY E;  2Q2E B;  4I4L A;  1IXS B;  3U6L A;  4DR7 M;  3VKG A;  4W5W A;  1IBL M;  3DFZ A;  3KOX E;  4NRV A;  1K82 A;  2V6Z M;  3SAS A;  4ITQ A;  4M9S A;  5E6J A;  4HLQ A;  3GRR A;  3GPX A;  3W0L B;  1IN5 A;  2Z4S A;  4I81 A;  5DNY A;  3J81 S;  4LRT A;  3JR5 A;  1DGB A;  4NRW A;  1GVN A;  2KRK A;  1W5S A;  2QZ4 A;  4KO8 A;  2W82 A;  4M9Z A;  1J09 A;  4FWG A;  2EA0 A;  1Q39 A;  3KXE C;  4DR5 M;  4LF5 M;  3HJQ A;  3FTC A;  3L29 A;  4IBE A;  3U6P A;  4G4O A;  2F5O A;  3I51 A;  4X66 M;  1DGH B;  4JI0 M;  4LJ6 A;  4WUR A;  3RE8 A;  3K92 A;  3A98 B;  3M7G A;  3KP0 E;  4DV2 M;  5IT9 S;  4GHA A;  4DV3 M;  2R62 A;  1XXH A;  3SFZ A;  3WHL A;  3R8F A;  3AFH A;  4G4R A;  4DR1 M;  2F5S A;  4M9X A;  1GL7 A;  4JI4 M;  1IN4 A;  1DGH A;  2Y21 A;  2L09 A;  4OW0 A;  3U61 B;  3BOS A;  3GRU A;  1IY1 A;  1XHB A;  3U60 B;  4G4N A;  5ITX A;  3RGS A;  3D8L A;  3LQQ A;  4NSR A;  3TL4 X;  2M60 A;  2QP9 X;  3GLH B;  4KLN A;  5FSW A;  2F5N A;  3E4R A;  4P16 A;  2HL7 A;  3THG A;  4TUW A;  1TDH A;  1R7R A;  3LMM A;  4LCB A;  4MGK E;  4D80 A;  2QEN A;  1QAO A;  4LGM A;  3GLG B;  5JI2 E;  5DYG A;  1Q3B A;  4ZPX A;  3KSX A;  4QOZ C;  3GLF A;  1GL6 A;  2HKJ A;  3SAU A;  3HU1 A;  3KOW E;  4LZZ A;  1SXJ D;  5ITQ A;  2LH0 A;  4L8R C;  4MGZ E;  2C99 A;  2KEB A;  5KO3 A;  2BNK A;  4QNM A;  5ITX E;  3UK6 A;  2CHG A;  3SAW A;  2RGO A;  3K8Z A;  2G8L A;  2C9C A;  3MHV C;  4FD2 A;  2R4E A;  4M0W A;  4BB9 A;  4LRS A;  4K0K M;  2O5R A;  3TWK A;  2DWZ B;  2HHH M;  2RGH A;  1IM2 A;  4LY6 A;  5FTM A;  1IBM M;  2FE8 A;  3HU2 A;  3HGI A;  1L1Z A;  2V1C A;  4PD2 A;  2QBY A;  3HHW A;  4FVM A;  4D82 A;  4DR4 M;  2ZAN A;  2XFT A;  2NQ8 C;  4LZJ A;  2DZN B;  4AKH A;  5DYI A;  3GPU A;  5C18 A;  2F5P A;  1HNX M;  1NHW C;  4IIW A;  3VFD A;  3PVS A;  1C1K A;  1Z59 A;  3FTD A;  3T1H M;  3VK7 A;  1K3X A;  1GLN A;  4AKI A;  3FYD A;  5FTN A;  3GLG A;  3SAV A;  4DV5 M;  3L25 A;  5KPZ A;  3HHX A;  4AG5 A;  3KVW A;  1PJI A;  4CIS A;  2XSZ D;  1E9R A;  4FCV A;  2I7P A;  3VKH A;  2J7O A;  3HJ8 A;  1NNU C;  4NL4 H;  3JR4 A;  1DO2 A;  4LJ5 A;  4AZF A;  2AHM A;  1Z5C A;  4MGH A;  1FJG M;  2H1R A;  4M0D A;  3SYL A;  3QAU A;  4JI5 M;  3IG5 A;  1NNJ A;  2UXC M;  3U5Z A;  5LMU M;  4GH9 A;  2CV0 A;  3GLI B;  3FUT A;  2M5Z A;  2YQZ A;  5F3W A;  2UUA M;  2XF3 A;  3T38 A;  3CF2 A;  2DZO B;  4DR6 M;  2K47 A;  2P5T A;  1I4W A;  1TH4 A;  3J2P B;  1XMO M;  4GIP A;  3D8B A;  3J80 S;  1QZM A;  4GMQ A;  1IBK M;  4AKG A;  2VQF M;  3QWL A;  4JI8 M;  2CEA A;  4WW0 A;  4S12 A;  3T15 A;  4OVZ B;  4X64 M;  3MK6 A;  5E26 A;  1EE8 A;  3E9S A;  1QAM A;  5EJC A;  3U6Q A;  1Z5A A;  4DV6 M;  1XNR M;  1E9S A;  5A2Q S;  1IN8 A;  1HNZ M;  1HQC A;  4IJF A;  3GRY A;  1PJJ A;  5FTL A;  3VDP A;  4A3V B;  1JR3 A;  5EXP A;  2C5R A;  3GQ4 A;  7CAT A;  3IG8 A;  2A5Y B;  3U5Z B;  4LFA M;  3ZCB B;  2KW0 A;  4B08 A;  4FWD A;  2L7I A;  4FCT A;  4DV1 M;  4JN6 A;  1HT2 E;  4IBI A;  4OU7 A;  2CHQ A;  2L6O A;  2V1U A;  2ZAO A;  4AI6 A;  1S3S A;  3TWL A;  2ZBK B;  4IBC A;  4LJ8 A;  4DUY M;  2CE7 A;  2I7N A;  2EO2 A;  3SHF A;  3WHK A;  2KA6 B;  1ORY B;  3J7A S;  3L27 A;  2CUZ A;  1NHG C;  4LF9 M;  2ZAM A;  2XZU A;  1E94 E;  1H6U A;  1SXJ E;  2ERC A;  5GKN A;  4NXM M;  5KPT A;  2OQ4 A;  1XC8 A;  4GC9 A;  5KPR A;  1K3W A;  4LGY A;  3SMP A;  3GLH A;  2XH9 A;  3FUV A;  5ITY A;  4BBA A;  2EUC A;  5EXT A;  4OX9 M;  3FUX A;  3OTO M;  1IY0 A;  1L2B A;  1IXZ A;  2R18 A;  2D7E A;  2DWN A;  2CV1 A;  1HR0 M;  4I8O A;  4LF7 M;  3TPZ A;  5C1B A;  2R45 A;  4JYA M;  3U6C A;  2Y0T A;  3TE6 A;  4B3M M;  1UM8 A;  2X8A A;  1NVM A;  4X62 M;  1IN6 A;  4QNR A;  1XWI A;  1R2Y A;  3HWS A;  4IJE A;  3NWL A;  2QCU A;  1HNW M;  4YHH M;  2HCB A;  3RGP A;  3UGJ A;  5FLX S;  3GQ3 A;  1OJL A;  4DR3 M;  3GP1 A;  3TWM A;  3VDU A;  2J7N A;  1T3T A;  3AOE C;  2KXE A;  4LJ9 A;  3SAT A;  3GPY A;  1YUB A;  5IWA M;  4GHL A;  2QBY B;  3FKE A;  5BR8 M;  1JQJ C;  3KFU G;  3U6D A;  2F5Q A;  3ZH9 B;  2D7G A;  4OVZ A;  2Z7J A;  1TGU A;  3C58 A;  2XEP A;  4AQY M;  1N78 A;  2FNA A;  2C98 A;  4XBO A;  1YSY A;  2FFJ A;  2Y20 A;  2R46 A;  4RF1 A;  1L2D A;  1KSF X;  3A45 A;  3AOG A;  4DUZ M;  1NSF A;  2OPF A;  3U6E A;  4GKK M;  3W0F A;  1I94 M;  5JI3 E;  4LFC M;  2UU9 M;  4IBB A;  3VLF B;  5H37 D;  1R6B X;  4PDI A;  2UUC M;  3U60 A;  5LMN M;  3LQR A;  1G59 A;  1IY2 A;  4NXN M;  3GO8 A;  4DV0 M;  4PCZ A;  3VK8 A;  3H4M A;  1MU5 A;  2XGN A;  5EP4 A;  3FYC A;  1N36 M;  1NJF A;  1NY5 A;  4MH0 E;  4BLC A;  3CF0 A;  1SXJ B;  4DV4 M;  4IBK A;  2G5G X;  3A42 A;  2X4A A;  1W5T A;  4PT5 A;  3L2A A;  5ITR A;  2C9O A;  2YR0 A;  3GRV A;  1HT1 E;  3GLF B;  3FTF A;  3EIE A;  2L7H A;  3UZU A;  2VQE M;  4CHT B;  3KOZ E;  3M6A A;  3AJI B;  2JA2 A;  3SMS A;  3FUW A;  2Z3X A;  2CV2 A;  1NJG A;  1ZQ9 A;  1QAN A;  2KZS A;  4LF6 M;  2YNM D;  4GRI A;  4AG6 A;  1QVR A;  3SBJ A;  1QYR A;  3L26 A;  3KS4 A;  2KZU A;  2C96 A;  3K2L A;  4REZ A;  1VDD A;  3SAR A;  1WXQ A;  4KOD A;  2LWX A;  4FCW A;  1IQP A;  4EIW A;  2ZM6 M;  3AL0 C;  2CHV A;  3T1Y M;  3FD9 A;  1ZAE A;  4Z6Y A;  4GIT A;  4AW4 A;  1XMQ M;  3A46 A;  4B3R M;  4L15 A;  2E5L M;  1DO0 A;  4MB7 A;  2XZF A;  1SXJ A;  1JR3 D;  3HHZ A;  4B7G A;  1N33 M;  4KHP M;  2CFO A;  2RKO A;  1QAQ A;  3R9X B;  1N75 A;  3U6S A;  1L2C A;  5KQ8 A;  3AV0 A;  4IBF A;  5FTK A;  1R2Z A;  4L78 A;  5BPV A;  1L1T A;  4X65 M;  2BJW A;  4R7G A;  4QHS A;  4JI1 M;  2VII A;  4RNA A;  1TH2 A;  5ITT A;  5KQD A;  1QQW A;  3KW6 A;  2D7H A;  1KFV A;  3KSJ A;  8CAT A;  3HKP A;  2LNH C;  2FOI C;  4GC5 A;  5EP2 A;  5IZ7 D;  3J7B A;  1E32 A;  3FUU A;  4CGY B;  4L16 A;  1DGF A;  2F4V M;  4DV7 M;  1XXH B;  1TDZ A;  4GKJ M;  4FW9 A;  3SHG B;  4B7F A;  1J7K A;  4LG2 A;  1Q3C A;  4B7H A;  4YY3 M;  5EXX A;  3I4V A;  4PDG A;  4NSO B;  1NY6 A;  3FTE A;  4JI3 M;  3AOE A;  4LJA A;  1GKI A;  3GLI A;  2BJV A;  2QPA A;  2YFQ A;  3B9P A;  3PNY A;  3U6M A;  1IN7 A;  5EQT A;  3SYK A;  3HHY A;  3TQS A;  4JI6 M;  4IBD A;  4RF0 A;  1PM5 A;  3KS8 A;  4G4Q A;  5EP3 A;  1MX0 A;  3LVV A;  5IRE B;  1N32 M;  3KP1 E;  4JXJ A;  3MJ5 A;  4L4U A;  3U61 A;  2DWM A;  5ITU A;  4II7 A;  2UUB M;  1D2N A;  1N77 A;  4QOS A;  3ILK A;  1N34 M;  4FWH A;  1L8Q A;  1LV7 A;  4IBJ A;  3DOA A;  4R3D A;  4LF4 M;  3KOY E;  5EP1 A;  1KYI A;  5EXS A;  2XFS A;  3J27 B;  2R65 A;  3CTW B;  1G8P A;  1X37 A;  4MGI E;  3ZC7 B;  3PNV A;  2XLJ A;  4LFB M;  1G4A E;  3HJS A;  4MM3 B;  3GQ5 A;  1G3I A;  1IXR C;  2DHR A;  4G6Z A;  1YE9 A;  3UMM A;  2DXI A;  3NBI A;  1Z5B A;  3GPP A;  2XSZ A;  1XNQ M;  3PFI A;  3JAM S;  4MGY E;  3EIH A;  3HU3 A;  3I4Y A;  2UXB M;  2DVW B;  4LF8 M;  4QHT A;  1DGG A;  3U6O A;  2DWL A;  3Q8X A;  4LJ4 A;  1TH3 A;  4Z8X A;  3KDS E;  2KRU A;  1OFH A;  3DZD A;  2Y0Q A;  4JV5 M;  3AKZ A;  4JI7 M;  1Z6T A;  3M0E A;  2UXD M;  3K1J A;  4DR2 M;  1G41 A;  4HL4 A;  4D81 A;  3DA1 A;  5FTJ A;  3LVW A;  3SC3 A;  4B3T M;  2Z4R A;  3CF6 E;  4B3S M;  1OFI A;  2LXE A;  4JI2 M;  4NOO B;  2R4J A;  3UJN A;  3PXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...