4GMSL

Crystal structure of heterosubtypic fab s139/1 in complex with influenza a h3 hemagglutinin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
211
Chain Sequence
DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQEKPGQSPKTLIYSASNRYSGVPDRFTGSASGTDFTLTITNVQSEDLAEYFCQQYNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1 chain
total genus 45
structure length 211
sequence length 211
chains with identical sequence M, N
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmsL01
2F54E 3QHFL 5I2IB 3GMLB 4P9MH 5EU5A 3CFBA 1NDMA 3O8XB 1KENL 1A6AA 3X3GH 1PQZB 2X2YA 4P57B 5D7LA 3SE9H 5JXAH 4JFDB 5BRZE 1SYSA 3PQYB 5E6ZA 2YA1A 2QLVB 3FO1A 4MXQC 3V0AC 3VA2C 1WBXA 4G9FA 4OZFB 15C8L 1WIOA 1BAFH 1EPFA 1FZOB 4MYWB 1OPGH 4M6OH 1NC2D 4LQ1A 4RWYL 3MRIB 1JTPA 2PR4L 3BZ4A 1RUMH 5GS2H 4NUGL 4OLVH 4Z5RB 1YMHB 1B4RA 3OPZH 1CZ8H 2R69H 4JFED 5MI0B 4ELME 5D1ZC 5C07D 5FDWB 5L2KA 1S9KC 4HGKC 3NABH 3V52H 2H9GA 2QEJA 3VRLF 2K1MA 1UJ3B 5DI8A 1GAFL 4K3GA 3JWDC 3B3IA 3VFOA 3VXOA 5FF6A 3WFHB 1IM9B 5FYLE 3M1BA 3QXTA 1T21A 5D2NA 3O8XA 1MRCH 2IWGA 2DQGH 1D5IL 3C87A 5FYKE 3HNSH 5B38B 2IBBA 4R4NC 2HJKA 2B1HH 3TJHD 2ATPA 2FECI 1F6AB 2CUIA 4KTEL 2D7TL 5I1JH 5IB3A 4OZIF 5IW6A 3QG6A 3IAGC 3ZKMD 4MLIA 1J18A 4PJ8D 4XBPB 3PNWA 3RWCB 1OB1B 3V4UL 5C86A 4I0PD 1LQSR 3JWOH 4UQ3A 1MWAA 2AQ2A 4TNWK 1S9YB 3C5ZD 1NANI 4MHHI 1EERB 1RZJL 1NCNA 2R0KL 2XTJC 4OD1H 2J8OA 1UM5L 1JYNA 4K2UL 1CT8B 2GKIA 3IF1B 4D8PB 4NWTH 3TLRA 2X41A 5C09A 1OD9A 4I3RL 1MY5A 4KGJA 1CFQA 4M61B 3DYOA 3LVEA 4HD9A 4BQ8A 3L7FB 1A7OH 5L9DH 1ZSDB 5DJYB 5B3JF 1EEYA 3BSZL 4KUCF 1A21A 1OF2A 4S10A 1XIWA 2C9AA 1KACB 1U8HB 3H9ZA 2P8MB 4FFZH 4Z9KB 3GKWL 2IEPA 4RGNC 3VFPA 1F6AA 1W0VA 4HULB 5I1IH 2VXQH 5DSCB 1CLOH 5FHBH 4HKZB 2HJKB 3WXVL 4JRYE 4NBZB 4XNZB 3IYLW 3GEWB 4WFGD 2F5AH 2QL1A 2HMIC 4MAYA 1HHKA 2H2PC 3MBEA 1HQRB 4WCYL 1IGYB 3WE6B 5CBAA 3BEWB 5I74C 5KG9A 2R29L 4OLVL 4FXGA 1L7TL 1XZ0B 5HYQA 5JIKA 5ADOH 9CGTA 2AABL 5DYOB 3BD3A 4PRDA 3CSBA 5JMRA 1CLZL 2CKBL 2JCCF 4APQA 4PLNC 3K4AA 4XCFL 3BT2L 3UO1L 1A22B 5DFVD 3OHXB 2DQDL 2R0ZL 1OW0A 1W8OA 4GRWH 3CSYA 3HC0B 1EHNA 3QIUD 4LBEB 5DEGB 1JI1A 3O3DA 5D7JB 4DVBB 3CFCL 3HB3C 3MRRB 5IROC 5LBSL 3RDTC 3BPLC 4X7SL 3C5ZB 4Y5VB 3LKRB 3FRPG 5ITBL 5CUSL 4C56A 5LG1A 2IH3B 4HKXB 2HH0L 4LRNL 4UIKH 3B9DA 2AXFA 5IW6B 5B3JE 4YIQA 1RHHA 4WW2A 3WNOA 3FO1B 3PHOA 3LKNB 5DK0B 4NKOA 1CFBA 2I27N 3H3PL 4FTVD 4F7PA 4JRYD 1NDMB 4NN7C 2YKLL 1UXWB 2SEBB 3NCFB 5BJTA 1SMOA 1V7MH 3ZTJG 1BJ8A 4JDTH 2R4SL 1ZHNB 4ZQKA 1FP5A 1MCPL 2MFNA 3ABZA 1Q9LB 3LN4A 5FYJD 1R24B 1TNMA 3KPLB 4YBQC 3T65B 1ACYL 5IHUL 5C8JA 5HHPB 1J1PH 3QUXD 3WFBL 1BREA 3U4BH 3HS0A 1QSEA 3UBXB 4QGYA 3UMTA 1G9MC 4XPTH 3VWKD 3EO1A 4LKXA 3MUGB 4XBGA 5HHQB 1U8LB 1R3HB 1G7MA 1T2JA 3KJ6H 4I0PA 1AGCB 5C0CE 2XPGA 3O4LE 4XNMB 4DVRH 2NXYC 5JPNB 2KZWA 4PRPA 5F71A 4JFHE 1JZ8A 1I9RL 2EC8A 1IMHC 4XXCC 4OLUH 3UEZA 4G9FB 3T2PA 1IGMH 1LO3L 4OZHF 4LL9A 1HCFX 2IC2A 2C5DC 3N1GC 1JF6A 1DFBH 1Z0NA 3U9UA 1PG7H 1S9VB 3HI6L 2XYCA 2ZZUT 5D70H 4OI9A 4OCLC 4XC3L 3SPVA 5D7KE 3L3JA 2AGJH 2IBGA 4JFPA 1P7QD 1NKOA 1R3KB 3NCYS 4OCYH 1JMXA 3TO2B 1KBGH 4JHAL 4JN1L 4X83A 3S6CA 5DWUL 2I60L 4PY8I 5BO1L 2LU3A 1CTOA 5D93B 1AQDA 2GK0B 3UBXA 3OKKA 4WEBL 5F3BB 1E4WL 2Q6WB 1UC6A 4A2MA 2NXZC 1AP2B 3QO1A 3MZGB 5IBLD 1MRCL 1JMZA 5HSFA 3IT8D 1YY9C 2DQGL 5DJXA 4CU7A 2H32A 1TJIH 2VDOH 3KPPB 3KPQB 4PV8B 1HKLL 4WDIB 3QAZC 4R4FH 1WTGT 2UWEF 3O3EA 1P6AB 3HAEG 4QYOB 3DYMA 4XCEB 1OGTB 5L88H 2D4DA 4JDZB 4X6BA 5D1QB 4EZMA 4Y4KD 5HDQH 3LKSB 3RU8L 4PJGB 1J8HB 3QUYD 2X1XR 3BN3B 1QRNE 1RIVH 5E24E 1CDUA 2W9EL 4HIXH 3JXAA 2FLRT 4QRRE 1TQCC 3O2DA 4OLYH 5J6HA 2Q8BH 1UFUA 2J2ZA 3FQXA 2G2RB 4I1NB 5DHYA 4HIHB 1RJYB 5E00A 4JFDD 1IVLA 4HGWB 1S78D 1BPVA 3RX8A 3O6KH 4OM1H 4PY7A 5C7XH 2AJSH 5CFHA 4OJFH 1RFDH 4R8WH 1CT8A 4Y16C 4ZXBD 2E7LA 2CK0L 2EYRB 4HUXB 3MV11 4YLQT 1P7QB 4WDIA 4D3CL 1VADA 4WW2C 3U0WL 3IDIA 4JM4L 1FH5H 3KPSD 4N0UA 2ITCA 4AQ1B 5IESH 4ZOAA 4LLVA 2JIXD 4PP2B 3SBWA 2ZUWA 2FD6H 4JY5H 3SDAC 3PIQB 2FJGB 3INUH 4O58H 2GFBA 1F58H 5EZLA 5FYJH 1BIIB 1MCJA 3G04A 3K8KA 2AXJA 5E8OB 4JFPB 3W9EA 1J10A 2WANA 3SGJA 3GJFB 1CQYA 3QXDA 2AGJL 4HKBA 4AEIH 2XNAA 4G8GD 3PWJA 3FRUA 1J5OL 5C0JA 1NCBL 2WIMA 1WWBX 2VISA 1BVZA 5DUBA 4PRPD 2O5YH 5F7DA 4QXTB 2PKDA 4OLWH 3AU1A 1CD0A 1S3KH 3FOMB 5C9JA 2LU4A 3OKLA 2DM7A 4KK9C 2P5WD 4IMKC 5HDOA 4HWEH 3IJHB 5F89A 1ZVSB 4NN6C 3UDWA 3WS6A 3BAEL 1MLBA 4MCYA 4D8PA 3DWTA 5AAMA 4JQVA 2DI9A 4I0PB 1E6OL 2W0FB 2QQQA 4OF3A 1QR1A 3MV8B 2CGRH 3MYJB 1OARH 4OZHE 4YDKL 2A73B 5JPNA 1JGDB 5C6PB 3VGHA 4WWKB 2DOCA 1MLCB 4WV1A 32C2A 3T4YB 2XIDA 3P9MA 5BMFL 4HFWB 1CVSC 3V52L 4FZEH 2ICWA 1LEGA 5CZVL 5L2JB 4G6KH 4P5TC 1JJUA 1V7ML 3IDIB 2AV1B 4LCWE 1JK8B 3QDJA 3QIBC 4YFLI 5T3ZE 4KDTA 1X4XA 4JFDA 4HKJB 3BE1L 2R0KH 4JJ5B 3UTSA 4HC1H 1CL7H 1JPGA 3FQWA 3MACL 1CCZA 5DR5L 4EUPG 3I9GH 1XIWD 3D0VA 3DARA 4WI3A 1GGTA 2BOCA 1TQBC 1OD7A 4LCYB 4NPYA 3ZE1E 2VDKH 1KB5L 4Q9BA 1RJYA 5LGHH 5AZ2L 4NQXB 3KYKH 5F9OL 3O6KL 1SY6A 5DD6B 1GC1H 2AP2A 4KTEH 1NL0H 5J6HB 1RZKH 1J8HE 4PJ5D 5ITFA 3X11B 1J0KA 4M7LL 1UKTA 4FS0A 4H1LA 2UZXB 4NQEA 5D1ZA 4F80A 2HMID 4ELMB 1LE9A 4U31A 4WWKA 3TZVA 5F6IB 3MNZA 3BP7B 3IU3A 4XNZC 1N64L 5IMOA 3X14A 1XZ0A 4KZDL 3DROB 3PGDA 3ZL4L 3PP4L 4MZ3A 3IDJB 2CDGA 2FEEI 2EXYD 3QNZB 1BVLA 4U3XA 2FH8A 3RA7L 3GSRB 1Q9KA 5C0BD 2FIKA 5F9JB 3PV7A 1NBZB 3MRHB 3LKQA 1S5IH 5CBAB 3QWOA 3TWCL 1IC5L 5E5MA 3JV4A 4J1UB 2UYLB 1FRGL 1DQTA 3JV4B 1FG2B 4H8WH 3EDKA 3OXRA 1HOCB 2HKHH 3EDDA 5CJXA 1W0WA 5A3ID 3OXSB 3P11L 5IGXH 3OR7B 2FX7L 3QZWG 3ILPA 4U1JA 3S9DB 3PWLB 4HIJA 5JIPA 5TDPA 2Y36H 5FHBL 4X6DF 5LQBH 3T09A 4GXUN 4G9FE 3QHTC 3GSUA 2O61B 1RSFA 1I8KA 4NC0B 3F7QA 2NX5A 4N1EA 5KVEL 4UTAL 1OWWA 3EOTL 5I6XB 3LV3B 3VRJA 5KAQF 4M6NL 4HK0B 3WJLC 5E4EC 5GZOD 3E2HB 4X9HA 5GGUB 5JNYB 1RURH 1EO5A 2H8PA 4FQ2H 4BUGA 1AIFA 4KXZI 4JPKL 3RY6C 5TQ2H 2ZCKL 3HNSL 4CMMA 4PREA 1JV5A 4X9BA 2X4TA 4IDLA 4AYFA 1ZEAH 4HUWB 3DGGA 1Q9LA 3LN4B 5AYUL 4LHJB 3KJ6L 5J1AB 5H37G 1JHTA 4O51A 1JNLL 4IRJC 4XX1E 2E8ZA 4KROB 4LK4A 2ZNXA 5EPMA 2FECL 4HWZB 4JM4H 2C1PA 2F54A 3CZFB 3L6FA 2BSRA 3AVEA 3KNBB 4WTXA 2ZCHH 1KB9J 1T1WA 3MXVH 4HXAH 4QT5B 1T1XB 1UJ3A 4PV8A 2C7UA 3MGOB 4Y4HB 5HHVH 1ITCA 4PJDE 1IT9H 2EDDA 4R0LA 4WHDA 2YC1A 5KBNC 4HPYH 1W72L 2VXUH 5KVGH 4N0CC 1FNGB 2J6EH 2ENYA 4X7EC 5DUPH 2ICWI 3RWDA 3MV9E 1FNGA 4I4WA 1CFSA 2BOBB 4E42A 4PB9H 1MFEH 4YFDB 4LDEB 4O5LL 1BF2A 4Z7WE 5EC2A 1ZT7B 4YHPA 4DZ8A 4EN3C 2BXZA 1WWCA 4KJYB 4TQEH 5ILTH 4MB3A 1ZVHA 1M05A 3BIKB 3ULUD 1NGYB 2GTZB 2YBRB 3HNVH 4MCZA 2D4FA 4X98A 5HI5D 4G9DA 4FFZL 3FFCB 3DURA 4QXTA 4QRSA 4C59B 4YBLB 2VLLB 4KRMB 1YMME 4DTGL 1HHJA 3ZE2E 1S8DB 5IFHL 3E6FB 4N0FB 4I8DA 2C1PB 2WMPA 4PYGA 3WLBB 3IFOA 4J7RA 1HYSC 2P4AB 2E7BA 3TT3H 1KFAL 1FFNA 3NBNA 5HHOE 3BW9A 4Z7QF 5DD3L 3SJVD 3MR9B 1A6UH 4NO2B 3QI9D 4WW1B 3VXRD 3BVNB 5HHOA 4N0UE 3O3UN 2R2BA 4HIIA 4JN1H 2XTJE 3D3VA 1OLZA 1K4DA 2FYYA 1QSED 3MLXH 1ZGLA 2VZVA 3JTTA 4P46A 4AEHL 3ULSB 2UZYB 2HRPH 1QNZL 1FCCA 2HJFA 3QDHA 3TM6A 2P8PA 1K8DA 5DJ6B 4R4FL 5HYSA 3TFKC 5EN2B 2VQTA 1FNFA 3L95A 3KHQA 5DJ6A 5GS1B 4HMDA 3EOBB 4JANA 4XTRC 5I30L 5GGRB 2GSGA 4S0TD 2ZOKB 2F5BH 4JG1L 4DFIA 4U1GB 5MERB 4X6CB 2G2RA 1P4LA 3BMWA 5F7NC 4AK1A 1MCOH 3OXSA 4JKKA 2EC9T 5IB4B 3VFUA 1ZHLA 4PGEB 1E27B 5FGSA 4ENED 1CGSL 2V2XB 2GSIA 1KCKA 1W0WB 4XP1H 1DBML 5FUCE 5DDHB 3O9WD 2BNQA 1XGRB 2YUWA 3HMWH 1D5BA 3LKRA 4QHNB 4PJBB 3M45A 3TVMA 4DK3A 1YY8B 1NAMH 3B9KD 1OGTA 4G8IB 3AMKA 2R1WB 1A02N 1MCWM 2D9QB 3CLEH 4PLKC 4NM8H 4MNGB 4OFIA 2YBRA 1HHGB 1FH5L 3HUJE 1EO8L 3TVMD 1G6VK 2HTLD 5EFIB 2CO6B 2CK0H 2Z35A 5JOFA 2AXGA 5J56B 1DQMH 3VXRB 3BEWA 1NDGB 3GNMH 2YD5A 3Q1SH 5F96H 3SKJL 2DKUA 2R9HD 1CU4L 1LP9A 2FX7H 3ES6A 2A9NH 2IF7A 2MHAB 3NMEA 5ESVB 3LDBB 4WUUE 4X80H 2EYTB 4P9HH 3LDBC 5GRXG 5EIQA 1D6VL 3B5GA 1DBKH 3BYTA 4ZAKA 5I1HH 3DUSA 4K94L 5JA8B 3OKDA 3TT3L 3KG5A 2BVOB 4IIQC 1GOFA 4KRNA 4KKAD 5DD3H 3BGAA 2BFVL 3LD8B 3DV4A 2EDLA 1NLBL 3ARFC 4OD2A 4OBSA 1UGNA 1R6VA 1N0XH 4ZD3L 1ADQH 3MRMB 3RFZC 1UENA 1FGVL 2NY6B 4JJ5A 3UTSB 1MI5B 1QRKA 4LAQH 3T0WA 4Y5XA 1IGFH 4EI5D 2Q86A 1HILA 3GBNL 1ETZA 3QT2A 1EBAA 2YPVH 3RL1B 4JPIB 4AH2A 2MQ3A 3CSGA 3PWVB 2OLDA 1RZKL 1DLFL 1JNHB 1OT1A 4ODUA 2F5AL 3TZVD 1U8QA 4GKZA 4BFIA 1WLHA 2WLYA 4M7LH 4LNVA 5I8KL 2DLFH 5DRXA 3UPCA 1ORQB 5SV4A 1WV7T 4Z76A 4GUPB 4NIKB 4G9FD 1MLBB 2WWKT 5CEZE 2DTMH 1UM4L 5GGVL 1G1CA 4HS3B 2WK2A 4PP1D 2R0ZH 4KKAC 4OCNC 2HN7B 3CX2A 1S8DA 3MODH 4RDQF 3EDFA 3PG2A 5IIEA 4TRPL 4M6ML 4PY8J 1CL7L 3F5WA 4GRMB 5JHDE 1XF4B 2QQLL 4GBXD 3SOBL 4H0HB 1YNTA 4S1QL 5CINH 1YEIL 4L1HA 1YUHB 1MJJB 5T5NG 5IOPB 3LN5B 2WIIA 4J3XA 1OP5H 3E3QE 3INUL 4O58L 4UNTA 1U8QB 4EQ3A 1CFTA 1U8MB 4Q2ZB 4ZUWB 1N5YH 1G6RH 1FLTX 3QDMA 4F8TA 2DTSA 3DSFL 5CZXD 2X89A 5IK3A 5HPOA 1N2RB 3NIGE 5B8CB 5SWZE 3TBWA 4KKNA 4U49A 3QDGB 2BXYA 1EH9A 2HFEB 3C6LD 5E2WH 3TESA 1KCRL 4LLUA 5F6HI 5F7EH 3QJFA 2AJVH 4XP6H 1G7JB 4HBCL 3ZKXB 1J8HD 5I75C 2XWTB 2XWJA 2DMCA 1UQSB 5I2IA 2HP4A 1N8ZA 4G8FB 3H9HA 5C0GA 3H9YA 4ENEC 1FGVH 2PW1B 4XH2B 5DK0A 2J88L 3ARWA 3S35X 1KXTB 4BSVA 4U33A 2ZSWB 4O4YH 1QSZA 2V17L 5M7QA 3TH4T 2IH3A 3OL2A 3FQUB 5K9KB 1NCCH 2P8MA 5DJZA 5ERWB 2FCBA 3H7BA 3Q3GB 3TWCH 1MCFA 3FQUA 4NUJA 3VGBA 1FRGH 4XWGH 2OTUA 4XVSL 4XAWL 3VH8B 3VXTA 3HG1B 3V7AE 3K80A 3LS4L 4Z7VA 2H45A 3MV7B 1D5XA 3AREB 2DQIL 3VXRE 5K9OA 1EIBA 5HYSB 1KCUL 1JHLL 4DKEL 6FABH 3H42H 1MJ8L 1A9EA 5E6IB 4ZSOB 1AGFA 5LXGH 4XXDB 2DL9A 3T0EB 4BK5A 3TBWB 1NCUA 3O45A 3DX8B 1FNLA 3DX9B 4U1GC 2I9LA 3HN3A 3QEQD 4I3GA 2DQJL 3MNWA 1GGBH 5F7MC 1YMMA 32C2B 2Q6WA 1RZ7H 4DN4L 2DM4A 1YY8A 1EHLH 3KDMA 5I15L 3GUTB 2IQAB 2UWEE 3OQ3B 3TYGL 1Z2KA 2K7PA 3P77B 4LCUB 4OD3H 3O6ML 4N1HB 4X99B 5F88A 4AG4L 1H3PH 2HTKD 2OQJB 2VERN 3PDGA 1D9KA 3CFJB 1AKJB 1QHOA 3HMXA 4F8QA 4CN4A 3IVKA 3SPVB 3HNVL 3MCKB 1P6FA 1L4IA 3RWEA 1JPFB 4PRHD 5I8EB 3D18A 1JPFA 4P3CH 5GRYA 1DQML 3T3MF 3H0TB 2FSEB 3BXNB 5DRWA 3RUGB 5IVZA 4OB5H 1H0DA 4NM4L 4BSWA 3A67H 3VD9A 4HIEA 2XNAB 4GRWB 5L2KB 5HY9B 4P0DA 3SE3C 5DS8A 3W0WD 3WNMA 5AG9A 3EO1B 4LKXB 5HHME 2ZJSL 2GJ6B 3NA9L 2GUOA 4QNPF 4PGDB 3N1PC 3EJYC 1MEXH 1G9NL 5D71H 3U4EA 3EO0A 4ONFL 4V1DB 4ELMA 3DGCR 1IC1A 2IANB 1U95B 3TA3A 4S1RL 3ZHKA 4N0UB 3REWA 2FRGP 3DI3B 4U1KA 3F62A 4EQ2A 4UIMA 1P7QA 3LKOB 3MYZA 4M4PA 4K23L 1YY9D 5E6ID 1U6AH 3QQ3A 4EBQL 1IC5H 2HLAA 2R1XB 3CDCA 5BZWB 2Y5TB 4OLUL 4UV4H 3P4MA 4XVSH 4F7MA 2FZ3B 3VXQB 4F9LC 3ZHLA 3P4MB 4KHXH 1ZANH 1UCTA 4MDJA 4NQDB 2NQCA 3N50A 4JG1H 1M7DA 2YK1H 5D72L 3O9WB 5E7BA 5HHMD 1U3HB 1S9XA 1VGKA 4D0CB 3VXMA 5DJDA 3WL9B 5T3ZH 3KWWB 4JZJA 3WKML 5E8EA 1YNKH 1FFRA 4G5ZH 2H26A 1KB5B 5BRZA 4JEGB 4HUVB 5CLTA 4MXVE 4HHAA 3ZDXF 5DJ0B 3MRPB 5GGUA 5JNYA 3ECBA 2XQBH 4V1DA 1JZ3A 4MHHG 2XWBA 4ONGL 4MQ7A 1ORSB 1ZK9A 2XN9B 5FO8B 3WIFB 4WY7H 4LBEA 4L9LA 2ILLA 2WUBL 4DN3L 4BQ9A 2X42A 4ZODA 3SE4A 3IJSA 3PHSA 5EU7C 3MLSL 3MLXL 4MNHB 5L7XL 3FL7A 2MKWA 1T1XA 5EBMB 3WS3B 4ELKB 4BSJA 3RVXC 4P57A 5D7LB 2AS5M 1SYVA 2MCPL 4LLMB 3DXAE 1J87A 1R0AH 5E6YA 3CDYA 1JWMB 1JPSH 4PTUA 1M71B 2NTFA 3O2VL 3CIQA 1LHZA 1OOAA 5I9QC 3QUKA 5LWYH 1RUAH 3DUUA 4ZS7H 1XGPB 2QHRH 2VMFA 4PJ9D 4NNPL 1JHKL 1R3KA 1AH1A 1PY4A 1JV5B 1W72H 3GHEL 4WI7A 2HT2D 1KG0A 2E9WA 2W1NA 1UZ8A 1H5BC 2FATH 4UU9A 4XPAH 3MLPA 5EU7E 2CLZB 2ED8A 4NO5A 4S2SA 5F7YC 3SDYL 5I76A 4GQ9H 5DJCB 4HS6A 5DD1H 4OQTL 4K8RL 2AK1L 4L4TA 3BPNB 3QPXL 4LSDA 4WUKL 1BX2A 4NQSA 5ILTL 3BWAA 3L7FA 1NMAH 4ZSOA 3JBG7 4L4TE 5IHZA 4WFHE 5KVFH 5FYKH 3O4LA 3PHQB 3PWUB 4L9LB 3OKOB 1A0QH 3FMGH 3CNKA 1U93B 2ZOLA 3HZYA 4M03A 5F70A 1WC7B 3VE0B 2GIYA 4OSUL 4X4MA 5CBEA 1J0JA 2D31A 3TBVB 4ZUSA 3L3OB 2R2HB 3BQUA 5IB2B 1AI1L 4RZCA 4R2GB 1OVZA 1HH6A 3OKYA 4XP4L 3P0VL 4X6FA 3D1MC 2C1OA 5DRZA 1FAIH 1P7KB 3ARDC 5DJZB 3S3SA 1T7VA 1FIGH 4TUKH 5IUSA 1AE6L 3WO3B 4NFCA 3V4PL 5T3ZL 3CK0H 2W38A 3QWOB 3RWGB 1KCLA 4FABL 4I18C 5SWSE 5D93C 5F9JA 4M7LT 1XAUA 2DF3A 4PGCB 2RQ8A 4XPFH 2DQEH 4M43L 3QUML 5HTSA 5HJ3B 1ZLUH 4IHOB 4YPGB 1ED3B 5JW3L 2W9LA 1SJVA 2EDHA 5B8CC 5T1DL 3N85H 3EYSH 4MDIB 4G6ML 35C8L 2DQFB 4IMLB 2EICA 1AXSA 3EO0B 3L3GB 3MOQA 1INEL 2DLFL 4MJ5A 1BZ7B 1DUZA 3O6LH 4HGMA 4WUUA 1BFTA 5TQ0H 1CXHA 5I8OH 3S8WA 1HQ4B 1T66C 5JIIA 3L5XH 1A1NB 4G8GE 3OSKA 2P5WB 4PJFF 5D2NC 1E4XI 1VCAA 5GRJH 5C08E 5CEZD 5DVNA 5I19L 2FSEA 4ZS7L 4NN5C 3PGFL 3QIWD 1DUYA 4QRQA 1G9MH 4TRPH 2UV3A 2EC9U 2FHBA 3SKMA 1N7ML 5EUOF 1C1EH 4I2XE 1JFQH 3WE6A 4ZUTA 1HHHA 4GQ9L 1JPGB 2BVQB 3QXAB 2BNQE 4ONFH 4ZFGL 1H5BB 3KPSA 1FVCA 5TE4L 1HXMA 3BKMH 5EOQH 1I1AC 2B20A 4H26B 3RWGA 4KDWA 1DZBA 1FO0L 5MEQB 2FGZA 3L5JA 3OZ9H 2YD7A 4RNRB 1RPQA 2VR4A 1PYWA 3I75A 1S7XA 4HFWA 3MV7D 4O2FA 3SDCD 3MNWB 7FABH 1YYLL 4X9IA 2P43B 4YHIB 3EYVA 4YWGH 4M48H 4XNXH 2PXYD 3RVTC 3WKNA 3DHJA 4CVXB 1F3DJ 5B3NA 2EDTA 1AGBA 3VI4E 3KXFA 4L8BA 3RL1A 4PRIA 5CJQH 1D5XB 1MCQA 3SDAB 2CMRL 4XMPL 2W92A 5EOCH 4WGWB 4P5KB 4MMXC 1K85A 3FQXB 3B2UD 2NXYB 3J7HA 1PGRB 5E2WL 3H9SE 3P3YA 1N5AA 2C3HA 4O5LH 4NO5B 4OCSL 4S2SB 3S36H 3O11B 4L8CB 5E6IC 1P84J 1KYOJ 3G6AB 5IROA 1QA9A 3SDDB 2OI9C 3MLWL 1DLHB 5BS0A 2XRAH 4MGXA 5DK2B 4GBXB 2W59A 4HX1B 4XRCB 4F9PA 3AREC 1QBLH 5KSBE 5ANMA 1IQWL 4J12A 2DBLH 1D5MA 2IGFH 2X1QA 3QFJE 5MEOB 1LE5B 2OBGA 1LP9B 3LHPH 1FPTL 3BKYL 2VXVL 1MCLA 4CN1A 2MCPH 5GRVK 5F7KC 1MCSA 4URTB 1HCVA 2D7TH 3EOAA 5J12C 5I1JL 1P69B 3WO4B 1KJMB 2QBWA 1OAYL 5FUZH 2R0LL 3O2DH 4KK5D 4HUXA 4X5XA 1P4BH 2UVEA 1VDGA 3R0NA 3RQ3A 1DBJL 4NQED 1L9MA 4M9PA 2P24A 2P5WA 2DQTH 5E94B 2WBJC 2DDQL 1A2YB 3VA6A 3D39A 4FXGB 4DZBB 3K2UH 4JAMB 1FCGA 1ZOXA 2AEQL 1DN2A 1QBBA 3VH8G 5DMIH 1NCTA 3RNKA 3SE8H 5FGCB 3BKCH 4G3YL 3SOBH 3G08A 2EO1A 1D9KD 5AD0B 4NOBA 3RDTB 1FL3B 1WCBA 2JIXB 5T1MA 1Z0MA 4WI5A 1YNLL 2VZ1A 1F4HA 3B9EA 3G6AA 3G5YA 2A77H 2Z8VC 4NQCE 3EGSB 1ED3A 4YDIL 1SJEA 5IVXB 4RFOH 4YJZL 1ZS8A 5A16A 5HYJA 4LSUH 4K7FB 5JPMB 5J7CC 2X5PA 1JNNH 1JNLH 4X6CA 5TPWH 4GG8A 3IDNB 3V6OC 4C4KO 4ZO9A 3O3EB 1B4JL 1V7NH 3QEGL 5B21A 3NPSB 4L8BB 3HKFA 2E3VA 1M6OA 2A83A 3PABA 5ESQA 3WUWB 4UIMB 1FGNL 1KELL 4HFUL 2NLJA 2C3VA 3WBDA 3P73A 4YHYB 4Y89A 4TVSa 3S97C 3WIHH 3P9MB 3DRTA 3FN3A 1DVFB 4K7PX 1AGDA 2EXWC 4GW1A 5ALBH 1WAAE 2AI0H 3FRPA 4PJAE 4RWHA 4YX2L 4KK5C 4Y5XC 4OF7A 5I1DA 1NCCL 3U4AA 3GI8L 4M9OA 1DANU 5JDJA 1PG7X 1CR9L 4G7VL 1CD1B 4P4RB 3CU1A 2Q3AA 1FO0B 1GPOH 3SKNA 3BQUD 3GJFH 4UTBL 3IDGB 1EEUA 4ODHL 4PIRF 4S11A 5LGJB 5KSVA 1JZ7A 3C9NB 2APBA 5EIVA 3RP1A 3RWJA 4Y5YB 3VMPA 4IS6B 2HJLB 3DURB 3VXNB 3OR7A 2OX5A 5JLZA 2XZCL 4NT6A 1F11B 4D0DA 3RDTD 2HT4C 5TQ0L 2BNUB 4TULL 2F8OA 2PR4H 4JVUA 1C16A 4M00A 3L5XL 3GSQA 5L8JB 1O7SA 4C58B 5EUOA 1URLA 1VFOA 1RUAL 2XQBL 1EVTC 1BLNB 5A2LH 3S36X 1JGUH 1GGBL 2H32H 2GTWA 4PJIA 2ZSVA 3C8KB 4G5ZL 2X05A 5JIHA 3PV6A 1GC1C 4J6RH 2IALB 5DMIL 2VLJB 2WINB 3PF2A 3QWRA 5CHNA 4KRPB 5HGAA 5FB8A 1T0MB 3U2SB 2P46B 1KB5H 5DZOA 1AHWA 1G0DA 5B22A 4JM2B 3WFCL 2JB6A 4BM7A 4QGTA 3V5KA 3D39E 2ZG3A 1A1OB 1DQLL 5ID1B 4MA7H 2ADIB 1S5HA 1R3JA 4XTRD 3B8SA 2Y25A 4G7YL 3DMMB 4N8PA 1CBVH 2GJZA 4X0KA 1HDMA 1D5BB 2Q7NA 3CVHL 1QFWI 1C5BL 3NIGF 5BS0B 1AQKH 1KJVB 5KJRH 4YUEH 2BVPB 4M8QB 5GZND 1WICA 2EEDA 1GSMA 4KK6D 3OAZH 5IW1A 2DTML 3U9PL 4CNIB 2Y07L 3TPUB 1WF5A 4PJDA 2KPNA 4UT6H 4X6FB 5FYJL 4D9QE 3K2MC 1TTUA 4L29A 1CL7I 2Y7QB 4F33A 3MRCA 1WFNA 4RGNE 2DWEA 3KJ4C 3MUJA 4RZCB 3D0LB 3H9HB 2HVKA 3FT4A 4HK0A 5D9SA 1QLRB 2NX5E 3NA9H 2F53B 2FHCA 4H20H 1LO5B 4O00A 1OTTC 2A0LC 3I50L 4HBQA 1B0RA 1FN4B 2DLTA 1P5VA 4TYUA 3C8DA 5JO5B 1E0OB 1G7IA 5CGYD 4K8RD 2D0FA 4MJIE 2HJFB 4LDOB 2KKQA 3CXHK 2P5ED 4OLZL 5D1XA 3UPRB 4NZDA 3IGAB 1NCAH 3DXAA 5FYKL 1A4JA 3ARFA 4XP4H 1QFUH 2F58H 5KS9F 3D85B 4GG6F 5HI5C 4OKDA 5TF1H 1JYXA 1NGXB 5HPMA 4OSUH 5DXWA 2VLJD 2HVJA 3MV8A 1DANT 2FEEL 1AI1H 2X6MA 4BQ6A 4X6EB 4P46C 5DS8B 1CE1H 2DLHA 3VXUE 1IZJA 1QVOA 3HZVB 4B0MM 1KNOB 1DE4A 4O9HL 3BT2H 3UO1H 5C70A 2HG5A 3VXSE 1A3RL 1DR9A 5KVMC 2DYPD 4HC1A 1GAFH 5KSBF 4JFEE 1WCQA 1NCWH 4W6XB 2N1KA 1GIGH 4JFEA 1YDPB 2HTLC 5FGBA 4OI7A 3OJ2C 4FQLL 3QHFH 1M7IB 3R0MA 1B6UA 1IGFL 5GIRA 2VLKB 2OYPA 3SE9L 4ONOA 1NC4B 2GAZB 2XY1A 4Y1AB 4L5FL 1V05A 5I1DB 5FGBC 1YMHA 3AS0A 3WDJA 2WQ8A 1UYWH 2IPKB 3LQZB 1BM3L 1HNFA 2AJYL 3OZ9L 1DVFA 5IVXF 3RTQD 4KV5E 4UQ3B 3WJJA 1RIHH 4RFNC 1QEWB 2VZOA 1NBVL 4GKZB 4BFIB 1ZTXL 5DHXB 1TCMA 1ZHBB 3V6ZB 3FO9A 1JRHL 4UB0L 1FV1B 1GYAA 5E0QA 3HC4H 3GHBH 4EI5B 2YRPA 4U4BA 3I6GA 3B83A 4P59L 3MXVL 4WI4A 1EAJA 3ARGC 3HR5B 1F42A 1U58B 1KCSL 1VSCA 3U46B 4BFGA 2BRRH 5ANME 4WI6A 3SN6N 1SJHA 4IDJL 5EPMB 1IT9L 4S0SD 4LHUB 4NGHH 2B1AL 3PDDA 4BZ2L 3VFTA 3SDDD 2HFTA 4TSBH 3LN9A 4XWOD 5IB1B 3MRLA 4DKFH 1PFCA 4PJEB 3LKOA 5GHWL 3RY4A 1IILE 1LEKB 4ZXBA 1QD0A 1CFVL 2AV1A 5GJSL 2Z31A 3VG9C 1LEIB 4OFKA 2C4FT 2WAHA 1XMWA 3BHBB 1GGIL 5GJTH 3AAZA 4R4BA 4Z7UB 4OT1H 2OJZH 2Q87A 2OXHA 4FZ8L 2QQNH 3HE6D 1JWUB 5GRVL 3FOLA 5DQJA 2ZP0T 3BX7C 1OTTD 1DFBL 3BO8A 3NPSC 2PTVA 4WWID 4PRHA 4JM2C 3CSYB 3DSFH 3UTPE 4XPHH 4KKBD 1IGML 5BV7B 4G8GA 4OD1L 4YXHH 1AP2A 3QO1B 4ZTOH 1MSPA 2EIBA 4GW4B 2FO4B 4NRXA 1OSZA 4LF3B 5E8NB 3T1WA 4EDWH 43C9A 1XGTB 1NBYB 4GSDL 3DO7A 1VPOL 3VFGL 2X4SB 3ARFD 2ZKHL 4M62L 3GSVB 4L3ED 4R7NA 4I2XA 5C0AE 3EUUA 5T1DH 4EN3A 3E8UH 2H1PH 1XGRA 4X7SH 2WBJD 2AKRA 2K3TA 4U6VH 4YE4L 5FA4B 3QUMH 5KS9E 1BIIA 4HT1H 1JZ4A 3NCEB 4JFZL 3NN8A 1KLUB 5C07A 1UKQA 1G9EA 4MSWA 2VUOA 1MHCB 3AC0A 3ZDYE 3LZFL 3D25B 5I16A 5LKNA 4M6OL 1CQKA 4A6YA 3TIEB 4TSCL 5I1GH 1E4JA 3FB6B 3V4VL 3B9KB 2BSED 2AK4B 1YN7A 2ZOKA 2DQIH 5E2JA 3G6JE 2CXKA 4U2ZA 1IKFL 3LB6D 4JPVH 5EN2A 2XN9A 3RY5A 1P53A 1TFHA 3P0YH 4HXAL 3KXFE 3ROLA 2VOTA 1EHAA 1U8LA 4ESKA 4WEUD 1P84K 3BH8B 3IXTB 3MMEA 5CEZL 1R5WA 5H37H 2C3GA 1N64H 4TSAL 4Y5YC 3TO4B 3DVFA 4ONGH 4J3OC 3WFEH 1EEZA 4I13B 2ID5A 1U8IB 3HZMB 1RZ7L 2OL3A 3KYKL 3FTGB 4PJEA 2A77L 1A6ZA 1X7QB 2O5XL 1TJHL 4GAJL 4I3SL 4LCIL 4F15C 5HVHC 4PJGA 4XPBL 5EUOE 3QFJA 1WIUA 1XR8A 4WU7B 1KULA 4F7EA 1E6JH 2J5LB 2DD8H 3WJLA 1JTOA 2MOVA 4X4ZA 4C54A 4KJWC 1QKZH 1WWAX 1FO0H 3C6SA 2OI9B 3U6RA 4D94A 1QFUL 1I85A 4CMHB 4F7PB 3STZB 4YQXH 2ED7A 4WNQB 4GFTB 4U05A 4XC1L 1TZHB 5T33H 3VFOB 4TVPL 4JY4B 5EO9A 2IANA 4CADA 3MLZH 4LKCA 1HH9B 4K94H 2ADGB 3DV6B 1SMAA 3MLYH 5GISH 5IBTL 1MCRA 3IXAB 2WZPD 1U92A 2GJ6A 3DECA 1EJ6A 3MYJA 5EBWA 4C57C 3BH8A 3HRZA 4HFUH 2JF1A 4HK3N 3RVWC 3IXAA 4FQIL 3E2HC 3U4BL 5FM4A 2NTSP 4P2YA 2XZQH 4JFHD 1OY3B 3CCHA 5I1CL 4KUCD 1NGZB 4PRNA 2XZAL 4TTDC 4MDIA 1INDL 1KLGA 3QNYA 4Y4HA 4LSPL 3RZCB 1WBZB 1UZ6F 1I3RB 3EYQD 3GMPB 4JFZH 4JRXE 1RUQH 3P0GB 4LFHD 5JZ7C 1DQLH 4KC3B 4MAYB 1ZA6B 2L7JA 4AT6A 1SEQL 2X4RA 1MIEH 4U1SA 3NAAH 2AKRB 1QQDA 3BKYH 4R97B 5T3XH 4WFFE 4YDKH 2GQHA 3VFRB 5IBUG 4ORGB 4L4VD 1AE6H 3KLAA 3QNXA 3SBWC 3ULUC 1T2XA 4MD0B 2HRLA 1ORQA 1DEEA 5C0FB 1WEJL 2ZUYA 2X4TB 1IC7L 4LLWB 4OTXH 3MGTA 4NJAH 4WHTB 4EN3D 4K3HA 3QDME 3RGHA 5E2VL 3AM8C 2PTTA 4FTVE 4DEPB 1ONQA 1ZLVK 2H6PB 2FO4A 2IBZY 4NRXB 4F2MB 1MQKH 2NXZB 3WFEL 2V5MA 3M8OH 4RMTA 2DQCH 5FCUH 4MD5B 3UJJH 4OJFL 5TGBA 4JGUA 1NL0L 1RZIA 1HI6A 4RAVA 4TTGA 4ZO6A 2FB4H 4ALAL 2SEBA 5E4EB 3U0WH 5GSVB 4I18B 3ARGB 4IRSD 3TA3D 2G5BA 4FG6C 3EYVB 3I2CH 3MRCB 1UG9A 3HCVB 3BP4A 5DJ2B 3GRWL 3OF6A 4NUJB 1ZHKB 1R5IA 4WO4A 5IFAH 4NNXA 1OB1A 2VL5B 1EFXD 3VMOA 1QYGL 1UZ8B 1AJ7L 1I9IL 1OAQH 3ARDB 5HYJE 4PJEE 2XY2A 4NNYA 2OZ4L 4ZOEA 3F7PC 1F45A 1HDMB 2OP4L 4X6DA 5F44A 3GMMA 1EJOL 1HXYB 1MCBA 1VEOA 4P5MB 5L6YH 1CE1L 1OP3H 4R0LC 1MFAL 1AO7E 1HN1A 3VXRA 1UCBH 1C08A 4LSQL 1CICA 1YPZB 1UWEL 2OTWA 3VGAB 3VRIA 3DRQB 1BF8A 3KPPA 1IEHA 3B3IB 3I6GB 3T0DA 1JBJA 2JB5L 5T5FH 3VG9B 5J4MA 2EE6A 1BVKA 4L4VB 4QRUB 3RTQB 3VFVA 2V17H 2R4RL 1YEGL 3BUTA 3GGWB 4QXUH 1DUZB 3UTQB 1QLFA 1GVIA 1NCAL 3ZKND 5FYLD 5F9DC 1EVUA 3MPCA 3AAZB 5E08H 2N4IA 1I7UB 1PJ9A 7CGTA 1FZKA 1WZ1L 3MRQA 3T3PF 4NNYB 3RL2A 2BK8A 3T8XB 1AGEA 1J12A 4HEPG 5DMGD 1VKXB 3ZHDA 5DJ8A 2X7LA 3HI6H 1I1AA 3KWWA 4JZJB 3QCVH 3ARZA 1Q0XH 4K71B 5IG7A 1YEDB 2B2XL 2N7AA 3V0WH 1Q94A 2IFGA 4G6FD 4JFXB 5J13B 2CRYA 5D7IF 5GRUH 4ONHB 2P8LA 3ZTNL 1T66D 1IAOB 3T4AA 4F9LA 4MJIA 2AJUH 4ZUVB 5TH2A 1R3HA 2EE3A 2CRMA 3BYYA 5C71A 4EI5A 4MA1B 5IP4A 4M1CD 3RY6A 3BZEA 4J8RB 5T1LA 1B0GB 2Z4QB 4FFYH 3BZEB 4U1HA 4HPOL 3MA9L 4YR6A 4NO3B 4Y19D 2B1HL 4YR6B 5IKCB 5FA3A 2O26U 3BW9B 2WM0A 2XKNB 1VERA 3CLFH 4LOUD 4P5TB 4KZEH 3GJEB 1AY1L 1YA5A 4FQQA 3CH8A 5EZIH 3DVGA 1QSVA 1PX4A 4FFWD 4GRLD 4XC1H 4IDJH 1HYRC 3QXAA 1UXWA 4CDGC 4JHZA 4FQHB 4I5BA 4Y16B 1JRHH 3LPGA 2V5YA 4QXGL 2KUTA 4A6YB 4P59H 1OM3H 5H94B 1JPTL 5EU3A 1OGAD 2H3NA 3VXSA 2A6KA 4E5XA 4J4PC 4OGZA 1RZKC 1BWMA 1NFKA 1A5FL 1MEXL 3T04D 5GJSH 5BV7L 1AXIB 4KHTL 5EA0H 3PQYD 5FDWA 4J2XA 2FL5B 1KN2H 1EFXA 1FHGA 2XA8L 3BWUC 1OCWL 4KY1H 3K3QA 2VLKD 1U92B 5EBWB 1U8KB 4XB8A 1NBYA 5EZLB 2B4CL 4XMKH 3U82B 5IFJA 4O2EB 1AXSB 4Q6IA 4OKVA 5HGDB 5FM8A 1SYVB 3MGAA 3WIIH 1A7PH 5IFHH 2J7LA 4PUBL 3TFKD 1B4JH 1JZ5A 2FNBA 1A6VH 3ARBC 5ICZB 3ISWA 1YEHH 1H8SA 4HWBA 1CYGA 1IAII 2YMXH 2VLJE 1FZJA 3ILQD 3MFFB 5J0BA 4QHLB 2VWEE 3MREA 3C6SB 4ZDHB 5SWSA 5F9WC 1MJ8H 3FT4B 4UINL 4KKBC 4HDIB 3AM8A 2D7MA 1NUDA 1F4WL 1WISA 2YN5A 4GXUM 4POYA 5DJ0A 1FE8H 3ARYA 1RV6X 1I7TB 4GXVH 4P4KC 2ICWJ 4JPKH 4YE4H 2D7OA 1LDSA 3X12B 2ERJC 5B39B 3GMNA 4NT6B 5CLWA 3U79A 2MQ0A 2VITA 4JN2A 2F53D 2A6KB 4ERSH 1TVBB 2H1PL 3MLSH 1H3UA 2R56H 3MXWL 4MX7B 5DHVA 4IS6A 1K3ZA 4DEPC 1F6FB 1N59B 2FB4L 4X0KB 4ALAH 2D31B 4M61A 3MRFB 4YPJA 3TBVA 4FQJH 4ETQA 4PBXA 3QISA 1L7IH 3FO0H 4I18A 4MJ6B 2CPCA 4XCEA 3LV3A 4ZTPH 4RRPG 5GQBA 1BIHA 3SCMA 5BCAA 3QHZL 4XCNA 4XWOC 3G5ZA 2DIJA 1IAKB 4CVUA 4M4RA 2LVCA 3ZLQC 1JF1B 4P5TA 4EEEA 3QPQD 5E8DL 2MQCA 5EU6E 3LH2L 4LSTH 1ERNA 2X4NA 3BVNA 4N9OB 2HFGL 3L7EB 4HPYL 3FFDA 2NY4C 4H88L 4MD0A 3IDMA 4UDTA 3SGDI 3WN5C 2IPKA 4X8XA 5ESAA 1FL6A 3SE8L 3ZYJA 1J1PL 4Y1AA 2W0FA 1HXMB 1IGCL 4OGXL 1ROWA 1H3VA 2CRIA 1U36A 3IJHA 5F89B 5C0AA 4M7KH 5T5FL 1F11A 1ZT4B 1MJUL 2WBJB 5ICYA 4ZG1A 1CFVH 1X5XA 3QNYB 1YEGH 5IVXE 3VXOB 3T1FB 4GS7C 5KZCD 3B9KC 3RWHA 2DICA 3W0WA 4APQC 1E6JL 4K7PY 4WFEE 3UTTA 2VZSA 3V7MA 3W0WE 4FNLL 3GB7B 3VFNB 4RGMB 2HYMA 3HUJA 4G43A 1NFDF 1U8NB 5CIPA 1O7VA 2IPUG 2BOBA 2DKMA 4K7PL 3C5SB 4FQ1H 2ZUXA 3GSWB 1FIGL 4TUKL 5CJXC 5CEYA 5GZOC 5CSZA 2NXZD 4LQFH 4XP5L 3H3BC 4GAGL 3EDEA 2B0SH 4PRHE 4NQVB 3QZWB 3UTPD 4MQSB 1QO3A 5I73B 4EI6B 3ORJA 5DTFA 1UB5B 4ZNEA 1TNNA 1RZGB 3ARQA 3A0OA 5CKGA 3DMMC 1WTLA 2CDEB 4JY4A 5I71B 1HZHL 2BY3A 4LCCA 4TPRL 3B5TA 5DD6A 3GI8H 5KAQG 1TZHA 4G42B 3ZYIA 1SVZA 3VU2A 1VACB 1NANH 2NNAB 1N59A 4JFFE 5CCKH 4N5ED 3D3VD 3RAJH 3GBNH 3QULB 4P23A 1TJIL 5FDYA 3V4VH 4IM8A 1S7VA 4PD4J 4QRPE 1RUML 2DQUH 3R06A 2PO6B 4F7TA 1G7LB 3V79C 1U8IA 3HZMA 3MRBA 1WEJH 1TITA 3RGVB 4TSCH 5DD0H 2AW2A 3OKDB 4OTXL 1A6ZB 3ALPA 1TMCB 1CK0L 1V3LA 2OZ4H 5CEZH 3NFSH 4XNQA 2P48B 1MPAH 4YDJB 4HCRL 2BNRA 2VDNH 4WO4C 1IC4H 1CXFA 2HFGH 5GSVA 5GXBB 4E41B 1KTDB 2GJJA 2JB6B 2YD6A 3E3QC 1VFBB 2WUCL 1YN7B 2AEIT 1JP5A 4HSQA 3OHXA 4RX4D 2DIBA 2AV7A 3MOBL 1W2KT 5KTEL 2YXMA 3G6DH 4YHOH 3LQAH 4IBLT 1EO8H 1HIMH 4Z7QE 3BJLA 4EVNB 4GAYA 3QIBA 2BSSB 4KVCH 1J11A 1PKQE 2PW2B 3QWRD 1T83C 2AJXH 1K4CB 3PGCB 3HG1D 4H5SA 3TVMB 4HWNA 4DAGH 1BFOA 3MLZL 4LEOB 3ZYOA 1J05B 2GSIB 1Z9OA 4I2XB 3F8UB 3ARED 1LK2A 1RZFL 1XCQB 2XKUA 3MQIA 4UT6L 1K8IB 4JFYA 4YAQB 5GGTH 5DJAB 3ARVA 4OF0A 4XP6L 5D71L 2MSPA 4BZ2H 2ITCB 1Y0LA 4WENB 3NFPA 4TSBL 5D1XB 3UPRA 1LDPL 3NACL 4YBLC 3KPRE 1FSKB 2ZPKH 1CDYA 3FQRB 3MV8D 4DCQA 1G7PA 4OF5A 2IFFH 3MJ9H 5IV2A 2AV7B 4ZFZB 3OGOE 3RWFA 1AR2A 5LCVH 2A6JA 3P30H 2IAMA 2KQNA 4XVUD 2A6DA 3OKNA 5ETUA 1I3GL 4XPGH 5JHDD 4HGWA 5KN5A 1WSST 2LU7A 1F5WA 3TN0A 1F3JA 4RMQA 1JWUA 3OAUH 2H26B 1K9TA 4BFBD 1UKSA 2V7NA 1KPVB 5GGTA 4K07A 5DD5H 1M7XA 5EO9B 2DI8A 4LSVL 4NP4L 4XHJC 4XWGL 4DK6A 3ALXA 1W0YT 4OUUA 1MY7A 2R2CA 3ARRA 3PUCA 5DQ9A 1R3IL 1SJHB 1XF1A 2D0HA 5TE7L 4F3FB 3D48R 5IHBA 3D85D 4DKEH 3M1BB 2YR3A 2Q76B 4WY7L 1ADQL 3SY0A 4OFYD 4QEGA 4KRLB 1UB5A 4LAQL 3WNLA 1ES0B 1IGTB 3I9GL 2RBLA 1GGUA 2CIIA 3RDTA 1HSAB 3BKML 2DQCL 5FCUL 3QQ4A 2X10A 3LQZA 3K0WA 3TN0B 4M7KL 5DA4A 5I1KH 3LZFH 2WIIB 1IFHL 4YDIH 4YFLF 4OFVA 4YO0B 5SX4H 3ROLB 1QYGH 4OV5A 1AD0B 2CLRA 4N0YL 2Y5EA 3HC3H 4IIQB 1PX3A 2A6JB 5EOTB 3HZYB 3HI1B 5C08D 4HJGA 4BKLA 2A74B 1UB6B 4B7IA 5MENE 3GSNB 3QCTL 2MJWA 5FOJA 1NGWA 1YQ2A 2XA3A 1JTTA 4IOIA 4X5WA 1NC2B 2G9HB 5CEXB 3RWJB 1MAJA 1UT9A 1FDLH 5H2BB 5D6CA 2R29H 1KNOA 1EV2E 1XGYL 4HBCH 4F3FA 4H0IA 1NBQA 2QSQA 4JRWA 4UOW1 4LEOA 3EYFB 4S1RH 2E5EA 1KBGL 5HXMA 3SKOA 4N0CD 1K3IA 5E5RB 3VI3F 4EN3B 4AIZA 4FXKB 1U8OB 1ADQA 5K93A 3CMOL 4O4YL 2J12B 3K46A 2EDEA 1WT5A 4K9EH 1NLDH 3PP3K 4POUB 1KJ3H 4F9PC 3BP4B 5DJ2A 3S96A 3DXAB 4Z6AT 3FT3B 1BGXH 1BEYH 4JKPH 1FZMB 2E7CA 3D2UD 3HE7A 4H8WL 5E6IA 1IAMA 3SDXF 1K2DA 3MFGB 3E0GA 5F9AC 4Y19B 5DEZA 4QXUL 2NW2B 3CVIH 1G6RL 4IRSB 4N8CL 4AQOA 1TCRA 2JJSA 1SEBB 4G80A 4XPHL 2D3VA 4CU8A 4NCC2 1JWSB 3CMGA 3HAEB 4PJ8B 2YKLH 5HI4C 4GRLB 5EZJB 3IJYA 1B9ZA 4F33B 4J3UA 1T5XB 1Q72H 4ETQB 1D5ZB 2K9UA 2NY4D 4CAGA 5DJAA 1ZLWK 3WYRA 4WW1A 1JGUL 4LSTL 5TDPB 3OKMB 4NQCA 3QRFM 1Y18A 2Q8AH 3VJ6A 3GBML 1NLBH 5C07B 4OGYH 3RGVA 1W72B 4HG4K 2ARJQ 4P2RD 4QRPB 1LEKA 4D9RE 5L8LB 1U2CA 5ICXB 2BX5A 5LBSH 2JLLA 4QTHA 3GSOB 3B5HA 2CQVA 3KHOA 2X4QB 2X4OA 3MOBH 5D7IE 2BVQA 3GO1H 3MREB 3UTQA 1QLEH 3NZ8A 3VMNA 5C7XL 5F1NA 4HDIA 1QTYT 5EFIA 1DLFH 5J6GB 1Q9KB 3OG4B 3STLB 4FQXD 1T4KA 1SY6L 1GZQA 1IE5A 5IR1B 1K2DB 3TCXA 3WHXB 1SBBA 3EZ8A 1MHEB 1U3JA 2W9DH 2WSKA 5C0IA 3DRQA 3I6LD 3W5NA 4YWGL 3FT3A 4PRHB 3H42L 1S7SB 1QSFD 3D2UA 3HE7D 5DRNA 3DXAD 3FAWA 3LY6A 2XWBB 5BQ7A 4P2OA 3MRKA 4XNQB 1MCKA 4N90E 4PJXF 4WWKC 5ECJE 3EYFA 4XMPH 2YC1B 4D0DB 3N06B 4N5EC 1EHLL 3FT2A 3VDBA 3GSQB 5ENWA 3EW3B 1RFDL 4NNXB 4K71C 4KY1L 2GHWB 2JTDA 2NY7H 2XACC 3QIUA 3JV5A 1DQQA 1XGUB 4L9LC 4OF6A 4HZLA 4TQEL 2K7QA 2VLME 4TUOA 3MCKA 3V5HB 4UV4L 3HTLX 3U48A 5JW4M 5EORL 1VACA 3Q6GL 3L95B 4KJQD 2XKSA 3HNTH 4CVZB 2VTFA 3ARPA 3VW3H 3QUYC 1RVFL 3KPNB 4NRZA 4MXWH 4LVHC 3KYMA 4GAGH 1QSEB 1CD8A 4KDTC 1HKFA 4L3EA 3B9AA 4PG9B 3D5OF 3W9DA 3VGFA 1PVHA 1A6PA 3T4YA 3T0EE 4G6KL 4NBYB 1C5CH 1U91B 4HCRH 1A7QH 5T1LB 5CP7A 4FQIH 4R3SA 5E8PA 2NLJB 3HAEH 2Y6SD 4GMTH 3VD5A 3WLWC 3LS5H 1KXQE 4MQTB 5BW7C 3P9WB 4NC1E 3HPJB 5KTEH 1Y6MR 3QIUB 3H0TA 3HG1E 3F7YA 4NDMA 2HRPL 1H3GA 2ICCA 1I1AB 3HG1A 1UXSB 1KLUA 5E03A 3FT2B 3RWEB 3WEXA 1XF5A 1V5JA 2F9BT 5IVXA 1WZ1H 4XNUH 1FNEB 4N0YH 1SM3L 3F6LA 4GLRI 1RZJC 2CLRB 2MHAA 5ESVA 3NZHL 3NFSL 4PRBA 3QCVL 4OQTA 1CZ8L 4UB0H 5FUOL 2F19L 4BZ1L 1DCLA 3V0VB 1IC4L 3GUTA 3DV6A 4PJ7B 1NAMB 5HHNA 3OB8A 2DWDB 5E8NA 1PKOA 3BD4A 1INQA 2G60H 4K8RH 2BVEA 3R1GL 1T04A 2ZCLL 3SGEH 3ZKQD 3NFPB 3KPOB 1IAKA 3PDOB 3FHQA 3TO4C 4GKOA 1LO5A 3MNZB 4POZC 1HHKB 4I0PC 4NKDA 1I1YB 2Z92A 5GGSB 5C0BE 2GTWB 1LO0L 3CC5A 4HKZA 2VQ1A 4PJCE 3WFZA 2CJUH 1JPSL 2OTUB 1EO7A 3ROOA 3HNTL 1KIPB 4D3CH 2XFXA 3GNML 5F96L 3ROOB 4CMMB 1YJDC 5LWYL 4H1LG 3VI3E 4LSVH 5D7JC 1MI5D 3RZWA 5DC9B 1MCWW 3SO5A 5I8CA 1JHKH 4LVEA 3VFMA 3RNQA 2EDXA 2YWYA 4M3KB 2FGWH 2D7NA 2ZPKL 5C09B 2D03H 4ETYA 3IAPA 5F97E 3RHWK 4NZUH 3MJ8B 1GOGA 4HS3A 3WNPA 4GJTB 4GSDH 4B53A 4JGMA 3BE1H 1GIGL 3BWAB 5GS3A 3TN0D 4DUVA 1YEEL 2O61A 4MD5A 3TP4A 5DR5H 3GSXA 3T3ME 2OSLB 4IOSD 2H2SC 5E99L 3DBXA 4H8WC 3MZTA 5DD5L 3Q5TA 4U6HA 5KW9L 3N9GH 3CX5K 2YN3A 4RQQB 1IRAY 2B39A 4B41A 2E6PA 2CKNA 3LN5A 3UTOA 4YHLH 4NN5B 4OZIA 5KS9B 1MJJA 3HI5L 4OF8A 1GRWA 5I8OL 3HPLB 1G0YR 3T77B 2YUVA 2FH6A 3TBTA 2HFFA 4JFFA 2Z8WC 1HILB 1FAIL 2E9JA 1WQVT 4WIQA 3VFRA 3RBGA 2APWA 3TBYA 1KSRA 5ACZB 4LRIA 1JE6A 1NEUA 3OKLB 1NBZA 3MRHA 4FFWC 4GRLC 4UTAH 5IHLB 2DMKA 4Q9CA 2DLIA 4OM0H 4QLRA 2AEQH 4NWUH 4X98B 3NH7L 3QUMB 5E4IA 1OAYH 5DMJB 3LPWA 3TNMB 3SKNB 4MNHA 2H41A 3NIDF 3VRLE 1AD0A 2NY5L 5D96B 4NGHL 1C12B 2PYEA 2A74A 2OR9H 4N68A 1WUNT 3WN5A 3BP7A 4KDVA 1J1OH 2ADGA 4NHCL 4UAOB 3CU7A 3STBA 3MXWH 1YN6A 1ZXQA 1OHQA 1MIMH 5SX4I 3HC3L 4DKDC 1EK3A 1RU9H 1I9EA 1HSAA 1BQHG 3VFNA 4PJ9C 2OTPA 1MUJB 3GMOB 2ARJA 2WBWB 3MRDA 4MNQB 3Q6GH 4L3CB 3QH3A 1ES0A 4U7SA 2CIKB 4LPTA 4CVZA 1QBAA 2LFGA 2NYYC 1AO7B 1H15A 5CP3H 4JDTL 5F1NB 2DMBA 2NY2D 2XQYK 3U6RB 1G84A 5IMMB 5EOCL 3VWKC 3HPLA 4P49A 4P2RB 4QRPD 3DGGB 1N7MH 3MLYL 1VEPA 5ANMB 4WJ5A 2XFXB 1ZS8B 5HYJB 4K3JH 4G6JH 3VI4F 3SDAD 4MAYD 2KH2B 3F12B 3F7VB 5J57B 4HKXA 2Z8RA 1Y18B 3VJ6B 4MB5A 1X5KA 4K9EC 5ID0B 2XRAL 1II4E 3GSXB 1KN2L 5C0GB 3HFMH 1T5XA 3OAUL 2DM3A 4FQXB 1X5IA 3VE0A 4UTBH 4PJ8A 2Y06H 1EX0A 1WAAA 3OBAA 5E95B 5EWIL 1I3GH 4KJWD 5TF0A 2UWEA 3WIIL 1QBMH 5C0ND 3IETA 1A1MA 3P2TA 3QG7L 1R5VB 2RR3A 2IG2H 3C2AH 2MMXA 1GL4B 3TIEA 4HEME 2JKXA 3PWPD 4A6YH 5DEFA 2CLZA 4BK4A 5I76B 2QJDA 4O9HH 4QCIB 3H9SA 4LSSL 3AROA 2IADB 4PFEA 5HYQB 12E8H 3B9VA 4LPUA 3OKKB 1JHLH 4P2QD 5I16B 1KOAA 1HOCA 3FRUB 4JRXA 4X7TA 4QOKA 2WP3T 2B5IB 1IQDB 5KSAA 2X1PA 5CZXC 4Q9RH 4ZOCA 2OMBA 3MRNB 3HMWL 4U7KA 1I8LA 4CUCA 1RJLA 5DWUH 5D2LF 4MAUH 4P3DB 3LB6C 3VFSA 5EUKA 1E4WH 2J3SA 1YNLH 4OZHA 5KVGL 1YMMB 4ODWA 1KTLB 3CD4A 3MLTB 4N0FA 4EJ1C 4E0RB 1U8HA 4PP2A 3QEUA 3O81A 5KSVB 5A2IH 3DX9A 5CEXA 1CLCA 4GRLA 5EZJA 4L1DA 3BPLB 4Y0GA 3RZCA 4GKNA 4EXPX 2ESVD 4GH7B 2CUMA 3QA3B 4HJJL 1XF3A 3SCMB 3VFWB 3KPRA 3T0AA 1CGVA 3NCJH 3QJHB 2ITDB 5H35B 5HGDA 1A1MB 5EU6D 2ZUSA 4FQXA 5K9QG 3O2DL 3I6LE 2YPLB 1BQLL 1N5YL 3CFKA 4IOFC 1AXTL 2RJMA 2R23A 4L8SC 2DS4A 4KTYA 5TDNB 4H88H 3KLHD 1ZA3A 3U9PH 4RGNB 3QUZB 4YXHL 3Q5YA 1I8MA 3RVVC 3DX7A 3BKCL 1MCHA 1TXKA 3B6SA 4I3RH 1N6QL 4N1CA 3QULA 4LU5L 3V5DB 4L8SA 2A0LD 5DJDB 1S5IL 1A6UL 2AXHA 1ZHNA 5I1EH 1FVCB 3LQAL 2BSRB 4R8WL 4NHUA 4K7FA 4Q9QL 4P2QB 4ODHH 1HSBA 4Z78A 3BFOA 5E8PB 5BXFA 1KC5L 1T04B 1I3UA 1H3TA 1KEMH 3SO3B 4F58H 4PRNB 1QO3B 2BRQA 4EIGB 3GMOA 5EH1A 2C1OB 1X3DA 4TULH 3M17B 2VLJA 2WINA 3QUXC 1CLYH 1RZGA 3LPFA 1IAIL 3GRWA 1WK0A 3GGWA 3A6OA 1RVFH 3SE3A 4EOWL 4UNVA 3SDDC 5CSZB 3U0TA 1CICC 1KIUA 3QRGH 4KROC 1FNEA 1ZVSA 4RGOL 4XCFH 2YHGA 5E9DD 4M6AA 5SV3A 1A7BA 2E27L 4TSAH 4R7DA 1WGOA 4ZFOL 5F7DB 4L5FH 4K3DH 1OAXH 4XVUC 3QEUB 4PJCF 2WUBH 3KNBA 4ODWB 2R15A 1NC2A 2VXTL 1EMTH 1ZT4A 5TDOB 1D5MB 1H3PL 4LCUA 5J1TC 4RGMC 1UB6A 2ICEB 5E8OA 1BZ9A 1LO0H 3CFJA 3BDXA 3GJFK 4PJXB 3VFPB 3GRWH 5BVPL 5MI0C 2CJUL 4BZ1H 2CD0A 1KCVH 3D2UB 1X5HA 1P7KA 4X4ME 1D5ZA 1UJ3C 5GS2D 2VLRA 1CE6A 3L7EA 2CIIB 3CFKB 1KJ2A 2WV3A 3QR2A 3RPIA 3K2UL 2CDGB 4QTIH 1QHPA 5ISZD 3AXLB 3CGTA 5T3XE 1EZVY 2M8XA 1VGEL 1AGFB 4IRJA 4ZFZA 2EDKA 3RWFB 2VDQL 3RZCC 3BO8B 3G9VA 1J9CT 3O6FB 2QQKH 2YXFA 4OCXL 4PJGF 2NY4B 4Z8FL 2AK4A 4KXZH 2HWZL 3A6CL 1YEDA 4NKMB 2E7MA 3WFCH 3MGTB 4WHTA 4OIBA 6CGTA 2OJZL 3CVHB 4YK4C 4E0RA 4LASL 4O2FB 2Z31C 3CLEL 1J7VR 4X5LA 1LMKA 2Z91A 1MFCL 2ZSWA 3MROB 4FP8L 1I1CA 4JRXD 1PLGH 2NPLX 3MJ7B 4WI9A 4M8QA 4PJHA 5E9DE 5DRNB 2BHZA 4DW2H 3NAAL 5D6CB 2V5RA 4ZTOL 3D0VB 2FR4A 2R1YA 4CMHC 1XGYH 4MXWL 3EO9H 3CK0L 4MNQE 3QCUH 1BVLB 3BZFB 2B2XH 4QRTB 3V0WL 3NH7H 1KJ2L 4HQQL 3H2WA 1NGYA 1YEEH 2GTZA 3PGDB 1K6QL 4L3EE 3G9AB 4O02H 5B4MD 2UVFA 1INDH 3L3DB 3CMOH 1VFBA 1CICB 4KK6C 4PJ8C 3UJIL 4LHUD 3MODL 2LABA 3OV6A 3SDXE 2BCKA 4HH9A 4U3CA 3TJHC 3U83A 1JUFA 3MV8E 4OZHB 5D5MF 4YHLL 3L1OL 4CVWA 1J05A 2VXTH 2HKHL 1H8NA 2CK2A 5F7WC 3DX6A 3EHBD 1C12A 2PYEB 2KQMA 4AM0A 1GZPB 5IWLA 2VRAA 5BXFB 4IHOA 4YPGA 2IQ9L 1ZAGA 3DETD 2W07A 1F90L 1X6LA 3GSNH 5C07E 5MEPB 5A2JH 1IKFH 1G7LA 1CF8L 2XQYG 1OF2B 1LD9B 1XH3A 2GITB 2EZ0D 4JFEB 4KH2A 3MRLB 3IJYB 4OLXL 1UM4H 4P3CL 3REVA 4M7ZC 4M7ZB 1I1FA 3UTTE 1Q9WB 3C09B 3BGFB 3MUHL 2EH8L 3WV0A 3VXUB 2UUDH 4TVPD 4JCMA 5K59F 3D9AH 2EDOA 2XKNA 3NGBB 1XR9B 1OM3L 1VFAB 4OZIB 2EDNA 4NWTL 3TYGH 4K3JL 4YZFF 1KPVA 4GAFB 3O6MH 4LLQA 1FJ1B 2R23B 4B7LA 3S96B 4LOUC 4XI5D 2NR6C 1T1ZA 5ALCH 3QZWA 2VDPL 5HGGS 1LO4L 4NRYA 2JB5H 2IPUK 3ARFB 1BQUA 3B4NA 3K4ZA 1B3JA 4A2LA 5AG8A 4JQXC 5AYUH 1MCEA 3UTSD 4OZFH 4P9ML 5C0DB 3Q6FB 4KPHH 1EUUA 4S1SH 5J11B 3KPMB 4Z78B 2EYRA 2NX5B 3TYFA 1U8JA 3IDNA 2EDBA 3B8YA 5IVOA 4M48L 4OD2B 5A40E 4ZS6C 4MS8C 5DQ9B 2NNAA 2DAVA 2OM5A 3DJ9A 5FV2A 5IQ7L 4PV9A 5CKAA 2YK1L 1WBZA 4K2UH 5CJBA 3REVB 1BQSA 3RIFF 4PGJA 1LK2B 3RJQB 4KK9D 4QRRB 3BPOC 4NCC1 4W4OA 5EC1A 5BVJA 1Q0XL 3IVKB 4OUOA 3WKMH 5MEPA 4ELMF 2ARJB 4KJPC 4MMZC 1N6UA 4JREC 3T77A 2L7UA 5C08B 5GISL 2P5WE 4QOKB 3T0BA 3VD3A 4EI6A 5GGSY 3P4OB 1ACZA 3ZTNH 5ETUB 3TO4D 2DQEL 3D39B 3ULUE 3RX7A 2CH8A 1KJ3L 2G75B 1FVEB 5CJOH 4YHMH 3QNZA 5EORH 3BUYA 5EU6A 5M95B 1JVKA 4XXDA 1RZ8A 3OR6A 4PJAF 5DJXB 1EA9C 4YGVA 4XX1G 4UDUA 2VAAA 4OKVB 3MLTA 4RMWA 3ULUF 1NAMA 5HHNB 3FHAA 4PJHB 4ZXBC 4HV8B 5GZNC 5GGVH 4DOHB 5HI3C 3KPSE 1BLNA 1BQLH 4IJ3B 3THML 2R2EA 1T20A 1K4CA 3MUY1 4OZ4A 3MJ7A 4MJID 5KS9A 4XHQA 3Q3GA 1W8NA 2MKLC 3ARDA 2LAAA 1ZGLM 3O9WA 4P5KA 3AS1A 2VDQH 1S7RB 2H3NB 2QKIB 2OL3H 1BHGA 5DEFB 3GM0A 1PSKH 3RUGF 1N0LA 1U3YA 4DN4H 2BSTA 3P4NA 5EA0L 2IAMB 4V2BA 4D9QD 2OCFD 1YEJH 2BNRE 1CDJA 2GSGB 2A1WL 5I18H 3FB5A 3O4LB 3PHQA 3PWUA 4MVBC 1XGQA 4PJAB 1QRND 5GS0C 3QXVA 4KQ3L 4NN7B 1G6RA 1ZVYA 3MTRA 1FVEA 3S5LB 1FYTE 1MELA 4NOFA 3W9DB 1MJ7H 1YECH 1IZKA 3L3KA 3D39D 4G6AD 1NMCB 4TVPE 1Q8MA 5EZOL 1Q0YH 3TNNB 3KYAA 2ICEA 4GQPH 5I17B 1A6TA 3H8NA 2D9CA 2A83B 4H5SB 5B38A 3IKCB 1T20B 1FFNB 5F72S 4KZDH 2NTFB 2FLBT 1YYMH 1K6QH 5EU4A 5C0NC 1NFIB 4Q0XH 1Q9WA 4CRPA 4AT6B 1H15B 3T0EC 3QDAA 2VC2L 1S9VA 2JK5A 1A7NL 1DQQB 1CFNA 3MFFA 5C0AD 4XGZB 4PB0L 5D7JD 2FWOB 1PZUB 2HTKC 1T03H 4OIAA 1FV1A 4YHML 3E6HA 3L1OH 5FM5O 4P4RA 4OV5B 4LNRB 2QQNL 4PJIF 4Y4HC 3BUYB 3RL2B 4MCZB 5D7KD 3LS4H 4YO0A 1TJGH 4HJGB 4WCYH 3Q1SL 3SKJH 5T3XL 4EBQH 4XAKE 4L8DA 1H8OA 4GUPA 4MQ7B 5F1SA 2HA1A 1NMBH 3OJDB 1D6VH 3LSOB 4RISH 3MRPA 5TE6L 1GGYA 1B0GA 2Z4QA 1KT2B 3L3IA 3NIDE 4TNWF 1FFQA 5IMKA 4UT9H 4FQXC 3GFUA 3WUWA 2OJEA 3RI5K 2P44B 4DQOL 4R0LB 1YDPA 1Z5LB 3UP1A 5IM7A 1H3XA 4X8JA 4Z95H 1MVFA 4NQDA 2Q76A 1DQDL 2WUCH 3N85L 3VGAC 3STZA 4NQDE 4Z7VB 1MI5A 1CGWA 3QFJB 4NSKA 4Z7VE 4JFFB 2E7LC 1HQRA 4HIHA 4KVNH 4HPOH 2XICA 5DURD 3VWKB 1M4KA 4LSRL 3GMMB 1NEZG 5DUML 3LRSB 3QUZA 4MNQA 1RY7B 1BOGA 1X6NA 5TDNA 4YHZL 1CDCA 3RRQA 1I7TA 3HR6A 1MFCH 1E4KA 2B5IC 3JWOL 3SQOH 4WU5A 4HLZH 4JLRB 1G7HA 3G5VB 4NM4H 2JELL 3LH2H 4I77H 3GBLA 4HW6A 3KGRA 2Q1EA 1IEBB 2DLGA 2IH1B 3HAEA 2FD6L 4UT7L 1MRDL 1J1XH 4F57H 1XGQB 4PJAA 3DTXB 1U8NA 3DUHA 4GKSB 3MJ8A 3V6FB 4GG6E 2P7TB 2NW2A 2ZOLB 1VENA 2X89D 4GG6A 2VB5A 1INQB 5BZDB 1E4XH 4FG6D 3W0WB 1S7WB 3QA3A 3ZT7A 2GJ6D 4TOYH 3RUGE 4W68A 3RIFK 1I8KB 1XCQA 1N4XH 3ZZ1A 5TFSL 1TJHH 1TZGH 4L29B 2C3WA 4NZTH 2VISB 3SQBA 1K5NB 1P1ZB 3X3GL 5KANI 1KIPA 1BECA 1U3HC 4DGIH 2IAND 2F74A 4U1IB 4MB4A 3FONA 1P9MC 3UTTD 1KG0B 4ODVL 3T2NH 15C8H 1A7PL 1CGTA 3GJFA 3QIBD 3LKPA 3WXVH 4Y4FB 4HX1A 4XRCA 1M71A 2DYPA 1S7TB 1OW0C 4U1SB 4JJHA 1OSPL 5DMYA 3S88H 1CLYL 3NIFF 5DVMA 3S5LG 1R3JB 1RK1A 3CDGA 5DQDH 1X44A 4RMVA 5D7LD 3VXUD 4UBDD 5D6DC 3O6LL 4QWWC 2NY0D 4Q74A 4NN6B 1JNJA 1CF8H 3QFJD 4M1CC 1FYTB 3CH1A 4EVNA 4WFGE 5D1QD 3LOWA 2V9QA 3P40A 5HI3D 3T0EA 5MENB 5EU6B 3ZE0E 5HDQL 5IQ9A 3IKKA 4G8GB 1Q72L 5IR1A 1A7RL 3DTXA 3QPQC 5JZ7D 5A2KH 5I19H 4BKLB 1CGXA 1QFWM 3EO9L 3QDJD 2I60H 3VGGA 2W60A 2GYSA 1YEFL 2GCYB 5CP7B 2BNRB 4QF1B 3ME0A 1PZ5A 1FVDA 5FA3B 4Q6IC 4CVXA 1A3LH 5C9KA 4YXLH 4LHQB 3QUZD 2J88H 2NY1C 4Y2DA 3WD5H 4AZ8A 1WT5C 3RWDB 4HCRA 1U2HA 1LVEA 4MZ2A 4P2CG 4QTHB 4ZFGH 4XVTH 1TETH 2V2WB 5LGHL 4OV6F 3KR3L 1LEIA 1XF5B 1W72A 3VWKA 2VIRA 4QHMA 3EJZC 1WBXB 4AIZB 2UUDK 25C8H 4MDJB 5KZCB 2BOCB 5I6XC 1S9XB 1P4BL 2NY1D 5EZIL 3KPSB 5SWQB 3LEYL 2YZ1A 1KLFA 4X7CC 2VDLL 4PJHE 4Y4HD 3TYFB 1HHJB 1OTUD 2RIKA 1TDQA 3GIZL 3PWPA 3I3DA 2ZCHL 1CDHA 3RBSA 1IC7H 1WBYA 4PJ9A 2Q7YB 2BY1A 1KCSH 1MCNA 3ZTJH 1PY9A 2ZUQC 2CLVB 3NTCL 4Y16D 1KN4H 4Y4KA 4KTDL 1LWRA 5SWZB 3OAYH 3JWOC 3ETBF 3MRKB 3OJDA 2W0KA 2FEDC 4O2EA 1U9KA 1EAPB 4RBPK 4HUMB 1JGDA 1OGAB 3KYNA 1HIML 4WW2F 1HINL 4NKIL 1NSNL 1UA6H 5C0BA 4AL8H 4I48B 3GZKA 1ZT1B 2J4WL 3BZ4B 5C3TA 3C6LC 1S3KL 4X6CF 5ALCL 3UX9B 3KPRB 3VXUA 4PJ7F 4ODVH 4HWEL 4MA8H 5EBGA 4DCQB 4TUOB 4HWBH 1OQOA 2Z9TA 2VO5A 3C60D 3RUGA 1HEZB 2NZIA 3P11H 1OQXA 2YMXL 4MA1C 3FQTB 4XGZA 3FOMA 3QB7C 4PGCA 2X09A 4R7DB 4PG2C 2EH7H 3FN0L 1AC0A 1NMBL 1U8JB 4MD4B 4XNXL 3RGVD 1JN6A 3WFDH 2BERA 1KTKE 1RK0B 3BRFA 3MRGB 4PRAA 3TIDA 1XFPA 1MCIA 1JHTB 4M1DL 3QI9A 5D7IA 5EO0B 3OF6D 5A2FA 3B6SB 1AGCA 1YJDH 4FRWA 4GXVL 3WNKA 2D2OA 3L5WB 1A6TB 4OZFG 4K3EL 2H2PD 3HRZB 3S5LA 4JQXA 5BV7H 3TN0C 4LLVB 4Y1AD 1S7SA 2IQAA 1U8PB 4FMFA 3HCVA 2VN4A 4LVHB 5SWSD 3GK8H 3DBXB 4ZNEE 2YPKB 1LK3L 1IGTA 4X5XB 5HGBB 4GG6B 2YPVL 4U6YB 4PJFA 4OZIE 1WVZA 3TT1L 1OARL 4PGBA 1UWGH 3EOAB 3QJHA 2BSTB 3P4NB 3IFLL 2HVKB 3BDYL 3BN9D 1QR4A 3QEQA 1G7PB 2QKIA 3BD5A 3UZEA 4JFQB 1T7ZA 5C0RL 3SDCB 5E5UB 2CO7B 3N1MC 1HXYA 3WSQH 4HS6B 1MWAB 2IQ9H 5JTWA 2VDLH 2X9YA 3TZVC 3BHBA 4EOWH 5DK2A 4EDXB 4RBPH 3HE7C 3HUJF 1QA9B 3SDDA 5HYIA 3P0YL 2Y07H 4U1MB 4J3TA 1DBMH 1RJLB 2PYEE 2JCCB 4R97C 2EH8H 1KN4L 2V7NB 3PGCA 2QADB 4LDLB 2ZUQB 5AZEL 2AJUL 1YEKL 2ZCLH 5AZ2H 3KJ4B 2PW1A 1CXIA 1GC1L 1NGPL 2IJ0C 1EGJA 1FVDB 1RZIB 3KPOA 1B0WA 4UILH 3VFVB 4RX4A 3CXDH 1BVKB 2DQHH 2P24B 3FAXA 5E94A 5L7XH 3W5MA 3VCLA 4U6YA 4P9HC 3MRJB 3ARXA 3Q5OA 4FQJL 5MHSD 2YSSA 3BJ91 1JK8A 4GKNB 1R5VA 3KLSA 5D8JH 4JKPL 4ZS6D 3VD4A 4OI8A 1HQ4A 2ADFL 3QHZH 5HGHB 5J9PB 3DO3A 3QQ9D 1AY1H 5TJWK 2QSCH 2BDNL 2UZIL 4KWUA 3FOLB 1CDBA 1F4XL 1PKQA 4QWWD 2YD3A 2C4FU 4L8DB 3TBSB 1AQDB 5LQBL 3UPAA 5EIIB 3IDUA 3QEGH 4Y4FA 3TVMC 1DLHA 4PJBE 3S4SA 4FMKA 2P49B 2VZTA 3DNKA 3E6HB 4X7TB 1PDKA 4H20L 5EU3B 5IHUH 4WJ5B 4N5UA 3C9NA 3RI5F 3GIVB 3S35L 1MCDA 2APVA 1FAKT 4M7JL 1F3DH 5KSAC 2YPLD 1D7FA 4W70A 4G8EB 4YXKL 5KVFL 5FKAB 2A38A 2LV4A 4KI5F 1GPOL 5TGBB 2VC2H 1JL8A 2KL6A 1DQJA 3G6JA 1D9KB 4DUWA 3H9SD 4OAWB 4JHBA 4NC1C 1QNZH 3VDAA 5FIEA 3BQUC 5KW9H 3ULSA 5I17A 4U6XB 1UWGL 2O5ZL 4NO0B 1VESA 5INCA 1IEAA 5CMAA 3WUWG 4UDTB 1SQ2N 3OAZK 5KVDL 5DD0L 5DTFB 2R2BB 4HIIB 5EO1B 4OGAD 4BJLA 2XTJB 1DBJH 3EJJX 3WSQL 1ZWIA 3MX0A 2XZCH 2QTEA 4ORGA 1UVQA 2VABB 3ULVH 4HIXL 3VXPB 1VFAA 1RK0A 1T7XA 4FQLH 4JHAH 5IT2H 3PL6B 4RGOH 1ZLSH 3THMH 3MV7E 3SJVA 1NGQH 3CX5J 4BSWB 5JPMA 3C5JA 3UJIH 3R1GH 4KI1A 2AAVA 5DC4B 1PSKL 3WDHA 3BEVA 4G8EA 3VFMB 4XNYH 4L8SB 3EGSA 5FO7B 4TOYL 3UJJL 2AJSL 2BY0A 3VG0H 5IEKB 1U58A 3U46A 4K8RC 1NGWB 3RKDD 1WWWX 4NQTA 5FOBB 5DGRA 1PEWA 4AL8L 2OL3L 1TPXC 4PR5A 4I0CC 3UROR 2VDOL 2J4WH 2R8SL 1ZT1A 2OQJA 3KPTA 4C56B 1CLOL 1VEMA 4JR9H 2O93L 5IFAL 1CFSB 5D1QA 3R8QA 3M17A 3MV9B 1IGJA 4KQ4H 4N8VA 4HXBL 3VWJC 1CI5A 3K4DA 3ARBD 5IF0B 3FB8B 4M5ZL 5F1OB 4UT7H 3SY0B 5J6GA 5IF0A 1LDPH 1FYTA 3CH1B 3WXWH 4APQB 1RJCA 3CFDB 1BQHA 2NZ9C 4FOMA 3X3FH 3STLA 1CFNB 1A8JH 4P2QE 5K9OB 2O5YL 1LE5A 4YK4B 1JGVH 1SHMA 4P5MA 4QOKE 4GMTL 5FO9B 4LRIC 5D1ZB 2XZQL 1MREL 3D6GA 4FXLA 1GGIH 2AVGA 2P1YA 4JG0L 4HHAB 3QWQB 4ZNCD 1G1YA 2Z91B 4JFFD 1C16B 4BUHA 4AIXA 3TCLB 1TETL 1V8HA 3R06B 4UAOC 4KI5E 5JHDB 5IGXL 1FFOB 1MHHA 2HH0H 1RUQL 4LRNH 2G5BB 1ZSDA 5DJYA 3F5WB 3VFTB 2R2HA 3BQUB 5IB2A 5E08L 4PV9B 3HZKA 5F21B 1ZGLP 5IVNA 5CGTA 4F7MB 5IQ7H 3K1KC 2CXGA 3BH9A 4JZNA 4DWHA 5C0RH 4YZFE 3FQWB 1WC7A 3BGFC 4N8CH 4PJFB 3LEYH 3KXFB 4WTZG 3EOTH 1A7QL 3B2UC 1FSKC 2R4SH 5DFTA 2KDGA 3QEQB 3KS0H 1KTDA 1KJ2B 3HE7B 3LD8C 4W4OC 1AD9B 2OS7A 4Q9RL 1QEWA 3WD5L 1G7HB 3G5VA 1TLKA 2AJ3A 1NCWL 3TV3L 1RK1B 4Q2ZA 1J0YA 1HZHH 5EBLA 3UBXG 1B6DA 5E8EB 5F93C 2CKBB 3KPNA 4NRZB 1BOGB 4WVRA 4MA3A 3TIDB 3OXRB 3F58L 1PYWB 3I75B 2O5XH 2FL5A 5TDOA 2KZ1B 2ATKA 4OD3L 1S7VB 4QNPE 4Z7NF 3TJEH 3MNVB 1MI5E 4M93C 3UTTB 5CIPH 4PP1C 3RWHB 3ULUL 5DC0A 3MO1B 1R0AL 2Y5TA 25C8L 3QO0B 4JKLA 1LO2L 1KLGB 4YQXL 4HLJA 3S3JA 1LD9A 1XH3B 1R3IH 3HPJA 4NZJA 5K9JH 1OTSC 4Q58C 4ODTL 5TE7H 5BS0D 5IEHA 3GI9H 4GW5B 2G60L 1DTUA 4X9GA 3S37L 3MLVL 3W9EB 4WUUB 1MRDH 2EDWA 2Y23A 3BIKA 3GJEA 4I4WB 2J1KA 4HWUA 3U0TB 2LAGB 4MWFA 1NSNH 1UA6L 3RNKB 5EC2B 5HDBF 4UQ2B 1B2WL 1CGYA 4XMLL 4HH9B 1VPOH 4H1LB 4EI5C 3ILQC 4L3EB 3F12A 4PG9A 5IWLC 1EAPA 1NMAL 4U0RB 3KYMB 5GJTL 1HINH 1MHPL 1J0HA 1FL5B 3ZKMC 4CADB 1GZQB 4Q7DA 5TF1L 3CFBB 1ZMYA 2Y06L 4LHUG 1NC4D 3BKJH 4MJ6A 4P23B 3MO1A 5DURB 4CJ1A 1KB9K 3FQNB 5E9DB 3EDJA 3RIAF 3I6KB 3OX8B 4Z7OE 2ICES 3IRZA 2PO6C 1ZANL 3WCYA 2PUQT 4X99A 2VDRH 2Y7QA 1X7QA 4QHNA 4YEEA 3P77A 4F37K 3WMSA 3V4PH 1FG9C 2EEBA 4KUZL 2FX8L 3MCLH 2X9XA 5E1AB 5I1LB 4M6NH 1FZKB 4HF5L 5EO1A 4UQ2A 2BVUA 2IFFL 4KK8C 5CD5C 2BY2A 5GRUL 4PGDA 2NY5H 5E99H 1XIWC 4MAUL 1D5IH 4CW1B 2J8UF 3UYRL 2I9TB 1WIPA 4AJ0A 4PLKD 2RGSA 1FNSH 1I4FA 1UYWL 2QQLH 4HIEB 4LLYB 4Y1AE 3IF1A 5D7SL 3TNMA 2VLKE 4RWYH 5JQHC 2VQUA 5HHXL 5HVFB 4FTVB 5DHVB 2VH5H 2VNCA 3HC4L 4W6YB 1SJXA 5HHOB 1LO2H 4CNIA 4JY5L 4XNUL 4C55A 2QSCL 3QP3A 5FYJU 3VWJA 1OL0A 1CIDA 1S7UA 4OCWL 4CL7A 2VLMD 5E8DH 3GSOA 2AQ1A 4HXBH 3C2SA 3N0PB 4ZPTB 1BZ9B 2VQ1B 1T89C 3U30C 2CMRH 1ND0B 3FONB 4ODXA 3GSVA 4R7NB 4J1UA 5F3HA 1GHFH 1QPPA 4XVJL 2ZJSH 1X5AA 1VGEH 4JRXB 4WO4B 2VAJA 2BMKA 3X3FL 1XF2B 1P1ZA 1K5NA 5LGJA 1OAUH 4JFOB 4QRSB 2FIKB 3O8XC 3FKUS 1YEKH 3SGDH 3FB8A 1MHEA 3QSKB 3OB0K 5FYKU 2DD8L 1TCRB 5FYLL 5I9QB 3QEQE 3V95A 1IBGL 3SDXA 4IIQA 5EOTA 1DP0A 3V7AG 2XTLA 1I9IH 4PJFE 4QHKJ 4OFYA 4PGZA 5EWIH 5GSRB 3ZKNC 1MH5A 5I8CB 3ZDZE 1QBML 4GMSH 4P9HL 3F7VA 5L6YL 1OPGL 4YBQD 3S7GA 1J1XL 4PJDB 4F57L 4QRPA 2BNUA 3PABB 5JDSB 1CLZH