4GMSL

Crystal structure of heterosubtypic fab s139/1 in complex with influenza a h3 hemagglutinin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
211
structure length
211
Chain Sequence
DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQEKPGQSPKTLIYSASNRYSGVPDRFTGSASGTDFTLTITNVQSEDLAEYFCQQYNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1 chain
publication title Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity.
pubmed doi rcsb
source organism Influenza a virus
total genus 45
structure length 211
sequence length 211
chains with identical sequence M, N
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmsL01
1K4DB 3DSNA 1JN6A 3RVXC 1K8IA 4I18B 1WIUA 4JQIH 4D0CB 5CBEB 3X12A 1UENA 1D5BA 1BJ1J 1F4XL 1KEMH 1UXWA 5HPMA 3NA4A 5ESQB 3VG9C 1JNJA 1WBXB 4L8SA 3F7PC 4IIQB 1CFNB 3LD8C 1CD1A 4I5BA 1LMKA 2R2EB 4Y8DC 2M2DA 1T5WB 3V6FA 3DX8A 4N0FA 1EX0A 3MRFA 5EDXA 3W39B 2YD1A 1R5WB 2AK4E 2GK0B 4LVEA 4XP5L 3VW3L 2GKIA 4L4TE 1CXFA 4F9PA 1JZ3A 4L3CB 1A7RL 5D7LA 4U1JA 2HVJA 2PO6A 4OCNC 1QBAA 2FX8L 3GZKA 3BEWA 4HXBH 5TF1L 3ZYIA 2R4RH 4G8EB 4EXKA 1NC4D 1HOCB 3QNXA 4WWKB 12E8L 4BFIB 1E4XH 2X4QA 4JRWA 4Y1AB 3GNML 2MMXA 1P4IH 3V5DA 1KENL 4R96B 4HGMA 4YZFF 1G7QA 2VQTA 2GSGA 2R1YB 3QQ9D 1EZVY 2J4WH 3IS0X 1ES0B 2PR4H 5I9QB 1CZ8H 4IJ3C 1RPQA 3UAJD 4Y4FD 5CJQH 1ED3B 4O02H 5F3HA 1LDPL 3C2AL 4OCYH 5D2LA 1PKOA 5T1MB 3MRJB 1HHHA 5C0JB 3HNVH 1LWRA 4ZS7H 3H3PL 1A3LH 1HINH 1OWRM 4X8JA 3E2HC 5JHDB 2SEBB 4V2BA 4EQ2A 4XNQA 1ZVSA 4L3AA 1CIUA 1CXHA 1N0XH 3CLEH 1C7SA 3FN9A 3CX2A 5KSAD 4Y4KB 3NIDF 1KPRA 4TYUA 4X0KA 1MFNA 4AL8L 2OMNA 4HDIB 4Q0XL 1KEGL 3MOBL 3D5OF 1HI6A 2CIIA 5T3ZD 5GS0D 4MD5A 3VWKC 2J8HA 4M1DH 5DTFA 3VFWB 7FABL 2QBWA 1GHFH 4NUGH 5I1CL 2N56A 3RWHB 1I85A 1RK0B 2MQCA 3SKOA 5D6CA 2OCFD 4HWUA 4NQUA 3NIGE 5EU7C 2RIKA 4U1NB 4PB9L 1PW3A 3WJJC 2UWEB 1HXYA 2ICWJ 4FTVB 2ESVB 2I9TA 4R90H 1P69B 3U0TA 1BFVH 2EECA 3MACH 3WIHH 3GFUA 3VXMB 2P5WB 4XRCB 4NKDB 4LCUB 1JNHA 2PYEE 2APXA 4WWID 2X7LB 2X89A 5KSBE 1R3KA 3OL2A 5JW4Q 2X09A 1KPVA 1F4XH 1N6VA 3TO2A 4ENED 5IVXA 4PYHA 5F88A 2XFXB 5TF0A 2NY0D 2ADGB 4C58B 4M5ZL 4FQQB 2GJ6B 3GRWA 1N6UA 3LB6C 4FG6C 3FT2B 1Y18A 3OX8A 4K3JL 1RSFA 4QXWA 4Z0XA 4YAQB 4MXQC 3WUWG 5I6XB 4XCFL 1INDL 1FZKB 3UYPA 3C60C 4YXLL 4PGEB 1MWAL 3SKNA 2QQKL 1NUFA 4XP5H 3VW3H 1O7SA 5GGRB 4QCIB 2DI9A 3ALPA 3JBG7 4U3XA 4Z8FL 2X4UA 3TZVD 2YWZA 2FX8H 1NBYB 1N3NA 1JWUA 1UM6L 5T3ZE 5TF1H 4RMWA 4IRJA 3VFSB 1X5XA 1F02I 2E9WA 4ALAL 2B1AL 2YHGA 4O2EB 2WLZA 1K8IB 2AQ1A 3KYMB 12E8H 1ZS8A 4LGSB 4G7YL 5AZ2L 1E28A 3IKCA 3OJDB 4G42A 4BK5A 4N0CD 3GNMH 1MCOH 4D9QE 1KENH 4OGYL 1D5BB 4GRMA 3EJZC 3QXWA 1UXWB 2FHFA 3TV3L 4QHLB 4FXKA 3WFEL 1NGQL 4OZGE 5BVPL 4YHIA 4L8SB 2AJSL 3WIIL 1HWGB 1CD1B 4I5BB 1LDPH 1F45A 3C2AH 4YGVA 2VDQL 1NUGA 4N0FB 5I1HL 4FN0A 2BVQA 4MDJA 2YUZA 1PZ5B 3H3PH 4M7ZB 4W68A 3D0VB 5EZLA 4AMKH 3G08B 1ZMYA 4LVHC 3RWCA 1KFAL 4YO0A 4K8RC 3HI6L 2YA2A 4AL8H 4NCC1 1KEGH 5K9QI 4GMSH 2QKIB 3H9YA 1S7TA 3MOBH 1NGPL 2BNUB 4JRXA 2P4AB 2FCBA 1CDHA 1EEYA 5MHSD 1V3MA 4WHCA 1OB1B 7FABH 3V5DB 2ZOKA 3TH4T 4PJGE 1B0GA 5MI0C 1FL6B 3DX7A 5I1CH 1FC2D 1TQBB 4XAWL 5LGKA 1JHLH 3IXTA 3KS0J 2AS5M 1NL0L 2XN9D 3O0RL 4XMPL 2BERA 4JDZA 1H3GA 4KDTC 3BPCB 1A6PA 5CHNA 5D2LB 3MV8B 3U79A 5D2NC 2Y4SA 2G75A 4ONOA 1T4KA 4UINL 2R8SL 2NY6B 4Y1AE 3VXMD 3GSNB 5DURD 1NKRA 4EN3C 4LNVA 5JQHC 2GIYA 4HUWB 3L3OA 2HJKA 5KOVC 3CFJA 4X0KB 1T2XA 4KK8D 4WI6A 5BRZB 4MA3A 4YE4H 2FIKB 4WO4A 5BO1L 4D8PA 1HI6B 4HKXB 3NIGF 4YK4B 3OKKA 2D7QA 1A3RH 1M71A 4XCFH 5FA4A 1INDH 4W70A 1PBYA 2DD8L 1AY1L 2GJ6D 2IAMC 4YXLH 2HTLC 5IB3B 1MWAH 1QFWL 2QQKH 1DVFA 5D6CB 3KXFB 1A1NB 1NFIA 5HYSG 3WXVL 3SDYL 2UVEA 2YRLA 2O26U 1IGYA 5DMGD 4Z8FH 2RBLA 1LGVA 5JHDE 1T2JA 1HXYB 5FB8A 1UM6H 1OPGL 3RNKA 1U3HA 5KSBF 2X4SA 4M03A 5MHSE 5BXFA 4ALAH 1DQTA 2B1AH 4WW2A 4OM1L 1YY8A 4G7YH 5AZ2H 5F9JB 1JF6A 1LK2B 4K8RH 5HVGB 4PJCB 4RA0C 4X9BA 3S97C 4OGYH 5HVFB 3TO2B 3TV3H 3TJHD 1JIBA 4OFVA 4WJ5A 4JB9L 4JQVC 1NGQH 5BVPH 1WC7B 1DQLL 3QNYB 2AJSH 3BN3B 4LKXA 3IDJA 4NNXA 4NUJB 3WIIH 4U1MA 1V8HA 2O5YL 1ZT1A 2VDQH 4YHZL 3OX8B 2UWEE 2V2TA 4FTVE 1INQA 5I1HH 1AE6L 4LLYB 2ESVE 2RFXA 43CAB 3KPPA 4UB0L 1T20A 3VXME 2P5WE 3ECBA 5A1AA 4M5YL 1QOKA 3QUMB 3F5WB 4JM4H 4MNQB 1QKZL 5C0EB 4HK0B 3H2WA 3MRRB 2XI9A 3P4MB 5GGTH 3RDTA 4AENB 3MRMA 3FB5A 1KB5A 3RGHA 1NGPH 1I3GL 2PO6D 4JGMA 2GJ6E 2BSTA 5DMKA 3IKCB 2WLYA 3SDAC 4OZGF 1WTGT 2XKUA 4XBEL 1EXUB 3PDDA 2EE6A 4YC2B 1IARB 3RY4A 1AI1L 3IS1X 2A83B 2DQUL 2F54B 4ELKB 1A21A 4XAWH 1NGWB 3BIAX 2C4XA 3VXQA 1NL0H 2FX9H 1JRHI 4XMPH 2PYFB 4OKDA 4K3DL 5DO2D 2BY0A 3L3GB 5HJ3A 2YPVL 1UC6A 4L3EA 5T1KA 4P46C 3PWNB 4OT1L 2NQCA 1EHNA 2P24A 2AJVL 5DLML 5KANG 4DZ8A 3C09C 1F11B 4DUVA 2R8SH 3IFPA 5IB4B 2F5BL 5CJOL 4YO0B 1QFWM 4IDJL 4JJ5A 2B5IC 5KVDL 4HWNA 4PJGF 2NY6D 2Q7YA 4RZCB 4DTGL 5HVHB 1EEYB 4JCLA 4ZMAT 3IVKB 3EYVA 2P1YA 1TZIA 1WBZB 1B0GB 1DANU 3DX7B 2DD8H 5BRZD 1AY1H 5LVEA 1NMAH 1QFWH 4AT6B 3T2NL 1MF2L 3N50A 3IXTB 3PWPA 4KVNL 2QV2A 3WXVH 3SDYH 2JJTC 1RFDL 5CZKA 3PUCA 4GW1B 5FYKE 5LKNA 4JDZB 4MYWB 3KVQA 4MWFA 1FLRL 1XGYL 1OPGH 4PJ7B 2WAHA 4ZFGL 3SY0B 5F72S 1VACB 4JM2C 4NWTL 1JPGA 2IQAA 3SE9L 3VXTB 3F6LA 1A7OL 3BDXA 5MP6L 1IZKA 4MNHB 3UDWA 2AERT 3SKMA 1DR9A 4MQSB 5DD3L 4FXLA 1WFTA 1T7VA 1KIQA 3D2UB 3WKNA 1FQ9C 5L0QB 5KN5A 2XZAL 1CL7I 3L3OB 4JB9H 1SHMA 2X89D 1JP5A 1DQLH 4MA3B 4HJGA 2Z8SA 4WO4B 3MV01 5E5RB 2O5YH 1W0VA 1YNLL 1PZUB 4CADA 3BESR 4YHZH 1YYMH 1AE6H 4YDVB 3HZYA 3FRPA 5D2LE 3MV8E 2YRZA 3W5MA 4RCAA 3P4OA 1WFNA 1YPZA 4LEXL 4OV5A 4M5YH 1IGYB 1QKZH 2UYLB 4MGXA 5FB8B 4GAFB 3RNKB 3AMKA 1U3HB 3WN5A 4YNYB 2A6DA 1CVRA 4ZFZA 3BHBB 3OPZL 2Z35A 4WW2B 1T1YB 1I3GH 4M7LL 5BRZE 2DQHL 5BZDB 5I2IB 4Y2OA 4PRHA 1KYOJ 5T1DL 1HSBB 3VI4F 1RZFL 2D7NA 4IRJD 3ESVF 4JY5L 3VH8A 2GYSA 2W1NA 4NOBA 2DQUH 2ATKA 2HTKC 1X5HA 35C8L 4ORGA 3RU8L 5E8EB 1OARL 3ES6B 2UWEF 3QCTH 4NO2A 4OZFA 2R1WB 1J1XL 2WBKA 3KXFE 4UV7L 3UCRA 1EFQA 1J05B 4U1MB 1BVLA 4K3DH 5C09A 3LS4L 2F54D 4LF3B 2RR3A 2YC1B 2ITCB 2YPVH 3LKOA 1CGUA 5LJYH 3UBXG 4KKNA 4PRAB 3FB8A 1P9MA 4OT1H 2AJVH 1KG0B 4JHZA 5FUOL 1JVKA 3A67L 3W9DA 4I4WA 4PRNB 2CDFA 2F5BH 4A6YL 3GJEA 5CGYD 4MJ5B 5DQJA 2A2QT 4WEBL 1A2YA 2LABA 1X5LA 1BOGA 2N4IA 5IVXE 5KVDH 3DVNB 1ZA6B 3MUHL 2ZZUT 4DTGH 1FHGA 4NHUB 1VKXA 1MFAL 2CDGB 5C7XL 4KC3B 1Z5LB 4HWZB 4KKBC 3TBWB 1Z9SA 1BFSA 5EORL 4UOW0 1MF2H 4JRXD 4XZUB 3MLYH 4NQSB 3VXQB 1IE5A 5JQ6L 2L7UA 4N8VB 4PBWD 2MCPL 1KCVL 1FLRH 4MNQE 1XGYH 1L9NA 4ZFGH 1B88A 4PGCB 4LARL 3JUYA 4NWTH 4MSWB 2DQFA 4FQ1L 1FN4A 1LEKA 3SE9H 4K9EC 5F7DB 4AH2B 1A7OH 5MP6H 3V7AG 4JREC 4PV9A 2UY7A 2P24B 4LHUA 2G5BA 3RVTD 5JTWA 5IMOB 1QSEB 3IDIB 1XGRA 5DD3H 4LFHD 5J06A 2JJSA 3MUZ1 4ZO6A 4BUGA 2XZAH 2ADIA 1FSKB 1T89A 1NDMA 2F54E 3UPAA 1NCBL 4TTDD 2UVFA 1FPTH 2Q7YB 4OFIA 4OQTL 3S3SA 1EHXA 1YNLH 3D2UD 1JI2A 4UMGA 4LSQL 2GUOB 3U30B 3EOAA 1EIBA 4WO4D 3GMOA 5DUBA 3QIBA 4LEXH 4HWBA 3PWPB 1RD6A 4KUZL 2FL5B 1EBPA 3FRUB 3EFDL 3GSOB 4PLKD 5CZXC 3MFFA 4NBXB 1U8JB 5ID1B 1DVFD 4CVZA 4X9HA 1IKNA 3OKOA 1N5AA 4LCCA 3S88L 3BP5A 1ACYL 3OPZH 4U6XB 4M7LH 2DQHH 3F62A 3GMMA 4HIJB 4MX7B 3P0VL 4LRIA 1U3HD 3QEUA 5GJSL 3U2SA 1PVHA 5KVMC 1RZFH 3PP3H 5BW7C 4JY5H 4F2MB 3SDDC 1KIQB 2CQVA 4WTXA 3S5LG 1WJ3A 2QHLA 3C5SB 2EYSB 3EYQC 4N90D 5D1XA 35C8H 2ARJB 3MNWA 3RU8H 1MJ8L 1OARH 4XP1L 3L6FB 4HJGB 5D2LF 2FX7L 4UV7H 3H3KA 3LS4H 4MXVE 2XACC 2BCKA 3HR5A 3SE8L 4PJ7E 1NJ9A 5H94A 1H0DB 2P8PB 3P4OB 4WU7A 3PG2A 1KCKA 1YPZB 2PXYB 3JWDL 3DXAA 2C7UA 5FUOH 3A67H 3I3BA 3IDXL 1P84J 4A6YH 2A6KB 1G7PA 4UDUB 5F3BA 3WN5B 5CP3A 3BP7A 1UADC 4K9EH 4LLUA 3DX6B 1HHIB 3CXHJ 3MC0A 3EJYC 3KYKL 1T0MB 3HZKA 5JORA 2VQ1A 5HHPA 2OS7A 2NXZB 3RDTD 1MFAH 5GS3A 5C7XH 4DEPC 1QVOB 5DHXB 5IHUL 2XTLA 5EORH 4M4RA 4ORGB 3ULSA 4LIQL 4NO2B 2NY4C 4ZOBA 3MLSL 4P3DB 2IALA 2HT4D 5JQ6H 3CZJA 1MUJB 1KCVH 5EFIB 2E7CA 3MYJA 4LARH 1IKFL 2WIIB 2Q6WA 3RHWF 2GTWA 3IJSB 5HI4C 1LD9A 5GRUL 1YEIH 4PJHA 5E1AA 4OFYA 3GO1L 5C0ND 1CT8B 4P5TB 1I8MA 2AXHA 3B9EA 5IVXF 1L4IA 4I4WB 4GW5A 3IGAA 2CDFB 5JIPA 4L3ED 3L3DA 4FQHB 4LSDA 4TUKL 4N9GA 4GRWB 4WV1C 5IVZB 3TNMA 1BOGB 3H9SB 1TXKA 1NCBH 1QSED 3T3PE 1FZJA 4OQTH 1J0ZA 4M7KL 4Z7OE 5KVGH 2I07B 3G6JA 1VKXB 1OVZA 4UQ3B 2WUCH 1ND0B 4LSQH 3LQZB 3BZDA 3QJFA 1QHPA 1M7DB 3IFOB 5ID0A 2HT3C 1R3HB 3JZ7A 3OR7B 2Q76B 1NEUA 5CEYB 4KUZH 1E6OL 2OL3A 3EFDH 4F7EB 1SY6L 4Y5VA 3B9DA 3BPOC 2R2BA 4HEME 5FECA 3PWPD 1MPAH 3K80A 5INDA 5DRZA 1CGYA 1ACYH 5HYQA 1WZLA 4P49A 1YEJH 3P9MB 4IMLB 3DHMA 4PV9B 2DKUA 3GJFH 3DYPA 2G5BB 3P0VH 5GJSH 1FJ1A 8FABB 2GQHA 1VFUA 4CJ0A 5CP7B 4M1GL 2P7TB 4WGWB 1JGLH 1CGWA 3UXFA 1MJ8H 3RJQB 1I8IB 1NDMB 2CLRB 4XP1H 1BBDH 4PY8I 2RJMA 2FX7H 1NEZG 3VDAA 1JRHL 1PSKL 3OZ9L 3X14B 3SPVB 3SE8H 4DJMA 5I8KL 3NTCL 3DUSB 3BFOA 3VCLA 2OR8A 5DUBB 3MNZB 4HCRH 3JWDH 1FL5B 3IDXH 4W4OA 1YN6A 1S5IL 1I7TA 4EZMA 1QSEE 3BP4A 1RZ7H 3JXAA 4OI7A 1FYTB 3EO0B 4XHQA 4LCCB 4OBSA 4NN6C 3BP5B 1S9KC 4RNRB 4X80L 1YQVL 4RWHA 1NUNB 4UU9A 3OAZK 3QEUB 5F1IA 2B0SL 1LP9A 5IHUH 3VJ6A 1JGDA 3OHXA 3KR3H 2OR9L 3CMGA 5D9SA 3FFCA 1KB9J 2VITA 4LIQH 1BEYL 3EHBC 2FATL 4ODUA 3SJVB 4PRHD 3PWPE 5ERWA 3GEWB 2A77L 2VQUA 1IAMA 4YPGA 4NRXA 4JFHD 3MUGA 3HR5B 3ABZA 5EBLA 3WDIA 1NJ9B 4GBXA 5GRUH 3WNPA 1MLBB 4RMTA 3VFRB 4EDXA 4MQTB 5ESVB 3U46B 4EJ1C 4JHAH 5C09D 3TBYB 5DD5H 3AFLA 3TBVB 4H0GA 3HG1A 2DIBA 3O9WB 4CNIB 3OKLA 2LU7A 4U1KB 5C86A 4TUKH 4IM8A 2DWDB 3BP7B 4LLUB 4B5EA 1OT1A 3U82B 4PRDB 1A7BA 3BVNA 4M7KH 2QR0B 3HZKB 2BP3A 4JZJC 1WV7T 2FH8A 5DJXA 2V7HA 4G43A 5TDPA 4HFUL 4PJ9C 3RAJL 5FEBA 1TJIL 1F4YL 4QHMA 5D1QB 2QHRL 1JYNA 4M8QA 3ULSB 5FM5M 4HKJB 2HKHL 2EC9U 1GGCH 5DRXA 1YPZE 1E6OH 1P5UA 5HGDA 3S36X 2AV1A 1U8OA 4KHTL 3WS6C 4R4FL 4ODHL 3MYJB 4R8WL 4WW2F 1L7TL 1Y0LB 3ARGB 3HCVA 4LEOB 4ZTPL 4B0MM 4GRLC 4D0BB 3LRGA 1Q38A 4X9GA 4PJHB 1R3LB 4P2OB 1KXVC 4L8DB 3ZT6A 3OG6B 4IRSC 3PP3K 4GW5B 4M1GH 4Z7OF 3RIAK 1ROWA 3PGCB 1HH6A 3JV4A 4LHUD 1PD6A 1FVCA 2EIBA 2EKSA 1JRHH 1PSKH 3G6JB 1NC2A 5IKCA 4MAUL 5I1JL 5LWYH 3OZ9H 5BZWB 5HY9A 1IM9A 3CU7A 1VGEL 2D4DA 3FQTA 4WHDA 5DI8B 4XB8A 4BSJA 3NTCH 5I8KH 3WDHA 1QZ1A 2B1HL 2HWZL 3V4UL 3NMEA 5ID0B 3VMNA 2VWEE 1ZHLA 2NXYC 4FQCH 1XMWA 1YMHA 5L2JB 3FB7A 2FLBT 4R26H 1S5IH 5TGBA 4CU7A 1RJYA 1P4BL 1CGXA 2LQRA 5J13C 1NCCL 5D5MA 4Y5VB 1DDHA 3QIBD 3O2DA 1CICA 4Z77A 1B0RA 2LTQB 1XF5A 4GRWE 1FLTX 4KK9C 3QEGL 4HFWA 2E6JA 4X80H 4BZ2L 4R2GC 4QT5A 2B0SH 4FA8A 5F44A 4KHXL 2FYYA 3O3DB 2OR9H 3MBXL 1TPXC 1T1WB 5C08A 1BEYH 4PD4J 3S34L 2CKBB 4XGZB 3RWEA 4R0LC 2K7QA 2EDDA 3EFFA 3B43A 3HB3C 3IJHB 2A77H 1KIPA 4K7PY 1JZ5A 1FCCA 1U0QA 4LHQB 1ZLUH 5D1XD 2R29H 1EO8L 4HBCH 4K7PX 3ULVD 2NY1C 2XQYK 3B5HA 4HKBB 4XCYA 4P4RB 1J1OL 3HC4H 5E03A 3SCMA 2DS4A 3QDHA 4MD0A 3AB0C 3ARFB 5C07B 5HI5C 1KJVB 4PY7A 4ZODA 5CD5D 1G7JA 2AXJA 1R5VB 2HMID 1I7TB 1CGSL 1FNEA 1N2RB 5IV2A 3BP4B 3CFDB 1CD0A 2HLAB 4HSQA 3DXAD 4PJ8C 4FABL 1CL7H 3ILPA 2EDKA 1YEFL 5HGHA 5FGBC 4NC2B 5JO5B 1T7ZA 2EDQA 5IW6B 1G7LB 2R2CA 5AZEL 5F1IB 3SE4A 2WMPA 5JR1L 3QJHB 3AY4A 4HFUH 3RAJH 1DJSA 3OHXB 1TJIH 1ZA3A 1F4YH 1UJ3A 1A7NL 2QHRH 3AREA 1J88A 1M4KA 2VITB 4HUVA 1CLZH 3FFDA 5TE6L 5ERWB 3T1FB 4KHTH 3EYSL 4R4FH 4ODHH 5E2VH 3STBA 1GH7A 2L7JA 4R8WH 5D1QD 5EBMB 1L7TH 4OZIA 3E3QE 1HSAA 3SKJL 2YK1L 4ZTPH 3JVGC 1FYTE 4KGJA 4UAOC 3QHFL 5FA3B 4EDXB 4KI5E 1CE6B 3QUXB 5F1KC 5E9DB 4F3FB 4HV8B 5TE4L 3HG1B 1Y6KR 4M3JA 4AEFA 2HAZA 2OBGA 4NT6A 1V5JA 3S36L 3RI5F 2HJFA 3KPRA 2XICA 4OFYD 4BK4A 4WHTA 5FM5O 3H7LA 2A74A 3SJVE 3FN0H 5GRJH 2R2HB 2P43B 4G6KL 4MAUH 5ADOL 5I1JH 3B9KB 1VGEH 2V7HB 1YPZF 4JZOB 2DAVA 2HFFA 4WEMB 3V4UH 2B1HH 2HWZH 3RWDA 3QQ9C 5E7BA 3L7EA 3U6RA 3VGHA 3UAJC 5DRXB 3WYRA 4C57C 4EI6B 4R97C 5HGDB 1V7NL 1H3VA 3NBNA 3LMJH 1U8OB 3BZEB 1F90L 5SWQB 5E56A 1P4BH 4QRQB 1JJUA 1NCCH 1ORQA 4LU5L 4S1QH 1OAQL 1P7QA 5HGGS 4EEEA 3HCVB 1MI5A 5IM7A 5DEFB 4JO3L 3CFEA 3WXWL 1W0WA 4RIRB 2BY3A 3ROLA 3OMZA 4J23A 4KHXH 5FYJU 5KBNC 2BNRB 4LAJH 3T8XA 5FUZL 2XQYG 3S34H 5GZOC 1L6XA 1IC1A 5FV1L 5KSAC 1N6QL 4UNUA 4ZQKB 5FDWB 3PABB 3VFTA 4F58L 3BP6B 2PETA 3V0WL 4ETYA 1NC2B 5IKCB 4KFZC 1UXSA 1HDMA 1EO8H 3CZFB 3QG6B 3FQTB 2WWKT 1TJGL 4B53A 1J1OH 1U93A 3HE6A 1ADQA 3TEUA 5JXEA 4U4BA 1JTPA 1ZHLB 3S35X 4PJHE 5EU4B 1FFNA 3Q5TA 1YMHB 5GGRY 4OCRL 5JOPE 1CGSH 4HPOL 1T03H 2FR4B 4JQXA 5KAQF 1DE4A 1CI5A 1CICB 3ARFD 1B0RB 3FO2A 4K7PL 4FABH 1LNUA 4XP4L 1YEFH 3UPCA 1NAMB 4DVRL 3NFNA 1BOYA 2BSSA 4GS7B 3NPSB 1ZLWH 1XR8B 5F96L 4NZRL 4MB3A 3EIFA 3G6JE 5JR1H 1R6VA 1X5IA 2DQGL 3MRHA 1A7NH 1YC8A 4ENEC 3GMNB 4I18C 4F7PB 4BELD 5J1AA 5TE6H 4AIZB 5E8PA 3EFFB 2W9EL 4Y19B 1JGEA 3EYSH 3O6FA 3E6FA 3FFCD 1L9MA 4Y16A 4QTHB 2DWEA 1H3WM 1PJ9A 2YUVA 3SKJH 4X7SL 2H32H 2YK1H 1F6AA 3EYFA 1JK8A 2XTJB 2CUMA 3QHFH 1U92B 3HE7A 5H37G 3NCBB 4TVSa 3GSXA 4IIQC 2CUHA 4DVBB 1UB5B 4LKCB 2WWMC 5I1GL 4RDQF 5TE4H 1YEDB 1RULL 4GBXD 5IV2B 4S0TD 1FNEB 3S36H 4YEEA 3WHXA 5E8DL 1MELA 3RVUC 1P4LA 4YBHA 4Q9CA 3K4AA 3HG1D 5DFVC 1SEBA 2YPKB 4GUPA 5JA8B 1REIA 3BWAA 4EVNB 4G6KH 3AM8C 1XIWB 4N0CC 3WO4B 5HHOB 4PP1D 3MGTB 1KACB 1JZ4A 1RHHA 1GJIA 2D3VA 4HLZH 5T3ZH 1OGAA 3GSRB 4D0DB 1V7NH 2R9HD 5FIEA 5LAXA 1F90H 2VIRA 2NY2D 4XVUC 1UEYA 4LU5H 1Z9LA 1OAQH 1HSAB 5B39B 3WD5L 1AGDA 5I9QC 4JO3H 5C0AA 2D7PA 1A6WH 3WXWH 4XNXL 2D2OA 1U91A 4OF0A 5I1IL 5H8DA 3ULVF 4U1GB 2VDKL 1LP9E 5FUZH 3KPRB 1BVKA 1RZGA 1TQCB 3FFCE 4M4PA 5DZLA 1A4KB 4ODSL 1TVDA 3L5JA 5DSCA 3GMQA 4OJFL 3QDJA 3PXJA 4F58H 1FO0A 3U0WL 3V0WH 2EDRA 5C6WH 4Z7UA 5HGBB 1HEZB 4WFFE 5GGSY 4GLRI 1HKLL 4M43L 2CO7B 4QWWD 4F37F 3UTZB 3OQ3B 4Y4KC 1TJGH 3MROB 4JRYA 1AQDA 1YNTB 3RL2B 1VGKB 1NC2D 4HD9A 4KRPB 4J8RA 4RQQA 4E41A 1U8KA 3KPSA 1IM9D 1G1CA 4OCRH 5J4MA 1QRNB 1SJHA 4HPOH 3HG1E 1OD7A 3WIHA 3AXLA 2RHEA 1UM4L 3WUZA 1MI5B 5IM7B 1QLFB 4K7PH 4XP4H 4DVRH 1CTNA 4LLDB 4GAJL 5F96H 3ROLB 4NZRH 4JKWA 4G8FA 5CKAA 1OOAA 3S35L 1CICD 3PQYB 4HK3J 4DQOL 1II4E 2DQGH 5D93B 2XV6B 2ICCA 2IEPA 1KT2B 4ZSOB 3WLWD 4KK8C 3FQUB 3VFTB 3D6GA 5KTEL 4KKAD 4JFDB 3CAFA 2W9EH 1KLUA 5DHVB 3NN8B 2BVPA 1RUPL 4NZDA 3DX9B 4LK4A 4CN6A 4PJHF 5C08D 4X7SH 4M6AA 1U93B 1NBZB 1JI1A 2E27L 3KPMB 1BQHG 1GZQB 1C5BH 3KHOA 3T0WA 1S7XA 1FFNB 5I1GH 3RUGB 5F7WC 5EU6A 1UG9A 3FOMA 3L3HB 1H15B 3A6CL 1RULH 3IDMB 2W92A 2XTJD 3DUHA 1MCKA 3SCMD 1MFEL 2BNRE 5E8DH 1A22B 3UZVB 2HH0L 4G6AC 1LNUB 3G6JF 2JIXA 2A73A 3ARZA 5F7MC 3EUUA 1OY3B 1QLEL 3VXRB 2BDNL 3QFDB 1QACA 3LEVL 1G9EA 1PX3A 4YFEA 3IF1B 4PJXB 3BT2L 5FYKL 3VWKA 1J0JA 4WFHD 3KJ4B 3TJHC 1F3JA 2GCYB 4F57L 5AYUL 1T0NA 5J1AB 1EFXB 4OB5L 3B8SA 3E6FB 4Y16B 1Z0MA 3QUZB 2IBGA 4ZXBA 2VL4A 4GSDL 3ARED 4KJPC 2HP4A 3WD5H 2J2ZA 3EYFB 2XNAA 1DQML 2DYPA 2OXHA 4L8SC 3P4NA 3WJJA 5IBUG 1NCTA 4XNXH 5EBWA 3ULUD 2HRLA 1KELL 3CDGB 2DL2A 3ARYA 4KKLD 4LLMB 3QEQA 1HKFA 4HH9A 5I1IH 5IBTL 3OV6A 3HRZB 1JNNL 4Z76A 2VDKH 4G8IB 2PW2B 1E27B 4M7ZC 4Z7QE 1AGBA 4K7FA 4ODSH 5A3ID 3ARDB 1XZ0B 4OJFH 4F9PC 4XXDB 4AEIL 3NFPA 5E8NA 3U0WH 1UCBL 3TYGH 3BWAB 3VWJA 2PO6C 4M43H 5FFLA 4Y19E 3VFPA 3KPRD 1I8KB 1BQUA 4FFWC 5E08L 2VDRL 3MYZA 1XF2A 1RHHB 4WUKL 1XGTA 5DA4A 5JDSB 3GDBA 4MA1B 2XTJE 2I5YL 3ZKQD 1ZGLB 3GSNL 4JKKA 5EZIL 2PW1A 3S5LA 2VIRB 3MZGB 5A16A 2EO1A 3DHJA 1FDLL 1MIEL 4RGNB 4BQ6A 1UM4H 2DM4A 3QI9A 3TA3B 1FFOA 5DO2C 2GAZA 1TQBC 1HCVA 5AG8A 1LP9F 4UQ2B 5ETUB 1ZLWK 4GAJH 4HAGA 1ZHNA 1P7QD 3BIKA 3MUJA 4WFHE 5F1OB 3S35H 1KTLB 2ZUTA 1MI5D 4MJ6A 1WZKA 4S1SL 5TFSL 4DQOH 4I3GA 5J6HA 3PWLB 5HHOE 5I66B 1ORSB 5C2BL 4IOFC 1BVKB 1J86A 3KYNA 4KV5E 3STLB 3QDJB 1VFAA 5KTEH 1FO0B 1UH2A 2IANA 4OI9A 3RNQA 3FONA 3RBSA 2NY6C 1RUPH 1RZIA 4PGBA 3TP4A 3WCYA 4JG1L 4QNPE 1MWAA 3VXNA 2BC4B 4FNLL 2EE9A 5K93A 2E27H 4IOSD 5DJZA 5F89A 5F6HJ 2X4NA 4RQQB 4P9MH 1U8KB 4ZUTB 1DLFL 4QHNA 4YK4C 1S3KH 3HE6D 2ITDA 5L6YL 3QUYA 2Z31B 4XNZB 3FQRB 1MFEH 5TDNB 5C0RL 3VD4A 5JXED 2HH0H 5ACZB 3LKRB 3H0TA 1MNUL 3KPRE 1S5HA 4WUUA 4AIOA 3TN0A 2VE6A 4EI5B 1QLEH 4HUXB 2CRMA 3CFIC 1LO0L 4G8FB 3OG4B 3QWOA 3WFHA 1SM3L 1X7QB 3S4SB 1AXTL 4XNYL 4KTYA 4G9FA 3BT2H 3QUML 5FYKH 1FNFA 5CSZB 4F57H 1G7HB 5AYUH 3HUJB 4J4PC 1IQDB 3DO7A 4YDKL 1DCLA 2E6PA 4OB5H 1KLUB 4FXGB 3SDCB 3KLDA 4NQTA 1QRNE 2HFGL 4GSDH 4H26B 1CDIA 4OLYL 1Z2KA 3WIFB 2Z0BA 1MI5E 2C3GA 2BFVL 2J3SA 3IDYB 5DYOB 1OQXA 3O6FD 1KELH 3H9HB 3CH1B 3QUZD 4Y16D 5EU6B 3FOMB 4ODTL 5IBTH 2F74A 3UTTB 1I7RA 1JNNH 4NRZA 3HE7D 1IGIL 3PQYE 2FECL 5DMIL 5GXBB 2JIXB 4AEIH 2V7NA 1YN7A 1NCUA 1UCBH 5FO7B 5T3XE 4C4KT 5C0GB 1W8OA 4JFDE 2ZJSL 1CG9B 3K1KC 5E08H 1G7MA 2VDRH 5EU5A 5IQ7L 3ARDD 1MQ8A 4ODXA 1MLCA 5ANMA 4FQLL 3H6JA 1MH5A 1CE1H 2I5YH 5ALBL 2X41A 5B3JE 3GSNH 3Q6FB 5EZIH 3LN5A 3DYMA 4YC2C 1TENA 4ZXBB 4XNUL 1FDLH 1MIEH 2FO4A 4LGRB 4N1HB 1DTUA 1GIGL 1OGAD 2DYPB 1NEZA 5E2TH 5EO0A 3VD5A 2VAJA 3MLTB 4RGND 3VXRE 2VERN 4S1SH 4P2RB 5TFSH 3AU1A 5C0AD 1IGJB 5C2BH 5CGYC 4OCLC 1TNMA 3LKQA 4NDMA 3HPJA 4PJXE 4GQ9H 2CGRH 3ZYZA 4CVUA 4MCZA 3NFPB 3LPFA 1UZ8A 2AJ3A 3VWJB 1MCFA 3QWQB 2Y23A 4JG1H 2XZCL 2ZUXA 5MEOA 1E4KC 4FNLH 3QDJD 3DV4A 1XGTB 4TSAL 4LDEB 2BXYA 2NR6D 3T0XA 3MA9L 3PHSA 4FFVD 4HX1B 2W0LA 1DLFH 2PW1B 4WGVB 5L6YH 1XCQB 5C0RH 4JRYD 1PY9A 2OTUA 2GAZB 5TH2A 4E41D 1MNUH 3KPSD 1QYGL 4FRWA 4HLZG 5M94B 5JNYA 4O2FB 2UZXB 4LLVB 3BIKB 3VFVA 4KV5F 1AXTH 1PGRB 4K3EH 4XNYH 3IU4L 2Y25A 3S37X 5IB5A 5J6HB 1S7QB 3QUMH 1C08B 3SDAA 1E4JA 3SO5A 2LU3A 3KYNB 4S2SA 1F2QA 3FOLA 3ULUF 4QNPF 2GTZB 3L9RA 4OZIF 4YDKH 3RNQB 3AS1A 1RZIB 2DTML 3QFJA 3QQ4B 2HFGH 5B4MC 1OTSD 5L0QC 4OLYH 3QEHB 5HXMA 2QSQA 4RGNE 5DJZB 2BFVH 3PWUB 4WO4C 2NY5L 5MEQA 4JO4L 4ODTH 4QHNB 1A9BA 4Z7WB 1A6TB 5B38A 3CIQA 2ITDB 4P46A 3WEXB 4ZUVB 4PLKC 1IGIH 1CTOA 4X6EA 1GC1L 2NLJA 5DMIH 2MPAL 1DVFC 4DFIA 5EU6D 1JE6A 1NCDH 1SYSB 3O45A 3QDJE 3UTTD 1C16A 2VDOL 1TTFA 1K4CB 5IR1A 3IJYA 3R06A 2VXQL 1U3HC 4Z95H 4G6FB 5IQ7H 3GMPA 1KCUL 1QQDB 2JIXD 4FQLH 1QFHA 4WW2C 5ALBH 4JRYE 2EIZB 3DIFA 4NJAL 3UTOA 3BD3A 3DO7B 3PHQA 4DKEL 4E41E 4KRMB 2YD6A 3KPSE 4UT9L 4C56A 2WP3O 4BKLB 1RZJC 4XBGA 4XNUH 4QXGL 3VWKD 3G5ZA 3HAEH 2JJTA 4O4YL 5EU3B 1AO7A 3O8XB 2BOBA 3VG0L 5HGAB 3RY6C 3NIFE 1TDQA 4ZXBD 3WJLA 4JM2A 5FKPB 2DN7A 3KPOB 2F74B 3F7RA 1OAZL 2DYPD 4E5XB 4X9FA 2A38A 3S8WA 5C0BA 3X3FL 2VLMD 3VGAC 2ICEA 3TBTA 2C9AA 5HD8C 2ENSA 3DV6B 3DVFA 3HUJE 4X99B 3V8CA 1NGXA 5DC4B 1OHQA 3ROOA 1JMXA 3P77A 5B3JF 2XZCH 5EU5B 4JPWH 5F1NA 3IDNB 3VXUB 3FO9A 1MH5B 3NZ8A 4HIIA 3VWJD 2AKRA 2HT2D 3DURA 4S11A 1IMHC 5HYFA 4L8BA 2BHUA 4XMLL 1UVQA 3TT3H 3ZT5A 2WK2A 5ESAB 1LEIB 2Q8AH 3LN5B 5EU6E 1CFVL 4EBQH 4UUJA 5EZOL 3UTTE 3WE6A 1EERB 3HNSH 4Y5YB 2VOTA 1QYGH 5MENB 2WWKO 2YD2A 5SWSA 5LQBL 1UYWH 1IEAA 2R15A 1VEOA 5C0NC 32C2B 3QI9D 1H8OA 4PJXF 1R5IA 3IU4H 3DGGA 2WBJB 5FCSH 4Z78B 3VXSA 1S78D 4H88L 5IW1B 2OR7A 2DM3A 5FF6B 2R23A 1FP5A 3CDFA 1U8QB 1Q9WA 1MAKA 3CC5A 4PJEB 5FGRA 2DTMH 3IAGC 4ESKA 1IAKA 1FSKC 3DMMA 3DV4B 3REVA 5EU7E 3A0OA 4ZPVA 1Q9LA 4YX2L 3S37L 4KWUA 1MVUA 2IAND 3MRPA 2GSIB 2NY5H 1XF3B 2ED7A 4JPKL 3AS0A 4FZ8L 4O5LL 3BUYA 1I9RL 2E8YA 5FYLE 3U30C 4P2RE 3MRCA 1U8NB 2MPAH 4OF8A 2OYPA 1P6FA 5TH2B 2VLRA 4K07A 5IB1A 4BQCA 2RGSA 1UH3A 3ZDXE 3L5XL 4BFBD 5JNYB 3QUYD 4NQVA 2WNGA 3FTGA 4HHAA 2X4OA 3UTSA 2VXQH 4GLRH 1KCUH 4WUUD 3AC0A 4JFPB 4OD2A 3DUUA 3MV7A 3TN0D 4YDLB 3CU1A 4OCXH 4XCCL 3UDWC 4KMQA 3RZCA 4C54A 4DKEH 3O6KL 2EYRA 2V9RA 1A0QL 5E5MB 4QXGH 4G9FD 2C3VA 4O4YH 4CU8A 4ZUSA 2Z8WC 4ZFOB 3SDXB 3QG7L 3OTTA 3VG0H 4P99A 2WZPD 2MSPA 2B4CC 1JHTA 3JWOL 2VAAA 1OT2A 1YJDC 1DUYA 1AGFB 2FZ3B 5C3TA 3STZA 3MRGA 4A6YA 1JNLL 1PQZB 1XGQA 4HIEA 4AEHL 3GGWB 1OAZH 2KKQA 3ILQD 2FRGP 5F7UA 5EIVA 3X3FH 2OSLA 3U4EA 2PXYC 4WTWA 4HGKC 4APQA 5ABDE 1NGZA 4BUHA 4Z7VA 4I1NB 5IHBA 5DGRA 1KJ2B 4P2YA 3D0LB 2IANE 2C1PA 4XNMA 5IR1B 4R4BA 5BJTB 3WN5C 3GMPB 3RHWK 3QUKA 3PP4L 3K0WA 1Q94A 3EDJA 2VXVL 4JN2B 4OLVL 5FGSA 2HYMA 3B3IA 3DIFB 1DANT 4XMLH 3JWOC 5DD6A 4XPGL 2NXZC 4C56B 3NIFF 1CFVH 5DJDB 3SEPA 3G5ZB 4LLWB 4UBDD 1LEGB 3NOIA 1AO7B 2DLFL 2X4TA 3W2DL 2JK5B 1BBJA 5LQBH 4TUJB 4WUUE 43C9B 4MCYA 2J8UA 4MNGB 1MCSA 3OJ2C 4GXUM 5J8OA 1L7IL 1HXMB 2EDWA 4GG6A 1WFOA 4H88H 4I0PB 5C0BB 2R1XA 4OQTA 1P9MC 5GPRA 3P9LB 4P5TC 2ICEB 3U7YL 3L95A 1D7FA 4KDWA 3PGDA 1HQ4A 2W59A 4FFYL 2OLDA 4QHKJ 3EOYG 1WCBB 3HFML 2UV3A 4YX2H 5K59E 4GT7A 3FQXB 3S37H 5IROA 3NZ8B 3DURB 3T0EB 1I7UB 4FZ8H 4O5LH 4X6DA 5J7CC 1I9RH 3B6SA 3TVMB 1JHKL 1QFUL 5AD0B 3QZWA 4XCEA 2BSRB 3MJ9L 3DROA 4OAWA 2B4CH 4WFED 4KVCL 3L3IB 3GJFA 3L5XH 1Q0XL 4OZ4A 4DZBA 3T4AB 4P59L 3IAQA 5E2WL 4NQCB 4PRBB 1KJMB 1JUFB 3MLXL 2GFBB 5I76A 3ZO0A 2EDJA 5D4QA 3B5GA 4DN3L 3RWJB 4OKVA 4JKMA 1GGTA 2R23B 3LV3B 2ZCLL 3O6KH 5C0CB 1OAYH 3MRIB 2X70A 2AEWA 5HI3C 1A0QH 2FO1A 1WZ1L 1QFOA 3QG7H 3DMMB 3C8DA 1T89C 1MVUB 3JWOH 3MRPB 5EO1A 2YS4A 3QFJD 5GGUB 3B2UD 1UKSA 1JNLH 2YA1A 3BUYB 1EAPA 1QNZH 4AEHH 4C83A 3OJVC 3LKSA 3FCTA 2CJUL 3PL6A 4DGYL 5IB1B 3D69B 5JW4N 2ZG2A 4ONFL 3KPNB 3RFZC 2X4PB 4GG8B 4WV1A 4NQVB 4P46D 1UZ6F 4JO1L 3E3QC 4HHAB 3DLQR 4PJEE 1IKNC 3GB7B 4JDVB 4LCCC 4NWUH 5IMLA 3PP4H 1JYVA 2HG5A 4KI5C 2VXVH 4OLVH 5I0DA 1NCNA 3E6HB 1WVZA 3CDCA 4RGOL 4K94C 3RZCB 4XPGH 4GRWH 1E0OB 5SX5H 5EO9B 5CD3A 2X4RB 3WNNA 4ZUSB 1XF4A 4LASL 2YXFA 3W2DH 1DQDL 5J6GA 1JHTB 4JFFA 4NKMA 4C56D 3LH2H 1DUYB 3MRGB 3OKMA 3F12B 5BS0B 4HMCA 1L7IH 1IGTA 1AO7D 3FQWB 5AWNL 2HMIC 1OGTA 4I3RL 4RAUB 1F3DH 4L1HA 1ZLSL 4JM2D 3KJ6L 4XI5D 1BZ7B 2UZYB 4JHBA 3VXPB 2C4FT 2NMSA 3O9WC 4FFYH 2E9JA 2ADJA 4POUB 3QCVL 1U8PA 1XGUA 3I3DA 5KSVA 2MHAB 4PR5B 5C0BD 1QSFB 5IT2L 1IAII 3QFJE 1UCTA 2WBWB 1Q94B 2Q86B 1DLHA 3SDXE 4E42B 2B2XH 4GKNB 5I71B 3CUPA 3OKNB 4YFDB 3SKUD 5DD6B 1FG2A 1SY6A 4NO5B 1JHKH 2BNQB 1QFUH 2IG2L 3TJEL 3X13A 3WV0A 3HRPA 3MJ9H 1HHKB 5D1QC 3FO0H 1NFDB 3T0ED 1U8HA 1BIIB 2JB5L 4KVCH 4LPCA 3DPBA 4QYOB 1BBJB 2BVEA 1F4AA 2X9XA 1Q0XH 4HIHA 1P7KA 3B5TA 3W9EA 1WWCA 4P59H 1FVEB 3CSYB 5E2WH 1A6VL 3ARGC 3AS2A 4QTIL 3IRZA 3MLXH 5C71A 5SWSD 2P44B 4YHPA 2IPKA 4DN3H 2R1XB 1CWVA 4P2OC 4AJ0A 2L4OA 4PBXA 5K59F 3RWFA 1HQ4B 2F8VA 2DF3A 3G5XA 3QB7C 1RJLB 4HLJA 1WZ1H 4C56E 2NYYD 2VTFA 3BPLB 4U1IA 5CFHA 2C26A 2H8PB 2HJLA 1AO7E 4NN7C 5C0CD 1JV5B 3BX7C 3LKPA 4L29A 1NBQA 4KPHL 5I8CA 1DQQA 2IC2A 2MTPA 3BXNB 4JFOA 3B6SB 4LCYA 5JPNA 2FNBA 3DMMD 2XKNA 3NZHH 4MNGE 5A40E 3VRLE 2CKBL 1F13A 4M1CC 4S10A 4RAHA 1B4JL 2CJUH 4DGYH 1RJZA 5C0BE 4ONFH 4HW6A 2QADB 4UTBL 4ODBD 4HS6A 2B7DT 1FV1A 3MRDB 4OZ4B 1RK1A 4JO1H 4LPWA 4Y5VC 1KLGB 1FZMB 2VLRD 2XWBA 4P9HC 5E00A 2LTQC 1MHHA 4NQXB 5DJ8A 3I50L 4OKVB 4IEFB 3V0VA 4PJ9A 3T0EE 3UTSD 2KH2B 1G9NL 1FVDA 5CP3H 1Q72L 4PP2A 4QRPB 1M1SA 3MV7D 5GGQL 3HC3L 2NNAB 4V2CB 2YBRA 4LASH 1JWMA 4BSVB 3TNNA 4I0CC 4WHYG 3RZCD 1DQDH 1FNHA 1HIML 2P47B 4Z7NF 4JFQA 2XXMB 5F7EL 2APFA 1EAPB 4GRLA 5SV4A 2KQNA 3DSFL 4QOKA 2ENYA 4K3GA 5EA0H 2CSPA 4NQCE 1VPOL 4ISVA 2G2RB 4I3RH 4IRSA 3FCTB 1ZLSH 1NCWL 5CINL 3ARFC 2VISA 4QRTB 4JY6B 2P8LA 4YFLF 3M17A 2Q3ZA 3GMRA 5D6DA 4L4VA 3H9ZA 3T65B 1EJOL 2X1OA 2BRRL 1ZHKB 5C0CE 1G9NC 4U6YB 1TZHA 5DC9B 4Y2DA 4MB4A 2CD0A 2HG5B 4APQD 2E7HA 3U4BL 3VRJA 4YHYB 3MSPA 5GGVY 1IEBA 3D85B 1I1FA 3H7BA 3TJEH 5CD3B 3RY5A 4RRPA 3RI5K 5HHQA 1K5NA 1AP2B 1XF4B 3KDMA 2JB5H 3WS3A 4FFZL 5J6GB 2VLRE 4QXTB 4JFFB 5CBAA 1CCZA 2V2XA 4P2CG 3DBXB 4BA8A 3OGCA 3MXWL 3FT3A 1FAKT 1A6VH 1T5XB 4QTIH 4MLIA 5GRVK 4X5LA 5CZXD 4L9LA 2CMRL 3VDCA 1OD9A 4JZNA 3MV7E 3VFGH 4J1UB 3O6LL 1DP0A 4S0SD 3SDXF 1ZEAL 4P9HH 4L4TA 2JB6A 3BI9X 4DCQA 1U8PB 1XGUB 3GBLA 4YDJB 3MFGB 5KSUB 4PP1C 5JLZB 3RWGB 1CFSB 1P1ZA 2AEIT 4N8VG 5DDHA 1NMBL 2NTFB 1A6UL 4YJZL 3BQUA 1MCJA 1P53A 2EDTA 3B9KC 3T0DA 1CFQA 2R9HC 4P57A 1LE5A 3X13B 5BS0E 2CKBH 4OF3A 3KLSA 3B8YA 1B4JH 2ZNWA 1U8HB 4HZLB 5EOTB 1WT5A 4QHUA 1B90A 1DL7L 4UTBH 1T6WA 1EJ6A 3QXAA 1NDGA 4W6YB 2V5SA 2V2WA 4HIXL 1DSFH 4MB5A 5DQ9B 5ICXA 2C1OA 3LKNB 5FGBA 2O5XL 1QSFE 3GSVA 5BMFL 3ARBA 3I50H 4U31A 3SGDI 4OF7A 1G9NH 5HYSB 1Q72H 3EJYD 4XCNB 4UI2A 2BNQE 5GGQH 3HC3H 5IHZA 5C9JA 1NAML 3TIEA 5E99H 3FMGL 4ODVL 4JM2F 1NFDE 1HIMH 4AEEA 1KIRB 1OP9A 3VRLF 1QP1A 5DJ6A 3LKPB 2WINA 1S9YA 1DQQB 3UP1A 5J1TC 1XCTA 2BY2A 5F7EH 5FO9A 4F9LA 3DSFH 4XC3L 5ELIA 5HYJB 2E5EA 2Z9TA 5IB2A 1VPOH 1YQ2A 4PJAB 3U36B 4C55A 1XT5A 5DVMA 3INUL 1EAJA 4NKOA 3IXAA 1NCWH 5CINH 5B8CA 3GSWB 3M1BA 4ZUUB 5E0QA 4X6CB 5J1SC 1FV1B 4NCDA 1S7VB 1EJOH 1RK1B 2OQJB 2BRRH 3FQNB 2H41A 3PL6D 1CICC 1ITBB 3U1SL 4UIMA 1KPUB 1MHHB 2LFGA 3U4BH 1D5XA 2DMCA 5ADPL 2C5DC 4GS7C 5DJ8B 3W81A 3NPSC 3WLWC 4OBRA 2PYEA 3WFDL 1CFTA 4ZO9A 4X6DE 4KKAC 1U8LA 3FRPG 2H32A 2NY7L 3V5KB 1MHEA 3I6LE 1RHFA 3KYAA 2BMKA 1U58A 5DHYA 1W8NA 4MXWH 4FFZH 1H3XA 2W0FA 1OSZA 1I4FA 3JSSA 2J5LB 2NY3B 4TNWF 3MXWH 1RZKL 5GGVL 5DUPL 4OLEA 2XTJC 2CMRH 4JFFD 2IPUK 2C3WA 2VNCA 3D48R 2ZSVA 1H8SA 2VRAA 4NO3B 3TPUA 2X1WL 3O6LH 3M17B 3GMRB 2K7PA 4PG9A 1P2CB 3QRGL 1WK0A 1ZEAH 3VH8G 3MJ8A 1N8ZB 1JWSB 1AKJA 4QRPE 5GRZA 2Q7NA 5F9AC 1MFDL 1TZHB 2FSEB 4OZFG 1F5WA 5EC1B 3ARUA 1J5OL 1BWMA 3TBSB 4DGIH 3C6SA 3VRJB 2JCCB 4RMSA 1NMBH 3MNVA 1A6UH 4PRIA 1XIWC 3WO4C 3SE4C 1I1FB 2Y7QA 5IHLB 1RZKC 1UJ3C 3AREC 3OXRB 2DBLL 2H6PB 3IDGB 4PPTA 3QR2A 1DL7H 5DS8A 3RRQA 4GKZA 3PV7A 4KKLC 1QSZA 3FT3B 4F37K 4WI7A 1CDYA 2O5XH 5KAQG 1U3YA 4L9LB 3ME0A 1KXTB 4ONGL 2XYCA 5IFJA 4TULH 1VADA 2EDFA 5I8EB 3EJJX 1K4DA 4U1GC 1IC5L 2JB6B 1DBML 4WRLA 4I18A 4ZAKB 1NAMH 1CU4L 2E7MA 1TQCC 2G9HA 4D0CA 3FMGH 4ODVH 1UB6B 1P1ZB 3VU2A 5KVEH 4V1DA 4K71B 4X8XA 4JFFE 4Q9RL 3BQUB 5ESQA 5K33A 1WBXA 3V6OA 4XC3H 1CFQB 4P57B 1LE5B 2IPTL 4IIQA 3PWJB 5T3XL 3P9WB 2R2EA 4Z7VF 1HCFX 4FQXB 1T5WA 5JIKA 3RTQB 2ZOLB 4LHUG 4YDIL 2GJJA 4U7KA 5DEGB 5F7FA 3GK8L 5J56B 4LSRL 4NJ9L 3W39A 3BZ4B 1I7ZB 4HKZB 2V2WB 1KN2L 2GK0A 4RDQG 2X2YA 5BOPA 3C5JB 3U1SH 4L3CA 1IAIL 5ADPH 1B6UA 4HF5L 3BAEL 1J18A 5J11B 5IUSA 3OAUL 2ERJB 3K2UL 3WFDH 2NY7H 4G8EA 1HOCA 4WWKA 4BFIA 5D93C 4Y1AA 4J3XA 5C0DB 2IPUG 4U7MA 4PJ9D 4UDTA 4R96A 3F58L 4RA3A 2R1YA 1FGVL 5EBGA 5JA9A 1ES0A 3PWVA 4RFOL 1ED3A 1RZKH 5DUPH 1G6RB 3QIWA 4NKQB 4DN4L 1NMCB 1YNKL 5JXEC 3K3QA 3EDFA 4FMKA 3IYLW 5DRNB 5T1MA 3M1BB 3MRJA 2NY3D 2V9TA 4GRLD 4OFDA 5GIRA 4D9RE 4QOKD 3DTXA 1T1ZB 3QRGH 4HS8L 3LEYL 5DXWA 4MHHI 3RPKA 3MRBB 4PB0L 4JQXC 4ZDHA 1MFDH 2H2PD 3TYFB 5JHDA 1J5OH 4UIMB 4X6DF 4OCWH 1T21A 2XA3A 3UBXB 4Y4KA 4JVUA 4X83A 4AIXA 3WNMA 4Y2DD 4HDIA 4YQXL 2UZIL 2ZSWB 3RWIB 2VLJA 2E9BA 1U58B 2DBLH 3KJ4C 4PJAE 3VFWA 4ZOEA 4EDWL 1BD2B 1S7UB 1Q1JH 4FQ2L 1A6AA 4PJIB 2RCSL 1QBML 3D25B 3LHPL 1I4FB 1FZOB 1J8HB 1RK0A 4NNYB 4Y16C 3QUZC 1GGBL 4MQXC 2YD5A 4JVPA 4FTVA 4ONGH 3WL9A 5HPOA 2ESVA 5FHBL 1A7PL 5D1ZB 2DBJA 2P5WA 4XRCA 4NKDA 1EK3A 3MJ8B 1IC5H 1DBMH 5HHMB 3U9PL 1AKJB 2AK1L 4GAGL 5F7YC 4H1LA 3RKDC 1CU4H 4LQ1A 2XY1A 5AAWA 3ARDC 2Z91B 2DKMA 4L4TD 1D9KA 1UT9A 3DNKA 3UMTA 1A1MA 2XFXA 4Q9RH 1J10A 1J87A 1T3FB 1I1YB 4FQQA 3CJJA 4D94A 1IAIM 4X7CC 3HB3D 3N9GL 3BN9D 1Z9OA 4MA1C 5T3XH 1Z3GH 1ZVYA 3FT2A 4PFEA 5DVKA 3FZUD 4Y4HB 2NY1D 4WCYL 5ACMA 1GL4B 3NABL 4YDIH 5DHVH 3BQUD 3GK8H 2D31B 4LSRH 4NJ9H 2GITB 4XX1G 4PGEA 1LO3L 4L9DA 1GGYA 1ADQH 2CDEA 5GGRA 4RGNC 3UTQB 3TA3C 4F7CB 5FUCE 4WI5A 2GY5A 3EYOB 1IAIH 3W11C 1HH9B 4NNPH 1NQBA 4GH7B 3BAEH 4HF5H 1NBYA 1M6OA 3JTSB 3S9DB 4JPVL 3GSUB 3VFSA 7CGTA 3NACL 4X6BB 4WDIB 4OCMC 4JANB 4O2EA 2CXGA 3KYMA 2CR3A 3OJDA 3ARBD 2VC2L 4OLUL 2G9HB 2KQMA 4OD1L 2NR6C 2VN4A 1FGVH 1CR9H 4V1DB 4N0YL 4FFVC 4QHLA 3I75B 5DUML 1S8DB 1BVZA 1D3CA 4RFOH 4MJ4A 1CQKA 3VRIB 4X6FB 2ADFL 3PV6B 1PDKA 4DN4H 4JHWL 1YNKH 5E6IA 3RJDA 3C60B 2WW8A 4KK6D 4N5EC 2ORBL 3I85A 4NFDA 3T04D 4HS8H 1PZ5A 3HMXL 3LEYH 3D0VA 4XNZC 4PB0H 1SJVA 5M95B 3G08A 4YH6A 5DC0A 1MQKL 1ZWIA 5IEHA 1AHWB 1RVFH 2R4SL 5LCVL 5CEZD 3V52L 5F6IB 4MAYA 5IJVB 2UZIH 2QKIA 3C6LA 5TJWK 2BNUA 4M93B 1OTSC 2EIDA 3L3JB 4EDWH 1OB1A 3HTLX 2PTTA 3QXDA 4UDTB 2PYED 3PHOB 5E4EB 1FL6A 1YEEL 2VZTA 2RCSH 4UT7L 2GI7A 1MJJB 1QBMH 3LHPH 4WU5B 3QHZL 1EZVX 1GGBH 3PWVB 3SO3C 4RMQA 4XBPB 3QIWB 1X5YA 4P5MA 3GIVB 3IDYC 3BPCA 1LO4L 4MA7L 5FHBH 2R0LL 1A7PH 1RUKL 3MV8A 5GIRB 2I26N 5DD0L 2CRZA 3DTXB 4H5SB 4LVHB 1L0XA 4YR6A 5CMAA 2AK1H 4GAGH 4ZDHB 2QQQA 1ZT4A 3P73A 4EKXA 2E9IA 3EBAA 1T21B 5F9OL 4RAVB 3GSNA 5BCAA 4HUWA 4P23B 5FYLL 1AKJD 5GZOD 5KS9B 2Y06L 4PJAF 5BRZA 2FIKA 2GT9B 3N9GH 2EDHA 1RQ5A 1PKQB 5GGSA 2VLJB 5GRWA 1U95B 4HKXA 3BO8A 2AAVA 1FO0H 1U8IB 4WCYH 3NABH 5I1DB 4PRID 3ZSSA 1A6AB 1O0VA 1U2CA 5IB3A 1SMOA 4D9QD 3WBDA 4ZXBC 3S96B 4O00A 1QR1B 3KXFA 1A1NA 3K4DA 3Q2CA 4Y4HD 5CEZE 3HI1B 5D2NB 2CLVB 4JAMA 1E6JL 3WL9B 1L6ZA 3BMWA 2CH8A 2BVTA 4FQPA 1HWHB 5T5NF 5D8JL 2P5EB 2PCPB 3GMLA 3NACH 4YHKL 3X11B 3ZKMD 4JFEA 4L5FL 4FHBD 2ZUQC 5DK3A 3QO0B 5F9JA 4H1LB 4X5WB 4J4PA 3D3VA 2VC2H 1I1AA 5ICYB 1LK2A 4OLUH 1EHLL 1UFUA 4PJCA 5HHVL 4OD1H 2E7BA 3LS5L 5BV7L 4N0YH 1D9KB 3BKML 1A1MB 2HT2C 3VWJC 5DUMH 4MD4B 1RMFL 1WC7A 3QNYA 5C6TL 1J8HE 4HGWB 5DJ0B 1SVCP 1RIHL 2ADFH 2PN5A 4J6RL 4NUJA 4JHWH 1HQRA 1A4JB 5CEXB 2IAMB 3KLAB 4V1DD 1F97A 1EEUA 3AUVA 2ORBH 4LLYA 2AP2A 43CAA 4ZOAA 4PTUB 4UILL 3HMXH 4PJBA 3F6IA 4LPXA 2VR4A 2WWMD 5CIPB 3REWB 2CDEB 3VD3A 3CPLB 5HHME 3QI9C 3QUMA 3F5WA 2OTPA 4MNQA 1A7RH 1Z0NA 1LO5B 2XPGB 5C0EA 1MQKH 4HK0A 5DQDL 5IESL 1S78C 3RVUD 3MRRA 1M6OB 3P4MA 5FOBA 2R4SH 5LCVH 2ZPKL 4AENA 4YHNB 1B0WA 3BPNC 3V52H 5DFVD 4JE4B 4PRIE 5K9JL 5ISZB 1A6ZA 1DBAL 2DMKA 4J3OC 5IJKA 1D5IL 1EXUA 2OP4L 1YEEH 2WUBL 3F7VB 2A83A 4H25B 3MGAA 2F54A 1CIDA 4ELKA 3QHZH 4WWKD 3HZMA 5EPMB 4PY8J 1NGWA 2D7TL 2KZWA 3MJ7B 4W6WB 4Y1AD 1AJ7L 4XVUD 3MZTA 2PYFA 5E6IB 1LO4H 1RUQL 1RUKH 3L3GA 5FO8B 5DD0H 1Q9OB 2X1XR 2H45A 3X3GL 3SGDH 4QF1B 3B4NA 3QIWD 2DJUA 3VFOB 3QUYC 4WEUD 3PWNA 3EAKA 1F11A 5IB4A 5F9OH 1ZWIB 5IEHB 3TN0C 2BVOB 5FYLH 4G3YL 1E4KA 3ZHKA 4V1DE 2Y06H 4F8TA 1H3TA 3MMEA 5JHDD 3HAEA 4Q0XH 3DI2B 4ZUWB 4MAYB 3C6LB 3V6OE 1CXKA 3MRLB 4RZCA 3BYYA 1B2WL 3IVKA 2W9LA 4Y4KD 1WBZA 2PTTB 2Y5EA 3QXDB 4AT6A 1S7WA 2VLJD 5CKGA 4OTXL 2CK2A 4R4NC 3P40A 1BJMA 4YWGL 3T1WA 4PB9H 4GW1A 4P5MB 3O8XC 5GSRA 3ILQC 1E6JH 3RVVD 1QLRB 4P3WA 4PJ7A 3SY0A 5D8JH 1VACA 4A2MA 5LGJB 4OQ1A 3C09B 4XHJD 4YHKH 4L5FH 4YR6B 3VXTA 5CMAB 3U9UB 4M3KB 4FTVD 4MNHA 1ZT4B 2ESVD 3P73B 1EHLH 1G84A 1J9CT 3O4LA 2P5WD 1TITA 3EOBB 1QPPA 3D2UA 5C3LD 1U2HA 3BKMH 1K3ZA 4HMDA 2KZ1B 4X4XA 4M5ZH 5C6TH 1NAKL 1K2DB 1DN0B 5ACLA 1EA9C 2MKWA 3I02A 4Q2ZB 5GGSB 4TQEL 3BO8B 4UBDC 1D9KD 4K3JH 3BGMA 5HVWA 4YDVA 5EWIL 1BZ9B 1KCSL 4PJDB 5FM4A 1RI8A 2FJHA 1UACL 4O51B 6FABL 4Y5YC 2YD7A 5DQDH 3E1F1 4JAMB 2UYLA 3ZE0E 1R3IL 1GSMA 4G6AD 1TLKA 4DKAA 4YNYA 1VHPA 3WNOA 3GMLB 5KS9E 3BHBA 4JFEB 5K9JH 1JYXA 1T1YA 5BZDA 5I2IA 1DBAH 3D3VB 1CXIA 1I1AB 3H42L 3ZTJH 1HSBA 2VLJE 1D5IH 4TVPL 5BQ7B 4MS8D 2DQDL 1PYWB 1LHZA 2WUBH 3U0PB 5DVOA 4OUUB 3WFEH 5E8EA 3ES6A 2D7TH 2I9LA 2R1WA 3EDEA 3W0WA 1AJ7H 5F9WB 3F8UB 1L0YA 2H2SC 4Q74A 3RY6A 1HQRB 1J05A 4KJPD 1RUQH 4LF3A 2JJUA 2YC1A 1G9ML 2ITCA 4HEPG 4KQ3L 4RSVA 3IB4A 3QDMB 3X3GH 4MDIB 4PJBB 2FJFB 2P5EE 3GM8A 2K3TA 4ZFOL 5IMMA 4PRAA 5E6ID 1CS6A 2ZUWA 1T22B 2D0GA 1KG0A 5LBSL 4PRNA 4JLRB 1WBYB 1LE9B 5E2JA 3LRSB 3O3BA 1KFAH 4N8PA 4HT1L 2APVA 4MJ5A 3D39A 5KVFL 5FOBB 2EH8L 4G3YH 4U1LA 1F4WL 4G7VL 3HI6H 2O61B 3WHE0 5FYKD 5K9OB 1NLDL 3LAFA 3DVNA 4JCMA 1JZ8A 1ZA6A 1A6ZB 1B2WH 4YDLC 1LK3L 4FFWD 4NHUA 2CDGA 1Z5LA 4HWZA 4U1HB 3TBWA 1KJ2L 4PTTB 1C12B 3BIBX 4MAYD 4LVOB 3C6LD 4PG2C 1G9MC 4LLQA 4D9LL 3HZMB 2HLFC 4RFNC 4XZUA 3B2UC 4OTXH 5FYJE 4NQSA 4YWGH 3O0RH 2OX5A 4N8VA 3P0GB 3P4LA 4PGCA 3BD4A 1H8NA 5HHNB 3LQAL 4IHOB 4MSWA 4PLJC 3RQ3A 4OCSL 5F7DA 3TPKA 4AH2A 5I1EL 3QCUL 2HFTA 4CU6A 5ISZE 3MV8D 4UINH 1QSEA 3IDIA 4KJQD 5IMOA 5SWZB 5C70A 2VSCA 4IOFD 4LSSL 5A43C 3MMEB 1RU9L 3SHSA 2AW2A 3JTTB 4MJIB 3HAEB 3ZYJA 1NAKH 2IQ9L 4I48A 5L2KB 4LVNB 5BO1H 5I1KL 3BGAA 3FHAA 4TQEH 3OKYA 3PJSA 1ZK9A 1OL0A 5F8QC 5EWIH 1KCSH 2PTUA 2GUOA 4HUMB 1ZHBB 5JW3L 2EYTB 1DQJB 1X5JA 1S7WB 1QTYT 6FABH 3DECA 1QHOA 2MNUA 2FL5A 2LU4A 1HILA 1G0XA 3FRUA 5GSRB 3GSOA 3MOQA 3A6BL 4DGVL 1R3IH 1U8JA 5TQ0L 5ID1A 2YEZB 4U2ZA 3WJLC 4QRRB 3KXFD 4ZOCA 4XI5C 4GKSA 5EN2B 4U6XA 4OM1H 3ZKND 1EPFA 5J9PB 3K8MA 4HIJA 3H42H 3BOVA 4MX7A 3AROA 3O4LB 4F2MA 4PRPB 2Z4QB 4JFED 2VZOA 3C5SA 4HC1L 5CWSB 2EYSA 4P5KB 5E24E 4U1SB 4X7DC 4X4XB 2ARJA 3T3ME 4J4PD 3D3VD 1I1AD 4XVSL 5F6HI 2MJWA 3L6FA 4KMLB 3CGTA 3I02B 2FJGB 1VFOA 2A6JA 3BGMB 4PREA 3T0EC 1J0IA 1G9MH 5DK2B 4KQ3H 4ETQA 3A6OA 2CLZA 4UB0H 3WFZA 1H0DA 2P8PA 2FJHB 3TVMC 4POZC 3ZE0F 2PXYA 3ARQA 1BMGA 1X5GA 4I8DA 5LBSH 5KS9F 3CDYA 1KBGL 4QRUA 5DWUL 2EDOA 3OSKA 4I77L 4HT1H 3ZHLA 5KANI 2A6KA 5LG1A 4UDUA 2EH8H 1AD9A 1F4WH 4G7VH 3DX6A 1HHIA 4MNQD 4KRLB 1ZLVH 4FQJL 3CFKA 3G04B 1T0MA 4KI1A 1LK3H 3M8OL 2NYYC 2H26B 4XBEH 1QVOA 1KJ2H 1V3KA 5FK9B 2P46B 3UZEA 1AI1H 3TH3T 4XVTL 4PJDE 4D9LH 4EIZC 2I9LB 4P3DA 1CGVA 3W0WB 3IDUA 3DMMC 1MUJA 3UJJL 5EFIA 3WNKA 4LL9A 4X5XB 3CFBB 2WIIA 3BJ91 2DQEL 3IJSA 3S4SG 2A0LD 3PNWA 4YGAB 3HPLB 5IMMB 5I1EH 4JFEE 4B50A 3QCUH 1CT8A 4P5TA 1HK6A 5DLMH 1I3UA 2DQCL 5EIIB 1IM3A 4Q9BA 3D3VE 2A9ML 3O3BB 5CJOH 4OF5A 1KNOB 4FQHA 4PJCE 5F97E 2NW2B 3CMOL 4IDJH 5ILTL 3D39B 5F9DC 2HRPL 1CFBA 4LSSH 5IVZA 4U1LB 3TH2T 1RU9H 3H9SA 4DEPB 2IQ9H 5I1KH 4QLRA 4YLQT 2R0KL 3MCLL 5C8JA 2I07A 4OGAC 3OB0H 3H8NA 3SGKA 3VE0B 4UQ3A 4OM0L 3QXVA 1ND0A 3RZCC 4Z5RB 3LQZA 5JW3H 5JW4R 1IGCL 1M7DA 3IFOA 3D18B 4LLQB 3T2NH 4PJBE 2ATPB 1R3HA 3OR7A 4KVNH 2Q76A 5CEYA 3OKDB 5K9KB 1RFDH 4NPYB 5J12C 1E4WL 1V3JA 5IWLA 4F7EA 4KKCD 3A6BH 4DGVH 5TQ0H 3P3YA 1UQSA 2VL5B 2Z92B 4JKLA 4KRNA 1HHJB 1AXSA 5GS2D 4CVXB 3P9MA 4IMLA 1OWWA 3MV11 3MR9A 8FABA 5HDLA 4OZHB 4CUCA 4APQC 5CP7A 4L8CB 1X4ZA 2P7TA 4HC1H 2CUIA 2ZUYA 1JCKA 2FBJL 3RL1B 2C4FU 3P0YL 3MPCA 1I8IA 3MJ9A 2CLRA 1VFBB 4XVSH 5DK0B 4I48B 3AS3A 3O4LD 3NVQA 3F7YB 2K9UA 4PS4L 4W81A 5B4MD 1A14L 5I71C 3PJSB 1FFPB 3X14A 3SPVA 1X44A 3DUSA 5JUEL 2AGJL 4KGLA 3MNZA 1ZV5A 3WDJA 1FL5A 3UBXI 1G0DA 2AEQL 5JW5B 3BPOB 3BRFA 1KBGH 1HILB 5DWUH 4I77H 5DVNA 4ZPTB 1GCFA 1J7VR 1FYTA 3EO0A 4B7LA 4E0RB 4GKSB 4M6OL 2F15A 3UJIL 4RNRA 4FQJH 1QPXA 4MJIE 3TO4A 3C8KB 5L2KE 3M8OH 4U0RC 5E94B 5T1DH 4CVWA 2Y5TB 3K74B 5FOJA 1K85A 4XVTH 1T7WA 4Y88A 1T04B 3SJVA 1AQKL 4ZG1A 5H35A 3GM0A 2DLTA 3BPLC 4RMRA 1J1XH 4R7NB 1CDJA 3UJJH 1OAXL 2EZ0D 3BZFA 1ODAA 3V79C 1VESA 5IROC 3E0GA 2QSTA 2A6JB 4PREB 3ELAT 4GMTL 4NBZB 3QH3A 4ETQB 2DQEH 4P4KA 2CLZB 3W0WD 4TRPL 3VMOA 1MLBA 4QRRE 1H5BA 3VFRA 3U46A 5ESVA 2DQCH 3TBYA 3TBVA 2YSSA 3CCHB 2A9MH 4QRUB 5KW9L 3O9WA 4CNIA 4J3SA 5EZJB 5ILTH 3CMOH 4U1KA 3VD7A 1MREL 2QADC 3O4LE 4P3CL 4WEBH 2DWDA 4PRPE 1AD9B 1S9WA 3O41A 1CQYA 2JTDA 2XZQL 4PRDA 5HD8D 4WI2A 4U7SA 5L7XL 3CFKB 4M62L 1MHCB 4PJDF 1CXEA 2QR0A 2BRQA 3D39D 5IMKB 3M07A 1MSPA 4OM0H 2DI8A 2HFEB 3QWRA 4G6ML 1IGCH 2JELL 5D1QA 5DJYA 4HKJA 4QRSB 2NPLX 3K81A 3QULB 1K8DB 2BX5A 2MCPH 3JWDC 1NGYB 3QA3B 3ZTJG 2A6IA 3QIUB 3BE1L 1Y0LA 3ARGA 4LEOA 3PNWB 4FQ1H 4D0BA 1U42A 2RB8A 4PJCF 1R3LA 2IH3B 3ARTA 4P2OA 4L8DA 3AAZB 1IM3B 3PL6C 2FWOA 4X4MA 3P0YH 5I75B 1I3RA 3PGCA 1I1RA 4XWOC 2F19L 3FAXA 4GAYB 3OJMB 4M6ML 1ZSDA 2Y1VA 3W0WE 4YHYC 4PS4H 1JPTL 3UROR 4UOJA 3THML 5C8JB 4HPYL 4PJBF 4WI4A 5BZWA 5DI8A 1MAJA 4YHOL 5JUEH 2AGJH 4U0QB 1IAOB 2ZNXA 3L7FA 2AEQH 5L2JA 3BH8B 3BW9B 3MLRL 3MREB 4XAKE 4N0UB 1UQSB 2CIKA 1J0HA 3D39E 3S88H 2YOCA 4TOYL 4I9WD 5KJRL 4HUKB 1TETL 1AXSB 2E7LA 1ZLVK 1XF1A 5I73B 2VZ1A 3DI3B 2XG5A 2O5ZL 4M61B 3MR9B 3IU3B 3O3DA 1T1WA 3RX7A 2XWJB 2YMXL 2CKBA 4XGZA 1RJCA 1AQKH 4HMEA 5CLTA 3N1QC 1OAXH 3IJHA 1JL8A 5D7JA 4GMTH 5GS1A 4HKBA 4P4RA 4TRPH 1IL1B 2OXGA 3R1GL 3ARFA 5C07A 2WV3A 3S98A 3RX8A 1KJVA 3VFUB 1MVFA 3N85L 1R5VA 4R3SB 5ECJE 1VA9A 1SJXA 1N2RA 4JFYA 5DD1L 1MREH 4P3CH 3CFDA 4OZHE 4YHML 2HLAA 3VXOB 2PXYD 1RZ8B 2XZQH 1X5AA 5L7XH 4GXUN 3TO4B 2WSKA 4M62H 5JO5A 3KYKH 3QISA 2AK4B 1S7RB 2J8OA 1G7LA 3OB0K 5IW6A 5F7HA 3RPIA 2G60L 2ICWA 3FO1B 3QJHA 3BYTA 2EXYC 4G6MH 5J0BA 3R0MA 3V2AR 2JELH 3UX9B 4MXVF 3LRHA 3I6GB 2D9CA 3MLSH 5H35B 2NXZD 3EYUL 4PJ7F 1CDGA 4LBEB 4I9WE 3ARPA 4F7MB 3T1FA 3BKJL 3BZFB 5A2JH 4DUWA 3BE1H 5CILL 2XRAL 5EBMA 1IKFH 4Z6AT 3QH3B 3LZFL 3MGOB 4Q58C 4P4KB 1H5BB 5FA3A 1ETZB 1IC7L 1CE6A 3GO1H 1T66C 4LCWA 3QIUD 3QUXA 5E9DA 4F3FA 2DLIA 5IEKB 4HV8A 2YSSB 4R9HA 2JKXA 1KULA 2FHBA 4FZEL 2DIJA 1CK0L 4JDTL 3Q3GB 1S9WB 1QO3B 1EEZB 3QHTC 4XPAL 3O41B 4P5TD 2JJWA 5D7SL 1FGNL 4TNWK 1JZ2A 2BVUA 4ODWB 1JPTH 3THMH 2R2HA 3TT1L 5I16B 1U3JA 1T7YA 4KTDL 5I8OL 4G6JL 3B9KA 1KUMA 3LVEA 3OXSB 5JZ7D 4JZOA 1F3DJ 1YA5A 3H9SD 5B38G 4CAGA 5DJYB 4M02A 1KEML 2Q3AA 4EI6A 4CDGC 2X44D 3R8BB 4UAOB 1VB9A 3MLRH 3BZEA 5SWQA 2A6IB 4QRQA 1SY6H 3GUTB 4MVBD 3DRTA 2J5LC 4QKXB 4TOYH 2NY3C 4P0DA 5KJRH 5DEFA 1TETH 3FT4B 4NZJA 4Q6IA 3TIDB 2DQJL 1FIEA 4RIRA 3O81A 3I3EA 2O5ZH 5CJBA 4IBLT 2H2PC 4A2LA 2FWOB 1YYLL 1F8TL 3HLAB 2BNRA 3T3PF 1TZGL 2Y9RT 5D6DC 1S9VA 3WFCL 3DYOA 1AC0A 1NC4B 2YMXH 1I3RB 2D4FA 5FUCC 4NQDA 4ZQKA 5FDWA 2W65A 1U9KA 1HYSD 3PABA 4Y2DC 5EUKB 3BP6A 1ZSDB 2HN7B 5HI3D 2OJEB 1C1EL 1IT9L 5KSBB 1I9EA 3CZFA 1TJHL 3QG6A 4Y4FB 4R6UA 2XWTB 1N59A 3R1GH 2BK8A 3VFNB 3L7FB 4NN5B 4IOIB 5EU4A 1BX2A 1CZ8L 4PJFA 4Y0GA 3IETB 5DD1H 2FR4A 2CIKB 1EVUA 1EUUA 1X6LA 3VGBA 4YBLC 1AFVL 1NAMA 5DJAB 3H9SE 3MA7A 1YQVH 3HNVL 3VA6A 5IG7B 1DFBL 1XR8A 4L9LC 1FYTD 1A3LL 5KSAB 2G60H 4KI5D 1BGXL 5HYIA 1OW0C 1BQLL 1H3UA 3TO4D 2LVCA 3GMNA 1AR1D 2FATH 4ZAKC 4F7PA 1N0XL 3CLEL 3I84A 2H9GB 4AIZA 3U48A 2YD8A 5DT1L 4Y19A 3BKJH 1AD0B 1UKQA 3BN9C 5T5FL 4QTHA 2XRAH 5CILH 4K71C 5D7JB 4F33A 3TCXA 3FZUC 3QQNA 5GS1B 4N0UE 4BZYA 3SJVD 3BQUC 3GI9L 1FNLA 4M1DL 1XH3B 1U92A 1NBVL 4M9PA 1YUHB 1IC7H 4DVBA 4OZHF 1UB5A 4LKCA 3D87B 4FQXC 3MJ6A 3RTQC 1YEDA 1WT5C 1JPFA 4JFYB 4P4KD 3DGCR 4FZEH 1CK0H 4JDTH 1AGCB 1G6RL 4XPAH 2PNDA 4G9DB 3RX5A 3G5YB 1FGNH 2OI9B 2YPKA 3O9WD 1QA9B 2GHWB 4EVNA 3TT1H 4KTDH 5I8OH 4G6JH 4POYA 2BHZA 1XIWA 1ZKAA 5FKAA 3ARBC 3RPIB 1KTRL 2D9QB 5HHOA 2ICWB 2NY0B 5DR5L 5J11C 3MGTA 2ERJC 4XXCC 1CN4A 1EHAA 5CEZL 3L5WB 2HKHH 1BREA 1CDUA 2AXFB 3GSRA 4D0DA 4L4JA 1BQSA 2QL1A 3QWRD 4PYGA 4G8GA 4KK6C 3MCKB 5B39A 1OCWL 2BOCB 4MZ2A 4F9LC 2I25N 4PJGB 1ZT7B 4ONHB 4BJLA 3I2CL 2DQJH 3TZVB 4LCWB 1NMCC 3GJFK 5D70L 5DJ2A 2VMFA 1N4XL 3ARGD 1YYLH 1OLZA 1F8TH 5B8CC 4OI8A 1TZGH 1MCIA 2FD6L 3WFCH 3LSOA 4P2OD 5JOPD 1A4KA 4R7DB 2AEPL 3LEXB 5AEAA 3EDDA 5GSVB 5C0FB 2WP3T 5HGBA 1HEZA 1C1EH 1IT9H 5DZNA 3UTZA 4U3CA 1TJHH 3MROA 4AZ8A 1MCOL 1YNTA 3RL2A 1VGKA 3GBML 3VI3E 4CGTA 1TVBB 1OSPL 1QRNA 2X05A 5BOZG 4M1CD 2PTVA 3QPQD 4NZTL 2FGWL 3DRTB 5T33L 1A9EA 1QLFA 2Q1EA 1AFVH 4Q6IB 2OTWA 3QEGH 5IBLD 2VZ3A 1VEMA 1Z9MA 3KWWB 5B22A 4BZ2H 1DFBH 4RFEA 4LLDA 1GXEA 1ZTXL 1GYAA 5CCKL 4AMKL 5D1ZC 3PQYA 2FECI 1BGXH 1BQLH 1S9VB 1TTUA 3ZHDA 3MBXH 3NA9L 1KT2A 1MCCA 2BSED 4ZSOA 3KNBB 4NQDB 2W65B 4FS0A 3FQUA 3QBTB 4JFDA 5DT1H 4XH2B 5DHVA 1GRWA 3NN8A 4LP5A 2NZ9D 5T5FH 3G6AB 3DX9A 1I9JL 2XZZA 4GMSL 4KUCD 4F15B 1AGEB 4UZGA 3GI9H 1NBZA 3LDBB 3KPMA 1NBVH 2XN9B 1MY5A 5AYQA 2R0WL 1GZQA 1N59B 1AIFB 1M7IA 3NH7L 2O93L 3NGBB 1YDPA 3RUGA 4OIAA 5D7JD 1X3DA 1BX2B 4GRWF 3L3HA 4PJFB 1H15A 4Y4HC 2VDNL 3IDMA 5B3NA 1JHLL 3T77A 4X4ME 5A2LH 5MEPB 3WSQL 1JZ7A 1G6RH 5C07D 3JV6A 1HHGA 3ZKMC 3V6ZB 3MA7B 1EDQA 3VXRA 5DURB 2V5RA 1T0PB 3QFDA 3DVGB 3MBEB 5AZEH 1R3JB 5DR5H 1U6AL 3BKYL 4EQ3A 1LDSA 3MRKB 5CEZH 2B39A 3QZWG 3IF1A 4PJXA 1G7IB 5LXGL 2Y07L 2GCYA 4NRYB 2GW5A 3QO1A 5HHXL 2IH1B 5C0IA 5K9QG 4MMXC 1EFXA 1YY9D 2EKJA 3ZE1E 5EG6C 1G0YR 3QUZA 4YE4L 1XGPA 4F33B 1MCBA 1S7SB 4JFXB 1OCWH 4ZO8A 4X98A 3V6OC 4WFFD 1GVIA 5E4IA 3I2CH 1A3RL 1W72B 3LPGA 1GPOL 3N1GC 3CDGA 4OUOA 1NH6A 4LLMA 5D70H 2Q87A 1N4XH 1JPFB 2FD6H 3KLHD 3HRZA 4G8IA 2PW2A 1E27A 1KN4L 1FH5L 4LCWD 4WI9A 3QUXD 2AEPH 4UOW1 1FFRA 1FL3B 5E9DD 4RWYL 3ARDA 1XZ0A 4JN1L 4XXDA 3J8F7 2DDQL 1JN6B 5ADOH 4LLAA 5FKAB 1I8KA 1AHWC 8CGTA 2P42B 5JDSA 4K8RL 5F6IC 3X12B 1RY7B 3T2QA 1DEDA 4WWKC 2P8MA 3GBMH 4HBQA 4RGMB 4M93C 1ZGLA 2MWCA 3B9KD 5HPMB 5C07E 1OSPH 2XKSA 3QP3A 4KI5F 5E4EC 4G8GB 4NZTH 2FGWH 4KXZI 5T33H 3TA3A 2DOCA 3V6FB 3DX8B 1WISA 3BGFB 2F53A 3MRFB 3QIWC 4UQ2A 5ETUA 5J57B 1DZBA 4NZUL 1ZTXH 5DJ2B 5CCKH 1IILE 1KTLA 4CDHA 4J3TA 3PWLA 4JM4L 5I66A 1M05A 1ORSA 3LSOB 3NA9H 5D7LB 4U1JB 3L5IA 2HVJB 2PO6B 1N6QH 3STLA 1IGML 3BEWB 5GGTL 3ARWA 1ACZA 2BNRD 4UNVA 2F58L 4GFTB 2V5MA 1ZLUK 1I9JH 3QNXB 4P23C 3VI3F 4NQDD 2BC4A 2X4QB 2R0WH 5D7IA 1G7QB 2GSGB 3NH7H 3ALWA 4LDOB 3U7WL 4ZUTA 4LCWE 4P2QA 2VDNH 1FCGA 5E9DE 2WQ8A 2Z31A 3FQRA 2FX9L 5TDNA 3WSQH 5F3HB 3RVVC 1WEJL 1A9EB 5ACZA 2DLEA 3LKRA 3G9VA 2OTWB 4XHJC 4EI5A 1HHHB 2BXZA 3ZKSD 4HUXA 4RFEB 2ED9A 2YKLL 1X7QA 2YXMA 4X8JB 1U6AH 3BKYH 5FYJL 3S4SA 4OLZL 3SGJA 2VR9A 5LXGH 4XNQB 2Y07H 1ZVSB 5CSZA 1G7HA 3GKWL 3MBED 5HHXH 3HUJA 1IQDA 1KPRB 4FXGA 3SDCA 3WFBL 4H26A 1D9KC 3HMXA 2AJYL 2CIIB 4MD5B 4U05A 5F21B 3WIFA 5DTFB 2LVEA 4CRPA 3O2WL 4KU1A 4XTRD 5DYOA 4KDVA 4Y19D 3RVWC 1GPOH 4JY4A 1M7IB 5EOCL 3H9HA 3CH1A 3Q1SL 1YDPB 4CKVX 1D5MA 1NMAL 5IVOA 3SKOB 3T77B 3UTTA 5I6XC 4DUXA 4HUNB 1KN4H 1FH5H 3MJGX 4RWYH 3JV6B 1HHGB 2I9TB 4JN1H 4Q7DA 3U0TB 4NQDE 5FO7A 2DDQH 2GJZA 5C0GA 3ARRA 1JNHB 1FNSL 1KGCD 3G6DL 1CG9A 5TPWL 4MS8C 1R3KB 1KPVB 3ZE1F 1ZXQA 1WICA 4ZO7A 1WUNT 2XN9E 3QO1B 1XIWD 5IVXB 4HK3N 5FHAL 5F88B 5HHOD 5C0IB 3Q6FA 1HE7A 2ZG3A 3VI4E 4PJFE 4WTZA 1XGPB 4TN9A 4ZD3L 1U8MA 1BM3L 2VDLL 5ENWA 4PGDA 4M48L 4RMVA 4X98B 1Y18B 3ZT7A 1YYML 4Z0XB 1OAKL 2CXKA 3MLTA 4G8GD 5E6IC 4M7JL 4NZUH 3SKNB 1J0YA 4KUCF 1WFUA 1MJ7L 1OTTC 4KY1L 4P2RA 3NFSL 4TNVF 4O58L 1IGJA 5EC2A 1ZAGA 2X4UB 3IKKA 5T5NG 4RBPH 1D5ZA 4CL7A 4XC1L 4K55A 1IGMH 1N3NB 1JWUB 1YEGL 4M9OA