4GMSL

Crystal structure of heterosubtypic fab s139/1 in complex with influenza a h3 hemagglutinin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
211
Chain Sequence
b'DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQEKPGQSPKTLIYSASNRYSGVPDRFTGSASGTDFTLTITNVQSEDLAEYFCQQYNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 45
structure length 211
sequence length 211
chains with identical sequence M, N
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmsL01
3O3UN 5IF0B 2ZOKA 5C0AE 5LQBL 2NY6B 3UTTB 4N8CH 1S78D 4LLYA 5CBAA 4X7TA 4G8FB 8FABA 4PJ7A 4QXGL 1H0DA 4F37K 4KGLA 1BQUA 3MR9B 5BXFB 2DMCA 1JWMB 1VPOH 4LMQE 2CO6B 1ES0A 5FCUH 5MEQA 2IALB 2BOCB 4HJGA 1KTDA 4Q2ZA 3S97C 2XG4A 3LEYL 2ZPKL 3KXFD 3PWLA 1SM3L 3MLRL 5GS2H 4WFEE 4OD3H 5ECJE 5T3ZE 3IDYB 4P46A 1CDUA 1TPXC 3DVNB 4Y4HD 1RHHB 3OJVC 2B8OT 2OR8A 4KGJA 1U0QA 4CVXA 4JQIH 4JY5L 4UZGA 2PETA 4U1LA 5GGVL 1RZFL 3O11A 5ADOL 5F93C 1U91B 4YWGL 3U46B 3VXSE 3DHMA 4QRQA 3NABL 3PWNB 5HYQB 3VRLE 2B4CH 2Z93A 5C71A 5KANG 5EO9A 2EDWA 4I3RH 3T08A 1TITA 3WEXB 3N9GH 2DI7A 3RZCB 1D6EA 5TE4H 5CEYA 4L3CA 1LEGA 3K46A 4UNTA 3VDBA 3JTTA 3RWJB 2X1QA 3C6LA 2R69L 3C8KA 5IEHB 2H32A 1S7QA 1QA9B 2ZOLA 2FL5A 2J88L 3KNBA 4FP8H 5E00B 1J0YA 5EU7C 1UKTA 2EDBA 2KUTA 1GL4B 2M8XA 4OD1L 4QTIL 4G6ML 5FYJU 2VQ1A 3ZE0F 2VN7A 4XMLH 3GRWA 2ID5A 4XP1L 1CD9B 1AE6L 1FNSH 1LO2H 3FHQA 1ZSDA 4RGND 4K7PX 2IH1A 1V3LA 3VXUB 3SBWA 1KPVA 2Z0BA 4Q7DA 1JMXA 4UIKL 1ZHNA 5GHWH 4ZAKA 3T3MF 1I9RH 1GIGH 1S7WB 3FB8B 4JKPH 2OTWA 4M6NH 1BBJB 3CVHA 2Q76A 1JYWA 2LU3A 5FGBA 4JN2A 1YA5A 2CDGB 4XBEH 1ETZA 4LLQB 3W39A 3V5DB 3CFBB 5HI4C 4RX4D 3BDYH 3FFCA 5TJWK 1XF3B 3QWQB 2QQKH 3ALPA 2G5RA 2HN7B 2I07B 2R4RL 3D85B 3HAEH 4G6FD 1HH6B 4HKBB 3RPKA 4P5MA 5D1QD 5DD0H 4MAUL 4X6DF 1MLCB 5IQ9A 3U4BL 2J4WL 3PV7A 3SDDC 2I9LA 5IK3A 3ARBA 2GK2A 3ECBB 3KJ4C 3DYOA 1SY6A 3IFNH 1D3CA 5B4MC 1IGYA 2ED9A 3QIBD 4P2RE 4WCYH 4X8XA 2IGFH 4QY8B 3M1BB 3WXVH 3O2DA 1DL7H 4QO1A 2HLAB 4XPAL 5B8CB 4P59H 2NW3B 4XC3H 2RR3A 1FVCA 3L3KB 3TBYA 2E9JA 4YUEH 1KC5H 3OKDB 3O6FA 4GKNA 1IGFL 2X4OB 2PTVA 4S11A 2EIZB 4PJCF 1EBAA 1UJTA 1UXSB 5DC9B 2E7BA 5T1MA 3H7BA 1U8LB 2FNBA 4LIQH 3LZFH 5F7FA 3S88H 3T2QA 1T22B 1QOKA 3QNXB 4R4BB 2IPKA 4PGBB 1CCZA 3G6JE 3QPQD 4LRNL 2R2EA 1OD9A 3QHTC 3T4YB 4Z7OF 1MCHA 4OFYA 4IRZH 3QIWB 3FT3B 4TNVF 1ZLSL 4U3XA 3BWAB 4RQQA 2RIKA 5EU6E 2E7MA 1AQDB 2RHEA 4Y19B 2VDLH 3QI9B 4U0RC 5CSZB 1S7TB 1RD6A 4MXWH 5I1KL 3KWWA 4D0DA 4X5WA 3HB3D 1FIGH 1J1PH 4XNQB 2PNDA 3LEXA 3V6BR 1HI6B 1A2YA 1EEUA 2V2XB 2HP4A 4FQJH 3G5VB 2HJFB 2P49B 5I73C 1KG0A 3KPNA 3BGFB 3IFLL 4RFOL 1PX4A 4LHUB 2DQHH 2ARJQ 1BOGB 3K2UL 4GRMB 1U8OB 4LCCA 4PV9B 3X11B 4P4KA 1IAKA 1LO3H 5E5UB 1RAMA 4MS8C 3LN4B 5DD6B 2BJMH 4HIHB 1NH6A 3MRBA 3S4SB 5ICXB 1N5AB 2QHRH 3QEQA 4EQ3A 1DE4B 4KUZH 3WS6A 2UZIL 3KPMB 5FO9A 1FN4A 5C6TL 4MQXD 1H5BB 2F53D 1F97A 1NBQA 2PW2A 4WU5B 1W0WB 4ONFH 4G43B 3FRUA 4Z7UE 4PJ8A 2NLJA 3BGMB 1MWAA 5ESVB 1ZKAA 4KI5D 3VMNA 4Y2DB 4FFYL 5DUBA 4UV4L 4NHCH 4FXGB 3IF1B 3WNOA 3U6RB 4J23A 1NFDE 2OP4H 5B3JE 3T77A 4U4BA 1E4XI 4MWFA 5DLMH 3GEWB 3WIHH 1R3HA 4XVJH 3WHE1 5KOVC 3WJJC 1VDGA 5IHUH 3RNKA 1W72L 4ZS6C 4QGTA 3TP4A 2P5EE 1X3DA 4PB0L 2JELL 1CFNB 3U48A 1B2WH 3LV3B 3B9AA 4P46D 1ZLVH 4WTWA 1D7FA 5DA0B 5IB4A 3DETD 4HMCA 3MRHA 4N8CL 4D94A 3BRFA 1LEKA 3VFMB 5I2IB 3S8WA 4XXCC 1RV6X 1FJ1A 1Q9KA 1KELL 4MQ7B 5H37G 3ARXA 3I3DA 1KXTB 3B9KB 3SKMA 1A47A 3TF7C 1EVTC 4NN5B 5EBWA 3TBSA 1KSRA 3R06A 3BZ4A 4Q97A 3FQUA 2PYFB 4I5BB 3ARFA 1UJ3A 2DM3A 2V17H 2XYCA 4WJ5A 3RHWK 4ZFGH 1EEQA 1MEXH 3C6LD 4OD3L 3NFSL 4RNRB 4R9HA 2C4XA 1HXMB 3FN9A 5C09B 3EAKA 4OAWB 1TFHA 1IRAY 1UYWL 4M61B 2X4UB 3BN3B 3RZWA 2MKWA 1CDGA 5E2UL 5I1LB 3SQOH 3O3EB 4OF6A 4JQIL 3GHEL 5MEPA 2EH8H 4LNVA 3SPVB 3QAZC 5C3TA 5GIRA 1PYWB 3JTSA 1WF5A 2DJ4A 2B4CL 1WIPA 3GDBA 2VZVA 4I3SL 1FFQA 3SEPA 4I3RL 1U8HB 3WDJA 3NPSB 2XKSA 1MSPA 1PLGL 4KH2A 1WBZB 5EU3B 4ZAKD 1IAIH 4FFWD 3U0WH 4EZMA 3SDAB 2B2XH 2EDJA 1MAKA 5KSBA 4MLIA 3LMJH 4QRRB 4FG6C 4WUUE 4RBPH 2O5XH 4OTXH 4FP8L 1UWXK 1U58A 4YDIL 1OAXL 4GBXB 3FFCD 2Q86A 3EO1A 1UACH 5J11C 1ZHBA 1AGBA 2HKFH 4XMLL 5DJ0B 1JGVL 4BELD 1G9NH 1RK1A 3IDIA 2A73A 1FNSL 1IARB 5I1IL 2AK4A 4QRPB 3VJ6A 2OTUA 2UVEA 3REVB 4KFZC 3ARBD 4OGXL 4WW1A 1N5YH 1E28B 1SEBB 5GHWL 2GITB 1I9RL 5BOPA 1GIGL 3H0TB 1AGFB 4MB3A 4JKPL 1GZQA 2DKMA 5DJAB 2XFXB 2VTFA 3C5ZB 1MHPH 2VXVH 3TCLA 5D7IA 3MGOB 4MCZA 4W4OA 2RBLA 1F3RB 2QQKL 3ELAT 3EOAA 4NNYA 3GSNH 3O6FD 1CFTA 4PG2A 3MLZL 4POZD 4LCIH 5C9JA 2CMRH 4UBDC 4PJXA 4GRLA 1PSKL 1AHWA 2ZUSA 4QKXB 1P2CA 1TQCC 4XWOC 2R39A 1AO7E 4HJJH 5EG6C 3I3BA 5EOCH 3IFNL 4C55A 4MVBD 1YEHH 5JPMA 4XCNA 1OLZA 4WCYL 3OAUH 2IGFL 5TE6H 3WXVL 3CVHH 1DL7L 3V5KA 1XF2B 2EDXA 4YBQC 4P59L 2R1XB 2OMBA 1I8LA 1MUJA 3HI6H 3OR7B 2WWMD 4OFYD 4JPWL 3S4SG 4YUEL 4O2CA 5BW7C 3FFDA 3MFFA 3T0XA 5FCSH 5TE7L 4V2CB 4DZ8A 5DVLA 1A4JB 3MV7B 4LLDB 3BPOB 5EBGA 3OX8A 2XT1B 2QADB 4OGAC 3QHZL 2CLVA 2QQQA 4S2SA 2YK1H 3CUPA 3CC5B 2AV7B 2Y36H 1AKJA 5DD3H 4N9GA 1XZ0B 4EVNB 1EFXA 3O2DH 4JANA 3R0NA 1EAPA 4F33A 4NKMA 5D1XC 5H37H 3DX6A 4O51A 1NEZG 4ZNCD 1T1WB 2CIIB 4LGPB 1WITA 4LRIA 4IRZL 3VG9B 3BZFA 1BIIA 1H3XA 4P4KD 1G7PA 4WV1C 5DQJB 5ISZE 2ZNXA 3F7VA 4DKEH 3B43A 5SWQB 4PRIA 1FIGL 4Q9QH 5IROA 4NKDB 4TSAH 4AM0A 2JB6A 2J5LC 3UO1H 1INEH 1YC8A 2PYEE 1VFBA 4JHWL 2ADJA 4PJ8D 2Z4QA 1GSMA 4PTTB 4XI5D 1LO3L 3CXDL 1JF1A 2EDEA 2BJML 1UGNA 2FO4B 1A7QH 2H26B 4KUZL 4R96B 4WW2A 3TFKD 3R0MA 2VZTA 3N1GC 4MHHG 3BT2L 2UUDH 1AIFA 1UM6H 3SKUD 3BJ91 3NZ8A 4P48A 5KAQG 3MV9E 3M45A 2R1YA 1CDYA 3BKYL 4R0LC 1LE5A 2VITA 4NHCL 4WI5A 4ZFOL 1R5IB 3V0VA 4ENED 1RMFH 4PYGA 2OP4L 5EU4B 5F1KC 5KN5A 1YQVH 5K59E 4GKSA 2OS7A 4AK1A 4K94H 2NXYC 1RSFA 5D7JD 1MCKA 4YIQB 1S7SB 1D5MA 2BNQE 3HE6C 3ARFD 4DVBB 3WHXA 2EYTA 5J13B 3C87A 4NQDB 2N1KA 3HI5H 2F74A 1QYGH 3LS4H 4M48H 4KKCD 2FGWH 1ZA6A 3NBNA 2JJUA 5K9OB 3X3FH 3VFVB 4DN4H 3IFOA 5KSVA 3VWKA 3RTQD 2AV1A 2YMXL 2NZ9C 2CIKB 5F9OH 2YD8A 3GSUB 4M93C 1V3MA 3HRPA 2WBJB 4IRJC 3TN0C 2VKWA 4RA3A 2OSLA 3VWJB 4HEPG 4JRXD 4Y4KC 2GAZA 1H3UA 5DO2C 5JZ7D 4U0QB 4P2OB 1NFIB 3O6MH 4HWZA 1TZGL 4ZFGL 3L3GB 4G5ZH 1YNKH 1NQBA 3L6FA 3TO4A 3BYTA 3D69B 3SDXE 4GOSA 3MCLH 3SQOL 5FYKH 4HGWB 4OZIF 4BA8A 2EH8L 5TDOB 3QT2A 1FVDB 4L9LB 1HWGB 5KSAC 4L5FH 2M26A 2AK4D 5DK0A 1I3GL 4F7TB 4G8EA 2NCMA 1IEAA 3E6HB 3HHRB 4RIRB 1H8NA 1IAIL 1VEPA 4E41A 3U0WL 3TNMB 2B2XL 3MRCB 3X13A 5JQ6L 3NIGF 4N0FA 3LMJL 1I8MB 3HUJB 1UB5A 3EYUL 1G7MA 4OTXL 5FK9B 5FUOL 3EJYC 1R3KA 1VGEH 5E56A 4MA1C 5IB3B 1KB9K 5TDPA 1UACL 3IGAB 3CDYA 5DZNA 1S9YB 4RFEB 3T0VA 4Q9CA 2HKFL 3BPLC 1ZLWH 3JBG7 3MUGA 2ED7A 3WN5C 1G9NL 3O4LB 2VZ3A 4GRLD 5JHDE 4ZS7L 1YEIH 3B2UC 5IJVA 4OQTH 4ZUTA 1HEZB 2AJYL 3ZDYE 5CINH 1UT9A 1WAAA 1QACA 2ATPA 4GRWE 1IL1A 3KPSB 5IKCA 4XMKL 4C57C 4XPBL 3TJHC 1VGKB 4LPVA 1AD0B 1MHPL 1DQJB 4ODUA 3T0WA 3L3IB 3ALXA 4N0UE 3KAAA 4ZSOE 4Z7QF 3VGAC 3EO0A 2W38A 3CU7A 4JEGB 2QQNH 1A6ZA 3O9WC 4LCIL 3ZDXE 2DMBA 3DRQB 3BEVB 4Q74A 4L8CA 5BV7C 1ZT4A 3ARGB 2ZUXA 2EZ0C 3IDXH 4Z95H 4HJJL 5EOCL 2XWBA 1CT8B 5IT2L 4WNQB 1T0MA 3VFPB 3OAUL 4UV7L 3FTGA 5TE6L 3AREA 4Y5YC 3CSGA 3SCMA 4JO4H 1N59A 1C7TA 3MRLA 3FO9A 3HI6L 1A21A 2BVYA 4OZHA 4M02A 1MRDL 2BVQA 5BZWB 2DF3A 4R6UA 1SJEB 5FO8B 3EYSH 1HWHB 4O9HH 4MJ4A 3JWNC 4JVWA 2R4SH 5DQ9A 1UB6B 4PRID 2NY4C 3PJSA 3HNSL 4L8BB 4U2ZA 5ABDE 3I75B 2BVOA 2W9LA 5JNYA 5A16A 2Y36L 4CDGC 5INDA 4GSDH 1Q1JH 5CEXA 3EYOA 2IADB 1U8PA 1RFDH 4MXVF 1FL5B 2H8PA 3V6OE 1E4KC 2ATKA 3A6BL 4RMWA 3ZT5A 4EN3C 1FRGH 1A9EB 1EO5A 5IV2B 2YPLA 1P9MC 4JCMA 5DHYB 4HFUH 4KXZI 2CSPA 1OGAE 4JZJB 2FJGB 1XGPA 1J8KA 3D39D 4MCYB 4DKEL 1K5NA 3BD5A 1OQXA 3LKOA 2A9NH 4DKFH 1MFAH 2A0LC 4Q9QL 1GGBH 3JV5A 25C8H 2AXHA 3UO1L 4MNGA 5E7BA 3SDCC 1INEL 1XIWB 5BCAA 2GTZB 3UDWA 3PGCB 4TPRH 2WAHA 3RX8A 4I48B 3GJFA 1OGTA 2C3GA 4P4RA 2YHGA 3EIFA 1C5DB 1P5VA 1BZ9B 3IJHB 1F3DJ 4Y4HB 1CZ8H 5JIPA 5JO5A 2UWEE 4P9HH 1DBKH 3DECA 3NCCB 1P1ZB 1A6TA 5DS8B 4P2CG 5JORB 2GJ6B 5CWSB 1TJHH 5A40E 3EYQC 2GJZA 3UYRH 4MD0B 1QR4A 2VO5A 3U9PH 1UM6L 4Y2OA 2C4FT 4HWNA 3RL1A 5F6HJ 1CICC 5KANI 1IQDA 1NJ9A 4V2BA 4K2UL 4Q6IB 4LU5H 1IGCH 4YFEA 4ELKB 3G5ZB 4OUOA 1RMFL 2LTQB 5AYQA 3VWKD 4KC3B 4OZIB 2I9TA 1T7ZA 1QSZA 1Q72H 1X6NA 3DROB 3MUJA 1PW3A 1PFCA 5I17A 5HPOA 1IGIL 1KTLA 2APXA 3SKOA 1X4YA 2EIBA 2P1YA 3AMLA 5LCVH 1OT1A 1VKXB 3GKWH 2XA3A 4ZTPL 3LN5B 5SX4I 3EJZC 5FM5O 3DI2B 2OMNA 1U3JA 3I6GB 5C07A 2FGWL 2OJEB 5IW1B 3TO4D 1JUFB 5J9PB 3K0WA 3X14B 5ALCH 1RIUH 4G6FB 4AIZB 5E8DL 5HI5D 3KPRE 1S9WB 1MF2H 1A6PA 1P4LA 4R8WH 5EZJB 5D7SL 4APQC 3NFNB 1GRWA 1HHJA 1HQRB 2D9CA 5SWZA 1EGJH 3GMRB 4R26H 4FQLL 5HHOA 4A6YH 2ERJB 3QIBB 4K9EC 5E9DE 2FDBP 5MHSD 3H9ZA 3Q6GH 4E41D 1JPST 3O6ML 5CHNA 4ZNEE 4R3SB 1YNKL 4ZODA 1FH5H 2IANE 3RWGB 5EFIB 3U7WH 1QSFA 3KPTA 2QSTA 3DMMC 3L5XH 3QO0B 2KZ1B 4FZ8H 2X4QA 3T0EE 4HPYH 4ZO9A 1LO4H 1V7NH 4HBQA 5F7EL 5DMYA 2DLFH 5FYKL 1UCTA 1LO0H 1SYVA 5F8RC 4TTGA 3AFLA 5HI3D 3WFZA 1GOHA 1KB5B 4ZPVA 3U4EA 6FABH 1JGUL 4TVPH 1YY9C 5MEOB 4HPOH 3QDAA 1LK3H 2NX5A 1U92B 1BZ7A 3RPIA 1WIUA 2PXYD 4YH6A 4NRZB 1QR1A 5C0EB 4S1SH 4PP1D 3ES6A 3FOLB 4UOW0 3ULUL 1BJ1H 2AKRA 2VLKE 1CLYL 1JVKA 2V7NB 4F37F 1T6WA 1VGEL 4X7SL 5ESAB 2VXTH 2PKDA 2V6HA 4D9RE 5AEAA 5ICZA 2HKHH 3L3HA 2V9RA 3RKDC 4NQXA 3PDDA 2X4RA 4MSWB 2GTWB 1NMBH 3JV4B 2HT4D 3TNNA 4G8GB 3BPNB 5D70L 4WO4C 2OZ4A 1T6VN 5HGGS 2JLLA 1IKNA 3GI9H 3WLWD 2VZUA 4QHLA 2EEBA 3RGVC 4GMTH 4HIJB 2PTTB 1TETH 3FQTB 3ARED 2H2PC 3SCMD 2XPGA 4X6CA 4F8QA 3G08A 1QVOB 3VU2A 5EO0A 3IDMA 1XH3A 1AQKH 5ERWA 4ETQB 1KFAL 4UQ2A 3QDJE 1QSVA 4K8RL 1KLUB 3ZHKA 2P43B 2QQNL 4DUVA 3MXVH 4CADB 1J5OH 2D7QA 4P23C 3FRPA 2HTKD 4DVRH 4PJHB 1HHGB 1ZANL 5EUKA 4Z95L 3AM8A 4O2EB 1Q0XH 2F53B 1RUMH 3TYGH 5E2JA 2IC2A 1D5XA 3WDIA 5DQDH 3TYFA 4JO4L 4ZOEA 3OWEA 4YXHH 2HFGH 2CRZA 3QXAB 5JOFB 3F12B 2ADIA 1G1YA 1QUNA 3FQRB 5IQ7H 4PRHA 3GMOA 3A67H 4TQEH 2YPLD 2DWEA 2YXFA 2JCCF 2VXSH 4U3CA 5ANMA 5GZOD 3OBAA 4O9HL 4ETYA 3DGGA 1CFVL 1VFAA 4HWBH 2R4SL 4XB7A 2XZCH 2VYRE 1PKOA 4K23H 1BFOA 1LD9A 1MFEH 3P4OA 1A6WH 5DEFB 3TZVA 5GISH 3PWPB 5IESL 1KTDB 4CUCA 4OFIA 4NJ9H 4KROD 3S37H 2A1WH 5GS1C 1X5YA 2O5ZH 3PWLB 1FNLA 4A2LA 4O4YL 4EI6A 2F54E 1IILE 3PHOA 4ISVA 1KUMA 5SWSA 4ELME 1FRGL 1MFBH 4JRYE 4P46B 4PJ5E 5E4EC 1RZJH 4OI9A 3HCVB 1RJLB 4HFUL 1A6UL 1EK3A 5CD5D 4GG6E 3MNWA 3S7GA 1KCRH 3TVMC 1YPZA 4Z0BH 2A9NL 4KK8C 2FJHB 3FT4A 1GGBL 4CU8A 3VH8B 25C8L 1MCWW 1DQQA 3H3BC 5D5MF 5JW5B 4XNXH 4L3CB 4N1CA 5E1AB 2UVFA 4AG4L 3JTTB 4TPRL 1X5HA 4K3JH 3C6LB 2QEJA 5TQ2H 4YGVB 2H32B 3U82B 3KNBB 3VXOA 4IMKA 1C8PA 3UTSE 4KMTH 4KTYA 3VXNB 4KHXH 2VQ1B 1DQTA 3IJSA 4P9HL 1DBKL 3O41B 2AXGA 1MCNA 4NQEA 2H1PH 1ZSDB 2IH1B 1QFWH 4LVHB 4LQFH 2W9DH 4NNXA 5HHNB 1A02N 4KMLB 1TJHL 5I73B 4WDIA 1MFNA 4ZAKB 1OP5K 4CVZA 4KDTC 1J8HB 2N4IA 3DUSA 3JWDC 4GT7A 1IGML 3IRPX 4PJBA 4Z7NE 1I1YA 3QJFA 2OTWB 1MHHB 4MDJB 4DEPC 3PWJB 3VD4A 1FFOA 2F58H 4JN2B 4G80B 4JFDD 4NQSB 1RZIB 3NFPB 1FSKC 2JJTA 1OPGH 3FFCB 4LU5L 2VDMH 1IGCL 4TNWK 5J4MA 4OQ1A 4P49A 4MJ6A 1MQKH 4S10A 3C09C 1M05A 2CK0H 1M71B 3CSBA 4PJIE 1Q72L 1U2HA 3V0WH 1HHKA 2J6EA 4RWYH 3TJEL 1WWCA 2I9LB 1UQSA 3ARBB 4GAYA 6CGTA 1IAMA 4YEEA 4QEGA 5SWZD 4CGTA 5JOPD 5LCVL 1VEMA 2QHLA 3AXLA 4BQ6A 3THMH 3GKWL 1J11A 3VRLF 5A2LH 3MRKA 3KLAA 2W0PA 4Y1AB 4DWHA 5AZ2H 3R4DA 1QSFD 4OF5A 2FEDC 1H15B 5F3HB 2FECL 5FYLD 1RIUL 3TBYB 4HQQL 3VFWA 1CXHA 3O6FB 2ED8A 4Y89A 2X1WL 3VFGH 1MF2L 3KPLB 4R8WL 5GZNC 3GSVA 2R9HC 5KS9E 5DMGD 3QXDA 3V6OC 4O2FA 1WEJH 2VXQL 4FQXC 1P7KB 4PUBH 4WFFD 3TESA 4X6BA 1OB1B 2VLRB 4N1HB 4XGZB 2MCG1 3OKMB 3WKNA 4LEOA 3ZYOA 2NXZC 1FH5L 3U7WL 3C8HA 2R2EB 3L5XL 2YRPA 5F9JA 4HPYL 1AY1L 1D9KA 1LO4L 3BH8B 4XAKE 4RFNC 4KRPC 3UPRA 5GRUH 5GGSA 2ZSWA 1LO0L 5M7QA 2EH7L 4P2QA 4R90H 4I2XE 2WIIA 3UBXA 1RIVL 5GSVB 4G6JH 1U8IA 3V5HB 2CJUH 4FTVA 4TVPL 3KWWB 4D0DB 4X5WB 4LEXH 1MY5A 4HPOL 3WL9A 1LK3L 4NRXA 3MREA 4GW4A 1OSZA 4XCYA 3C9NB 5FUCE 5GJSH 4S1SL 2R23B 5FM4A 2V2TA 1KG0B 3REWB 3KPNB 1QSEA 1DVFA 3RDTC 4ACPA 4CL7A 1NCTA 1C12B 4F15B 1EHXA 4NFDA 5C0FB 4HUWB 2BNRA 4MA7L 4P4KB 1IAKB 4LPUA 4XCFH 4Y8DC 1EVUA 3BMVA 1NMBL 2HT3C 3MRBB 3KYKL 2X42A 4HS8H 2EXWC 5FFLA 3VMOA 3JV6A 4RMUA 4FQ2L 3RHWF 2SEBB 2ZUVA 3HLAB 1WISA 1FN4B 5H35A 5HDQH 3RX5A 3BVNA 3MRIB 5DC4B 2XV6B 4GMTL 1TETL 2IAMA 1BZQK 3PL6C 4AENB 5GSRA 4HWEL 3T1WA 4ZFZA 1KTRL 3G5YA 3MA7B 5BS0E 5DUBB 3OGCA 1AQKL 4JR9H 4PRHD 1S3KL 1EUTA 4YDVA 2RQ8A 2DQCH 4YHKH 1QFUH 3MXVL 4QRSA 4X0KA 3EHBD 3G6JF 1J5OL 3TM6A 3MGTA 4XBGA 4UT6L 4LSSH 1R3HB 2OZ4H 4YQXL 1WCQA 1Q0XL 1MI5B 1I8IB 3LPWA 3PGDA 5D1ZD 1RUML 5CJQH 1WIOA 3RNKB 3TZVD 2VLLA 5B3NA 4D0CB 1F8TH 5HGAA 4U05A 5DJYA 2WK2A 4XHJC 2R56H 2HFGL 3MLYH 4HIEA 4QRTA 3JUZA 5SWSD 4MHHI 5IQ7L 2O26U 3UTPE 3BAEH 4TQEL 5IB4B 1RY7B 3IVKB 3VI4E 4P5TC 1UADC 1YN7A 2Z31A 1LEKB 3X3GH 5JTWA 1FJ1B 3SY0A 4NRYA 3I02B 1ZGLB 1KIRA 2XZCL 5D7JB 3SKMB 9CGTA 4ERSH 1JZ6A 3EYFB 1MFEL 5C0AB 2DQTH 3ARFB 2GHWB 4WFHE 3T0EC 1ZVHA 2BHUA 3SKJH 4WJ5B 4NT6B 3H3KA 4HSQA 2A9MH 3A0OA 4FFVC 2GKIA 3UMTA 3D6GA 2DQIH 3A6CL 3KR3H 5IM7B 1CU4H 3VXTB 2X9YA 4BJLA 4RDQF 1T7XA 1ZS8A 1JPTH 5ID0A 2GQHA 1ZV5A 3RTQB 4Z7UF 2CXGA 3EDKA 4K7FA 2DLHA 1KCRL 1UC6A 1N2RB 5E95B 5GIRB 4UINH 3JTSB 1QRNA 4YEFA 1BVLA 4I0PC 5CKAA 3LCYA 4LSQL 43CAA 2C1PA 3LB6C 4JRXB 1MFCH 4NSKB 4OFKA 4XWGH 1NFDF 3S36H 5EO1A 5FO7B 5B3JF 1UVQB 3FB7A 3QIUC 4JFHD 2D03H 2W9EH 3MC0A 3UBXG 3VXSB 1YEKL 4K3JL 5KSBB 3CZFA 5TQ2L 3QDGE 1CQYA 1OTTC 5E2WL 3V8OA 2P44B 4K3HA 1XGRA 3MOQA 2ARJB 4WV1B 1PQZA 5C0BA 4YK4C 1TNMA 3D0LB 1ODAA 5AZEL 2HH0H 2WLZA 4KHXL 1AGBB 3UTTE 5IG7A 4Q6YA 2IEPA 4YDLB 3VJ6B 2QR0B 2W9DL 3BDXA 1ACYH 2DLGA 4WW1B 5GGUB 4JG1H 4ONOA 5HHXH 3BP7B 3SKNA 2B0SL 2FATH 4JFOB 1EHLH 4PJFE 1JHKL 3DURA 1NEUA 2F58L 5IEKA 5JDJA 1MREL 5EH1A 1U3HA 1AD9B 3W9EA 1OPGL 1UXWA 4MCZB 1MQKL 1LP9F 2PW1B 4L4TE 1IMHC 5DHVA 1CFTB 2LU7A 4R4FL 1B0WA 1TTGA 3V0WL 4PJXB 4RWYL 3BE1H 1AHWB 4ZUSA 1A4KA 1YYLL 3GJEA 3DRTA 3D0VA 2QSVA 5B39G 4I18B 3CSPA 2DS4A 5DMKA 4WHTA 2DQFB 3WLBA 5JDSA 2IBBA 4XCNB 4H25A 2MNUA 1HDMA 2ZJSH 5L6YH 3V5KB 1TJGL 3E3QE 4R0LB 3O8XC 5AZ2L 3I2CL 1EDQA 1MUJB 1MVUA 1D9KD 2EDKA 4U1MB 4GS7B 5CP3H 1LO5B 5DJDA 2ESVA 1WWAX 4P2QD 1FG9C 2DI9A 4F7MA 3EOBA 3FFDB 2EYRA 4FTVD 2HT2C 5A2KH 4X99B 3U7YL 4RA0C 3QR2A 4U1NA 1EO7A 4PUBL 2FHBA 1UH4A 1FE8H 3VXUE 3V4PH 2FX9H 3O3AA 5DHXB 2O93L 5I66A 4U7MA 4OF7A 1EAPB 4F33B 2H45A 2C3VA 1QSED 1DVFD 3DX6B 2LVEA 1KEMH 4ZTOL 4M43H 2A83B 5FYKU 2X4TB 4QHUB 1N4XH 3IDGB 2W0FB 5GRUL 3BZFB 2CKBA 4R90L 3VA2C 3TN0B 3F7VB 4G6JL 2D0FA 2CJUL 1HYSD 2K7PA 1FZOA 5D9SA 2AJVL 4LEXL 4JPIA 5IMLA 1Z9LA 3GBLA 5ITFA 4F7CA 4U6XA 4AM0B 2JB6B 1MJ8L 2HFEA 2O61B 5EU6B 4LAQH 3ZDZE 1JPGA 4YC2C 2BDNL 4NDMB 4I4WB 2IAMD 1R5VA 3NCJH 3J8F7 4DGIH 2ADJB 3HE6A 1EV2E 4E0RA 5TQ0H 5D4QA 3G6AA 2Y6SD 4PRPA 5E94A 1AJ7H 3OB8A 1NBVH 5KW9H 1JF1B 3D39B 3OTTA 4F7EB 3HZYA 4HS8L 2XQYG 4HS6B 5EBLB 3ARDC 4HKXA 1I9IH 1NAMA 2OL3A 1UKSA 3BP6A 2ADFH 3KPOA 3WV0A 5E6YA 1L9NA 2VQUA 3ZE1E 2AXJA 4Z7WF 3DBXA 2G75B 3G6JA 3K7UA 4LGSB 3B9DA 3HRZB 4DCQA 2GK0B 3DYMA 3VXQA 1J7VR 1LE5B 2ZCKH 3BPLB 5LKNA 4JDTH 3AVEA 3WN5B 4WEBH 2DQCL 1A5FH 5DURD 1QFUL 1KPUB 3ZKXB 5KN5B 2Z31D 1FV1B 1Z9SA 4Z7UB 4RZCB 4Y19E 4LSSL 3V4UH 4WFGE 5HVFB 3MLXH 4POYA 3R8QA 1CLZL 5I75C 1B4JL 3NGBB 1IC4L 3QUXC 4LDLB 1RZ7H 4GW5A 4KDVA 1D5MB 4L8SC 5F1IB 5KSAA 1KB5L 2FBOJ 3WHXB 2EYTB 1F8TL 5B38A 4M7ZB 5F1NA 4W70A 5T3XH 2R56L 2F74B 4ODSH 3WSQH 3NCFB 2FX7H 1I1AC 4IJ3C 3ROLB 2YD2A 1DEDA 3BAEL 5IBTH 3W11C 4S1QH 3RA7H 1T0PB 3O9WB 3QEUB 4G6KH 4MJIA 1RI8A 3VWKB 3GB7A 2AV1B 3CVIH 3X3GL 3MRMA 1QRND 2DL9A 5HGHA 3SQBA 1BQHB 4PJGA 1RUPH 3ZKMC 1O5DT 2BHZA 5IFJA 2FYYB 5F8QC 4TSBH 4I0KA 3DTXA 2R0KH 3UAJC 4QHKJ 2G9HB 4JO2L 5LXGH 3RU8H 1KJ2H 3L6FB 4X7EC 2A6DB 1L7TH 3DI3B 1FYTA 1JPTL 2NNAA 5JW4M 3OKKA 2XXMB 3BO8A 2B5IB 5C0BD 1V7MH 5GS0D 1FL3B 5FUCC 3K8MA 1LP9B 1EUUA 3HFMH 4YHMH 3NCMA 4UINL 3ARPA 5ESQA 2NYYD 3EJJX 1MFCL 1HCVA 3Q0HA 3P4MA 4XWGL 3ULUE 5CILH 3L95B 3G6DH 4JM2A 5DWUH 5K59F 3DSNA 2P5EA 1HKFA 2W9EL 4LVNB 4RRPA 3X13B 1CYGA 3IKCB 4XVUC 4N0FB 2UV3A 4JFYA 1C5BH 5AD0A 3LKPA 1UB5B 1A3RH 2AQ2A 5AUMB 1U3HD 5DGQA 4Y5YA 1YZZA 3WFDH 4MX7B 1N6UA 5TDPB 4XMPH 2IMMA 1GZPB 1IQWH 4F7PB 2AJZA 3WMSA 5EUOA 5JW3L 1NCWL 5BZDA 1SJHA 4HBCH 2MQ3A 5DTFB 2PXYB 3DX9B 1N8ZA 1WLHA 1T0NA 4JG1L 4ZUTB 2FATL 4MDIB 1EHLL 5IKCB 1HSBA 1CE1L 3HZMA 5JXAH 5KTEL 3JV0A 1JZ8A 4MXQD 3U0PA 4NUJB 4JB9H 2ZNWA 2XZZA 4HT1H 5FUZL 3F5WB 5MI0B 5C09E 5D2NA 2C9AA 3QYCA 1PBYA 1PY9A 4AT6A 3EO0B 2ESVD 1OARH 2UUDK 1A6ZB 3ZKNC 4Y4FD 4CMHC 3RNQA 3BQUC 2C5DC 1R3LA 3BE1L 1G9EA 3SDXF 2DQJH 1T83C 3SE4A 2XWBB 3CFJA 3KLSA 1A7NL 2H3NA 1T2QH 1XGUA 4L8DA 1NLBH 5L6YL 5GGTA 1I7RA 4WUUA 5T3ZH 2Z91B 1N59B 3SDCA 3MRLB 3I9GH 4HS3B 4QRRE 1AO7B 1FNFA 1ZT1A 3ULVD 2BVQB 4KPHH 2HG5A 4BKLA 5B38G 3H9HA 12E8H 2QSQA 3BXNA 1YNTB 3QDMA 3UPAA 2BP3A 3PJSB 1CGVA 4S1RH 5H2BB 3ZSTA 3V4PL 5A16B 5C0JA 2XNAB 2J1KA 3STBA 4Z8FL 5AWNH 4FN0A 5EOTB 4Z7WB 1KEML 3HE6D 2VDRH 3QCTL 1K2DA 3MOAH 4Z7VE 3ZDYF 4RDQG 5DRXB 2I25N 4G6AD 2JB5H 1N4XL 2YPLB 4GRWF 1Y18A 5IMKA 4PRPD 3L7EA 1ZA3A 5FKAA 5C92A 2Z8VC 2BC4A 3PGFH 1K5NB 2XTJD 5F7KC 1FGNH 5DD5H 2EXYD 4PP2B 4JY4A 3KS0J 4H1LA 1KJMA 4WI7A 4JAMA 3AY4A 5JLZA 1BVKA 4KROB 4LAQL 3S5LA 3ZDXF 1KYOK 3MLVH 3CSYA 1CIUA 1SBSH 2NY6C 4OLEA 4P4RB 4HZLA 4YFLI 5DRZA 4JE4B 2E6QA 4GLRH 4N68A 3FAXA 5TQ0L 3U4AA 1OOAA 1F11A 1P84K 1NBVL 3AS1A 3BSZH 3GIVB 4OF3A 4RRPG 2XKNB 3N1MC 5EU5A 3WFHA 4PD4K 1FO0B 4OIIL 4NKOA 5HVHB 2BMKB 4OT1H 3VFOA 3S37X 1N0LA 1YMMD 1VFOA 1G7JB 4LQ1A 3MV7E 1Z3GH 1M6OA 4PLOB 1NC4A 2GJZB 5D72H 2PR4H 4U1KB 4APQA 1AR1C 3IDYC 3ZKSD 5K9JL 1KF9B 3RL1B 2MCPH 5D7LA 4H5SA 5CZVH 4PLKD 1NJ9B 1RIHH 5FYJD 3EYVA 4L4VE 1IGJA 3Q5YA 2AQ1A 2ZCKL 1QO3B 4JDTL 3BIKA 1BJ8A 4WEBL 3VD9A 3MBXH 4JJ5A 4MJID 1A5FL 4HHAB 4H0HB 4U33A 1IEBB 2DBLL 1T7WA 4WO4B 2A2QT 2I9TB 1FP5A 1TZHA 4QHMA 5C2BH 3V4UL 3AROA 3DJ9A 3VW3H 3MV9B 4XPHL 5I17B 3RZCC 4NO5A 3DARA 3E3QC 4XVSH 4D9QD 1CG9A 3HR5A 3ZE2F 4QHNB 4NJAH 1B88A 1NLDL 2HLFC 4JFDB 1DANU 3WSQL 4DKAA 4IOFC 2UYLA 1QBLH 3LVEA 1FYTD 1T66C 1KXQE 1OAQH 4KKAC 4S1QL 1UWXH 3PHQA 4G6KL 5F9AC 1A1OB 3C6SA 4P23B 5BQ7B 3TCXA 15C8H 1SHMA 4YAQB 2X10A 3RVVC 1LE9A 4KKBD 1P4LB 3GMPA 4M5YH 4ZFFB 2EYSA 3LOWA 1RUPL 7FABH 5SWZB 1EX0A 2CRYA 5BO1H 4TSBL 1FBIH 2R0KL 1R3IH 2UWEF 4JM2D 3SJVD 1Y0LA 4PJDA 4UTAL 4X4MA 3RU8L 1KGCD 2YR3A 3QDHA 1KN2H 1FVEA 4HUUA 1WFTA 1QSFB 3RGVA 1L7TL 1D6VL 2AJ3A 3QUKA 5F1OB 4QWWD 3MV8A 3WUWA 4TVPE 4GW1B 3HI1A 3T65A 5GGSY 3I6KB 1SYVB 4BH8A 2R2HA 3E8UH 4YHML 3QXWA 5DJZB 2CD0A 1Z9OA 4QF1A 3V6FA 5EC2A 3RPIB 1REIA 4HLZG 1Q9WB 4M1CD 4NBZB 3W2DH 5B8CC 3G6DL 5FKPB 2NY4D 3GSOA 2C1OB 4P5KB 3RWHB 3FZUC 5E4EB 1CFBA 1FAKT 4NQDE 1A3RL 1Z5LB 2MHAA 1YEDB 5B21A 5ITBH 2VAAA 2CRMA 4YR6B 2G5BA 2P42B 4XMPL 3LHPH 4C59B 2K9UA 1IQWL 4BZ1H 5M94B 1NDMA 1A7OL 3TNNB 1DTUA 1NCDH 4HAGA 1OHQA 3LN9A 4OCRH 4F9PC 3BWUC 2HYMA 3H3PH 1PEWA 4QHLB 5BV7H 1MJ7L 2P45B 2BRQA 3CCHB 4NM4H 2VIRA 3HNVH 4JFPA 1B3JA 1RZ8A 3M8OL 4X6EA 1N3NB 3MNZB 4AMKH 3BP4B 3HMXH 4X6CB 3SDCD 5J6HB 5CD3A 1AGDB 3G08B 5FEBA 4HT1L 1WT5C 4PLJC 3IDMB 3MRNB 5E8OB 1XH3B 4JJHA 1XGYL 4GRWB 1OARL 1KOAA 3BN9D 1NL0L 1Z0MA 4KJYA 1U8QB 2XWJA 3UXFA 3GMQB 4R2GC 3P30H 2J2ZA 4GXUN 4IDJH 3QDMD 5HHVH 5EUKB 1RURH 4NZTL 2XOTA 1FZKB 3BGFC 3BOVA 4NQVA 4N0UB 1I7UA 3RQ3A 4TOYH 4Z6AT 1YEFH 1SBBA 4PY7A 5T3ZL 1UENA 3CFDB 4LLUA 4B5EA 2J8OA 4TULH 2P8MA 2WWKO 3I9GL 1G7IB 3CXHK 3HUJE 2FD6H 2DWEB 1JV5A 3CH8A 3PQYA 4EEEA 5ANMB 5E08H 2DN7A 3DGGB 1VFAB 4XAWH 1OSPH 4UTBH 4WGWB 3UTQA 4IRSA 2V7HA 5LGHH 2FJFA 4S1RL 2X9XA 3OAYH 2BCKA 1AFVH 1T80A 1LD9B 5D1ZB 3TZVB 4MZ3A 4TNWF 1BREA 1T1YA 5AWNL 2A6IB 4Y2DC 3PWVB 3VG0L 5FHBH 4EI6B 1K4CA 3ILQD 2XY2A 1NANI 1DR9A 3FO2A 1P4BL 4ISVB 4DZBA 5J06A 1M7IB 4HJ0D 4IM8A 2JB5L 4JFED 4LF3B 3B6SA 5F7MC 1CD8A 1T20A 3KLDA 4NZUH 3ULUC 3MNWB 3O6KH 4XPTH 3PGFL 4AEIH 2E6JA 4U6YA 1WGOA 2MTPA 1KLGA 4RMQA 3HC0B 3C60A 3GMLB 4YHNA 5IBUB 1DQQB 1WCBA 3CJJA 5F89B 1CLOH 5TDNA 2IBZY 2FR4B 4YPGA 4G3YH 3W0WA 4X80L 1SBSL 1WV7T 2DICA 4OBSA 4N0CC 4BM7A 5D7LD 3DV4B 4KRPB 3MLSL 2P5WA 3MLPA 2XZQH 2FX8H 3B9KC 4G8IB 3IJSB 3G5XA 5E99H 4NN5C 1QFOA 1S5HA 3U0TA 1JGLH 3HKFA 2IQ9L 3H42L 4ZD3L 4NNXB 4OT1L 1TNNA 3H9SA 1CWVA 1HSAA 4OV6F 2YD5A 2AGJL 4M7KH 4K8RC 4WDIB 4CVZB 1EJOH 3RDTB 5D72L 2EKJA 1E0OB 1ZWIB 4PYHA 1CN4A 3V6OA 3QJFB 2UWEB 4YHIA 5IB1B 4NZDA 2MCPL 5CZVL 1F3JA 3MOBH 1RIHL 4R7DA 2V5RA 4PJ9A 5EDXA 5CBEA 1OGAA 1OTUC 4YJZL 5I71B 1L6ZA 1QZ1A 3MBXL 4K71B 1N0XH 3UBXI 1JCKA 2CKNA 1WBXB 3B3IB 1A8JH 3I84A 1HHKB 3ARQA 4PBXA 2X4PA 3VW3L 3S36X 3P9LA 1FLRL 3BH9B 1H9VA 4JZOA 1JYNA 3MYJB 4RISL 4XVSL 4Y0GA 5DI8A 3OJ2C 3SDAC 3L7FA 1P6FA 2ZSVA 3KPQA 2ZG1A 3PL6B 4P3DB 4GG6F 3X12B 1TVDA 3GSRA 2NR6C 3F8UB 4NJAL 3U1SH 1KT2B 5EWIH 3MRKB 3KXFE 4LVOC 2IQAB 3I50H 4K9EH 3WFBH 5F96H 4DW2H 3RGVD 5BJTA 1QBLL 5BMFH 2RB8A 1CFQA 1ROWA 3HZVB 1OAQL 2HMIC 3MV8D 3NZHH 2JF1A 3NIDE 3QEHB 3WYRA 5AG9A 4L29A 3IXTB 4KUCD 1FL6A 4RMSA 3L3DA 5LAXB 5DRNA 1BGXL 3GSVB 3ZYZA 4HUXA 3TH4T 7FABL 3UZEA 5CAYB 1DFBH 1FBIL 2CR3A 1QLFA 1R3IL 3C5ZC 4X6BB 3ZO0A 1KCKA 4LPTA 3WBDA 3VRIB 2VC2H 2WMPA 1N64H 4UDUA 1GAFH 4BFEA 1HN1A 5DK2A 3KPRB 1YN6A 4JDVB 4JZNB 2DQUH 3LD8C 2C7UA 1QRKA 5IMOA 4ORGA 5F9JB 3VGDA 4CU7A 1D9KB 5IIEA 2KH2B 3GSWA 2ZSWB 4Z7NF 1FNGA 4MD4A 4QOKA 4DTGL 3LDBB 4LARH 1NBYA 4AH2B 5F21B 3MLTA 5CEZD 1LNUA 4GAFB 4XC1L 5FDYA 5HJ3A 3HPJA 2Q7YA 1YDPA 1YNLH 4GAJL 4CW1A 3EGSA 4GW4B 4RGNE 5ACMA 4JY6B 4XCYB 4JGUA 4OLXH 1F90H 3OG4B 3K4ZA 1CD1A 1G7HA 3RVWD 3W2DL 4LSRL 5J1AB 5F3BB 4HV8A 4PJIF 2EE3A 4P9HC 4YZFE 2D7NA 1E6OH 1IFHH 4LFHG 1DVFB 3AAZB 3K4AA 2A6JB 1ND0A 1LDSA 4X83A 4NC1E 2QKIA 2VLJD 1CK0H 4MNQA 5C70A 5ITBL 3UC0H 2G2RA 4PJAF 3S34L 3QFDA 5KVEH 3LHPL 3MZGB 3QXUA 3VFTA 2X4NA 3OR6A 1C1EH 1NMCC 3QZWG 4BZ1L 3RWEB 3BPOC 2P4AB 4ONGH 4X7DC 5DYOB 2QADC 1HOCA 3WNPA 4X98A 1UH3A 3M17B 3SGEH 1NCDL 4RAHA 4EI5A 1AXSB 3U83A 3OKOA 3KYOB 3QIUB 1ZLUK 5H35B 3D87B 1JN6A 3H3PL 1TVHB 4PGEB 1INQA 4NM4L 5ICYB 3HNVL 1MCBA 2F5AL 4QRUA 3TH3T 3VI3E 2IANA 3S3PA 2IAMB 4PR5A 3CMOH 5KS9F 5ETUB 1H8OA 2OR7A 1OAKL 4AMKL 2A38A 2KQMA 2R0WH 3PQYD 3JVGC 3FB5B 4QRSB 4X0KB 2AEPH 3MGTB 4DQOL 1JK8A 1OW0A 2YUVA 4WU7A 4IRSD 1JHTB 4IDJL 1QP1A 1U93A 5HHVL 1DUZA 4XNMA 3WE6B 4P99A 4D3CH 1RURL 3FONB 1A14H 3PGDB 3GNMH 4YXKL 3QUYB 2VLLB 3QDJB 4RMVA 4TOYL 1MCWM 5TH2A 3MRDB 3NACL 2BSRA 1A6AB 4C56A 1JRHH 3WNKA 1C16B 3QUMH 5HGBB 3WDHA 4MNHA 2JKXA 4HIEB 2YPVL 2E27H 4W6YB 3QNYA 4J8RA 2P46B 4K3EH 2FD6L 1F6FB 1F6LL 1IM9B 3FQXA 5DURB 1YN7B 4DK3A 2Z31B 4XAWL 4UTBL 1JZ2A 4XP9H 4LFHD 2ITDB 3CFKA 3SY0B 5I1JH 4NRYB 2D3VA 2EDLA 1HH9B 2JK5B 1DN0B 3C60D 2AEWA 3RWCB 2QV2A 2VDOH 4Z18A 4U1IA 4FXKB 3W5NA 3OKLA 2JJWA 4MB5A 5FHBL 3W0WD 2ZUTA 3TA3A 3UZVB 2Y5TA 4PGDA 4KI1A 4XBPB 2P5WD 3EZJB 1BWWA 3RY4A 3MJ8A 2Z92A 3MJ7A 4XPTL 4AEIL 1S7UA 4NPYA 3U2SA 1J05A 1QRNB 1BF8A 2E9BA 5IVNA 3V7AE 3VFRA 4HCRA 43CAB 5J13C 1TZIA 4JRYB 3H9SD 4PJHE 4PJ5B 4GRWH 4M1DL 4KJQC 1J0KA 1QFPA 1WICA 1U8NA 1VFUA 3PUCA 1Q9OA 3FB7B 2F53E 3F6IA 3QRGH 1FFPA 1JJUA 1CI5A 3D18B 4WEUD 5IGXH 5J1TC 3UZQA 4HIIB 2D7PA 4IIQB 3VXPB 3JWDH 1FNHA 4BH7B 1D5ZA 5E6ID 1R24B 3MZTA 1RJCA 1T3FB 4KI5E 5GJTH 5H94A 1YUHA 1GH7A 4PJ9D 4F2MA 2XZQL 5EN2A 1U41A 1PQZB 4MGXA 5C0BB 3RIFK 1KIQA 2WBJC 4KY1H 2BZDA 3O8XA 2CK2A 5I8CA 5E99L 2YC1A 1F02I 3VWJC 3LPGA 5DJ8A 5IG7B 1JGLL 1HXYA 5E5MA 4PJ7E 4TUOA 4P2OC 4UQ3A 1K8DA 3VI4F 4UDTA 4YC2B 3ESVF 4M7KL 4NOBA 3SKNB 1B0GB 4FQ1L 5LQBH 1BF2A 3F58H 4BZ2H 4ELMA 1NC2A 3QQ3B 5IEKB 2G60L 3MOBL 4QXGH 3W9EB 4FFZL 2RCSL 1S9VB 3PV6B 5DF0A 3EDJA 4L9LC 4YLQT 3T4AB 3GGWA 1U8MA 1JGDA 3ARDB 2EDFA 5HVGB 3HG1A 2Y72A 3LEYH 2EE9A 1A4KB 3K3QA 3MRRA 3B2VH 3GJEB 3QUZA 4ZUSB 3D0VB 3STZA 1FNAA 1JNLH 5F88A 5DMKB 4P3CH 1X5GA 4WHTB 3WLBB 2VABA 3R1GL 1XR8A 4S0SD 3U1SL 1HDMB 5M95B 5EWIL 4QXTA 4PJIB 3O45B 4M9OA 4ODWB 1T21A 3WFBL 4JY5H 5DEGA 4Z78A 5GGVH 5ADOH 4YWGH 4KK9D 3P73A 5BMFL 3UTSA 2A6KB 2Y7QA 3SE3C 4WY7H 1MVUB 1XR9B 1JF5A 3O0RH 2Q3ZA 4G9FA 4NC2B 4HKZA 4PJAB 4QOKD 4Y8AA 1INDL 4Y4FB 5I75B 2EYRB 4M7LH 1OP9A 5IMMA 2IBZX 3QUXB 1ACZA 1K6QH 4N0YL 5JXEC 1JGEA 2V2WB 4ZMAT 4WWID 3G04A 4X8JA 1BMGA 2R69H 4U1NB 2BSTB 1DFBL 2HFFB 5CGYC 2J88H 5I66B 1FO0L 2X41A 5ID1B 1IC7H 3CDGB 2VC2L 3EDFA 2Q8AL 1N64L 4OD1H 5D93B 1MAJA 5GRZA 4G6MH 1I1AB 1UWEL 3HAEA 5ACZA 5DRWA 4LGRB 3PABA 5L2JB 3LSOB 4MNQD 5MENA 1AE6H 1G6VK 4P2YA 1PZ5B 3FFCE 1Q94A 4PJFF 5IJKC 1U95A 3ARGC 4UUJA 4YO0A 5E2TH 1JL8A 4F58L 3V4VH 2AJUH 3QXTA 2CXKA 5D9SB 3O4OB 1YNLL 4JPIB 4JLRA 4EI5D 1RVFH 1ZHKA 5ILTH 5ITFB 4OLXL 1F90L 1AGEB 1WZMA 5LGJA 4ZDHB 1JPGB 1FZMB 4I2XB 3VD3A 1E6OL 1IFHL 3QBTB 4FQHA 3FCTA 4L8SA 4MAYA 1Q8MA 3LRHA 3MACL 4MAUH 3KLHC 1QBBA 2NPLX 3BI9X 3G6AB 3L3OA 4PRPB 3P9MA 1C1EL 4Y5VA 3ZZ1A 3OJDA 4ODVH 4ONGL 2FH6A 2OJZL 1RZGA 1HIMH 2DLEA 3HZYB 1R3JB 3CPLB 2XTJB 32C2A 2YD3A 5KS9A 3PXHA 1NAMB 1QBMH 4XPAH 1Q0YH 5I8KL 3BP6B 3SO3C 2O5YH 3D48R 4NP4L 3H6JA 4J3WA 5I30L 5GGRB 3DBXB 3D2UB 4HEME 4F3FA 4C56D 1IGFH 4FQCL 1SMAA 4JZJC 5F1SA 4DCQB 1I7TA 1S78C 1LWRA 2BFVL 4PGJA 4ODBD 3ESUF 4ZOCA 4PS4L 1VCAA 4RGOL 5DFTA 2X9WA 2AEPL 3MRQA 1Y6NR 4NQCD 5FYLL 4PTUA 1YMMB 4D3CL 3OMZA 1CE6A 1F4YL 2WNGA 4M7JH 1A14L 4GKZB 1TVBA 3VD7A 1XCTA 2VISA 1EEYB 3GHBL 3U30B 4BFIB 1NDGA 1ZLSH 3QUML 4Y4HC 3MSPA 3SGKA 4GJTB 2E27L 3TA3D 4O02L 2KBGA 3B5HA 2FZ3B 2JTDA 4YNYA 4WIQA 1F2XK 4HUNB 3ZDZF 5D6DC 4MJIB 3FKUS 3NCYS 2BVPA 4XP9L 1U3YA 3F7YA 5I1JL 1M7DA 1FFRA 4DFHA 4J6RL 1L0YA 4N8VA 3IFLH 5HGHB 4PJGB 4EUPG 3K74B 3LKNA 4QT5A 2APWA 2VDOL 3PP3H 4KV5E 4Z76A 4LSTH 1OP5H 4ZFOA 4QHKI 1EH9A 4Q6IC 1TENA 3MCKB 5HYIA 3VFSA 4OLYH 4PBVC 2LTQC 1FYTB 2NNAB 3O3BB 3OKKB 3WIHA 4NCDA 3ZE1F 2CQVA 3GSQA 3BO8B 4RGNC 3OF6A 4PB9H 2R1WA 2FSEA 3HZKB 5C6TH 4N90D 4LCWD 1NGYB 4I13B 1G7QB 4S1DD 4OF8A 2W59A 3G9VA 4OIAA 4NC1C 3P4MB 5GS2D 4FFYH 3MA9H 3MJ9L 5J6GA 3SJVB 4PJEA 4UV4H 1J1OH 1S8DA 2PO6D 3PDGA 5LGKA 4I9WD 5FOJA 3DIFA 1LEIA 4JFYB 3V95A 1NC2D 1CXLA 1DUYB 5FV1L 3I6LD 4L3EA 5HYFA 4KAQL 4F9LC 1Z0NA 1OAZH 4LOUD 2AJZB 4MD5A 1W72H 5EUOB 3HG1D 4G42A 1FFNA 3GM8A 4IMLA 5BZDB 1SJHB 3QIBC 3QUZD 2OXHA 4PB0H 5J3HD 5HHMD 1T0NB 4DUWA 1T1XA 5T1LA 1ZK9A 4FABL 3EFFA 2DD8L 3F58L 3HZMB 2E9IA 4KU1A 3FQNA 3J7HA 4BZ2L 2YPKA 2ZCLH 1EBPA 3WO4B 3LRSA 3CNKA 1L9MA 1KELH 5D8JL 1S7RB 2F19L 2CLRB 4NIKB 5D2NB 4G9FD 5CIPB 5EOCJ 2LU4A 5F7DA 5K93A 3RUGA 4OM1H 4PJFB 5J57B 3RNQB 1A1NA 3B2VL 2WQRA 3NA9H 2ZKHH 2YEZB 3MO1A 4BQCA 2GT9B 1XF5A 1JNLL 1MNUH 4NCC1 4P3CL 3NFSH 4JRXE 2IFGA 1UYWH 3QPQC 1YJDL 4L4TB 5E2UH 3DO7A 1I7RB 2ADGA 4F57H 3GHEH 5TF0A 4NN6B 2WINB 3ULUF 5KSBE 4X9IA 3CDCA 1R0AH 5MEND 4WY7L 3O0RL 2FEEL 3BPNC 2MQ0A 4I3SH 4J3OC 3HB3C 5HPMB 3UTTA 2R8SH 3KGRA 2HG5B 4BKLB 2R0LH 1PLGH 4G8FA 4WI3A 4M7LL 1J9CT 1K6QL 3RFZC 4FQIH 2Q1EA 3Q1SL 4LSVL 2AK4E 2IH3A 3TIEB 5HDLA 2I27N 1CGWA 1GCFA 4FQQB 2BOCA 3ZL4L 1RUKH 1C5CH 4YDIH 1OAXH 1MCPH 1IC7L 3QQ4B 3QQ9D 4JPKL 1BHGA 4CU6A 2GJJA 1NCUA 3GSNA 3OXRA 1DCLA 1JGVH 4MAYD 4N8VG 3W9DB 3QISA 3MXWH 4HUKB 4EUPH 3DX7A 3GK8L 5I1IH 5D7IE 3Q48A 5L8KB 1MIEL 5IMKB 3CFEA 4OGXH 1SVZA 1I9JL 3V6ZB 5CJXA 5E2TL 1U91A 3U46A 4BK5A 4MQXC 3V4VL 2AJUL 1J0IA 3B83A 5D6CB 3WKML 4PJXE 5I0DA 1EMTH 1RVFL 5ILTL 1A9BA 4H1LB 1KJMB 4JAMB 3FO1B 43C9B 2AEIT 5JLZB 3WEXA 4KI5C 2J6EL 3IRZA 3HMWL 3S5LB 4Y5XC 3RWJA 3RWIB 1FORL 3CSYB 3MLZH 4HZLB 1OTSD 4EIZC 5CJ5A 1PSKH 4JFEB 5E00A 4Z0XB 3VE0B 5K9KB 1F11B 3DV6B 4TVSa 2HTLD 4ODVL 4OJFL 1HIML 5EU5B 3S35H 3WFHB 3BEWB 2FIRT 4NKOB 1OT2A 1QBML 2YD7A 4HKJB 1Q0YL 3VXUA 2O5YL 1F2QA 4ODXB 5F7YC 2BOBA 3SGDH 1X5IA 4JPWH 1S7WA 3FB8A 4P46C 2VB5A 5T1KD 2R2CA 2Q3AA 3DETC 3BX7C 4NQTA 2CDGA 4H5SB 3MRPB 5GGVY 4LLQA 5TE7H 3EYVB 1IGJB 2V5YA 1RHFA 5C7XH 1CR9L 3GFUA 3BKCL 1JWSB 1YC7A 3RJQB 5MERB 1XF3A 3TEUA 1X7QA 3MLUL 3QHZH 1BD2A 2I07A 4BFGA 1HH6A 1SEQH 4KDWA 3UX9B 4LSUH 3Q5OA 3BD3A 4Z7VF 1CF8L 3ZSSA 2D7MA 2IG2L 1MCJA 4PRIE 4M7JL 3ECBA 1VHPA 5I15H 4LP5A 3QHFH 1CG9B 3C6LC 3HR5B 1DEEA 2Z35B 3ZYJA 5LJYH 1O7SA 4XRCA 3OJMB 4QY8A 2WW8A 2P8PA 4KJPD 5C8JB 2HLAA 5B8CA 3HNTL 1CL7I 1YEJL 1W8NA 1MRCL 4NWUH 1IM3B 1QNZL 2UYLB 4URTB 4D8PA 3PHQB 5JA8B 3CMGA 2NY5C 3C6SB 2BRRH 3OKDA 3OF6D 2GUOA 4LVHC 4R2GB 5JHLH 3SBWC 3S98A 3D39E 1LE9B 3GMPB 1UXSA 4ZAKC 2EYSB 4FFWC 1U8LA 4JHWH 3H2WA 4J4PC 3WD5L 1IT9L 4MMZC 1T04B 4PRAB 4LSTL 5I9QB 4PJDB 3CXDH 4PRDB 1T22A 3DXAA 3QNXA 4XNUL 3IDNB 3O2VL 1FVEB 4OLYL 3L1OH 3Q6FB 5ELIA 3QUKB 4M1GH 5JMOC 3MV8B 3QIWA 3FT3A 3F7PC 3WUWB 1IC5L 2NY0D 4PB9L 1VENA 5GRYA 3OPZH 3BT2H 1AQDA 5EZOH 2R2HB 5SV3A 3QI9A 1MJJB 3ARBC 1S7TA 5HYSB 1MLBB 3HE7D 3NCBB 3V6FB 4XNQA 5D2LA 2J8HA 3WFEH 5EC2B 4ONHB 4H0IA 4HC1H 4L4JA 4D2NA 2RJMA 2R0ZL 3BKYH 3MA9L 4JO3L 2V2XA 1RK0A 3C5SA 1J1OL 2XZAL 3G5VA 3GSOB 3I3EA 1QFWM 4LHUA 3O6FC 4Q9BA 4POZC 2VAAB 3JWOL 1XGTB 3BISA 1D5BA 3X11A 2Y4SA 1IBGL 3LN4A 2YN5A 1OAZL 5DD6A 3QFJA 5CZXD 3S4SA 5ICXA 5GRWA 1N5AA 4ZUWB 5CUSH 1DE4A 4MVBC 5AYUL 4BSVA 3KPMA 1B0RB 1MHEB 4WVRA 4KVNL 5KG9B 4KJWD 4X9HA 1H5BA 4MA8L 2Z8WC 4WU5A 1W0WA 4XVTH 1ORQA 4G43A 3TBWB 2WWMC 1RZ8B 2N7BA 4X6EB 5C08A 1UFUA 2ZCLL 2YMXH 2EO1A 2EC9U 2VLJB 5ESVA 4C4KO 5CD3B 2VE6B 3TT1H 4D9LH 1NEZA 1ED3A 4FXGA 3GKZA 4LCUB 4Z77A 4OM1L 4OGYL 4KJYB 2XWJB 5C0CA 1LP9E 1UZ6E 2ZUWA 3NA9L 2ZKHL 1TZGH 1HILA 1MNUL 4JKMA 2PCPA 3DSFL 3IFPB 1F45A 4F15C 4LCCC 5MHSE 4E41E 4F57L 4F8TA 4P4KC 1CFNA 3FO0L 4KK6D 3EDDA 1R0AL 4GO6B 4HDIA 3EOYG 4LBEA 1GHFH 3VRJA 1I3GH 4OQTA 2R8SL 3PQYB 3A6OA 2R0LL 3VFMA 3BRGC 2WUCH 3UTQB 4IRSB 1CGSL 1P4IH 4MQ7A 5BRZA 4JFFA 5JQ6H 1IZJA 4FQIL 3B9KA 2BCKB 4BSWB 5GS0L 1M1SA 1UEMA 3UTZB 3EYUH 4PJ8C 2PYFA 5FUOH 1RUKL 4ZXBA 5HBBA 1C5CL 1MCPL 4LVOB 1WAAE 2QSCL 2EDRA 4XI5C 1K4CB 4LLAA 1BX2B 4JN1L 5HD8C 1HXMA 2L7UA 3MXWL 4OAWA 5C09A 1DBAL 2X4UA 4ZS7H 3B6SB 4LSDA 1T20B 1IEHA 3O3EA 3ARWA 3TFKC 2AJYH 2V5SA 4V1DA 3FT2B 3SPVA 3T2OA 3SE9H 1PYWA 4XMKH 1KLGB 2ICEA 4X6DA 3C60B 3DUHA 1EMTL 1UCBL 4XPBH 4Z7VB 4Q0XL 4UNVA 5CIPH 4YHNB 4M8QB 1U8HA 1WCBB 2FLRT 1WBZA 5EU3A 1U8JA 1ZEAH 1WJ3A 5TDNB 5DJXA 4UT7H 3LD8B 4U2YA 3V52H 1BWMA 2CLZA 2NY2D 4ENEC 3ZTJH 3L5IA 4HFWB 4CVWA 5C0IB 1PEZA 4GBXA 3L3JA 2Q7NA 4OUUB 2RFXB 1PKQA 4OZHE 4XNYH 5D7JC 5LG1A 5IT2H 1BD2D 5DJ0A 1VACB 1KULA 3L9RA 3S35L 1G6RB 4UV7H 3OB0K 3ARFC 3HUJF 2YA1A 4LHUG 4PJCA 4QRPA 5DZOA 1UJ3C 2UY6A 5JUEH 1JNHA 1JTOA 5IVOA 1E28A 1S9XA 3OXSB 1SEBA 2NZIA 2OR9H 2GITA 2ICWJ 4OD2B 3K8LA 4KK5D 4KKCC 3H0TA 1CFSA 1MRDH 4YHYB 3WNLA 2XFXA 5TGBA 1J12A 5E6IB 3RTQC 5E4IA 4Z7WE 2AK1H 2OBGA 4R7DB 4PJ9B 1NMCB 2X09A 5C7XL 3CXHJ 4QTHB 1WZKA 3HNSH 3OKNA 3FZUD 1CS6A 3NAAL 2YPLE 1SEQL 4LSUL 2VZSA 2X4PB 3ULVL 4XB8A 5JZ7C 3BHBB 5DJ6B 4LKCA 5F7UA 5IW6A 4L4VB 3A6BH 5I15L 2ZSVB 3QHFL 2VDKH 5L7XH 3EZ8A 1CD0A 2ZCHH 5IBLD 1Y6KR 3MUY1 4MNGE 5FA3B 4HG4J 3RY5A 3DXAD 4NBYB 5DDHB 1XF2A 4NWUL 5BJTB 3QEQD 5F44A 1CFQB 1CTNA 1PX3A 3OR7A 3QIWD 2BRRL 5EC1B 4PGCB 2ARWA 4YDLC 3LKQB 4J3VA 1FNEB 3V9FA 5JHLL 3QI9D 4L29B 1FL6B 3L3DB 5DRNB 3QQNA 4HXBH 4JGMA 2J8UB 1A4JA 4LLDA 4RSVA 4TUKH 4UOJA 1I3RB 3GM0A 4B50A 3CC5A 2AV7A 1QLFB 1WUNT 3GZKA 1XZ0A 2ICWA 3ILPB 4HD9A 3AGVA 4EVNA 1NAML 2BNUB 4OFVA 4W4OC 5CP7A 2W07A 1QLEL 2FHFA 3L1OL 1T1WA 3IDJB 4KQ3L 3HS0A 4ORGB 2CIIA 3OAYK 4M1GL 2RGSA 4LNRB 4J3SA 4OZGB 3BFOA 3V2AR 5IIEB 3GSWB 1XCQB 4EBQH 3AB0B 4LPCA 1AHWC 1OAUL 4MD4B 4QOKB 2P8LB 1J10A 3OPZL 5EZOL 3GMNB 1KNOA 4I18C 3QFJD 1NBYB 3PP4H 1LNUB 1BJ1J 5SWQA 1YDPB 4CW1B 3EGSB 3WFEL 1T5XB 3ME0A 4FHBD 4HC1L 4XPGL 1T5WA 4NKDA 5TPWL 3WJLA 1T89A 4K2UH 4HV8B 3SN6N 4HIXH 2HWZL 5FYKD 1ONQA 2BXYA 5C08D 1ZMYA 1ND0B 4LL9A 4GS7C 4M6AA 3KJ6L 3CU1A 4PTTA 4JFDE 2X5PA 3QFDB 3MX0A 1IGIH 2X4NB 3RBSA 3OR6B 4J1UB 2FHCA 1EGJA 2FLBT 4A6YA 4JG0H 1HOCB 2PF6A 4X98B 1XAUA 2H26A 5CUSL 3MV11 3T0DA 5C0CD 4R96A 2DLIA 5F7WC 4ZTPH 4EI5B 2YZ8A 3NIDF 4LSPH 1VSCA 3JXAA 1KBGH 2WBWB 1NBZA 5JOPE 5SWZE 2F8VA 4NO0B 2NY3D 4XVTL 4X4YA 4NO2A 4LRIC 3PDOB 1NKRA 5HDBE 4PBWD 3PG2A 3MROB 5EBMB 5E8DH 5DD1H 3TT1L 3INUH 4D9LL 3NMEA 1QSFE 5D7SH 1R5IA 5IB5B 5FYLE 4FQLH 4PRNB 5IROC 1JK8B 3D25A 2WWKT 5BRZD 4JFFD 1U93B 1JHLL 3B9KD 3LQZB 4YIQA 3NN8B 4ZXBD 4DVBA 5TH2B 4WFFE 5F7EH 3RIFF 3VFUB 4H8WH 1F58L 3GSXB 5GQBA 1JGUH 4FS0A 1GHFL 3QH3B 4YZFF 2DTMH 4OV5B 4WW2C 3FQXB 4WWKA 2QLVB 5GGRY 2ZUYA 1GJIA 4DN3H 2Y07L 2CIKA 5I1DB 3GSUA 2WUCL 2DDQL 4V1DD 3TBTB 4NQCB 1P4IL 1OLLA 1N6VA 3CFKB 3ULUH 4H0GA 3VWJA 1NCAH 1CLYH 2P24B 3HPLB 1OQOA 3T3PE 1NSNL 1KEGH 2E6PA 4U1IB 4N8PA 4X7SH 1AXIB 4BUHA 4CMMB 4NKIH 4P2OA 2BHYA 1NFIA 3GJFK 3NPZB 3RVTD 4PREB 4W81A 4MQTB 5CLWA 5D70H 4X6CE 3ZKXC 4C58B 2NY1D 3TC9A 3OKYA 1RZKL 1VADB 4GBXD 3VI3F 4HGWA 2HVKB 2AJSL 4OCWH 2Z92B 3NGBC 5TDOA 3SE9L 1FVDA 5GRJH 3VFRB 4TTDD 4QRPD 4F7TA 1TZIB 4M7ZC 1WK0A 3E6HA 3NOIA 3C08H 1U8NB 1MH5B 4BFBD 4RIRA 4IS6B 5I1HL 1ZEAL 4OM0L 1FFPB 4KQ4H 1KFAH 2BXZA 3MRCA 4UT7L 1MAMH 3V52L 4K8RH 4JFZH 1I1RA 3QWOA 4HWBA 3WO3B 1D5ZB 3VWKC 4J2XA 3P4LA 1DQMH 1YUHB 2RAMA 1VB9A 5IB3A 5EN2B 1WC7A 5LBSH 3IJYB 4AEEA 1ZANH 3IGAA 1KIQB 5GGTL 1S9YA 2V9TA 4PRHE 4XNYL 5D7KD 5I8CB 1GGCL 2YC1B 5T33L 3TV3L 1AKJD 2Z8SA 1E4XH 1NUGA 4LCWB 3O4LA 5ANME 4CNIB 5IHZA 1EFXD 5E5MB 1FGVL 4TUOB 1G9MH 5J12B 1PAMA 5JUEL 5C3LD 1K8DB 3DUUA 3D9AL 4UDTB 2KPNA 2OR9L 5FECA 2D31B 2W0KA 1K4DA 4M3KB 3ZHDA 5JXEA 2PO6B 3GIZH 3TO4C 3KPSA 4FQPA 1VGKA 3KYNB 1CFVH 2B5IC 4O5LL 1DQJA 4X5XA 2AK1L 3LIZH 4NKQB 5SWSE 5HI5C 3UJJH 4KHTL 4B7LA 4N1EA 4LLWA 5A2JH 5IESH 3H9YA 3HG1B 4FRWA 2W92A 3SO3B 3DRQA 3BEVA 3DO3A 3F62A 1ZHLB 1YPZE 4LVNC 4O4YH 3BYYA 2QADD 5D71H 4WNQA 2VDKL 5L7XL 2ZCHL 3VFPA 4G7VL 2XI9A 2DYPA 3EO9H 4EDXB 1A6UH 3OZ9L 1NGZA 1T21B 3RWDB 5DEGB 4ODTL 3IT8D 2JIXA 4PJHF 3P73B 3ZE2E 4UU9A 5HI3C 4G9FB 2K3TA 3MRJB 2X4SA 3MMEA 5BZWA 1SJEA 4P57A 5FO8A 2M1KA 2PXYC 3MBEA 3KXFB 4HXBL 5IMMB 1UB6A 1XFPA 4AG4H 5F97E 4KI5F 4F80A 5C0ND 4PP1C 4FA8A 1JGEB 1TTUA 1R5WA 4L8BA 4TUKL 1UEYA 4X8JB 4YGAB 2FB4L 1ZTXH 2A77H 2IADA 1SYSA 2ZG2A 3I85A 2W65B 4JFHE 4PJBE 3HAEB 4PJ7F 3UTOA 5MI0C 4DJMA 5ACZB 1A1MB 1MHCB 2APBA 3PABB 5MENB 3IU3A 4FNLL 5GRVK 4OKVB 2AQ3A 4EBQL 2OCFD 2OQJB 3TPUA 5I8EA 4MCYA 2H2SD 4E42B 2AXFB 3PP4L 3DPBA 2OYPA 3EKCA 1IGMH 3WLWC 1P53A 1G0DA 1ZHKB 4HMDA 3AREC 1BQLH 3SCMC 1TCRA 3FN0H 1XIWA 4XCCL 4R7NA 4HIXL 2GTZA 2X70B 3PGCA 4FQHB 1WFOA 4I48A 2XA8L 4QXUH 4MAYB 1T1ZB 4NZJA 1QEWB 4X7CC 1C5DA 4RGNB 1JNNH 3TJEH 4Y4HA 4WHYG 2HTKC 3P9MB 4KZDH 2H9GA 4Y5VB 2GSIB 3CDFA 3FOMA 1G7LB 4JG0L 1QHPA 32C2B 1NCNA 5DS8A 5IVXB 5JORA 1KCVL 4LSPL 4Y16A 2GJ6A 4WTZG 1S7VB 3V0AC 1KBGL 4GQPH 2EO9A 4MD0A 3S9DB 3D5OF 4HQQH 3MNVA 5D1QB 1U6AH 4OFDA 4JFQB 1MIMH 3AMKA 3TBVB 5DD1L 5GZOC 3INUL 1QLRA 5HHPB 1PG7H 3NCEB 4YHPB 4JGJA 4ELKA 2VXQH 1NAKH 4WWKD 4P2QE 4OZIA 2VNCA 1EHNA 3DROA 5JR1H 4IBLT 2BSED 4KROC 4FTVE 4B0MM 1E6JL 3UDWC 4JM4H 1TVBB 5HSFA 4JQXA 3ARUA 2VISB 4NFCA 1AY1H 4H8WL 1VKXA 1URLA 2VUYA 3BW9B 4P2OD 1TQBB 5I76B 2EH7H 3FB6B 1FAIH 5T1KB 3RVXD 3K2MC 1RIVH 4OZFB 1QSEE 5CD5C 3I6GA 3IDUA 3MCG1 4YNYB 1DJSA 2OJEA 5IW1A 4RX4A 1JUFA 5J9PA 1ZXQA 3VXRA 2DTML 5DEZA 4NO3A 5HVHC 2OM5A 2DWDA 4AIZA 4DN3L 1CL7L 3C5JB 5IP4A 2AEQL 3LKRB 5FA4A 1S9WA 1M7DB 4MJ5A 4J3TA 1NCAL 4LLVB 3NFNA 1A7PH 1HQRA 4H88H 4QT5B 3GMRA 1KEGL 1PVHA 5CEZL 4NKIL 4MA7H 1CBVL 2H6PA 4HWUA 3KYKH 3C8DA 2MPAL 3QO1A 3QO0A 1IJ9A 5IFAH 4FQ2H 5KVMC 4EKXA 5C0DB 4NWTL 5C2UB 1EAJA 1OWRM 4OCWL 1G0XA 3K81A 1KIPA 5FM5M 1XGQA 1ZOXA 1IAII 3QG7H 2GW5A 4LPYA 1KB5A 2C3WA 3O4LD 5E2VL 5MEOA 3QJHB 4QCIA 5GRJL 5FB8A 4MA3A 1MCIA 4HWEH 1U92A 4FXLA 2DQGH 4OIBA 4XZUB 1ORSB 2L4OA 3KDMA 3C08L 5IB2B 4NRZA 4PJEB 4TRPH 5C0EA 5JXED 4KQ4L 1S3KH 1MAML 3KPSD 3FOLA 4UIMB 4JFZL 3ROOA 2V7NA 4UT6H 2XIDA 3T8XB 4AEFA 3RIAK 1DQML 1C08A 5ESAA 3V7MA 5LBSL 4YQXH 2NY0B 1GC1L 4CVUA 4LDOB 2CDFB 1DDHA 4MD5B 1E4XL 5EIVA 2IMNA 4G7YH 4G8GA 1JFQH 3MUZ1 3HE7B 1FFNB 4IMLB 1DN2A 1MFDH 2OX5A 3CLFH 1G9ML 1FZJB 1UZ8A 4WHYH 4Y5XB 4ZUUA 2ZOKB 3GBNL 3GIZL 3EFFB 4HIJA 2PTTA 3FQTA 5EIIA 2DYPD 1FIEA 4LLYB 2YPKB 5CBAB 5C0GA 5I1GL 4X7TB 8FABB 3LRSB 2JIXD 4J3UA 4PJ7B 4XNZB 2APVA 1H0DB 1QVOA 4KV5F 3LIZL 3UJJL 5EA0L 1KLUA 5DMGC 1ES0B 5MEQB 3RUGB 1OL0A 4HJGB 4Q2ZB 4JQVC 3MBED 4Z9KB 1S9KC 4H20L 1HHGA 1H3WM 3MO1B 1XF5B 1QRNE 3A6CH 4GXVH 5D71L 1N6QL 3B8YA 2CR6A 3SE8H 3EO9L 4X4XA 3ETBF 4OLVH 5I74B 1KCSL 4CVXB 2FBJH 4U1LB 3O11B 1UWGH 4QRQB 1QQDA 3KYMA 3FQRA 4UNUA 1B6DA 1FCGA 2Z93B 1T03L 5EO9B 1BFTA 4LSQH 1ZGLP 5A2IH 1CGTA 4ALAL 3L5HA 4YHOH 5C0BE 5HYJA 2CGRL 1IKNC 3SDDA 2ENYA 1D6EB 5CEYB 1LEGB 5JIKA 1YEKH 3C8KB 2IH3B 4XX1E 5DEFA 1S7QB 5E2WH 2ZOLB 1ZTXL 3PWPA 2FL5B 1ZLUH 1I4FA 1G6RL 4CN4A 2A77L 3RRQA 1XIWD 5AZEH 3GSNB 3OXRB 4YDJA 5KVGH 3L5WA 2DIJA 4N5ED 3VDCA 5DUPH 3DX7B 1WQVT 5DMIL 3HCVA 1RJLA 1B6UA 1HKLH 3CFEB 3PP3K 1KPVB 1ZHNB 4ZOBA 5IVZA 5C6WH 4JHAL 3AM8C 4FZEH 2B0SH 1N26A 4JPVH 3CVHB 1JHKH 1BAFL 1JYVA 2FJHA 2Q76B 1PZUB 4K3DL 5L2KA 1A9BB 3VH8A 1AC6A 2NY7H 1BQLL 2CPCA 1NGQH 4Y16D 1ETZB 2GJ6D 5DVMA 5C07D 3W39B 1MREH 4XH2A 2C3XA 3FN0L 3UCRA 1GVIA 5JW5A 3ZKQD 5E1AA 5CP3A 4OZFG 2VSDA 4QXUL 4P5MB 3QEGL 4R4FH 4YGVA 3VXMA 5T1DL 4KKLC 5IQ9B 5A3ID 1JNNL 3EHBC 1YYLH 2XACC 5TFSH 1CDBA 5IK3B 5EB9A 1J0HA 5DSCA 5EIQA 4KZDL 1O0VA 3VXNA 1VERA 4PJAE 2ESVE 5HHOD 1IGYB 2XQBL 3O41A 4PY8J 3P0GB 5D1ZC 5J56B 3TZVC 5KSBF 5I0ZA 1L7IH 5DUML 1TJGH 5HHNA 2L0DA 2FIKA 3I2CH 4R4NC 1ADQH 2BOBB 2DKUA 2VLMD 1J8HA 1FPTH 2BVUA 1FVCB 1MQ8A 1EEZA 4J4PA 2D9QB 3KHQA 1MHHA 4MDJA 4JO1H 4GKNB 3PWJA 1U6AL 2NY2B 4ZO6A 5KAQF 4G80A 1MIML 4XTRD 1WBYA 4NQSA 1RZIA 3NFPA 5T1MB 1PG7L 1WTGT 3H7BB 1YJDC 1J1XH 3U7YH 4W68A 2NX5D 3VXRD 3ULVE 1X7QB 4C83A 3E2HC 1BD2B 1NAKL 1M71A 3N1PC 1HCFX 1TTFA 3U9UA 2DRUA 3Q3GA 5JR1L 1WVZA 1GOFA 5D7IF 2IPKB 1SQ2N 4JM4L 3NH7L 2KKQA 3STLA 5FDWA 3QSKB 4ZTOH 1DEEB 3LQMA 5LWYL 4XRCB 3TH2T 4RQQB 1FAIL 2P8PB 3B9EA 3V7AG 4IMKC 4PJXF 3KPPA 4QYOA 1HYRC 2LQRA 4Y1AA 2EDOA 1H3GA 3OV6A 4D8PB 4JHBA 2AJVH 2XN9A 1KXVC 1H15A 5F3HA 1A6VL 3TIDA 4KXZH 3LEXB 3K1DA 3HC4H 2GUOB 1A2YB 4PRPE 4AZ8A 1MJ8H 3KPLA 5ADPH 2BDNH 5FAAA 1Q9LA 2XTJE 3WJJA 2F15A 4EDWH 1A7PL 4H88L 3P0VL 3V79C 1P7KA 4LCCB 5AAWA 1OB1A 2VLRA 2XQYK 3EOTH 4XGZA 3OKMA 2Q8BH 3DXAB 2JJTC 5I71C 3F7QA 1HZHL 2E3VA 4K71C 3QEQB 5IFAL 2YXMA 3BH8A 3IKKA 4HXAL 5FO9B 4XXCA 4YHLH 2PTUA 3OL2A 3B8SA 5GSVA 3QG7L 2PW2B 4JFXA 3V5HA 1BQSA 4KTEH 4G8GD 3FRUB 4PJ8B 5D2LB 2NLJB 1MWAB 2DQGL 2KDGA 2VL5A 1ITBB 3C9NA 1YMME 3DX8A 5B39A 1RK0B 3C5SB 4TRPL 2R23A 4U1GC 4CRPA 5GGQL 1NUNB 3MRGA 5DJCA 1IGTA 1A7RL 1BFVH 5I1EH 3REWA 2Q87A 3T77B 1C12A 1RJYA 3P0YH 4MWFB 3VH8G 5C0FA 5FYJE 1CLZH 4HUWA 1B4JH 3Q5TA 1D5BB 1IC4H 1PY4A 4MJIE 3QFJB 2JCCA 4OZFH 3RVUC 1KB5H 3LQAH 2MFNA 4G7YL 1JFQL 1MCRA 3ZYIA 3JUYA 1MFDL 4BSVB 3CLFL 2SEBA 3HLAA 1KJ2A 5E8NA 3RJDA 1IKFH 4PJGE 4D9QE 3P11L 3MRIA 3GUTA 4YX2L 2LAGB 1ORQB 1MVFA 4AENA 3MRHB 5SX4H 5C08B 1D9KC 1U9KA 4RCAA 4WW2F 1X5KA 5HI4D 1Q9KB 4U6VH 3MA7A 3LDBC 1NEZB 1ED3B 1OP3K 5DT1H 4KVCL 5I1AA 1FYTE 5EBWB 5TF1L 3TBSB 5D96B 4Z77B 3R06B 3BZ4B 4X4ZA 4GKOA 5L0QB 3FQUB 1NCCL 3CK0H 2E7HA 5HYJD 1DQDH 1UJ3B 3SDDD 5C0CB 4AL8L 1PGRB 2ZUQB 4IDLA 4JO2H 1HILB 3JZ7A 2VXUH 2IPUK 4GXVL 1MI5A 4OKDA 2PCPB 5B4MD 1I8IA 1DVFC 3BIAX 3PWPD 3F6LA 1SJXA 3SE8L 4D0CA 2NY3B 2FWOA 5D5MA 4OLVL 3SJVE 4HCRL 2FBJL 4P3WA 3W81A 5MEPB 4TYUA 1UWGL 1KGCE 2X6MA 2EEAA 4NQED 4HDIB 4LBEB 1ERNA 1HYSC 1DANT 3VRJB 3IVKA 3QPXH 4YHOL 3VA6A 3D3VA 2BK8A 5BRZB 4JFFB 5IOPA 5EUOE 3I02A 3CX5K 1ZGLA 5D7JA 5E03A 2YSSA 1V8HA 5L2KD 2IAMC 1VPOL 3EYFA 4YPJA 5C0AA 3RL2A 4CJ0A 5FCUL 4HAFA 4J7RA 1U58B 4ZXBB 1EA9C 2Q86B 3EO1B 4NT6A 3QP3A 1ZHBB 4MMXC 2Y6SC 1UM4H 5KVGL 5IM7A 4CAGA 5L8JB 5I6XB 1RK1B 3IDIB 2A73B 3VXTA 5DUPL 3BPCA 4M62H 3VXMD 5JW3H 2AK4B 1NCWH 2GFBA 5CKGA 2OTUB 1HKLL 2W60A 1VEOA 5BW7A 3RTQA 3T2NH 2GCYA 5D2NE 1P5UA 4V1DB 4FZEL 2ORBH 1N2RA 1WZ1H 1I85C 4JPVL 1GZQB 2V9QA 1CE1H 3QUYC 2ICEB 4OLWH 5KTEH 3JWOC 4X6DB 1NFKA 1CQKA 3F7RA 4JRXA 2NY7L 1YEGH 1NGQL 4NSKA 3TCLB 5D7IB 2C26A 1H3TA 5C0RH 3N9GL 5FO7A 1UVQA 5FUZH 1U8JB 5TE4L 5D1XA 1J8HD 4UB0H 3RI5K 1UZ6F 5DJXB 3EOAB 4NNYB 3DHJA 2BVEA 4J4PD 1QPPA 2CLZB 2XICA 4YHZH 5CJ8A 3VXSA 4DOHE 5INCA 5C9JB 3CLEH 4GRLB 2Z31C 2NY1B 3DNKA 5H8DA 5TFSL 4Z5RA 5I1CH 2ARJA 4MS8D 4WV1A 1P2CB 3L3JB 2NQCA 4LCYA 3D0LA 1PKQB 1RQ5A 1A7NH 5JPMB 2PN5A 5GS3A 3L9RB 1L7IL 1LO2L 1EJ6A 4PJCB 4M00A 3VCLA 2QR0A 3QDME 1JNHB 5GGUA 3WXWH 1ADQL 1I3VA 4HGMA 1S9XB 1UM5H 3TWCH 3BP7A 1FPTL 1J0ZA 2NTFA 2ICWI 4JFOA 1CFSB 4GMSH 2X2YA 4JO1L 4M6NL 5HYEA 4PV8A 4O2CB 5TGBB 3OGOE 4XBEL 4Y1AD 2H32H 3MFFB 3MLWH 5DVOA 4DZ8B 1AD9A 3BDYL 4WI4A 2XN9D 3OX8B 3OKNB 1J1XL 1V5JA 4HUMB 1WAAF 2PW1A 2CLVB 4S2SB 3CUPB 4Y88A 3GRWH 1AKJB 5DD0L 3EUUA 4OI7A 4N9GB 2NY5H 1AI1H 4Z8FH 1EFXB 4JANB 4NKMB 4OZ4A 4LKCB 5IW6B 4I18A 4O51B 1I1FA 3QCTH 4GQ9H 4ZS6D 1F00I 2DQFA 4YXLH 5CFHA 4IIQC 1X5FA 2FECI 2VLRD 1WSST 2BNRD 1BIIB 3OSKA 1YMHA 1G7PB 4R0LA 5GS0C 2HJLA 4PRIB 5CJBA 2OLDA 4XC3L 2X44D 2YD6A 4M6MH 1KIUA 3T0BA 4U1MA 1NMAH 4JFEE 1LO5A 1KC5L 3HC4L 4PFEA 2NYYC 2VL4A 4P2RA 5J89A 3OQ3B 4I0CC 5ADPL 1PG7W 1JYXA 4X99A 5CS7A 1VFBB 4EDWL 5T3XD 2Z4QB 2YZ1A 4LIQL 3LZFL 1F13A 4OZHF 1SY6H 5F9WC 3S88L 3EOTL 2ICWB 2Q8BL 1U3HC 5I8OH 5CP7B 2FO1A 1AP2A 4OGZA