4GMSH

Crystal structure of heterosubtypic fab s139/1 in complex with influenza a h3 hemagglutinin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
EVQLQQSGTELKKPGASVKISCKATGYTFSSYWIEWIKQRPGHGLEWIGEILPEIGMTNYNENFKGKATFTANTSSNTVYMQLSSLTSEDSAVYYCARPYDYSWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 39
structure length 218
sequence length 218
chains with identical sequence I, J
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmsH02
3VMOA 2FBOJ 2C7UB 1KJMB 5K9QG 3C9NB 1D5MA 3EJZC 2NW2B 3BZ4B 2HT4C 3UJIH 1OAUL 4YHLH 2ATKB 3MRMA 1A9EA 2J8HA 5ITFA 3WFCH 5LJYH 5CINH 2VC2H 4OCXH 1M7DA 1I7UB 2CR3A 1CDCA 2Q6WB 5HHOB 3UDWA 3QR2A 3DIFB 2YEZB 5J6GA 1S7UB 2YRLA 4NQSB 5AYUL 1AD0B 2XI9A 4M62L 2OL3H 5E6ZA 3BD3A 1R6VA 3STLB 1YEHH 3CAFA 2NY3C 4ZOBA 2VDOL 3SO5A 2YHGA 5KVEH 4NZJA 3DBXA 3FB6A 4YC2C 1HILA 4O9HL 1T7WA 2YZ1A 2G75A 1I1FB 4OBRA 1JRHL 1SEBA 1R24A 1P84K 4X4ZA 5I76B 2ED9A 3KPSE 3AREC 4OJFL 1KJ2A 2JKXA 3EFFB 4NJAL 4OD1H 5F88A 1KPVB 1D5IH 1EERB 3NCJL 4CUCA 1LP9A 1D5MB 3MV9D 3MRMB 1A9EB 1L0QA 1V3LA 5E6IA 1OM3H 3H9HA 2CGRL 1PAMA 3CPLA 3DURA 1R5VB 1NBVH 4YHIA 4QYOA 3EYQD 1QBLL 1OP5K 4DUXA 4P9HC 1MCKA 1KULA 4XI5D 1KN4H 4XH2A 5T1KA 3UZQA 4Y4KA 5HYFA 2VH5H 4OZFG 4NN7B 4LF3B 3HI6L 4N5UA 1KT2A 1FJ1A 4G43A 3BT2H 4G9FD 4QCIA 4GRLA 3EYUH 2J5LC 1RU9H 3DBXB 1S5HA 3FB6B 3QIUD 2G75B 2O5ZH 1CK0L 3CX5K 3ZDYE 1SEBB 4UDTA 3E2HC 1R24B 3F7RA 4XP9H 1ZLVH 5CIPH 1KJ2B 1N59A 1QSFA 3LHPH 2F5AL 2EE2A 3TZVD 2B7DT 1PD6A 1LP9B 4K23L 1LILA 1T1XB 5T1KD 4Y4KD 2M2DA 3QIUB 5TFSL 5E6IB 4NZDA 4WHYG 5EDXA 1WCBA 1BGXH 5FM8A 3CPLB 2F15A 3DURB 2CDFB 2E7LA 5D2NC 4YHIB 3TZVB 2EC9T 3EDJA 5HVHB 1RAMA 3MXWL 3LMJL 1KYOJ 5CJOH 1IC4H 3ARPA 4XH2B 5T1KB 2PO6C 4Y4KB 1Z9SA 5DMJB 4Z7OF 4P23C 3VFWA 3ZL4L 4Z7WE 1N0XH 4Q6YA 1KT2B 1AI1L 3NCEB 5E99L 4CMHB 4N8PA 5DJCA 1QSFD 1MRCL 1FJ1B 3KG5A 4G43B 5F89A 4QCIB 4GRLB 3K0WA 2PYED 4U31A 1Y6NR 1S5HB 3NZ8A 5GGQL 3VWJC 2KKQA 5FDWB 3WFEL 3ZKNC 3K4AA 2VO5A 3BAEL 3KNBA 1UGNA 5F9OL 1QSFB 1X5LA 1JWUA 5ESQA 4XCEA 4D3CH 3X14A 2PYEB 1RJLA 4G8FA 4HIEA 5DWUL 4KI5E 4UTBH 2C1OA 3HNVH 1OB1A 4WUUE 3ET9F 3LS5L 3QXWA 2OX5A 1UM6H 4LCIL 1WCBB 1KCUL 3K1KC 4UTAL 1K4DB 2XZZA 1WZ1H 5F1SA 3UPRB 3IAGC 2XA8H 3BZEA 1QTYT 4X80L 4RMUA 1QSVA 4HWEH 2ZKHL 4Q9CA 1G6RA 2VQUA 3VFWB 1A7PH 4XPGH 4HUWA 2E9JA 4WCYL 3WS6A 5DJCB 4JO3H 2NXZB 4PJAE 1LE9B 5F89B 1EHAA 2YD8A 1IL1A 3CLEH 3AMLA 5D9SA 4N5ED 5IW3A 1A4KA 2XPGA 3OG4B 1IC1A 3F12A 4KKCC 3KNBB 1HYRC 4DOHB 5AZ2L 1DQMH 1MCPL 1JWUB 5ESQB 4LSSL 4UIMA 1OP5H 4Z9KB 1RJLB 1KPRA 4G8FB 4HIEB 4MAYA 2C1OB 1GYAA 1OB1B 2WWMD 2D4FA 4IMKA 5DS8A 1LDPL 5FV2A 3KPPA 5HDBF 4BFGA 5KAQF 2HH0H 2BDNH 5LCVL 1KCKA 4ZS6C 1RUKH 2CIKB 3GSNH 1IAII 1BLNA 2D4DA 3OAZH 4M93C 5F7YC 2E6JA 5A2FA 3B5HA 3J7HA 3VFVA 1G6RB 1MUJA 5D71L 3BW9A 4QF1A 4KK5C 4HUWB 4TUKH 3O2WH 1FO0H 1H0DA 1WGOA 4Z95H 1IL1B 1EHNA 4MAYD 1DQQA 5I74B 5D9SB 5CJXC 2FEEL 1T03L 2WNGA 1G9NL 4Q9RH 1A4KB 2XPGB 1F3RB 5EOCL 2FH8A 3F12B 1NEZA 4PREB 1RPQA 4PJXF 5F72S 3T08A 4UIMB 1FLTX 1INEL 1RVFL 4WEUD 3A0OA 3UTTE 4KRPC 1UWGL 1MLBB 4MAYB 1CLYL 4GKZA 3KPOA 1OF2A 3KPPB 3AXLA 1YC7A 4KHTL 1UCTA 4RGMC 4DN4H 5ELIA 2PNDA 4NJ9H 1OAYH 1N7MH 3BN9D 1BLNB 4D0CB 1MI5A 4QXGL 5DJDA 4EDWL 1SJHA 1BX2B 3D85A 3VFVB 1MJJA 1MUJB 4LQ1A 2Q3ZA 3BW9B 3QCVH 4QF1B 4IOFC 3PHOA 4XHQA 4X6CF 3HC0A 3FZUC 4XPBH 4R96A 1H0DB 2A77H 5DD0H 5CWSA 3SN6N 1SYSA 3ETBF 3TIDB 4YXKH 1GZPA 2ZSVA 4OF0A 1QFWI 4IRSC 1NEZB 2NY7L 4Z7UA 3HN3A 3CDCA 4XB8A 3FONA 1MI5D 1T83A 3ZLQC 4WJ5A 4GKZB 3KPOB 4CN1A 1OF2B 3CJJA 12E8H 3AXLB 1EMTL 2XQBH 2VABB 3TYGH 2LU3A 5KZCD 1PBYA 5KSAC 3MBXH 5DHVA 4YDIH 1RZ7L 1MI5B 3O4OB 5DJDB 1MJJB 4HH8A 5I1DB 1V3JA 1BQUA 3PHOB 3HC0B 3KHOA 3R1GL 4WI9A 5KZCB 4R96B 3RAJH 4UB0L 1SYSB 1KN2H 3NFSH 4JLRA 5GGTH 5ILTL 5CCKL 1GZPB 2ZSVB 3D9AL 3G5ZB 4QHMA 3TH3T 1CLCA 4KKAC 3MRLA 4KUCD 1V05A 2DLFH 3FONB 3ZO0A 3GMMB 5FFLA 4B7IA 1Q1JH 2QSCH 4LOUD 2DDQH 3QRGH 3ILQC 4OFKA 4Q6IB 1KB5H 4JKKA 3IRZA 2EDFA 1A7NL 3NA4A 5KS9E 3QA3A 5D7LE 3GSQA 4QLRA 5CP3H 4Y8DC 2DTML 3BKJH 5J11C 4Z7NE 1P69B 1P4IL 3G6AB 5K59F 5T1DH 2Z91A 5H2BA 1XGUB 2XTLA 3VI3E 4Z0BH 2V9QA 5C6PB 2OXHA 3B9VA 3VG9B 1LK2B 4ODUA 2OJZH 3ARUA 3NCYP 1R3JA 3MFFA 3N85H 4JLRB 3MJ9A 5DO2C 5DJ8A 4LK4A 5GGSA 2VXTL 1EAPB 4O02H 4QHMB 3ULSA 3V7AE 5GZOD 5EU6D 3PQYE 3U7WL 3NA9H 4X9GA 1FNSL 1KC5L 2EO1A 1F4WL 4RGNE 2EXYC 5D2LA 3OPZL 5JXED 3QZWA 1NGZA 1LE5A 2EZ0C 4CU6A 5EU6B 1I8LA 4LLMA 3KPRE 5EIVA 1CGVA 1DE4A 1YNKL 3QA3B 3GSQB 4BZ1L 2Z92A 5IW1A 1T1WB 1CE1L 4GBXA 2OR7A 1FBIH 4YDKL 3ARFD 4FQPA 5J1SC 1L9MA 5DVOA 2H1PH 4LVEA 4G7VL 4YZFF 1BJMA 2MOVA 3WHE1 4ODUB 3P73A 5F6IC 2VWEC 2Z8WC 1R3JB 1D5BB 2DBLL 3MFFB 2VZ3A 1UKQA 4FQXC 4NWTL 5DJ8B 4K71C 5GGSB 3ARFB 2IMMA 3E0GA 3ULSB 3P0YL 4XCFH 3S3JA 3OJ2C 1QFPA 4TOYL 3S9DB 3TA3C 3OF6D 5IVXE 4X5XA 4GBXD 1TQCC 1FYHB 5EA0L 5HSFA 1UH3A 3T3PF 3QZWB 1NGZB 3DETD 1LE5B 4XNMA 2Y23A 3C2AL 4PJIF 4CVZA 4CN4A 4N8CH 5D5MF 4LLMB 4KMQA 3MNWA 2YD5A 2DIBA 5DEZA 4KU1A 1F4XH 1Q94A 1DE4B 5EG6C 3IJSA 2V2WA 5HI3C 3KDMA 5IW1B 3LEXA 4GBXB 1I85C 2NX5A 3W11C 3ZSSA 3N50A 2NZ9C 1CT8B 4G9DB 5JW4Q 2WUBL 1YPZF 3NIGF 2OJEA 4H88H 3P73B 4MD5B 4M3KB 4PTUA 3BPCA 4JB9L 4I0PC 3MCG1 1BBDH 4I4WB 4CRPA 5DJAA 5B8CA 1ZTXH 5J8OA 1IBGL 1I7RA 1OQXA 1WC7A 4AQOA 5C08A 2MPAL 1KIRA 3VDCA 4ZOCA 1CXHA 2BXZA 2BSRA 4P49A 2NX5D 1ZLUK 5JW5A 5CEZD 1ORQA 2V2TA 4PG9A 4XNMB 5IR1A 2XT1B 1WIOA 4FXLA 4FZ8H 3VGEA 1KACB 4LSQL 4G6KH 1V3KA 3TNMA 2LV4A 3MNWB 3WD5H 4QRQA 5KSVA 1K2DA 1Q94B 4R4BA 5C2BH 3IJSB 4S1QL 2BSSA 2V2WB 8CGTA 3KDMB 4HMEA 3LEXB 4FFWC 2NX5B 4OSUH 4G8IA 3FKUS 2DLTA 3DV6A 5DRXA 4HGWA 3NABH 1JVKA 2D9QB 3T0EA 3OTTA 2EDHA 5IQ7H 2OJEB 5C08D 2VLMD 4L1HA 4OLEA 2G5RA 3DVFA 2BFVL 2RR3A 4WEBH 4PTUB 4NM8L 3BPCB 1ZE3C 4C59B 5F9DC 5GRZA 1HKFA 2R39A 3LAFA 4LQFL 5B8CB 1I7RB 1WC7B 5C08B 1FO0B 4HPYL 3TYFA 3D18A 1WBXA 5KTEH 5JW5B 2FECL 3IAQA 1ORQB 2DM7A 4Z7UE 3MODH 1H3TA 2UVEA 4PG9B 5IR1B 1Y6MR 3T0ED 2CUHA 3QPQD 3WKML 4MXQD 4TVPE 4UNTA 2CK2A 5DD6A 4QRQB 1OAZL 5KSVB 1K2DB 1UM5H 2BSSB 3ALWA 4JDVA 2ATPA 4X7CC 3ZMRA 4R9HA 2P43B 4G8IB 3DRQA 4LSDA 4JJ5A 1Q0XH 1KBGH 5TPWL 1TZIA 5C09A 3IDUA 5EBLA 3DV6B 5DRXB 3T0EB 1DEEA 4Y2DA 1BQHA 1UEYA 5E70A 4XNZB 1RMFL 1SVZA 1J1XL 5CBEA 1C5CH 3M45A 32C2B 3QISA 4TYUA 1AR1C 4NZRH 4X8JA 2OCFD 3HZYB 2EYTB 4TNVF 1DBKH 3BKYH 4NHCL 1L4IA 3TYFB 5I8OH 3AC0A 1IKNA 1WBXB 3IKCA 4P99A 3WFHA 1D6EA 1U8JB 5BVPL 2VZSA 4JFFA 1TJHL 4Y2DD 4K94C 1UH2A 1VENA 3D5OF 5DD6B 1EGJH 1HHKA 1GC1C 4FQQA 2Y07H 4JPWL 3MYZA 2E27H 4ZFFA 1TQBC 4JDVB 4H8WL 5IT2L 3DRQB 4KMLB 4QOKD 2YPLA 3UYPA 2IBGA 5EBLB 1NCCL 2R2HA 1DEEB 4Y2DB 1BQHB 1WWWX 4D9LH 3T3ME 5DMIL 4FQHB 5CBEB 3OHXB 1ZLUH 4X9HA 2HJKA 3HE7C 1S9YA 4P57A 5FGBC 5GISL 4JFFD 5JR1L 4X8JB 4WFEE 3BQUD 3KLHC 4KVNH 1N5AB 3AY4A 3T65A 4NQVA 3VXOA 4OD2A 4AIXA 4R97B 3IKCB 4X6DB 1LO2H 1CGSL 3WFHB 1A3RL 1LQSR 5IWLA 5BXFA 4JFFB 5BO1H 5GS0C 1NUDA 3NPSB 3WIIH 1GJIA 3BQUB 3MA9H 3F58H 4XBPA 2QADC 4TSAL 4NWUH 4X0KA 3U4AA 5D2LE 4XX1E 4ORGA 1HHKB 4FQQB 3VRIA 4ZFFB 4R4NC 3AROA 4RMSA 4LGSB 1DP0A 2GUOA 1V7ML 2R2HB 4U3HA 4ZXBC 2HT3D 4CU7A 1MIMH 3QUML 4Y4HC 3L5XL 2Z0BA 1S9YB 2QHRL 5LG1A 3CDFA 1JZ5A 2NYYD 3T65B 1L7IL 3VXOB 2E8ZA 4N9GA 4OD2B 3WDHA 5D1ZA 2DQGH 3ARQA 4K3DL 3NTCL 1KV3A 4CJ1A 3HNTH 4XTRD 3BP5A 2W9DL 2HRPH 5BXFB 1ZT4A 4XBPB 4J2XA 4TUOA 1UM4L 3MGTA 2CD0A 4ORGB 4F58H 4IS6B 3VRIB 5C0EB 1SVCP 4DVRH 3PWLA 2EKJA 3L3KA 4JFYB 5E9DA 1W72L 4ZNCD 1MCOL 3QNZB 2FX8H 3VA2C 5HHNB 3U0TB 1P6FA 1JZ6A 4FFZL 4HCRH 3MJ8A 3MC0A 4Z8FL 4Y4FA 5DQJA 5D1ZD 1PG7L 5F1KC 4N1HB 2FHCA 4F9PA 4O4YL 4V1DA 1NMAL 2PR4L 2E7MA 1JZ8A 4EBQH 3STZA 4N9GB 1MAML 1FL3B 3SE8L 5D1ZB 3QYCA 3BEVB 4I3RH 5I73B 4EZMA 3BP5B 5LGHL 3SKOA 3I2CL 1MHCA 3CFCL 4U7KA 4TUOB 3SJVD 4UIKH 4Y4FD 3MGTB 2ERJC 2AJYH 1G7LA 2CJUH 4OZFH 4JCMA 1MCWW 2PTUA 3GK8H 3VMNA 1NMBL 1QLEL 1IC5L 2B1AH 3C8HA 3BMWA 4CU8A 4YHZH 3DI3B 4V1DD 2MCPL 1LVEA 1QBML 2VXUH 3SJVB 4ZO6A 4Y4FB 1NKOA 3DVGA 4WTZG 1U8QA 2J6EL 2KZWA 3VRJA 4DEPB 5FDYA 5CEYA 3T2NL 5A2KH 5ADOL 4V1DB 3HA0A 1CDUA 2FYYA 3NH7L 5KW9H 3ESVF 5DSCA 3STZB 3MCKA 5EULV 4WHYH 4JANA 5D1XC 4Z7QF 3IDXL 2W0LA 3WXWL 1NCDH 2J8OA 1A1MA 1RURL 2YD2A 2EIEA 3SKOB 1DQJA 3G08B 1CTOA 2OTUB 5BMFL 3QQNA 3QI9A 5E8OA 1E4WL 3KS0H 5HI5C 1J0YA 1JCKA 1S7SA 4PBWD 4U1LA 5BRZD 4G7YH 1PKOA 3CK0H 3O4LE 2H26A 3O3BA 2A83A 1H3XA 1RUML 4P5TC 5IFJA 3WHXA 1NJ9A 2G2RA 3FCTA 5I30L 3JUYA 3GRWL 4NBYB 3DVGB 3RZCC 1U8QB 1JV5A 1OAKL 3O8XA 4WU5A 4F9LC 5C09E 5TQ0L 4NC1C 1MJ8H 4M1DH 3OQ3B 3VRJB 1B88A 1JN6A 2FYYB 4L9LC 3I9GL 3EO0B 3QI9D 2OR8A 5L9DH 1PZ5A 4XRCA 3IXTB 4JANB 3O9WC 4PBVC 2ADFH 2HFGH 4JCLA 1YECL 4MJ2A 1XIWD 4TULL 1A1MB 5L2KE 3WLWD 3ROLB 3L1OH 3MLVH 4K2UL 1E27A 3EHBD 2FNBA 3VXUE 4W6XB 1QLRA 3GBML 2YUWA 3QI9B 1D6VH 2EEAA 1S7SB 4MXWH 5HPOA 4U1LB 3QWRA 2H26B 3AM8C 4HLZG 3O3BB 4H20H 4RMVA 2A83B 4Z7OE 3MJGX 1B0GA 5ALBL 5IFJB 1NGXA 5DVKA 3WHXB 5T3ZL 1NJ9B 5EUOA 3FCTB 3TBSB 3U0WL 2FCBA 3O0RH 2IPUG 2EDXA 2YPLE 4WU5B 3C5SA 4PJ9C 4G42A 4LASL 1YY9D 5FGCB 1JHKH 1JN6B 1DBJH 1N64L 3U2SA 5EORL 3WLBA 4NO3A 2V5RA 1HCFX 3O81A 4XRCB 1INDH 3F65A 3U83A 1I1YA 2XQYK 3E8UL 2AEIT 3BFOA 1OCWH 5F7KC 2F58L 1NLBL 5CJQH 3SGKC 4UILL 1E27B 5KVGL 3S36X 3UJIL 1AQDA 1QLRB 4MA8H 4YHLL 2CR6A 2G5BA 4KXZI 3F7PC 4XXCC 5CINL 2VC2L 4NOBA 4J3XA 1C5BH 4YUEL 1FNAA 4IRJA 1OTTD 4Q58C 3SQOH 4NKDA 1U8MA 3L5HA 1B0GB 3WIFA 2R56H 1EFXA 1BBJB 1NGXB 3PF2A 5GGUA 4ZUSA 5EUOB 5JHDE 1LNUA 1RSFA 5DEGA 1C08A 1BAFH 2GT9B 1DFBH 2OL3L 1NGYA 4LNVA 4Q74A 3GNMH 4ZO8A 3C5SB 1WQVT 3MRHA 4G42B 1YEHL 3NACH 5TDOA 4RIRA 2Q7YA 3L7EA 5HVWA 5KVEL 2A6DA 2MQ3A 1YUHA 2PXYC 3DGGA 5L8LB 3WLBB 2EIZA 3LKNA 4NO3B 4NQUA 1F3DH 3UEZA 2H9GA 1YC8A 1S7VA 2R0LH 4NCC1 1T22A 2VXQH 4IRJD 2WWKT 4K8RC 3HUJF 1FC1A 3QUZC 1D5IL 5HDBE 3EJZD 2HT4D 1BJ1J 2NY4C 1AQDB 5JIKA 2IFFH 5EC1A 2G5BB 2VXSH 1B9ZA 4ZAKC 1FSKC 1JHLL 2MQ0A 4F7EA 1MEXH 2K1MA 4HHAB 3AREA 4IRJB 4U0RB 2BVPA 1U8MB 3WIFB 3CSBA 1EFXB 2F74B 1P2CB 5GGUB 4ZUSB 1YEGH 5DEGB 4YFLI 1ADQA 1NGYB 5E9DE 4OF3A 1HHHA 3BO8B 3MRHB 4UV4H 4I8DA 5TDOB 3CVHH 4RIRB 2Q7YB 3BT2L 3L7EB 2AKRA 1ZAGA 3UXFA 5F9JA 1KGCD 2A6DB 1YUHB 2I25N 3KWWA 3ZYIA 1YJDC 1BD2E 1WFTA 2D31A 5C8JB 2BHZA 1INQA 2EIZB 2YC1A 2O5ZL 4M3JA 1FRGH 6FABH 1S7VB 1CVSC 3ARED 2B0SL 3FQNA 4S0TD 3ULVH 2OQJA 3OKDA 2CSPA 4YC2B 2ZUSA 3QWOA 5EC1B 2FIKA 4K55A 4NFCA 3EAKA 1BGXL 4JM2C 3AREB 3JTTA 1MFBH 3E3QC 4PD4K 4ZTPH 4X6CE 2JIXD 3IFLH 2EXWC 3GJFK 4L4VD 5CJOL 2IAMC 4RWHA 1YMME 1ZWIB 3RRQA 4MQ7B 2PTTB 1N0XL 1HHHB 3VD4A 3VGDA 2HTLC 5J13B 4N90E 1N0LA 5DD3H 5D2NA 2AKRB 3LD8B 3NCBB 5HGBA 5F9JB 3TCLB 4ZUVA 2JIXB 3KWWB 3MRPA 3BH8A 4L4VB 3CFEA 2PO6A 3U48A 3EDDA 5CLTA 1INQB 2YC1B 1BZ9A 4HAGA 5FA3A 4ONGH 4P23A 2XICA 4HQQL 5F7MC 1KTDA 4JM4H 1I9RH 4D3CL 4OZIA 3OKDB 2OQJB 2H3NB 4UTBL 3HNVL 3MACH 3LZFL 5DMGC 5ICXA 3QWOB 3VWJA 5DUMH 4OAWA 3CXHJ 4PYHA 2FIKB 4KJQD 4KK6C 2ORBH 4MHHG 5HYQA 2K7QA 1UM6L 3E2HB 5HI4C 4XP1L 4DGIL 3MJ6A 5SV3A 1FDLH 4XVTH 2XA8L 3P4MA 4NN5C 5IVOA 1YEDA 2PO6D 3EOYG 4HWEL 1KLGA 3FQRA 4P23D 5FUZH 2NY5H 3RPKA 2VDML 3BSZL 3GIVB 1A7PL 2DLIA 4L3EE 2W0KA 2W91A 2MCG1 4C58B 3VI4F 4JO3L 1OSZA 3CCHB 2A73A 2C4XA 5HGBB 3KVQA 3QG7H 4ZUVB 3MRPB 3BH8B 3VWJD 3CFEB 2PO6B 3PXHA 1QZ1A 4P23B 5DYOA 1CXIA 3LB6C 3QDAA 2EO9A 3D0LA 1KTDB 4H1LH 1OAQH 4I9WE 2W07A 1MRDH 4OZIB 1MHHA 1JE6A 2JK5B 5ICXB 1TZHA 3VWJB 4K94L 4K7PX 4OAWB 4UT9H 4LPUA 2AV7A 2IPKA 4EQ3A 3U1SL 3GI9L 2X4TA 2HH0L 4Y0GA 2BDNL 5D70H 5K59E 2VZ1A 1HNFA 3VG0L 3SCMA 3GSNL 4OZGF 4KKLC 3P4MB 1YEDB 4X6BB 3WUWG 4AK1A 4PGEA 3FQRB 1BM3L 2HJLB 5F93C 4E0RB 4TUKL 1OSZB 1YDPA 2A73B 4AY0A 4ZYKA 3SQBA 1WZMA 2PF6A 3VDAA 2HN7A 4Q9RL 4M7JH 1HYSC 4WFHD 5DYOB 1XF3A 2YWYA 3D0LB 1WTLA 2AJ3A 1Z0NA 4C54A 4NSKB 3SCMD 4OT1H 2V6HA 4XAKE 5CJXA 1ZVYA 1MHHB 3UO1H 4JKPH 3QNXA 3MR9B 1TZHB 1J0HA 4KRMB 5BOZG 5K9JL 2AV7B 2IPKB 3FFCA 3D25A 3ESUF 5DJ2A 1UACL 4DN4L 2X4TB 1E4JA 1OAYL 5F70A 1N7ML 4N8VA 2AJZA 3SCMB 4NHUB 4L4TE 3VFSA 1IAMA 4PGEB 1I1AC 3MRIA 3NBNA 3LDBB 3QCVL 3D1MC 1A6TA 4XPBL 1YDPB 1MY7A 4ZYKB 2BMKA 8FABB 2A77L 5DD0L 5EUKA 3TBWA 2HN7B 3UC0H 1GGIH 3U4BL 1YEFH 3FFCD 1XF3B 1PKQB 3FT2A 1KPVA 3CSYB 2KBGA 3T3PE 2J6EA 4PJIE 4QNPE 2PTVA 5DJYA 5D5ME 3B4NA 3TO2A 2FX7L 1MVFA 2HLFC 4LARH 4LLYA 3RVWD 4OFYA 5DA0B 4KPHL 2X7LA 3QHTC 2HKFL 3DO3A 3FFCB 3V52H 3D25B 3GHEH 4IRSA 1W0YT 1Q9KA 2OI9C 5DJ2B 4JO2H 4HC1H 2EH7H 1X5YA 4W6WB 4YDIL 3QUXA 4N8VB 2AJZB 4KRPB 4NQCD 3SEPA 4A6YA 2B2XH 3NIGE 3VFSB 5E8NA 5FOBA 3P4NB 3MRIB 4IOFD 4JFOB 1P4LB 1KIPA 1UYWL 1GGCH 5AD0A 1CZ8H 4RGMB 1CFVH 1A6TB 1CGWA 5KSAA 2BMKB 3QBTB 3C09C 4NQCB 5EUKB 3TBWB 4YHOH 3NFSL 1A0QH 1QP1A 5GGTL 5IMKA 4HXAH 4Y1AE 2NW3A 5T33H 4AM0A 4PRPA 3FT2B 5BZWA 1HEZA 4JPIA 2N7AA 3UYRH 3QUXD 5DJYB 2DLFL 3RGVC 1S7TA 3TO2B 2WP3O 2IANA 3VXME 2EC9U 2CRZA 2QV2A 4LLYB 2D7MA 1KYOK 2D0GA 2X7LB 1ACYH 2DDQL 4IRSB 1Q9KB 3WJJC 4ZD3H 3MRGA 1YNTA 3PGDA 3M1BB 3QUXB 1XR8A 4A6YB 1U92A 1V5JA 4M6OL 3BKJL 1I3UA 4LMQE 4PRPD 1J05A 3BOVA 5T1DL 1AXTH 4OLXH 1KIPB 5AD0B 2J1KA 4EDXB 1CBVL 1EV2E 2W1NA 4GG6F 4BK4A 1F4HA 3KGRA 4GMSH 1U42A 4Z7VA 2DL9A 3T2QA 5JQ6H 3VXSA 5C0JA 4QKXB 5IHBA 5IMKB 2VDKH 1FV1B 2GJ6A 4HKZA 1S9KC 1ZLSH 1JPTH 4O02L 4PRPB 5D2NE 4H25A 3GKZA 4TPRH 3RDTC 4HFUL 2GSIA 5BZWB 3NA9L 1HEZB 3UCRA 4JPIB 3CVHB 2NTFA 5HTSA 2I60H 3T0XA 4AYFA 4BFEA 2NQCA 3SE4C 1S7WA 4LPYA 3LQAC 4AL8H 3ILQD 3ARVA 4QHKI 1MHPH 1R3IH 5EIQA 1YNTB 4KTEH 4ZQKA 2IMNA 1XR8B 1U92B 1BZQK 3VXSD 3TBVA 5EU4A 3B2UC 2OS7A 1FBIL 1AC6A 5FIEA 4K07A 3MZTA 5HD8C 1J05B 2R0WH 5HHXH 2IJ0C 4AEFA 4YXLH 4Z7VB 3SGDI 4MAUH 1I9EA 3VXSB 2VERN 4KDWA 5DO2D 5C0JB 5J11B 2GJ6B 4HKZB 4M7KH 2HA1A 3WL9B 1T5XB 3V5KA 4H25B 5E2JA 4HEME 5BJTA 4XCFL 3ZKXB 2F54E 1NMCC 2GSIB 3VFTA 1P9MC 1QR1A 1JMZA 2NTFB 5HHQA 2EXYD 2DQUH 2GFBA 1S7WB 4FQXA 2EZ0D 1E6OH 2DF3A 4PY7A 2MWCA 3NCMA 4WW1A 2ZUWA 1T66D 5TE7L 3RVTC 2X40A 3MOAH 3ISWA 1HOCA 4ZQKB 4EI5C 3TA3A 1CCZA 5I18H 4LLVA 1T21A 4RAUA 1EFQA 5GGVH 1DUZA 5FAAA 2FO4A 1P5UA 3LEVL 5DK0B 4NQED 4MVBD 5DR5H 3WJLA 4C56A 1I85A 1L7TH 3JWDH 2VLRE 2VL5A 4P46D 3V5KB 1BBDL 5BJTB 3VFTB 1QR1B 2XV6B 4P2RA 4U1SA 5GSRB 5HHQB 4NQEB 2GFBB 1F45A 3EUUA 4UINH 1KOAA 1P5VA 4K71B 4PRIE 2RCSH 4X6FB 3BP4A 4I0PA 3FOMA 4OQTH 2J8UA 4P2QE 4PY7B 4FZ8L 4P46B 4G6KL 3MLPA 1W0WA 1VEOA 4WW1B 4FTVA 4YE4H 5JXAL 4KGJA 1HOCB 4H1LB 5C2BL 3TA3B 3GJFA 4C56D 1TQCB 3W11D 2EDNA 5GXBB 1T21B 3QXTA 4RAUB 5E03A 1DUZB 2B20A 3WIHH 3N9GH 2FO4B 2W0FB 3NABL 1OL0A 1C12A 4DTGH 3VD5A 3S88H 5IKCA 2ICES 2QKIA 4WEBL 3JWOC 3OWEA 2IPUK 4JG0H 5FYKH 4C56B 1ZGLP 3QHZL 1PEWA 3C6LC 2VL5B 1OOAA 3IJHA 5F7LB 1CFBA 4FTVD 4IDLA 4U1SB 4K8RL 5C3LD 5EO9B 3K8LA 4M4PA 3MRKB 4GRWB 1F6LL 4RX4D 3MODL 3BP4B 3FOMB 3L3JA 1UKTA 2J8UB 1UZ6F 1MAJA 4K3EH 3BVNA 3QEGL 5CLWA 4R8WH 3HPLA 4HG4J 4UU9A 2ZOKB 3D6GA 4FTVB 4HKXB 4OM0H 5I6XC 3MLRL 2OSLA 3GJFB 1XH3A 3B3IA 1IEAA 3SGEH 1Q0XL 1KBGL 4Z0XA 4OLVH 4OQ1A 5C0FA 4XPAL 1RIHH 2QKIB 4D0DA 3GGWA 4N0YL 3SDXF 4NZRL 3SKMA 1YJDL 3QAZC 1MF2H 1T1YA 3IJHB 5H94A 4LSPL 1DBKL 1SJVA 3BKYL 2FECI 4JRYA 3VJ6A 5EU3A 5I8OL 4BQ8A 3QXAA 3BDYH 4XNQA 3V6FA 1BJ8A 1CFQA 3T0VA 5HHMD 1HINH 3OKEB 3L3JB 5CD5C 4EQ2A 1B3JA 3BVNB 1NUNB 4HDIA 3PG2A 3HPLB 2ICWA 2R1WB 2IANE 4J23A 3UPCA 1EGJL 3WE6A 3Q6GH 3V6OE 2Y07L 1IEBA 1XH3B 4CJ0A 2IALA 3B3IB 1IEAB 1A6VH 2JCCF 3V9FA 5C07E 5HHMB 2X4UA 4D9RE 2ZP0T 4WNQA 4Z0XB 4D9LL 4D94A 5C0FB 4JRYD 1QHPA 3BDBA 3CVIH 4D0DB 3I02A 3IU3A 3UBXA 5ABDE 4X7TA 2PCPA 1MFCH 5C0CA 4OD3L 2MTPA 3SKMB 3G6DL 3FRUA 2A74A 4Z7QE 3G5VA 2BX5A 1T1YB 5H94B 5DJZA 4E41E 4LMQI 4KVNL 1IT9H 1MHEA 4JRYB 5EU3B 5J7CC 2GJ6E 3DXAA 3QXAB 2BRRH 2UUDK 5T3ZE 5KN5A 2P4AB 1CE6A 3HE7A 1LO2L 4I2XE 4LEXH 4Y5XB 1CFQB 1CLOH 4HLZH 3V6FB 1AGBA 5FGBA 4HT1H 4Z5RA 2CRMA 5BO1L 3WIIL 4DGVH 1MCEA 2WBJD 4HDIB 3F58L 4NWUL 2ICWB 1F3JA 4MXVF 3WE6B 2DMBA 4LGRB 1KUMA 4RFOL 4XBGA 2IALB 4OF8A 1XZ0A 1JF6A 4M9PA 3WFDL 2X4UB 3CDGA 1VERA 2WBJB 3Q48A 4JRXA 1MIML 1NCWH 4QXUH 3VMPA 2X4PA 5CKAA 1TQBB 1VHPA 3I02B 3IU3B 3UBXB 4X7TB 2PCPB 1NAMH 5C0CB 5FO8A 4NKQB 3FRUB 4M02A 3G5VB 5DJZB 4JHAL 1QBBA 4ZXBA 1BREA 3GSRA 4Y4HA 1CGYA 5KN5B 1QQDA 1CE6B 4YBLC 3C5ZC 1JPFA 3ZHLA 3HNTL 2WSKA 1AGBB 5D7JA 5GS0D 3U9PH 4Z5RB 1CR9H 3HZKA 1U2HA 2P8LA 3BP7A 4PGCB 3B9AA 2I5YL 1F3JB 1BVKB 2R15A 1O7VA 4WHCA 4OIBA 4DW2H 4R4ND 3CFJA 4XBGB 3MV8D 4MJ4A 4ERSH 3HRPA 1XZ0B 2FBJH 1EEYB 2FX8L 2CRIA 3CDGB 5CILH 4G3YH 5FKPA 4G5ZH 4JRXB 4ZXBD 5A2JH 4NYLA 4Y4HD 2X4PB 4MJ5B 1CICC 1TETH 2HG5A 5IP4A 2JJWA 3HAEA 4NKMA 3RWEB 3MV8B 5FO8B 5D7JD 5F96H 2YUVA 4YPJA 4M48L 5B38G 5GIRA 5BW7C 1LO4H 5DFTA 2DI8A 4EBQL 4ZXBB 2DQHH 3GSRB 4XBEL 3HR5A 2DWEA 3TVMC 4Y4HB 1QQDB 4I3RL 3L3GA 1JPFB 5D7JB 4PJHA 3HZKB 4P2RE 4NQDE 2GCYB 3BP7B 2XN9A 3MRQA 1RZFL 5IHUL 2L7JA 3MFGB 5F1OB 5GGRY 3ZHDA 5C0NC 4Y5VB 2CJUL 4LSTH 3G9VA 2QQKL 4J12A 2D3VA 5INCA 3CFJB 3GK8L 1UADC 4JFDD 2B1AL 1TZGH 4WY7L 3MGAA 1ZGLM 1R5WA 4GAJH 5FKPB 2OZ4L 2VXUL 1U3JA 5DFWH 1F90H 2A9NH 4TRPH 2HG5B 4NKMB 3HAEB 3VGGA 3S6CA 4KROC 4Z78A 4QXWA 1HI6A 4JFDB 2VAAA 3IGAA 3A6BH 5GIRB 4EXPX 3HUJE 3FTGA 3VGHA 3FFDB 4KY1H 1AGDA 3HR5B 4RMTA 2DWEB 5ISZD 1VSCA 4XVJH 4XPTH 3PDGA 5FYLL 5D4QA 3L7FB 4PJHB 1MCSA 3IXAA 3QDHA 4HKJA 1KJ3H 3O2DA 2H41A 5TDPA 2AAVA 4KZDL 5BS0E 1C8PA 1AE6H 5SWZA 4G7YL 4LLWA 3LKRA 4GG8A 5C92A 2ITDA 5T3XH 2YKLL 1CQKA 2Q7NA 1R5WB 5GRVL 2LVEA 3TF7C 1DL7L 4OGYH 5DJXA 4NNYA 3NCYS 2ERJB 3NFNB 3O11B 5KJRH 3MUZ1 1MJ8L 1HI6B 4M1DL 5ANME 4HBQA 1WUNT 4P5TA 3TO4C 4PJCF 4YHKL 3W82A 3IGAB 3H9YA 2NR6C 1TIUA 4PTTA 1AGDB 1WEJH 5C7XH 5I8EA 3RZCA 5SWZD 3WFBL 2ADFL 1FNEA 3FO0L 3P11H 4F9LA 2DOCA 5EZLB 4NNPL 4YJZL 3IXAB 3O6FC 5FB8A 4L9LA 3MLVL 3VCLA 2JJSC 4HKJB 3OR7A 3LPWA 4CVXB 4Z6AT 1JWMA 1D6VL 3O9WA 4MXWL 5SWZB 4JFED 3WV0A 2R0KH 2W92A 3V4PH 1TVDA 4JN1L 4H20L 3LKRB 4GG8B 1Q0YH 4P5TD 3TPUA 2ITDB 4LPWA 3VGAC 1QUNA 4L5FH 5AEAA 4NNYB 1U8IA 4UV7H 5D93C 3RZCD 5F7EH 2ZUUA 4X9BA 1AXSA 4Q9BA 3AM8A 2IADA 1FHGA 5I75C 4OFDA 1CL7I 4P5TB 4DKFH 4O2FA 1JHKL 1NDGA 3ALXA 2ARWA 1DBJL 4NUGH 4J1UA 3IFOA 4JO1H 4DFIA 4M4RA 1AJ7L 1VCAA 4NC0B 3TT1L 3O9WD 2YRZA 5I8EB 3RZCB 2A2QT 2IH3A 4PJ9A 1FNEB 4XP6H 3TEUA 2ZWLT 2VAJA 4S1SH 1OCWL 3X11A 1HSAA 2GAZB 5CJQL 5L6YH 3LQAL 3MNZA 4YHMH 5FB8B 1GZQA 3VCLB 3DXAE 4BSVA 2BY3A 1T5WA 3OR7B 4MA8L 4AEHH 1F4YH 25C8H 4GRMA 1JWMB 3O9WB 2Z8SA 3QH3A 3LN4A 4PRDA 1C5BL 2A6IA 1NCNA 5EO1B 4AIOA 3OKMB 1A6UL 3QPXH 3TPUB 2HRLA 4PJBF 3SGKA 3MCLH 2BSTA 3VI4E 3O41B 1F8TH 1VGEL 2CMRH 4PR5A 1U8IB 4NZUH 1BAFL 3D3VA 4PJDA 1DFBL 4J3TA 4XXCA 4PJ9D 3S96A 4MS8C 3NACL 2IADB 1QR4A 4JRXE 3LPFA 4K9EC 4O2FB 1YQVH 2NY1C 1NDGB 3ULVF 4J1UB 3IFOB 2Q8AH 3ZYJA 2IQ9L 5E5MA 3V4VH 2IH3B 3EGSA 4PJ9B 4M5YH 4JQVC 1IZJA 3F7VA 1NAMA 3X11B 5ACZB 2ICEB 5C0DA 1FVDA 2PXYA 3ARWA 3MNZB 1XCTA 1GZQB 2BY2A 3QDME 3RI5K 2AK4A 1GXEA 4DK3A 1T5WB 3D3VD 3P40A 4GRMB 4OZGE 3TJEL 3QH3B 2AXFA 3LN4B 4PRDB 2A6IB 1MEXL 2V7NB 4DGYH 1JGUH 3QUZA 3S36H 3HLAA 1MELA 1YEGL 4PR5B 1ZA6A 4PJDB 3D3VB 1RY7B 3OKOA 2H6PA 4FFVC 4ZAKA 1Y18A 3S96B 5FEBA 3V4UH 1AHWC 3BIKA 2PXYD 1A1OA 3L3HA 1HQRA 2AK4D 4XT1C 4FP8H 4FQLH 4PP1C 2IBZX 5JZ7C 5IMOA 5E5MB 1WJ3A 6FABL 4RGNC 3EGSB 3QUZD 3F7VB 5I1EH 1G9MC 5ITBH 2VDNL 1NAMB 4G6FD 2CLRA 1LO3H 5CZVH 2ZCLH 5C0DB 1FVDB 2PXYB 3V6ZB 3ULVL 3VFPA 1XCTB 4GKNA 4DKEH 2AK4B 1UWXK 1B6UA 2DIAA 2W65A 4ZAKD 1CD8A 2AXFB 4Q0XH 2IWGA 3GB7A 2P42B 4HUNB 4FQ1L 1MFBL 2XN9E 1R0AH 3QUZB 2FJFA 4YXHH 4G6FB 5GS1C 3I75A 1X5JA 5E95B 2QJDA 3HLAB 5AYQA 5HVGB 5AUMA 1ZA6B 2XWTA 3BGAA 4QHKJ 3OKOB 5I1GL 4ZAKB 1KPUA 1Y18B 1FSKB 4CDHA 5FV1L 2VLJA 4JM2A 4RZCA 4WENB 2SEBB 5HYJA 1NFDA 3BIKB 2ZCKL 2VZUA 3JV4A 1HQRB 2FDBP 2IAMA 1Z3GL 4MJ6A 5IMOB 4ONGL 1I3GH 2KUTA 5BOPA 2B39A 1WITA 2ZUYA 3BZFA 3VDBA 5CGMA 2CLRB 2AK1L 4U1JA 4QRUA 2AS5M 2P48B 5IEHA 3VFPB 4GKNB 3MACL 4OCSL 4JR9H 4XNUH 5DUML 1KIQA 2W65B 5DLMH 2ORBL 2VLJD 1CF8H 3EFDL 1LGVA 3GB7B 1F42A 1NEZG 4CW1A 1U8LB 5HYJD 2R23B 5DURD 2FJFB 1G0YR 2BOBA 4X4YA 1FDLL 3U36A 2FHBA 1MCIA 4XVTL 3DI2B 4LHUA 3VA6A 2IAMD 5DRNA 5AUMB 5TGBA 2XWTB 1YYMH 5LXGH 2NY5L 5IB2A 1E6JH 1WFUA 2HTLD 2VLJB 4JM2B 2VMFA 2XA3A 3T1FA 5E2WH 5HYJB 5DURB 3CDYA 1NFDB 5EC2B 3JV4B 3DX8A 4FG6D 2IAMB 4MJ6B 1UG9A 3RNKA 3Q3GA 4DAGH 4BKLA 1X7QA 1OQOA 4WO4A 3BGFC 2WUCH 1OAQL 1OD7A 2ZSWA 3IF1A 4RQQA 1FL5A 4QRUB 5IEHB 3B9EA 1MRDL 2C1PA 1MFEH 5F71A 5DMGD 2ADIA 1T7VA 5JOPD 3L95A 2DMCA 2IEPA 1KIQB 3QFDB 4M1GL 5D7KE 4NC1E 4TTGA 3W0WE 1WBZA 1GL4B 5JOEA 2Z35A 3KXFE 4X4YB 3U36B 4LHUB 5E1AA 4GG6E 4J3SA 3PWJA 5DRNB 1NC2A 5TGBB 3OJDA 3UAJD 4WO4D 1QBAA 3WEXA 3NFPA 3T1FB 2ESVE 3OB8A 3DUHA 3DX8B 4NN5B 2ICWI 2J2ZA 3Q5TA 4M7JL 5I16A 1MCJA 3ARGC 3RNKB 3Q3GB 4BKLB 1X7QB 4WO4B 3KPQA 1I4FB 2ZSWB 3IF1B 4GSDH 4RQQB 3D2UA 4FABL 4OT1L 1JPSH 2C1PB 3JVGC 1K9TA 1NANI 4UNUA 3HS0A 1WBZB 3UBXI 1KLFA 3OBAA 4HBCL 2MKWA 2Z35B 3ILPA 4K7PH 3TLRA 3IRPX 3RWCA 5E1AB 3PWJB 2P7TB 4F8TA 5F3HA 1Z9LA 3CC5A 3NN8A 3QDGA 1I9JH 5FHBH 2VDPH 3WEXB 4BH7B 3NFPB 4L1DA 3D2UD 2AQ3A 5E2TL 4WRLA 4HIHA 3UC0L 1GGIL 2CXKA 3H8NA 1HYSD 5BQ7A 2VISB 5I16B 2OZ4A 1I1AA 5FYJH 4F37K 2BJMH 1DQLH 1IAIH 3DVNA 3KPQB 1QSEA 1B4JL 4XP4H 4EN3D 2GJJA 3D2UB 4APQC 5F7WC 1KNOA 4ODHH 1F2QA 3QDGD 5E08H 2LAGB 3HS0B 2FEDD 1NCUA 5JUEH 3MPCA 2DRUA 2FATH 4JO2L 1DLHA 4HC1L 4LVNC 3ILPB 4EN3B 5IFAH 2R1XA 3JXAA 4QWWD 3RWCB 3RA7H 4QY8B 2B2XL 1SY6H 3FB7A 2BY0A 3QZWG 3NN8B 3CC5B 3UTPD 1A6WH 3QDGB 3HMXA 2X6MA 2FO1A 1CZ8L 1CFVL 5T5NG 4GH7B 3ZDZF 1QSED 3GIZL 5EZJA 5MP6H 3MBEC 5DD5H 1FZOA 5FHAH 5TQ2H 2UWEF 3A67H 2EDYA 4JAMA 4YHOL 5BQ7B 4HXAL 4JDTH 5EBGA 3H9SA 5T33L 2XKSA 4XXDA 1FAKT 4GAYB 4LKCA 1NCBH 3DSFH 1A7RL 1QSEB 3UYRL 1IAKA 3VD3A 3BYYA 2APFA 2HLFD 3UTSE 4OGAC 1KNOB 3HC4H 1ACYL 3QP3A 1QFUL 1K8DA 5JPNB 4GS7C 4OIIL 4M5ZH 3KPNA 4ZD3L 2R29H 4UAOB 4LDOB 1DLHB 2N7BA 2X09A 1CDJA 3PV7A 4TTDC 3RGVA 1QFWH 4YBQC 3G6JF 4OLYH 4LCYA 2BERA 3FB7B 4P3CH 3WCYA 2HLAA 2DKSA 3UJTH 3H9SD 2LU4A 2BNRD 1AXTL 4OLXL 5AG9A 5CBAB 2OI9B 3WJJA 2HWZL 1OLZA 1A7OH 1GIGL 2EDEA 5BV7H 1MCNA 5EZJB 4RRPA 3KLDA 4GMSL 3DWTA 2EDTA 1FZOB 2IBZY 4JAMB 3OKYA 5LQBH 2XZQH 5E2VH 4QRPD 2VDKL 2A0LC 4X7DC 3BKCH 3LOWA 3H9SB 1JPTL 4I1NB 1WCQA 3CXHK 4XXDB 2VR5A 1GCFA 2FZ3A 5GRXG 3WNLA 4GJTB 3EYVA 1UZ6E 2I60L 3QEUB 4WFGE 2FWOB 3RGVD 1IAKB 4GQ9L 2UY6A 5C1MB 1ZT7A 4O5LH 4OLUH 1GSMA 4F7CB 4OZ4A 1U58A 3B5TA 4AL8L 1K8DB 4MA3A 2Y7QA 3RDTA 3T0AA 1MSPA 3KPNB 3IDGA 1MHPL 1SJXA 4RFNC 2ARJQ 3GI8H 3RGVB 3SE4A 4W4OC 1AO7A 2P46B 3E6FA 3MZGB 5LVEA 5DC0A 1DSFL 2R0WL 4JPKH 5HHXL 1PX3A 3CFDA 4D9QE 4MA1C 4MAUL 3K3QA 4F7TB 1O5DT 2F53A 4M7KL 3RDTD 1RZIA 3MLSH 4PJFA 3DX9A 3EYVB 4EUPA 2B5IB 2DQUL 1AO7D 9CGTA 4OZ4B 5JMOC 4G8EA 4M1CC 3D87B 1E6OL 4OTXH 4MA3B 2Y7QB 1XT5A 3RDTB 1A02N 1WAAF 2X4NA 3MGOA 5CAYB 2JCCE 1P9MA 3IDGB 5EZOH 3MOAL 4GXVH 1CIDA 1E4XL 4FFYH 4KTYA 5K33A 3FMGH 1AO7B 3E6FB 5I18L 3A6CH 3ULUH 2JJVA 1F58H 3KAAA 2NNAA 4TQEH 1HXYA 3MLYH 1EJOL 3S3SA 4RISH 1CU4H 3QG6A 5E7FA 3CFDB 4KTDH 4ODSH 1LEGA 1UT9A 4EI5A 5GRYA 3W39B 5DR5L 1MRFL 1FIGH 1FQ9C 1HXMA 1L7TL 1CWVA 4X9IA 2PW1A 5CD3B 2F53B 1CYGA 2L4OA 2M26A 5DHYA 1XGYH 4MB3A 1RUAH 2CKBH 2VDQL 3IS1X 5F97E 5E5UB 1BQHG 4MB5A 1S7QA 2CK0L 3DX9B 5IBTH 4EUPB 4PV8A 3FO9A 4UINL 1MLCA 3V0VA 4PRHA 1OGAA 1C16A 2RCSL 4G8EB 4OQTL 4P4KC 2CLZA 4YDJA 5C9JA 2ED7A 2JB6A 2R2BA 1QRND 4HIIA 2X4NB 1NMCB 4U1KA 3MGOB 3IDJA 3RVTD 1FPTL 4EI5D 4J7RA 4XCCH 2R4RH 3MJ7A 2X89A 1FNHA 1MREH 2NNAB 3WIHL 1HXYB 3N9GL 1QRNB 1A14H 3FHQA 3QG6B 2EH8H 3DROB 1P1ZA 3S88L 4EI5B 1U8PA 2UYLA 4HLJA 3TT3H 3MXVH 1FFOA 3NCCB 4FXGA 1RZJH 4JG0L 5FYKL 4HK3N 4ZFOB 5I9QC 1HXMB 4K9EL 1OGAD 2PW1B 3VXTA 4S2SB 3EO1A 2J88H 3P9WB 4HS8H 4HUKB 3Q1SH 5DHYB 2HP4A 3INUL 3KLAA 1S7QB 3QXVA 1RIVH 2JB5L 4OF7A 4HXBL 3FO9B 4HUMB 3QQ4A 2ICCA 3L6FA 1MLCB 3V0VB 4PRHB 1OGAB 1C16B 2X89D 3C6LA 4JY6A 4FN0A 2CLZB 4YDJB 4IIQC 4K3EL 3PP3K 3RY5A 3IDJB 1WSST 2H2PD 2W9EH 5D7IA 4UUJA 3EO9H 1OLLA 1CIUA 5CGTA 1OAXL 4WV1C 2DQCL 4PGZA 4ODXA 1RZ8B 3KYOA 4LP4A 1PSKH 5FYLE 4OLVL 1P1ZB 1U8PB 1S9VA 2UYLB 3RX7A 1RIHL 1BQLH 5K9KA 1FFOB 4FXGB 5MENE 1Q9WA 3VXTB 4G8GE 3H3PH 3C6LD 1JGDA 1MF2L 5DVMA 4JFQB 1AP2A 1L9NA 4OCMC 4RMWA 2EDLA 2VYRE 1S9XA 5C0BA 3KLAB 3GMOA 1QO3A 3QRFM 1XEDA 3W81A 3QQ4B 2GKIA 4ELMB 3LEYH 3EZ8A 2ENSA 3C6LB 4JY6B 4LEOA 2DJ4A 4OLZH 3TH4T 5KOVC 1G9NC 1IAOA 4M61A 2A38A 3BIBX 5D7IB 1QOKA 4JE4B 4UUJB 2OLDA 3QCUH 2Z93A 1K85A 4Y19A 5DJ0A 5EIIA 1A6VL 3MYJA 4I18C 3TJHC 2AJXL 4ZO7A 1KB9J 1A47A 4ODXB 3KYOB 5C9KA 5C0BD 5D7SH 1LO0H 4ORZC 3SOBL 5I6XB 1S9VB 1U8NA 4OCWH 5IGXH 2MFNA 4RMRA 4XVUD 5K9KB 1QD0A 2F8VA 1CG9A 3RIAK 1MFCL 3MOBH 1Q9WB 2XKNA 2F9BT 4QGYA 2ZNWA 1MOEA 1AP2B 3TH2T 1PX4A 1JGEA 1R5IA 4J4PC 4OGZA 5C0BB 4WWID 3GMOB 1QO3B 1FH5H 1MJUH 1IT9L 5IROC 2BRRL 3SDCA 1JI2A 1NUFA 3BP6B 4RFEA 2XACC 1CLOL 1KJ2H 1IGJB 2AXGA 4XC3H 3QAZB 4R90H 5HGAB 5CD5D 1KCSH 1VFOA 4LEOB 3RWJA 3VE0A 4DGVL 1RULH 3KPSA 1RJZA 3IDMA 2FJGA 1IKFL 1IAOB 5IESH 4M61B 4YDLC 3B9DA 2Z93B 1AGCA 4Y19B 3MYJB 5IM7A 2AI0L 3ZTJG 4DVBB 3V6BR 4J3OC 3CMOH 2QL1A 2YUZA 5A40E 4DZ8A 4PJCE 2YD1A 2EDOA 1NCWL 4QXUL 1U8NB 3SDCD 2VQ1A 3VFOA 1CG9B 5SWSE 1RV6X 4WGVB 3NGBC 5JA8B 4MD4A 4OKDA 2WIIB 3PP3H 1I1CA 1JGEB 3KPSD 3VFUA 1R5IB 5IIEA 1KFAL 4ZUUA 3B6SA 4WU7A 4TSCL 5BV7B 2F53E 3SDCB 4RFEB 1IMHC 4PJFE 4JEGB 4JHWH 2AXGB 4HH9A 1I8KB 5DD1H 3U9PL 1ZHKA 5L0QC 1CR9L 3RWJB 1EJ6A 3KPSB 1RJZB 3IDMB 5JIPA 4H0HB 2FJGB 3PGFL 1FCCA 3F8UB 4CAGA 2XZCH 2QTEA 1AGCB 1K4CA 3C5ZA 2JELL 3MLWH 5IM7B 2FBJL 4JZOA 2ZJSH 2OK0L 4EKXA 4G3YL 1HIMH 4G5ZL 3B5GA 4OI7A 1ZANL 1WIPA 4R3SB 4DZ8B 2X1QA 1TCMA 3BKMH 1TETL 4U4BA 2VQ1B 1SBSH 3VXNA 3CFKA 3LSOA 1OP3K 3RVXC 1A3LH 4MD4B 2UV3A 4Z7WA 3VFUB 1LO4L 3OKLB 3F6LA 3HMWH 2DQHL 4ZUUB 3UJJH 4WU7B 3KPTA 2DTSA 1QHOA 2JJTC 3B8SA 1CICA 5J89A 1QNZH 2AV1B 2OP4H 4PB0H 3C5ZD 1MY5A 4HH9B 1ZHKB 4LLAA 1A9BA 3MUHL 5BW7A 5CJ8A 4XZUA 3WN5B 2V7HA 4X7EC 1FL6A 4K3JL 5TE6H 4PJBE 4WW2A 4PRHE 3TVMA 4F57H 4GKSA 3DMMC 4KKBD 2O61B 4P2OD 3C5ZB 4N68A 1Z5LA 43C9A 4WUUA 1TZGL 4JZOB 1TITA 3UYOD 4L8SC 5J1AB 1F90L 1G6RH 3ULVE 2A9NL 4TRPL 3RWIA 5DFVC 3VXNB 2B4CH 4P2OB 3CFKB 4KMTL 3LSOB 3RVVC 1RHHA 1TFHA 3CXDH 4Z7WB 4LDEB 3A6BL 4PBXA 4JN2A 3VXQA 3PE9A 4PJAA 4HV8A 1I8IA 3TVMD 4HG4K 2ZCHL 1CICB 4KI5D 4XVJL 5HGDA 4XPTL 5IFHH 4WUUD 3OL2A 4R4FL 1T4KA 4YK4C 2XG5A 5A2IH 1H3GA 4LCWE 1KJ3L 1FL6B 4MQXD 4PS4H 5C0ND 4HWBA 4NKOA 4WW2B 4X7SL 3TVMB 3PHQA 3AS3A 4GKSB 4JVUA 1UXSB 3BGMA 3LIZH 1Z5LB 43C9B 3DTXA 4ISVB 4WUUB 5T3XL 2JLLA 1VKXB 2FHFA 4M43H 3ZT7A 2HVJA 4PGDA 5EWIH 4L8DA 5KJRL 3RWIB 1VA9A 1LHZA 3ZDXF 4N0FA 1ZHLA 3D48R 1FNFA 3KPLA 4HK0A 4XMKL 1RHHB 3CSPA 1OP9A 3I84A 4LAQH 4G6JH 5B38B 4JN2B 3SO3C 3VXQB 3MV7A 4PJAB 4HV8B 1WEJL 3OMZA 1I8IB 1I8MA 1CD9B 3DGCR 5HGDB 3P11L 2AGJH 4CDGC 2CPCA 2W38A 3VFGH 3AVEA 2R4SH 3SDDC 1JF1A 3TO4A 1T4KB 1AGFB 4X6EA 4X4ME 4NKOB 4V2CB 3WDIA 2NY2C 3PHQB 3UTTA 5TF0A 4JPVH 3BGMB 1FYTE 3P0VH 3V5DA 3V4PL 3DTXB 1EAJA 1Q0YL 4XHJD 1G7JA 1K5NA 4W4NA 3O6FA 3F7QA 2JJSA 2YSSB 1XCQB 2HVJB 1UVQA 4UV7L 4L8DB 2LTQC 4Y19E 3C60C 4TNWK 5F7EL 2QSVA 1UWEH 4N0FB 1HNGA 3L5IA 3PWPA 4NPYB 1ZHLB 3GKWH 2O5YH 1T7ZA 3KPLB 4HK0B 3TO4D 5JTWA 3W9DA 1HSBA 1KF9B 1LO5A 2NR6D 2RQ8A 4NUGL 4NO2B 3QJFA 3S97C 3HFML 1S5IH 3IT8D 2JJUA 5F7NC 1NKRA 2DJUA 3UTTD 1JPST 3WUZA 4BFIA 5I1KH 1I8MB 4XP6L 3OAUL 3EDEA 4JFZL 4BSJA 1F00I 1X9QA 4S1SL 4LRIC 1IGYA 1JF1B 4XWOC 3TO4B 3O6FD 4ODWA 1UCBH 4X6EB 4TVPH 5CZXC 5IF0A 2K3TA 4AEHL 1D3CA 1F4YL 4LLUA 3KJ4C 25C8L 1YEEH 5JOFA 5JORA 2VDRH 5GQBA 1N6QH 1C1EL 1KELH 3UTTB 3B8YA 3KHQA 3UX9B 1YMHA 5DZNA 3V5DB 5IJKC 3QPXL 5EBMA 1G7JB 1K5NB 1X5KA 5DHVH 3O6FB 4ZG1A 4LPCA 3KYKL 1F8TL 2CMRL 1EA9C 5ENWA 4NZUL 1ES0A 3EOTH 1KXQE 5ACLA 5ITFB 4LCUA 1RZKC 1U9KA 1M7DB 4U6HA 4PJ7F 4S1DD 3QHFH 4YPGA 2XRAL 1HSBB 2GK0A 1LO5B 1NL0L 3VGAB 3QJFB 5J6GB 2Q8AL 4S10A 5D93B 3UTQA 3C5JA 4BFIB 5I75B 1QYGH 1IGYB 1KCRL 3D0VA 4ODWB 3GO1H 1KENL 2DYPA 3GBLA 4U1HA 5IF0B 3U7AA 4LLUB 5JOFB 2R9HC 4ZUWA 1HILB 5JORB 5E6ID 5HHVH 5I1CH 4JQVA 4DGYL 1YMHB 5DEFA 3QO0A 5AZEH 3S36L 3TBYA 3ARSA 5EBMB 4H0IA 5F88B 4JO4L 5FA4A 2F19H 4LL9A 1FG9C 5ENWB 1ES0B 3GSUA 5KS9A 5D7LA 4JQIH 3H9HB 4AENA 1BFTA 4U6HB 3RUGF 4YPGB 4GRLD 2DYPD 4KXZH 4H8WC 4QYOB 2P5EE 4HUUA 3MJ9H 1JP5A 3AAZA 3EYFA 1M6OA 3C5JB 4OF6A 4RCAA 5I1EL 2VDLL 1AHWA 2DLGA 4PJGF 1LO3L 2I26N 3D0VB 3ARYA 2YD4A 2DYPB 3PQYA 4DKEL 4U1HB 3HZMA 1NCAH 5CP7A 3MROA 4OZHF 2AP2A 4LSVH 4MNGA 4ZUWB 4HPOL 3BPLC 5F1NA 4QTIL 5HYSA 4Q0XL 4UDTB 5DEFB 1R0AL 3QO0B 3TBYB 1ZEAL 1N59B 4X83A 5DVNA 5FA4B 1NGPL 2WAHA 1T2QH 5FGSA 3Q5OA 3KPRA 4FFVD 3MRRA 3GSUB 5KS9B 4NT6A 3WBDA 5D7LB 4YAQA 2GYSA 4AENB 1BVLA 5IOPA 1IFHH 2CDGA 2NXZD 1BWWA 2YN3A 5GS1A 4I3SH 3PQYD 5E94A 3LS4H 4PP1D 2HFEA 1N26A 1EO5A 4HUUB 5JZ7D 3EYFB 2VUOA 1I3GL 4RGND 1AQKL 5AYUH 4NFBA 1FE8H 1M6OB 1LDSA 1V3MA 4XI5C 2FX9H 1B0WA 4NO5A 5F9AC 2X1XR 3H3KA 5E1HB 5KSBF 1AHWB 3FN9A 2VDOH 1CFSA 2O5XH 3PQYB 3HZMB 3KPRD 5CP7B 3MROB 3NZ8B 4MNGB 4RGNB 5F1NB 5HYSB 1CF8L 4O9HH 5IVXA 3KYMA 2X4QA 3QIUC 3RY4A 1Y6KR 4AZ8A 2YK1H 3G9AB 4OJFH 1A2YA 4XCEB 3X14B 3ZDZE 4PGBA 5HJ3A 3KPRB 3TZVC 1YYML 2XY1A 3MRRB 3OXRA 5CEZH 5LXGL 1IARB 3LKSA 1E6JL 2UWEE 4NT6B 5JQHC 2EDRA 4YAQB 2N56A 2N1KA 1BVLB 1KTRL 5E2WL 5IOPB 5B3JE 2R0ZH 2CDGB 3AS2A 2BRQA 1ITCA 4N8VG 4NKIL 5E94B 5EBWA 2HFEB 3ARDC 4OBSA 5CSGA 3ARXA 3BZEB 1DN2A 1QBLH 4NO5B 4DAGL 2E6PA 2X41A 1FVCA 2MKLC 3HI6H 3MV7E 3H2WA 1CFSB 4MZ2A 3BRFA 2P5WE 3G6JE 5E4EC 3S35X 5IVXB 3KYMB 2X4QB 3ZTNL 3FO1A 5FXCH 2QQLH 1CQYA 3D39E 1U8HA 3AGVA 4M6MH 1A2YB 4ELMF 4GLRI 1BIHA 2F5AH 3EIFA 4YHPA 1KPRB 4PGBB 3UPAA 5HJ3B 4JGUA 3OXRB 1BOGA 5DS8B 1C7SA 3LKSB 4XVSH 3NOIA 5IB4A 5TFSH 3BH9A 3P9LA 4MLIA 5AWNL 5KVFH 3CNKA 1UA6H 3OJMB 1EEZA 1LD9A 3RHWK 3C6SA 2XKUA 2R8SH 4YBHA 1LK3H 4O00A 3PWPE 2ZPKL 5CS7A 4NRXA 3MXWH 3JTSA 4PB9H 1GGBL 1UXWA 4KHXH 2D7QA 2X44D 5EOQL 1FVCB 4GSDL 1MRCH 1JPSL 3N1GC 2VZOA 1DQQB 4BFBD 1DVFA 3I3DA 1OW0C 3ARGA 4U6YA 1BZ7A 4WVRA 3DNKA 3FO1B 2FR4A 3BGFB 5JIHA 4Q97A 2DJSA 1YEJH 4K7PL 3CX2A 3FAWA 1U8HB 5F9OH 4YHPB 3JVGA 1JMXA 3X13A 4LKXA 1HHJA 1BOGB 5DWUH 3D85D 3ZE1F 4WUKH 5IB4B 2AJVL 4Y16C 5ICYA 5FHBL 2VDPL 4QGTA 2Y72A 1MFAH 3BH9B 5D8JL 5HGGS 2GY7B 4LCIH 4A2LA 1EEZB 1LD9B 1PDKA 4I13B 1DVFD 4HS6A 4NRXB 4UT7L 4OCLC 2D03L 1SJHB 3JTSB 4U49A 5I74C 3BISA 5GPRA 3D85B 5FYJL 1DQLL 1N8ZA 2ZKHH 4L8CA 2VNCA 1JWSA 2AXJA 1J0IA 1J11A 4TVPD 5CWSB 2RHEA 1FVEA 1YA5A 3EJYC 4ODHL 4YFDB 1DVFB 5E08L 5FOJA 3V6OC 1ORSA 4U6YB 1BZ7B 5FYKE 4IMKC 5F7FA 2XQYG 2FATL 4Z7UB 3BHBA 4E9LA 5IFAL 5AZ2H 4APQA 1MCPH 1SY6L 4LSSH 1KJVA 4LKXB 1KG0A 1HHJB 4WJ5B 1A6WL 3OZ9H 4KJWD 3LN9A 4WWKC 5ICYB 5DRZA 2DIJA 2C9AA 5MP6L 4LHJB 5DD5L 5TQ2L 1XMWA 5FHAL 5DHVB 3A67L 5LCVH 1AH1A 4HS6B 2CO6B 4LU5H 2E9IA 4IMLA 1RFDL 4JVWA 1N8ZB 4L8CB 5D71H 1NCBL 4BYHA 2XZAL 2GTWA 3MBEA 4APQD 5H37H 2FB4L 5KSUA 2IGFH 1FVEB 5ICZA 5EU7E 1ORSB 4YWGL 2KL6A 3VXRA 4M5ZL 7FABL 4BM7A 3JBG7 4OIAA 4P4RA 3MRLB 1KEML 3KJ6L 4GO6B 5IVNA 1QFWL 4MNGE 4APQB 4OLYL 5C0IA 1KJVB 4P3CL 1INEH 3HNSL 4JVPA 1N4XL 1UWGH 1OT2A 4PJEF 1FGVL 5DRZB 3QFJE 4N0CC 4WFED 1CN4A 4KHTH 4H1LG 2XZQL 1MWAA 5E2VL 1J0JA 4KDVA 3RZWA 2YD6A 1AY1H 1XAUA 3BKCL 2OR9L 1H3PL 4U6TA 5EPMA 4X5LA 4EDWH 2DMKA 3FB5A 3VD9A 3SDYL 2Z91B 5H2BB 4ZSOA 2A6JA 2GTWB 2MSPA 1CD1A 5DXWA 5KSUB 5TF1L 4O5LL 4OLUL 5I1IL 2C3GA 5ICZB 2VL4A 3ULUF 5MEQA 2FGWH 3L3DA 1JYWA 1EVUA 3N1PC 4P4RB 4ZTOH 2NY7H 3TNNA 3GI8L 2YA2A 4Q6IC 1JTTA 4GXUM 5D1QC 5C0IB 5D2LB 3MRCA 1FAIL 1NFKA 4JPKL 5DVLA 3HB3C 3WO4C 4LOUC 1SM3L 4MQTB 1X4ZA 2UZIL 4W4OA 1MWAB 2Z92B 2A0LD 4L3CA 5EPMB 1MNUH 3FB5B 3JWNC 5EO0A 2A6JB 2YD7A 4J3UA 1J7VR 1UEMA 3R1GH 1W8NA 3MNVA 2VLLA 2YN5A 4KZEH 4XPFH 3T09A 5MEQB 3S8WA 3BPNC 3ZTJH 3L3DB 5ILTH 4O58L 5CCKH 3QDJE 5T1MA 2H32A 4MSWA 4GXVL 4UMGA 3TNNB 3FMGL 4XAWL 2W60A 1CLZH 3CLFL 5IJVA 1FFNA 4X5XB 3A6CL 3ULUL 1YEKH 3EJJX 3R06A 3TN0C 5JXEC 4CVZB 5A3IC 2M1KA 3BI9X 5MHSE 4UBDC 1VFMA 1X5AA 4JY5H 1A7NH 3U4EA 1CVRA 1CDYA 1U0QA 2DTMH 1MCFA 2CKBL 5L2JB 1P4IH 2X1OA 5C0RH 3ARFC 5J56B 1R3LA 4MA1B 1JL8A 3MNVB 2VLLB 1HQ4A 3P4OA 4M1CD 4ZMAT 2BNQE 2K7PA 5I0DA 1RIUH 3SGDH 5FYKU 2V17H 1E4XI 2VXTH 5I1LA 5DJAB 2EKSA 4MSWB 3O3EA 3SE9L 5AG8A 2EDJA 2UVFA 4XCCL 1FNSH 1KIRB 2W60B 4U2ZA 4ENEC 1CS6A 1F4WH 5IJVB 1FFNB 2BSRB 2ILLA 4P4KA 1P4BL 2V2TB 2DM2A 3R06B 1J86A 3O4LA 3DETC 3TNMB 1RZKL 2EH8L 3QCTL 3TV3H 3TT3L 5HPMA 4R4BB 3MXVL 1DCLA 1RZJL 2J3SA 2UY7A 5A2LH 1QSZA 1YNKH 3BRDA 4HS8L 3Q1SL 2AW2A 2BVYA 3ME0A 4S1RL 4YDKH 4HGWB 1ZOXA 1ZK9A 3SY0A 1R3LB 4AJ0A 2VR4A 4EXKA 3UBXG 1HQ4B 3P4OB 1R3KA 4P4KD 2DBLH 2P45B 4JG1L 4KJPD 2BK8A 3O4LD 5I1LB 4JY4A 2EKSB 5KANI 2W9EL 4HZLA 5L2KA 3IDIA 3AFLA 3D18B 3VXUA 2DQJL 35C8H 5B3NA 4P4KB 4IIQA 5C09D 3RJDA 2Q8BL 3O4LB 4B7LA 1PSKL 1JFQH 1EEUA 3OB0K 2QLVB 4KAQL 1T1ZA 2YUXA 5HPMB 1BQLL 3HG1E 1SJEA 1GOHA 2ATPB 3RVUD 3H3PL 1JGVH 1PVHA 2P24A 3EDFA 4JJ5B 5FO7A 1TZIB 1LP9F 2Z9TA 5C09B 2CKNA 1CTNA 4OGXH 5T3XE 3SY0B 5L2KD 1X5XA 2WUBH 1OHQA 2HT2C 5I9QB 2E9BA 3VXUD 3LEYL 3JV6A 2GQHA 2A6KA 1FN4A 4OLZL 4JY4B 3MMEA 1G7MA 4HMCA 1J8HE 5IW6A 4QXTA 4MYWB 4HZLB 5L2KB 2G60L 4HFWA 4ZNEE 1DUYA 3VXUB 3VXRE 2MPAH 3QUKA 1BOYA 4IIQB 1D6EB 3IJYA 2YPLD 1B6DA 4EOWH 1JNHA 5D7SL 3LPGA 1LO0L 1CFNA 5JA9A 1T1ZB 2ZG1A 3QPQC 2B1HL 4LSQH 4OCWL 5IGXL 3CMGA 4PGJA 2DQDH 1SJEB 3TFKC 1IQWH 5JHDA 4S1QH 4I18A 2P24B 1I9IH 7CGTA 3RL2A 2YPLB 5T5FL 2V5YA 1YYLH 1FH5L 4JZNA 5F1IA 1X5ZA 2Y9RT 1E28A 5DQDH 3IAPA 3TGXA 4TNVK 3QEQE 3HAEG 4ZUTA 1LEIA 1KJ2L 3JV6B 2HJKB 4XC3L 4R90L 4ZSOE 5IHLB 4P57B 5IBUG 2A6KB 3JUZA 1FN4B 1RULL 4F80A 4J4PA 3MMEB 5IW6B 4QXTB 2VUYA 4HFWB 4NQVB 2R2CA 5IROA 4WDIA 1DUYB 1TJIH 2CH8A 5C0GA 3WNNA 5JHDD 4HPYH 1S7XA 3EYSL 3QUKB 3TJHD 4LGPB 5CJBA 3ZDXE 3IJYB 4AEIL 2QQNL 4LSUH 1JNHB 1HH6A 5GGVY 1CFNB 1ONQA 3WKMH 4X0KB 1ADQH 5M95B 1OAZH 3U6RA 1UJTA 1PY9A 1DQDH 3SKUD 5JHDB 2GW5A 4I18B 1FLRL 3TC9A 3AS0A 3RL2B 2GUOB 4J4PD 4P9HH 4U2YA 5TPWH 5DGRA 4ETQA 3DJ9A 1GGTA 4U3XA 5F1IB 4ALAH 1Q72L 2ARJA 1J1XH 2Z4QA 1F3DJ 1BD2A 4PJXA 1FC2D 1LEIB 5DD1L 4TVSa 5HYIA 3OB0H 3RTQC 4HIJA 1PQZA 3P30L 4NZTH 3BQUC 1S8DA 5J0BA 3O2VL 4YIQA 4WDIB 3MOQA 2PYFA 4NHCH 2XZCL 1S7XB 3ZKQD 4RWYH 4WTXA 4POZC 2ZUQC 3MLWL 5E9DD 2ZJSL 3O3DA 1FGNH 5ALCH 5E8DL 1ZT4B 4NRYA 1HIML 4NO0A 4QRTA 1HH6B 5FM5M 4YDLB 3BKML 4X6CA 1T3FA 1BD2D 1SBSL 3N1MC 2HMID 2VSDA 1YMMA 1QFHA 3PWLB 4JPWH 2Q76A 3L3KB 1A3LL 1OPGL 3GBNL 5E9DB 2X4OA 2VLKE 2NZIA 3HMWL 4PJ5A 4XNXH 4ETQB 3UJJL 5BVJA 3MJ8B 4HUVA 1NCCH 3QJHA 4XPHL 2ARJB 5DQJB 2I24N 4LLQA 1J10A 2OP4L 4PB0L 1TVHA 1BD2B 4U0QB 5LGJA 3NGBB 1MFDL 4KK9C 5JR1H 5I15H 1G9EA 1JTPA 3VFMA 2JJTA 5DK2A 4F57L 1S8DB 4YX2L 2X1WL 5J3HC 4YIQB 5J12B 2PYFB 1Z2KA 1HZHH 4A2MA 1J18A 1H8NA 4PY8I 3O3DB 3C87A 3DPBA 4NRYB 1A3RH 4N90D 4QRTB 3RWFA 4PJ7E 1MHCB 1AC0A 1G6RL 5JW3L 3IDNA 4C4KO 2CDEA 1G7LB 1CDGA 3DMMA 4X6CB 1IC7H 2B4CL 4J6RL 1YMMB 3RVXD 2BNUA 3T0DA 3CXDL 2Y5EA 4L3EA 3VFNA 1T0NA 4FQCL 4X9FA 4L8SA 5BVJB 3QJHB 3BJ91 4LLQB 4WFFE 1TVHB 2Z31A 4L3AA 2J4WH 5IFHL 3MX0A 5LGJB 2Y36H 1CI5A 5CEYB 1IGCH 2C3HA 1A6PA 1IGFL 1S78C 4PS4L 3VFMB 5DK2B 5DSCB 3DMMD 3MCKB 2WLYA 3FAXA 5FM5O 1WBYA 3MUGA 4K3DH 3O6KH 3IFNH 4L3ED 3K46A 4GAFB 3NTCH 1MPAH 2W9DH 2EEDA 4M43L 1DQJB 1MQKL 3RWFB 1Z9MA 2X9YA 3NCFB 3RUGE 2WIMA 3IDNB 2CDEB 1VADA 3BD4A 3DMMB 5E8OB 1UM4H 3O8XD 2Z31D 4Z7UF 2BNUB 1ITBB 3RVVD 2YBRA 4L3EB 1UENA 4LAQL 3VFNB 4HJ0C 1MCOH 4L8SB 4G6AD 5DRWA 4DEPC 5IBLC 1JYXA 4PJGE 4I9WD 4RGOL 4HX1A 2G2RB 1NLDH 4Z8FH 3W5NA 1JF5A 4GW1A 1JV5B 3O8XB 2Z31B 1TXKA 1JK8A 3AB0C 3VFGL 5C6TL 3M8OH 4KUCF 1BF2A 1PG7H 5CJ5A 1IAIM 1KB9K 1AFVL 1DANT 5DTFA 3RIFF 3D69A 4S11A 1NMAH 1G0XA 5HDLA 3MO1A 1PZ5B 4JPVL 5B39A 1WBYB 3QWRD 3P0VL 3SE8H 3ARZA 3MUGB 3SDDA 3LQZA 4YK4B 3IETA 4P5MA 5LGHH 5IK3A 1AR2A 5CGYC 3I2CH 1UWEL 1VADB 3WFCL 2AXHA 4NCC2 2VTFA 4L4TA 4OCXL 2O5YL 4KQ4H 1F13A 3VWKC 4U7SA 2YBRB 5MEOA 1MCWM 3GUTA 2A9MH 1D5ZA 5DRWB 4Y5YC 5KSBE 2R69H 5DK3A 1S5IL 3C60A 5I1KL 4XAKD 4GW1B 1JK8B 2B8OT 3SDDD 2J6EH 2DD8H 1UCBL 3AMKA 3SO3B 2BVOA 2VXVH 2YZ8A 5DTFB 3D69B 4OCYH 1G84A 2N4IA 2DL2A 3U2SB 4PJIA 3NH7H 2NY2D 3FQUA 3MO1B 5D5MA 5B39B 4L4TD 1G6VK 4KDTC 1I1YB 2Q1EA 4LRIA 2KZ1B 3SDDB 2VITA 4IDJH 5C0AA 4OD1L 3LQZB 1EFXD 4A6YH 3WXWH 4LSRH 3IETB 1XIWC 2CXGA 3OX8A 4QRRE 4P5MB 5IK3B 3WLWC 3MV01 4WI5A 3EOTL 1K3ZA 1NBYA 1TPXC 4JZJC 1QFWM 2NY2B 1SHMA 4UDUA 5BMFH 4ETYA 4JFHE 1YPZA 1OM3L 1CGUA 4L4TB 2DAVA 5IJKA 4NKDB 5MEOB 1NBVL 2HYMA 4WI2A 3WKNA 3GUTB 1D5ZB 5D2LF 4MNQE 2HJFA 1KN4L 2LTQB 1BMGA 5GGRA 3TCXA 1LNUB 3SGJC 3C60B 1A1NA 1C08B 3H7LA 2VH5L 3EDKA 5T5NF 4LVOC 3WS3A 2NY3D 5E8EA 4XWOD 1QA9A 4Y1AA 5TQ0H 3OXSA 1S7RA 5CZXD 3EYUL 2ZZUT 1RU9L 3DGGB 2ED8A 1JRHI 4PJXE 4PJIB 4GXUN 3FQUB 3LKNB 1CL7H 5D5MB 2H9GB 5HHVL 3VXMA 5E56A 4XP9L 1T22B 3SKJH 2NY3B 2VITB 5C0AB 2W59A 2VSCA 3LHPL 5FYJE 2VKWA 1YECH 1BPVA 2F19L 1DEDA 1P6AB 3OX8B 4TULH 1AKJA 1NGWA 3KJ4B 4F7PA 1NBYB 1JBJA 2NW2A 3BZ4A 4UDUB 3GBMH 1J87A 2VN4A 2EYRA 4JQIL 4R7DA 4F7EB 5D72H 5EFIA 4CBPA 4Y1AD 2BVPB 3OKKA 1I7UA 3ARTA 4YFLF 2YS4A 3IU4H 3NZHH 1ZLVK 1OTTC 3HKFA 4LHUG 4OF5A 2FH6A 5ALBH 2YEZA 3MJ9L 1F02I 1IC4L 4NQSA 5T3ZH 1A1NB 3VW3H 1T2JA 3VXMD 2FSEA 3K8KA 5E8EB 4JREC 1QA9B 4PJ5E 2DQTH 1DBMH 4Y1AB 1OTUC 1VPOH 3OXSB 2V9RA 1S7RB 1AKJD 1NCAL 2D31B 1AIFA 2R9HD 4LSVL 1N64H 1XR9A 3IYLW 3VXMB 3FQNB 1GPOH 1DBBH 2J5LB 4CN6A 1AKJB 1NGWB 3E6HA 4UILH 4F7PB 3GMLA 5KVGH 2EYRB 4R7DB 3OJVC 5EFIB 4U6VH 3JTTB 3TESA 1IFHL 4YUEH 3OKKB 3I6GA 1EO7A 4UQ2A 1WZ1L 4I3SL 1R5VA 3LS4L 1NSNH 4OKVA 3DX6A 5GS2H 1FE8L 2FX9L 2FSEB 3MV9A 4XPGL 5F7DA 4LF3A 5D2NB 1LWRA 3CLEL 2O5XL 2F54A 1AIFB 3ZKND 1BZ9B 1XR9B 5FA3B 1QG3A 3MLUH 4KQ3H 5BCAA 3QUMA 4CMMA 1DQML 2YK1L 3DARA 5A43C 4G9FA 3E6HB 4AG4H 5CEZL 1T1XA 3O6LH 3GMLB 3BPLB 2AEQH 5HDOA 2QEJA 1WISA 5E6YA 3QIUA 5HYQB 2XTJE 1KCVH 1JHLH 2R0ZL 1HHIA 3I6GB 5J13C 4UQ2B 4U1MA 2CDFA 1NQBA 1RUKL 2F54D 3LD8C 4MMZC 4OKVB 3TZVA 3DX6B 1KLGB 3NPZB 3MV9B 5CMAA 5L8KB 3U46A 5F7DB 5SWQA 2X5PA 3OSKA 3O2WL 2VLRA 3T77A 1FO0L 1SMAA 4Z95L 3NIFF 3E1F1 4Z76A 2F54B 1W72A 1ZHNA 3ARDA 4GRWH 3OAZK 1ZV5A 5FDWA 4KKCD 4DKDC 4PLKC 4PRIA 5D6DC 3QUMB 4CKVX 4CMMB 4P2QA 2QQLL 4PJEE 2B0SH 4M6ML 3GJFH 5M94B 1RK1A 4G9FB 1B90A 2PYEA 3PHSA 4HWUA 5B4MC 5JLZA 4XVSL 5JIIA 4KJQC 4XC1H 5KVFL 2VLRD 1HHIB 1UA6L 4NJ9L 4ZS6D 4XGZA 5DT1H 2R8SL 4U1MB 1LK3L 1K4DA 3ARDD 3UPRA 4X6DF 2BSED 1E4KC 4YZFE 5D6CA 1VGKA 3MQIA 4PB9L 3X3FH 2XNAA 1P7QA 4KHXL 4KK5D 5CMAB 3OG6B 3U46B 4PRID 5SWQB 3HCVA 3ULUE 4P2QD 5FO9A 2VLRB 3T77B 3UMTA 2FEEI 3FB8A 1LE9A 4Z76B 1W72B 1ZHNB 3ARDB 4M93B 3DHJA 4YXKL 1P7KA 1QPPA 4MJIE 1CFTA 3FQTA 4PRIB 4HQQH 2AJ3B 4P2QB 1YEJL 5ESAA 2YR3A 5FYJU 4KRPD 5I19H 1RK1B 3S35H 4EI6A 2J12B 4NUJA 3QNXB 1OW0A 5E4EB 3LZFH 5JLZB 5C0AE 1P7QD 3I6LE 4WUKL 12E8L 1JHTA 3IS0X 2XQBL 1MFAL 3RU8H 1CDHA 3TYGL 2VRAA 3MBXL 5HVFB 1F4AA 4XGZB 4XP1H 5EH1A 2WK2A 4DGIH 1V7NH 1I75A 4P0DA 1YPZE 2CIKA 4DJMA 5ETUA 5D6CB 1VGKB 5HXMA 3PV6A 3L3OA 3BWUC 2XNAB 2MHAA 1P7QB 4Y16A 2VDMH 3BSZH 3FZUD 3HCVB 3RHWF 5LAXA 5FO9B 4RRPG 1Z9OA 1JI1A 3FB8B 1IVLA 1MCCA 3RAJL 1KN2L 3JZ7A 2LQRA 4OFYD 2X9XA 2OTPA 1P7KB 1X6LA 1YZZA 3S5LA 4IRSD 3BYTA 5E2UH 2BP3A 3GRWA 1CFTB 3FQTB 3S37X 1J1PH 1OT1A 1REIA 4PREA 5ESAB 4EI6B 4NUJB 3SCMC 1VACA 1MLBA 1Q1JL 2QSCL 3OZ9L 3I6KA 3V6OA 3FO2A 4AH2A 3H3BC 4K94H 3ZE2F 4Y16D 1JHTB 1UKSA 3QRGL 2YD9A 3LDBC 1KB5L 5C07A 5KSAD 3V2AR 1GC1H 3U1SH 3GI9H 1NANH 2J7LA 2Z8RA 5L88H 1MIEH 3VG0H 5ETUB 5E8NB 4D0CA 5FOBB 3PV6B 3Q0HA 3L3OB 4LU5L 4WWKA 2MHAB 3K2UH 4Y16B 1BX2A 5HHOE 1BM3H 5LAXB 2AVGA 3GMNA 4O2EA 4Z0BL 3CZJA 5KSAB 2LVCA 2IGFL 3I3EA 2OJZL 1X6NA 3EJYD 2VJXA 4E41A 2IAND 3N85L 3TIDA 1PEZA 4GFTB 2NW3B 3H7BA 3S5LB 4AM0B 4I2XA 4KKAD 2DLEA 3ZYOA 4ONFH 5C07D 4I77H 2MMXA 3K1DA 4EUPG 4D9RD 4X99A 1S7TB 4ODVH 2IANB 1VACB 2C5DC 4M9OA 5FF6A 3I6KB 4WWKD 4WI8A 3FO2B 5GS0H 4AH2B 1WTGT 3RVWC 5CSBA 5K9JH 4ZFZA 1F2XK 1U6AH 2I27N 5C07B 3MRGB 2XYCA 1UACH 2VABA 1F5WA 3PGDB 4E41D 2NY0C 1AY1L 5D96C 2GJ6D 3SHSA 3C2SA 4WWKB 5T3ZD 5ECJE 2F8XC 2QSQA 5I1DA 4F7MA 2H1PL 4O2EB 3GMNB 1IGIH 1BFVH 3LRHA 1II4E 4E41B 1J5OH 2D0HA 4NBXB 3MV9E 2EDKA 3IB4A 2FGWL 1Q9OA 3H7BB 1FNLA 4I2XB 3U4BH 3G5ZA 2OL3A 4ZTOL 4DUWA 2W9LA 1VEMA 4X99B 1HN1A 5L8JB 3QUXC 5FF6B 3GMMA 2X1PA 2H2SC 2FX7H 5DMYA 4KPHH 3QQ9C 4N0CD 4N8CL 2HKFH 4ZFZB 4G9FE 2WINA 1LP9E 4Q6IA 1F4XL 5SV4A 5D1QA 3HAEH 3V8CA 3TBVB 5EU4B 4JKLA 4BA8A 4MGXA 5E0QA 3RKPA 4XMPH 2EE9A 5GS2D 1MNUL 1LEKA 2ENYA 3G6AA 1MFNA 2NLJA 4F7MB 1UYWH 1XGUA 2BC4A 4H88L 3V7MA 4KZEL 4XPFL 1LK2A 1IE5A 4FQXD 2Y1VA 1Q9OB 3P9MA 4Q2ZA 1EAPA 1EBPA 1N6VA 1ZTXL 2OL3B 3FN3A 4NQDA 5KVMC 2WV3A 5D1QD 3TA3D 5F6IB 5JMRA 4FNLH 4IHOA 1CLZL 2WP3T 4K7PY 4FQXB 1NGQH 2DS4A 4KH2A 3ULVC 1YEKL 2A1WH 3HB3D 1QSFE 5F44A 3WD5L 3O6MH 4J8RA 4PY8J 5EU6A 2PYEE 2WINB 4L8BA 5GJTH 5CIPA 5D1QB 5HI3D 5ADPH 1HWGB 4JY5L 4ODBD 2YXMA 4BQ6A 1YN6A 4OSUL 4LLVB 4GUPA 2NZ9D 1T1WA 2IC2A 4M6OH 3TN0A 1LEKB 2CUIA 5JXEA 1A7QH 5C0RL 2NLJB 3WO4B 2QSTA 1M7IA 1CBVH 5IQ7L 4Z77A 4P2RD 3ZKXC 4NQDD 1F97A 1CXFA 2BC4B 3HUJA 1IZKA 2E6QA 1BEYH 1D5BA 4I0PD 1RIUL 3P9MB 5SX5K 2V17L 4Q2ZB 3ARFA 4NQXA 2KQMA 4FQ2H 5EUOF 3O2DH 2E9WA 2EDBA 4P3DA 4HFUH 3EKCA 3P77A 4P2RB 4NQDB 5JDJA 4IHOB 5KTEL 2D7NA 3BPNB 5BS0A