4GMTL

Crystal structure of heterosubtypic fab s139/1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
b'DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQEKPGQSPKTLIYSASNRYSGVPDRFTGSASGTDFTLTITNVQSEDLAEYFCQQYNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab S139/1 light chain
publication title Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmtL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmtL01
4JHBA 3EUUA 4U1LA 4Z7UA 3OWEA 3QEHB 4ZPVA 3B9AA 5JUEH 3TM6A 1VPOH 3QUZB 3V5HB 5I75C 3KS0H 5F72S 5K9QG 4F3FA 1Q9OB 2Y5TB 2VDQL 4XPFL 3C5ZD 1VESA 3EO1A 3RY6C 3U46B 3U30B 1R5IB 3O4LD 3V6FB 3F7VB 3SGEH 3UTQB 4S1QH 3HI1B 2FECL 1S7XA 4QRRA 3HCVA 3VU2A 5DK0B 3ULUF 1NGWA 1L9NA 1KCUL 2VSDA 4Y4FB 4MJ6B 1BZ9A 1QSFE 1PX3A 4JFZH 1HN1A 4XBPA 4JDTL 1IQWL 2ZG1A 3NGBB 1IEBA 4QYOB 4KJPC 2AI0H 2C3HA 3HNTL 3FQTA 1S7VA 4ZAKB 4JFQB 1HOCA 4GRMB 4Z7WE 3U7YL 2R39A 5C08A 4KJYB 5F1IA 2R56L 4EUPG 2L7UA 4BSWA 3BZDA 4OZGE 1VSCA 4HUXB 4GRWH 1CI5A 1X5KA 1ODAA 2OMNA 5ESQA 4HZLA 5ESVB 1V7MH 5T5FL 1GIGH 4WO4D 4NFCA 4JM2D 1UB5A 1FL3A 1R3HB 3L95B 4OLYL 5DURB 4XP6L 5ITBH 1QTYT 1BQHB 4IRSC 1HEZA 4L29B 3O6KH 5BW7C 4IDLA 4BZ2L 4D0DA 1S7RA 4U1MA 4P46D 1S5HA 4XGZA 3QPQC 4NUJB 4NZUL 4F33A 1ORSA 1XGPB 1CICB 4KKAC 1HHHB 1KENH 2YOCA 3VCLA 4C59B 4H1LH 5EOQL 4POZD 4HKXA 2R1YA 2PTUA 4S1DD 3ARFC 3U4AA 4LGPB 3EOAB 4Y4HC 1JZ7A 5D2NA 4Y5XB 4KZDL 2QADD 2NXZB 2YWYA 1GH7A 1ZAGA 5HDLA 2HT3D 5FOJA 4M8QA 1IAOB 4X6DB 4KRPC 3V5DB 5J3HD 1IAII 1MPAH 4ERSL 2CRMA 3DI2B 4KDTC 4PJBF 1SMOA 2IAMD 3CU7A 3O6FC 4P2OD 2GK2A 4IRJB 3RY5A 4PGJA 4JRYE 3OKMB 1FFNB 1TIUA 3OKDA 4AM0B 1OAUL 1OHQA 4Y16D 2J5LC 3G5YB 1FZJA 3E6HB 1AHWC 4ELME 3MODH 3CFEA 4UOW1 4E9LA 1OSPH 4QXGH 3V6ZA 3MRGA 1LO0L 3RVWC 4PRHA 2UZYB 2NY6C 1KTLB 4JB9H 1I4FA 5E9DD 4ZD3L 2VKXA 4HUVA 3EFFB 3PGCA 5MENA 4LEXL 4HWBA 5LWYL 3S34H 4Y4KD 4HLJA 1OY3B 4IHOA 1IKFL 4NO0B 3PL6A 3MV7E 3MRHB 4ZPTA 3QEQE 2PXYA 5FYLH 3BHBB 5C07D 4Y1AD 1T7ZA 2R23B 2NZ9D 3K81A 3KPLA 2M2DA 3ZTNH 3SE4C 1YUHA 1HWGB 4UV7H 4ZFFA 4KI1A 5GSVA 1B0WA 3FQUA 5TE6L 3KPRD 2YRPA 5EZOH 2E7CA 4LSTL 1CIDA 3OBAA 3KPPB 1TTFA 3B2UC 4PY7A 3DVNA 5F97E 4Z78B 3LQAC 1WF5A 4IIQC 4OF7A 5EUOE 3VRLE 2NXYC 5SV3A 1F3DH 4NM8H 1LQSR 3OX8B 3MLTA 2R2BA 5GS0H 1TVHB 2NX5B 1JPSH 4AT6B 1X5AA 1G7JB 5EOCJ 1CGYA 4K7FA 5HYQB 2UY7A 1G7HA 3H3PH 3JVGC 4MQXD 2YD8A 1EX0A 1OAZL 2W0PA 2AJSH 3BO8B 5IB1A 4YR6A 1M71A 2HJFB 4LSSH 2GTWA 3MLSL 5EBLB 4DCQB 3M1BB 2ARJQ 3GFUA 1CLOH 1HNFA 3QT2A 3FQNA 4KUZL 2XACC 1JHLL 3BEVA 3UC0L 3MMEB 4KKLD 1N5AB 1CLZH 1NCBL 2DQUH 3G5ZB 1NMCB 1FN4A 1Q0YH 1VACB 3NIGE 4Z7OF 4NWTH 4RDQG 4Z7NE 3C08L 4R0LA 3FL7A 5C0GA 3QIUB 5DR5L 5C0IA 1MCOL 3PWPE 4JFDE 4R7NA 3TO4D 3HS0A 4DZBA 2B0SL 3WIHH 1TJIL 1NC2D 5DRWB 1CT8B 4LCYA 5I17B 3PDDA 4YWGH 3IT8D 1QFUH 3GRWH 2EYRA 3FFCD 5D1QA 2D31A 3TCXA 2IADB 1EZVX 2R2HB 2JELL 4QHKJ 4KMTL 4DFIA 4PJ8C 4HW6A 3QUXB 1DFBL 4QF1A 4GKZB 1RIHH 4E41A 3HNVL 4AENB 2Y07L 2JB6B 4J23A 5JQ6H 3I3BA 1BWWA 1YYMH 3QCUH 4DK3A 1S9KC 4G8GE 5FYKL 4GRLD 2YSSB 4GRWE 1TXKA 3DGGB 1P4BL 4H25B 4PJGA 4YHMH 2IANA 3RNQA 5B8CC 4MA3B 5DLML 5BRZA 1KC5H 2Z31C 5F1KC 3I84A 3O41B 4NZTH 4X7TA 4NRYB 5DHVH 4J8RB 5FKAB 3UZEA 2VMFA 4HLZG 3TT1H 2CUIA 1MFBL 3FQRA 3NOIA 4GO6B 3JV6B 1K4CA 1JNNH 4LMQI 1ZT4B 4M7ZC 3QFDB 1M6OB 5AEAA 1Q94A 5I1KL 5HYFA 3WJJC 4I48A 3HNSL 3EZJB 1LDSA 2Z8SA 5HDBF 4KROC 5CILL 5JW4Q 4RWYH 2UZIH 1FGNL 3Q5TA 5FA4B 1CL7I 3DTXB 1FL6B 2OZ4H 4CMMB 5L8JB 2R4SH 4OCRL 2BHYA 5DEGB 2F8XC 4CVZB 1YEKH 5E2UL 4FQ1H 1VHPA 1H8NA 3GHBL 4HZAA 1KEMH 4PJHA 1Z9OA 3C60B 3WE6B 3RWDB 5KSBA 1CIUA 3DRQB 1I8MB 4NRXA 5IV2A 3ULUE 4PS4L 5E1AA 2V6HA 5C0RH 3IDJA 5DGRA 5J8OA 4NO5B 4WWKC 4PJ5D 5HSFA 3CC5A 2P42B 3MRNA 4KK9D 4XVJH 1BZQK 3RGHA 2ICWI 1A6WH 4NUGH 3O4LA 4O02H 3SCMA 3UTZA 5FO7A 4WWID 2OM5A 4P23C 4LF3B 2Y4SA 7FABH 25C8H 5C6PB 4XC1H 2AJ3B 4G9FE 1RJYB 3MV7B 4MNQA 1YNTA 3BKML 3X12B 3MRBA 3QI9D 4X8JB 5I8EA 3P77B 5IBTH 5DEFB 1BFVL 4QTHB 3H7LA 4I9WE 1M05A 3CNKA 3M07A 3UYRL 2DF3A 2V9QA 4NQVA 4F7TA 2DLEA 3FHQA 3KYKH 1T1XA 4TUOB 5LGJB 1U8OB 5D7IF 5SWSD 1XGQB 2I5YH 2NY4D 3GSNL 1AR1D 3CFBA 4H26A 1WWWX 3MACL 2VQUA 2X4TB 4MX7A 4PRAB 3TBTB 1RFDH 2BSED 2IBGA 2GTZB 5C0BD 1I3VA 5J57B 2D7OA 1W0WB 4Z0XA 1KB5B 4LOUD 5IFJA 4NIKB 1UM6H 5EUOB 4UINH 1EMTH 1I7RA 3REVB 3LDBB 4YK4C 4D3CH 4P46A 2XTLA 4AEFA 4LU5H 1GZQA 4LDEB 3GMPB 4X4ME 4F7PA 4DOHE 1IKNC 4GT7A 5T1KB 3PG2A 4LSRL 1K4DB 4DN3L 2PCPB 2Z92B 5M94B 2LAGB 4KK5D 1PQZB 2G5BA 2CIIA 5A2KH 4J2XA 5JIHA 3QFJE 3GSOA 4HG4J 1YEFL 5F88B 3ARBA 4YDIH 3ULVD 1ZLUH 4PJBE 1XIWC 3MV11 5FECA 4HPYL 4JJHA 5JQHC 3EZ8A 1NJ9A 4K3JL 2BMKB 2VLRE 2FBOJ 3H9ZA 4WV1B 3J8F7 3LRSA 3PWPB 5B3JF 4JFDB 3MXVL 4PRNA 3GK8H 5CP7B 4FNLH 3WJLA 5DHXB 1IM3A 4YLQT 2HTKD 3QRGL 4O58L 3CUPA 2WSKA 5IEKA 4P2OA 3GBNH 4DZ8A 3RI5F 4NZRH 1VENA 3OXRA 3CLFL 3T0ED 4U1SA 1XH3A 2P44B 4JLRB 4MXWL 4LGRB 1DSFL 2DQDL 2OL3A 1GHFH 3K4ZA 4HV8B 3TIEA 3DO7A 2RCSH 2A6DA 2FSEB 4G8GB 3T2QA 2GEEA 3SEPA 1GSMA 4ZUSA 1HI6B 1SMAA 4GRWB 3MGOB 5GGRY 1EVTC 3NCCB 4QNPF 3GJFH 5ESAB 3BYTA 1A6VH 4AEIL 4PRBA 1EEZB 1NBYA 2JF1A 4PREA 2DMKA 4ZOBA 5EWIH 4XT1C 3STZA 1NGPH 4KVNL 4TSBL 3I6GB 2ADJB 2EKSB 1E6OH 2ATKA 4GH7B 2OXGA 4RGND 4Y1AA 3SGKA 1S9XA 2RFXB 2VR4A 5CD3B 5C09B 3IAQA 2X6MA 4YO0A 1DQJA 2EYTB 2KZWA 3H9SD 4OGAC 4H1LB 5L0QB 2UUDH 5K9JL 4I8DA 1RVFH 4OCSL 4EDWH 1IBGL 3FONB 4GFTB 2YR3A 2CKNA 4WW2C 3KPRA 2ZP0T 1GOFA 3WS3A 3N9GL 4DEPC 5EPMA 4YNYB 1MFEH 4XP4H 3O3DB 2VLKD 3FZUC 4R26L 3O3UN 5E6IA 1D9KC 1I7TB 4GUPA 3WEXB 1E4WL 2R2EB 1JK8B 3L3IA 5ACZB 1IRAY 3VXUD 1AC0A 2V2TA 1ROWA 3FB7A 3VFUA 3MYJB 4TRPH 2PO6A 1A6AB 3EYQC 5CGTA 4D0BB 1U93B 1WIOA 1OWWA 4Z7OE 2J6EL 1U8HA 5MHSD 1U58B 3NCBB 4G9FB 2GQHA 1BIHA 3HZKB 1T3FA 5CJBA 1HYRC 2H3NB 1F6AB 3EO9H 2Q87A 1TVBA 3GB7A 4DTGL 2EC9U 5EIIA 5FF6A 3L5JA 15C8L 3WO4C 3WKMH 1I1AD 1KTDA 4WTZA 4DVBA 5JZ7C 4YHOL 1HH6B 4HUMB 3BDXA 4ZUUB 4ZSOE 4KJQC 5IJKA 4KHTL 5I15L 5EFIB 1NC2A 4KQ3L 4XMPL 5T1LA 4D8PA 3DMMA 1BZ7B 3CZFB 4BFGA 1K2DB 1F3DJ 2Z8WC 4XXDB 3WIIH 2F53D 3FFCA 2I9TB 4U1NA 4IJ3B 5DO2C 1FPTL 4TOYL 3MLUL 5T1MB 2DBLL 1R0AH 5F6HJ 3T08A 3SE8L 1T03H 5D1ZD 5GIRA 3CZJA 5IB5B 2C26A 1DQQB 2P5EB 5SWQB 1CD0A 3V6OE 3WUZA 2VXSL 2CJUL 1JWMB 4NNYB 3MV8E 4ZS7H 3PP3H 2P24A 4MDJB 5HDBE 4DOHB 4WJ5A 3V9FA 4AJ0A 5ERWA 4XHJC 1D5BB 2YD6A 1LO4L 3O2VH 4X4YB 4PJBB 4N0FB 3STBA 1MF2H 3ILPB 1UYWH 1E27B 5EO0B 1T89A 1IJ9A 1PBYA 3HTLX 1S8DA 3O9WA 2X4UA 5L8LB 4XRCA 4MA8H 1MSPA 5IB2A 4QGYA 1VEMA 1F6FB 3DVGA 2VISA 1AR2A 1NGXA 3CSYA 5GSRB 2W38A 4KK6C 2X05A 5DD5L 4W68A 2QSVA 4GAYA 4FXKA 4YFLF 5TF0A 3GSVA 3OAYK 4HC1A 4WTWA 1AKJD 4XBGA 1TCRB 3DETC 4OAWA 1OAQH 5JOPE 1J0HA 3PWJB 3I3EA 2X1WL 4GMSL 1P7QB 1SJHA 3RVXD 3ECBA 2EDNA 3PDOA 1J05B 3ZYZA 3ARRA 4WU5B 5BZDB 3VWKA 1B4RA 4QRQA 3BDYL 4OT1L 1AO7E 2CO6B 1H15B 3RTQD 4M4PA 5JLZB 2CH8A 3KYAA 3O6LL 1KJ2A 3D3VD 2FIKB 4LFHG 5IKCA 1DQDH 3IXTB 4IOSD 1JYXA 1L6ZA 1J5OL 2IALB 3QCVL 1P9MC 5EG6C 4MAYA 3INUL 3L3GB 2R4RH 2YKLL 4QY8B 1XR8B 5DHVB 3O6ML 5J1AB 4MJID 4JQVA 3WLWC 3WL9B 2J4WH 3LV3B 2BOBA 4HWZB 2YPVH 1QNZL 4JY6B 4B53A 1HSBA 2YEZA 1MHHB 1JJUA 3M17B 3G6DH 3D39A 5FM5O 5FUCE 5IHZA 4OUUA 3ARGB 3IDGA 2QKIA 3B2VH 3BOVA 3RKDC 5FYJL 1C5DB 4HX1B 3H6JA 1LO3L 2GI7A 2A1WH 4KY1H 4NNXB 4HMDA 5IWLC 3QJHA 4ELKA 3BPLC 3T77A 4LCCB 3CFIC 4EVNB 5A2FA 1P4LB 1NAMH 2Y36H 2DQTH 5HI5D 5FKPA 5C6TL 3NCJH 1CBVH 1CGXA 4WUKH 1JZ3A 3O4OC 4NKOA 5GZND 4AIXA 2XPGA 5JHDD 1T66C 4U6XB 4QCIB 3B9KB 5FYKD 4XNYH 4NSKA 5T33L 3DX7A 4ZSOB 1MCCA 5JTWA 1VFBA 5TH2A 4AL8L 3SO3C 3SQOH 3WHE0 4G5ZL 4YHIA 1C12A 5KBNC 3EYSH 3AM8A 3OKNA 5BXFA 5CBEA 3IF1B 1GC1H 5BOZG 1EGJA 4QNPE 3H42H 1N6QL 1JTTA 1YECH 4PLJD 1HCFX 2FH8A 1J18A 4FP8H 3OGCB 1BIIA 1BX2B 2R0LL 1VERA 3TFKD 4LHUB 1KLUA 3MV8B 5D7JB 5JA9A 3KPSA 5HHQB 3P3YA 1GAFH 3PHOB 4KDVA 5CCKH 3MJ7A 4WHCA 1F90L 1DBBL 4XWGL 4YX2L 4JRXB 5IB4B 5GRJH 2GJZB 2ADGB 4OKVB 5GGVL 2AAVA 5F7KC 4EUPH 1BQUA 2VR9A 2GITA 4R7DA 3TA3C 3H7BA 4F2MB 3TBWB 5MERA 3C8KA 3CPLA 1I9RH 2NY3C 4J3VA 5I19H 4C56E 4M43L 5I8CA 1DN0A 1EHLH 3J7HA 3NPSB 4QXTA 4WIQA 5AUMA 1X4XA 2BJMH 1LD9A 2CQVA 1CXLA 3QO0A 2XICA 5EUKA 3T4YA 4I77H 1CLYL 1FH5L 2ZUVA 4F8QA 1T5XB 3RY6A 3RIAK 1J1OH 2AGJL 4XBEL 1IGCL 2GJ6E 2OS7A 4IDJH 1CGVA 5ICXA 1HXYB 4L1HA 2BDNL 5DFVC 4DAGH 2G2RB 5DVMA 2R1WB 5D93B 4U3HA 3FB5B 4DW2L 4EBQL 1R3LB 3HZVB 1Y0LB 1I8IB 1NGZB 1X5YA 3CLEH 2GIYA 3CSBA 4AH2A 1U2HA 2NYYD 3KPNB 1QBLH 3PWNA 4XPTL 3GJFB 2GUOB 4PJ7F 5LXGL 1FLRH 1GOHA 1S9VB 1FVEA 4LLWB 4WRLA 4RFNB 3IGAB 4GQ9L 2DD8H 3VXSB 2W65B 1OCWH 4YDKL 3ZHLA 1JF6A 1QPPA 3QNXB 2R0KL 2VDOL 5A3ID 3VE0A 1AP2A 4Q0XL 1XF5B 3QXAB 5DGQA 1RZJL 2DOCA 5GRWA 4RDQF 4ODXB 2YHGA 2FLRT 4IRSA 4G6JH 1U3HB 4XVUD 3W2DL 5C92A 5BW7A 2DMBA 2MHAA 3BP7B 3MRCB 3O3EB 5E94B 4MJ4A 1OPGH 2P8PB 5I16B 5AAWA 4OV6F 5CP3A 3LMJL 5E1HB 4N90D 2DWDA 1UVQB 4P5TC 3ETBF 1UKQA 2VDLH 4Y4HA 5LAXB 4M5YH 2VITA 3BXNB 3ZYJA 2IPTL 3NBNA 3AUVA 1F42A 2GAZB 1FG2A 3RWEB 4MJ5A 1F2XK 3BI9X 3VD4A 1RD6A 4JO2L 1ZWIB 3LKNA 2ERJB 4KDTA 3WNMA 4P9HH 4PRPA 3O6FA 2NW2A 5F9JB 1JHTB 1VFUA 5K9KB 1NQBA 4M9OA 3MOBL 2HLFC 1B0GA 3U2SA 3BH8A 2BY3A 2WUBL 3R06B 1WAAA 3GSRB 2P7TA 1AHWA 1U8KA 3MA7B 2YPLD 3IDNB 3IFLH 3TH4T 1WFOA 4K9EC 4ONGL 1WFTA 3PV6B 4ZQKB 4LAQL 1MJ7L 3CVHL 4LPUA 5FHBL 2EDEA 3EGSA 1XAUA 2VDKH 4HWUA 1NCUA 1K3IA 4CVUA 2OQJA 3RDTB 1OAKH 2XI9A 2DI7A 5E8NB 3FO1B 5CFHA 3S97C 4YUEH 2HJKB 1DANU 2Q6WA 5GHWH 1DVFB 5FO9B 1AIFA 2J2ZA 4LIQL 4K23L 4KGLA 5E5MB 2VO5A 4K9EL 4U1JB 5ISZD 4I4WA 4P0DA 5D9SA 5A43C 4KTDH 3D3VA 2IF7A 4UTAL 3C6LB 3U9UA 1IVLA 3VH8G 4UQ2A 2HVJA 1VKXA 3FRPG 4OJFH 2VRAA 2CLRA 2KH2B 3TBYA 1QSFD 3S3PA 2C3XA 3AXLA 4KPHH 1HHIB 1YN7A 4S1RH 4LBEA 1LEIB 1TPXC 1N64H 1LNUB 1DQML 1G9MC 5ICZB 3JSSA 2WINB 4C56B 4ODTL 2H1PH 4KDWA 1EUUA 4WEBL 3WDHA 2A9NL 2B2XH 4CVWA 4NCC1 4IIQA 1FYTA 5D6CB 3NTCH 1N59B 2JCCF 1P53A 2WBJC 3FT4A 1IQDB 3JTSA 3QWOA 4YXHL 1FNAA 2YUZA 1S7TA 4FQXC 2Z4QA 1QSVA 4OIIH 5JNYB 1X5LA 4BZ1H 2ZOKB 2HYMA 4LLVB 1VA9A 3VGAC 5JOFB 2FX8L 1U42A 3JVGA 4HLZH 4LVHB 1G9ML 1DBML 3GNML 2V2XB 1K6QL 3EDJA 1V3JA 1MI5A 1KEGL 1PG7W 3VFPB 5T3ZL 3OAUL 1B9ZA 5JORB 4NQCD 1WZLA 5C0CE 1BF2A 3C5JB 2AXHA 5IR1B 2EH8H 5L2JB 4FHBD 5CJXA 3QCTL 5JW4R 4LLYB 1EFXD 2R1XB 3RRQA 5HYJD 2OXHA 5DSCB 4L9LC 4GQPH 3CFDA 2J8UB 5KG9B 4D0CB 2FX9L 5FGBA 5DC0A 5IHLB 4YPGB 2XNAB 5E8OA 3ARQA 3MUJA 2I26N 3DUHA 3ME0A 5E00A 4CAGA 4XPHH 1YQVH 2WP3T 2EXYC 5DJYA 2IBZY 1JGLL 4HT1L 4PJ8A 1G7IA 5HGAB 3D69A 1QFWI 5FO8B 2D4FA 3DOSA 3F7RA 1MJ8L 2XQBH 1G9EA 1J11A 4EKXA 1CXFA 3P11L 1SBBA 1G0YR 4YHPA 3O8XB 3WFEH 3D2UD 3FCTB 3W9EA 2YN5A 3LIZL 3P0VL 4P2YA 2Z31A 1KJ3L 3DIFB 2A0LC 3GMOB 3VFRB 2NY1D 5JIKA 2LAAA 4QXUL 1I9EA 4GG6A 4IEFB 1IT9L 5KANI 1VGKB 2OK0H 4QRPE 1MLCA 1DUZB 1X44A 1TJHH 4MHHI 3EJYD 2J1KA 3NA9L 1QA9A 1JUFB 1MCEA 3HG1D 4G7YH 1JTOA 4UILL 5CINL 1ONQA 2IH3A 5CLWA 4JKMA 4KJWC 4EDXB 1B3JA 1MCBA 3OXSB 1CG9A 1L0XA 4PD4J 4Z95H 2MOVA 4NPYB 1RZFL 1Q9LB 2FD6L 2FYYA 1NCWL 3NZHH 3P4OA 3AS2A 5KN5A 1NFDF 1NAMB 3OKYA 1NL0H 2VUYA 5DHYB 4DKEH 4M1DH 3N85L 2WLYA 3HC0A 2XN9D 3OKKB 3AY4C 1GGYA 4O4YH 5HHPB 1RHHA 2D0HA 35C8H 3OJDA 1R5WB 3OR7B 4Y2DC 4DQOL 3VWJC 4N9GA 2DDQL 4WWKA 1C16A 4LRIC 3M45A 3HB3C 1M7XA 4WFFD 1E4XL 3PHQB 4LL9A 4M1CD 1IGMH 3GSNA 4O2CA 2QHRH 3KWWA 4P23A 1FHGA 5I1HL 3TZVB 4XZUB 1D5IL 1P5VA 2DQJL 2HJLA 1A2YA 3H2WA 4PYGA 5BO1L 3AMKA 5MEQA 4PJ7E 1MRFH 3OPZL 3S37H 5I9QC 5FGRA 5CWSB 4ZTOH 5MEOB 4ACPA 4QHNB 1KJVA 4TUKL 3QQ9C 4M93B 5DQ9B 1O7SA 2CPCA 2VE6B 1RI8A 3QNYB 2APFA 3WFDH 1J8HE 1CFNA 3FB8B 3IFNH 4HG4K 1T1ZA 4X0KA 5CGYD 2APTA 3CXDL 1PEWA 1CFSB 1QSED 2EDFA 4MB5A 4TNWK 3FOMB 3QISA 1R3JB 1TLKA 4JQXC 2XWBB 3MNVB 4JG1H 1NUGA 1CXIA 2CD0A 3RVUC 3TF7C 2YMXH 4MJ2A 4X9HA 2CXKA 4GW4A 4X80H 4EUPB 3LS4H 4MMXC 3MROB 1YEJL 1JMXA 1JWSB 4M9PA 5EO9A 2VZVA 5H8DA 4JPIB 5CIPA 2GSIB 5HHXL 4JG0L 1UKTA 5BJTA 3SDCD 1SYVB 1KIRA 3DGCR 3HE6D 4LAJH 2MFNA 1OM3L 3GI9H 4HEME 1YPZA 2ATPA 3RZCD 4RFEB 3ARDD 1QUNA 3FO2B 4NJ9L 4MD5A 1RQ5A 3GSQB 3A6CH 2O5ZL 1MRDL 3GSWB 1PG7L 2BFVL 1S7QB 4NP4L 5F96L 3V4VH 1L6XA 4GAGH 4WU7B 4B50A 5J7CC 1KIQA 2VXTH 1IGFL 4LNVA 3VXTB 4ZXBD 1XIWA 5C0CB 3REWA 5DYOA 5IMLB 1I1CA 3HI5L 3T4AA 3SDAC 1CGSL 4LCWD 4KXZH 4RZCA 3O11B 2HN7B 2RBLA 3GEWB 4H88H 5TE4L 4Q2ZB 3SE9H 4UU9A 1EK3A 4XAKD 4H8WH 4L8DB 4RGOH 4JZNA 5BV7L 3B5HA 1MCLA 5IJVB 4YFLI 4O9HH 3DHMA 5EN2B 3MGTB 2YPLA 1RU9H 3O2WL 5AZ2H 3QUML 4WFHD 3VDAA 4Z76A 3RPIA 2D0GA 5INCA 3V8CA 4JFOB 1SY6H 3R8QA 5DJXB 1AJ7L 2MTPA 1WEJH 1V3LA 2H41A 3MJ9L 4UAOC 3CFKB 5HHOD 3AU1B 4L4VE 3BZFB 1T5WB 3CK0L 1KN4L 43CAA 4HPOH 1YYLH 3ULUD 4J3OC 3ZYIA 4P4KD 4WI7A 3UZQA 3L5WA 3VFMA 3S35H 2Q76B 4J1UB 5E8PB 1T0NB 5ISZA 4NQTA 5F7LB 3NN8A 2ICEA 3G04A 1AGBA 3BKJL 5KTEH 4IS6B 2VDML 2FO1A 5JXEC 1J87A 2H2PC 4IOIA 5CD5D 2JCCE 3HA0A 2YC1A 5IVNA 5T5NG 3OJMB 1B90A 3NCMA 4WW2A 2QQLH 3UDWC 4PG9B 1MH5A 3K1DA 1LO5A 5EH1A 1DE4B 1D9KA 3VG0H 1MCPH 2EZ0D 4PFEA 3B5GA 3BW9A 1IGTB 1I9JL 3EYUL 4HIHB 4CNIB 2EDQA 2HKHL 1NUFA 3UTTA 4HS8H 1GGUA 3BP5A 4JHWH 1AE6L 5IGXL 4D94A 3OKLA 1PYWB 3RVTC 1M7IB 3MREA 3F12B 4XCCL 3UJTL 4Y5VC 3GSXA 1UJ3C 2R0WL 2FHBA 3E6FB 2HLAB 4M6OL 5H2BA 4PY8I 4K7PL 1JVKA 2EKJA 5IMMA 3GO1H 2VN4A 3G5XA 2X09A 3GMMA 4JHAH 2PTTA 3B6SB 1J8HB 1LEGB 5DMIH 5FFLA 3MJ6A 4QHUA 1OAYH 4AMKL 3QFJD 3U0PA 4HCRH 3PNWB 4W4NA 4G42B 4Y19A 4PJ9B 1FJ1A 5DJ8A 2SEBB 1BAFH 2YZ1A 1CFTA 1ND0B 4NQDE 4PIRF 2P1YA 3ZE1E 3LCYA 2EEAA 3EOTH 4F7EA 3PWLA 2VLRD 5GGSA 3KXFB 1YEIH 4FQLL 1J9CT 4KUCF 5BVPH 3DYOA 3SDXA 4ZDHA 1UCTA 3AFLA 2F58H 4OF8A 3SGJC 4CU8A 1B2WL 3QUZC 1WWCA 5GJTL 2QQQA 1JWUB 1CK0H 3SQBA 3WD5L 1G6RL 2CXGA 1I1YA 4CADA 2JIXD 3IXAA 3DV6B 4D9LL 3U30C 1Y18A 1GGIH 3W0WE 1U91A 3QDJA 4X6CA 1D3CA 4HK3J 3EYFB 1D6EA 2QSCH 4GW5B 2BNRD 4GKNA 3KR3H 1NDMB 5DD6A 1INEL 1NFDE 4TSAH 4WI5A 2ARJA 4Y4FC 3HG1A 2NNAA 3NGBC 4BH8A 4R4FL 4P57B 3RUGA 3QWRD 1ZS8B 4NHUA 4MQ7B 4LSQH 1KXQE 4O00A 4ZAKC 1VEOA 3U1SL 3N1QC 1O0VA 3C2AL 4CUCA 1LE5B 1G0DA 1KCLA 4FMKA 3AGVA 4Y89A 5DDHA 1CLCA 4HIEA 3P0YL 1RUML 1UXWB 2BNQA 2AK4D 12E8L 2EO9A 2VXUH 2ZG2A 3EFDL 1FL5A 5H94A 1E0OB 5CJ8A 1YEDB 4TVPD 5ANME 1S78D 5I75B 2R0ZL 2VIRA 4OI7A 1HH9B 5F8QC 3HC3H 4HKBA 3TCLB 3EOBA 5EC2A 1WIPA 4QOKE 2AJXH 3QHZH 3JXAA 4Y0GA 1QG3A 4L4TD 1BLNB 4KKBD 4FQQA 5EORL 1DBJL 2BVPA 1CICC 3RU8L 1GPOL 2CKBH 3A67L 3ZKXB 1ES0A 3MRKA 5CAYB 4HEPG 2AV7A 3D18B 5IF0B 4Y88A 5CS7A 1PZ5A 5HHME 4Y5XC 2L7JA 3KDMB 1HNGA 4LSPH 2VLLB 2NXZC 3V0VA 5KSAD 5FV1L 4GKOA 3D0LA 2JCCB 1ZGLA 5I76A 4O2EA 4JFPB 4R4NC 4X5WA 5IROC 4J12A 1XZ0B 5T3ZD 3OF6D 5J1SC 4OZIF 3BZEA 1FE8L 3PP4L 3CDYA 3TN0B 3IDMA 3NAAH 4JKPH 1BVLA 3ZYOA 4K2UH 2DQGH 3OKEA 4POYA 1FBIL 3F7PC 5INDB 5IWLA 4OLUH 1ZLSH 1LMKA 3F8UB 2E9BA 4EN3B 4EZMA 4M62H 3ZHKA 3BKYH 3LN5A 2IPUK 4G6KL 3PABA 5DZOA 1T4KB 4RMQA 1RV6X 5HD8D 5D7SH 2NY0B 3VRJB 4PGCB 1Z5LA 4KRNA 2D7PA 4F57L 1WITA 1A14L 3MBED 3BQUB 4ZXBA 2JJSC 4OD1H 2FHFA 1H8SA 4HDIB 4L3EA 1XGUB 2FX7L 3LKQB 3B8SA 2H2SC 2PUQT 1MAMH 4PRDA 4XAWL 4YXLL 4ODSL 5DS8B 1QYGH 3UJJH 4M61B 5BOPA 3VMOA 4P2QE 5I1LB 5D4QA 1KT2B 1C1EH 4YDLB 3ZKNC 3O3BB 5I18L 5TF1H 2AXFA 4WHTA 1ZVSB 1TNNA 5KZCD 2P43B 5FGSA 5D8JL 4PJHF 4OF5A 5AWNL 1PAMA 3QNZA 2CMRL 5CMAA 4JQIH 5MEPB 5KSBF 3L5XH 2Z93A 4O5LH 2MNUA 3SGDI 4FQJL 1RUKH 4QHLA 3LEXB 5HHOA 4JKKA 2V7NB 3GJFK 3MOAL 3X14B 1FQ9C 2VH5L 4DKFL 4XCNB 5I1GH 2EDKA 2JKXA 3V8OA 3EKCA 4HQQL 4RA3A 4S10A 5AYUH 3IS1X 5HI4C 4FFVC 3KNBA 3G9AB 3RWGB 1REIA 1QEWB 1NFDB 3IKKA 3KAAA 5C08E 5H35A 1EEQA 2CLZB 3WFZA 4N8CL 2CUHA 3LHPH 1FAKT 3IDIB 1AO7D 3FO0H 4I2XE 1NMCC 1OF2A 2UUDK 4FXGA 3NFNA 3HUJB 3QIUC 4IOFC 3IU4H 3P9LA 5B21A 3F6IA 3MRIB 4K71B 1MFDH 4P2RA 3V5KB 1HHKB 2GJJA 1JGDB 3MOQA 1A6TA 1DDHA 4F9LC 5ANMB 2R29L 4HUUB 1EBAA 3OJ2C 4LRNH 3QUXC 1D5MA 4NKMA 3QIBB 1JZ5A 3RWFB 3GUTB 3VXRA 3DUSA 3HMXH 5CUSL 4W6XB 2VDNH 2AJVH 5HPMA 5HY9B 5T3XH 4QOKB 5D2NE 1SM3H 4WW1B 2GT9B 1PEZA 3MCG1 2DJUA 2LE9A 1PLGH 4NBXB 4GXVH 2X7LB 4LKCA 4HH9B 4MCZB 5EU7E 4WI8A 2L0DA 4HJGA 4XHQA 1BQLH 2VWEE 1EIBA 1NLDH 4X4ZA 1Q72H 3HI6H 1AQKL 5HHMB 5CEZE 5IHUH 1YEHL 5D7LB 2Y6SC 5IVXE 4YHZL 3WSQH 2Z9TA 3QHFH 1MQKH 4GBXD 4MSWA 4YHNB 5E4IA 1SEQH 4F15B 4JN2B 1FAIL 4OZFG 4KHXH 1FP5A 5SWZD 4U6HA 5JW4N 4X9GA 4U1IB 3WXWH 3VFWA 3X13B 4FQIL 2B4CC 2C4XA 3QA3A 2MQ3A 3C60C 5MENE 5ADOL 4PR5B 1AQDA 4ODWA 5I6XB 1NFIA 3RX7A 3O45B 2Z35B 5F6IC 2D03L 1HXMB 1YNKL 4P5TA 1U3JA 3PP3K 5B8CB 1MVFA 2JIXA 1RUAH 4HJJH 3KPOA 4LLMB 1OGTA 4YE4L 4LSDA 4HS6B 3MV9B 5C8JA 2BOCA 2BNRA 1DBKL 3MRJA 4X99A 2N7AA 3UMTA 4YDJA 2B4CL 4CJ0A 5I1DB 1JNLH 3F7QA 4XI5C 3EDFA 2GKIA 3D87B 4I18B 3CVHA 3NACH 4X5LA 3QZWG 4KROB 2CRZA 1QOKA 3C9NB 4N1HB 4ODUB 2G75A 5EU6B 3WXVH 5ID0A 3V4PL 4RX4D 1I9IH 3FMGH 4KU1A 2ESVB 1NCNA 1T0PB 3LN4B 5J1TC 1N2RB 4ETQA 2EDYA 4P2QB 2FGWH 1X7QB 2BC4A 2G60L 4UNTA 1NGYA 4L9DA 2ZUYA 1INQA 3WUWA 3RX8A 1D5ZB 4OD2A 5C71A 3QAZB 3QIWD 4C4KT 1NMBH 3N1FC 4OFVA 2VZ3A 5I1CL 3I2CL 2ZG3A 2O5YH 3S3SA 2QQNH 4JCLA 5GGUA 1PX4A 4JFEE 4LPTA 2AABL 1GGCL 1LK3L 1G1CA 2PW1A 1X4ZA 4PJEA 4G3YH 1QRNE 3B3IA 5D96B 1IM9B 1OGAA 1BZ9B 3LDBC 5GZOD 1A3QA 4XBPB 5GPRA 1IEBB 2MCG1 3MUHL 4L4TA 4I0PC 4WY7L 1AD9B 3QYCA 4FTVE 4CDGC 2VN7A 3QDMA 1FFPA 4G9DB 3RA7H 3KPMB 1OTTC 4IMLA 4M3JA 5C08B 2PYED 3LPGA 1YMHB 4OZIE 1MCDA 1NC4A 3LH2L 5F1IB 2IGFH 4NM4H 1A9BA 2HRPL 4EI5D 2OJEB 3S36H 4KQ4L 3UCRA 4I2XB 3P30H 1A7NH 3CX5J 1OARH 1RK0A 5JXAH 3U36B 3VXME 4OCWL 3RGVB 2DICA 4WV1C 2OP4L 5EBMB 4TTGA 4KHXL 4E41E 4G8FB 1IMHC 1P4IH 3QH3A 5JUEL 2WBJA 1VPOL 1HWHB 2NR6D 5J12B 4FQXA 1WC7B 1QP1A 4U1MB 4Q9QL 2R15A 4JDZB 2CR6A 3SHSA 2IANE 4I13B 2NPLX 1ORSB 1MHEA 4ZFZB 5BRZE 4FOMA 1ZGLM 3AREB 4S1QL 5JW4M 1MNUH 1NLBH 2H8PA 2QR0B 2W60B 5J6GB 2FIRT 32C2A 5IUSA 5D1XB 3P0GB 5D5MB 4S0TD 1CU4H 4ZFGH 3SDDD 3CMOH 2Q20A 4JFZL 4M6MH 3Q48A 3QPXH 3BEWA 3GMQA 2B39A 3BPOC 3PWUB 4MB4A 4R8WH 5I73B 5DUMH 4M8QB 2AI0L 4UDTB 5TDPB 2Q86A 3JWDL 1KPVA 2FBJH 3AAZB 1A4JB 4L9LA 1TETH 2P4AB 2JJTA 1L4IA 4Q9BA 5IVXB 3DX6B 3TVMB 1YC7A 1GZPA 4OCMC 1CE1H 1SBSH 3CIQA 3MLVH 2BCKA 1HILB 4PD4K 4PJHE 1V7ML 5CLTA 2CKBB 1FZJB 1GIGL 5L0QC 5KSBE 5KS9A 3CFEB 4J3TA 5DMKA 3MRPA 43C9B 5ITBL 5IW6B 3MRGB 2XFXA 1FNGB 2BRQA 4LLDB 1QBAA 2DLFH 3O6KL 3VI4F 4N8VA 3O4LE 4NN5C 2H6PA 1N3NB 2WQ8A 1WIUA 1R5VB 4XTRD 3RL1B 3EJZC 4PRID 3T8XA 3KLHD 1KENL 4JFFA 2C3VB 5FXCH 2YBRA 2PXYB 3W11D 1EHXA 1OTUD 3DURA 1PD6A 2JJVA 2IPKA 1H5BC 4V2CB 3P73A 5T1DH 4N0YH 1YY9C 1OTSC 1YY8B 4PP1C 1MPAL 2CDFB 1RY7B 5ECJE 4RAUA 3BAEH 1HQRB 5C9JA 5DJ6A 3MUY1 4LDOB 3F7YB 3PGFH 1MCRA 1A6PA 2CDEA 3AY4A 1JYWA 1J0ZA 4S2SA 1MJJB 2OTWB 3AROA 2R2BB 3MODL 4OZ4A 4FG6C 4Y2DA 1OSPL 3VWJA 1CGWA 4QXGL 4TNVK 4U6YA 2F54A 4LRIA 5EIVA 1FZKA 1TJGH 3I6KB 1L0YA 5FOBB 4IJ3C 4JB9L 2LQRA 1F3JA 2VL5B 3SOBH 5IMKB 1J10A 2X70A 2DM2A 4JFEB 3FQWB 3S34L 4OFIA 4FZ8H 3GM8A 1QRNB 4A6YB 3Q3GA 1G7PB 4L3CA 1PVHA 1XGRB 4QO1A 6FABH 3TV3H 5FYLL 1EDQA 2A74A 1MFAH 1OAXH 1BREA 4FTVB 5LGHH 2H32A 4OZHF 3ZTNL 1O7VA 5I74B 3WFHA 4R7NB 3CAFA 1TTGA 3MLWH 5GS0C 3WO4B 4OZIB 4UV7L 4HKZA 1C5CH 2JK5A 7CGTA 3ULVF 1JN6A 2X40A 1OT2A 5C0JB 3WLBA 4JQXA 4GBXA 5EZOL 5EZLA 3VXMB 5AG9A 1AGEA 1KF9B 3EO0B 1MAKA 1TTUA 2FNBA 2EE9A 1PZUB 4HIXH 4IRJD 4YDVB 4MS8D 1N26A 4E41B 3HE7D 3TEUA 4NQEA 5SWZA 2B1HH 4NM8L 2HTLC 2Q7YB 3N1GC 4C58B 5TGBA 5GS0L 1CE6A 1ED3A 2Y06H 1U8MB 4K07A 5E4EB 1JPSL 4KTYA 5E9DE 4UT6H 3MNWB 2IANB 2O5XH 4CW1B 1N5YH 1C08B 3T2PA 4FQ2H 1JYVA 1WCQA 4MXVE 4LSSL 1AY1H 4Q74A 1CLOL 1K4CB 5C07E 1BGXH 5B39G 4Y1AE 2CUMA 4NO0D 1CLZL 5HBBA 2DQUL 4MNHB 3WS6C 3OHXA 4RISH 1Q0YL 3C6SB 3BRGC 4NWTL 3SDAA 2A83B 3MCKB 5F89B 3U0TA 3WIHL 3KPRE 3TNNA 3MJ9A 2W0FB 1KPUA 5A2JH 3DVFA 2W9EH 3QXTA 4YWGL 5TDOA 3EW3B 3GRWL 1YMMA 3CDGA 3SKUD 3TBVA 1QR4A 5F7EH 4PJHB 4XMLH 5KSBB 5IK3B 3HC4H 3MJ8A 4PJFA 1IEAB 5IV2B 2PETA 2LTQB 4HULB 3MGAA 1RIHL 3MCLH 1JFQH 4WUUD 3DI3B 4HK0A 1YYML 3QCUL 3C5ZB 1SYSA 2FJGA 3ALPA 2C3WA 2OTPA 3ARGC 2NX5D 5KVFH 1URLA 3U82B 4YHML 4TPRH 5F1OB 1Y6KR 3TPUA 3TNMB 5HGBA 1KC5L 3MRBB 4ENEC 1A7RH 4JRWA 4LCCC 3TT1L 4S1SH 4OSUH 3SJVB 5C0FB 1JNNL 3DRTB 1UB6A 5GRVK 1WTGT 3IJSA 5EBGA 2EYSA 4F7TB 2X44D 1RMFH 4RWYL 2UZIL 3QDGA 1YDPA 1ZLVH 3CFBB 4H26B 4QHMA 5C6WH 2IEPA 4ZUVB 4WI3A 5JXEA 5EBWB 3P40A 2OZ4L 1W72A 3FQXA 4EI5A 2R4SL 3OR6B 3RL2A 4JGUA 1DP0A 1YEKL 3UDWA 3B9KC 3FFCE 1LEKB 4FQ1L 3GIVB 3AVEA 5IG7A 3VH8B 1YJDH 4HFWA 4WO4B 4JM2B 2KDGA 1KEML 3G6AA 1E28B 1JRHH 4XH2B 2J8HA 3R4DA 4NKQB 1U8PB 3VFSA 5C0RL 1H0DA 1J1PH 3UTSA 4UTBH 3WN5B 2DL2A 3B9DA 4OLXH 5JPMA 4NRZA 4XVJL 1A6WL 4NUGL 5A16B 4O02L 3V7AG 1C7SA 1TNMA 1KG0A 25C8L 2NLJA 5FAAA 4BUGA 4XC1L 4DGVH 1UJ3A 3QG7H 5IBTL 4FQHA 3V6OC 2QADB 3DX9A 3PQYA 2A77H 4OBSA 1SVCP 4PUBL 3PJSB 3HZYA 2I9LB 1NJ9B 3X3GH 5HGHB 5I2IB 3KYKL 3BGMA 4QWWD 4OB5H 2I5YL 4RAVA 2WBWB 3KYMA 1FVCA 1UH2A 2BY1A 2IAMB 1OW0C 1MQ8A 1RFDL 1G6RA 3VI4E 4U1SB 4Y16B 1TZHA 4LKXB 1MCSA 4JO1H 2ITCB 4X4XA 3MA9H 3H9YA 1UM6L 3NPSC 1AGDA 4UINL 1FNSH 1EMTL 4PJ5E 4YHYB 3QEHA 3SGJA 1WAAF 1S9WB 1ZA3B 2F15A 2E6QA 1A47A 1G6VK 2HWZH 2V7HB 3QUZA 1U2CA 5E9DB 2BX5A 3V5HA 4D3CL 4LU5L 5HGDB 5DJZB 1Q9OA 4Y4KB 5IVZB 4JGJA 5KVEH 1T83C 5E70A 4HAGA 3TP4A 3U46A 3V6FA 1R5IA 3EYVA 3F7VA 3ZKSD 2XRAH 3UTQA 3HI1A 3ARWA 3V6BR 2YRLA 5C07B 5B38G 3AB0B 2GCYA 4MXQC 5AZEH 1KNOA 4HUKB 4XWOC 1F4YH 1ZHKB 5IP4A 4Y4FA 1PKQE 4MJ6A 3TLRA 4L4VD 5SWSE 4QYOA 2C3GA 1BBDH 3H3BC 1FFOB 3TC9A 5J06A 1FZOA 1U9KA 5DRXB 3GK8L 5F3HB 4FNLL 5D71H 4ZAKA 3TA3B 4BFBD 3QG6B 1ETZB 4GRMA 1RZIB 4YHKH 2WWKT 5D2LE 4K8RL 3GBNL 3D39E 4KJYA 4NNPH 1F02I 1XF3B 4NZRL 4GUPB 4RFNC 1IFHH 4HUXA 1U6AH 3LPFA 1IC5H 3U4BH 1JF1B 5ESVA 3L3IB 1GHFL 1XF1A 3L95A 1HQ4B 2RCSL 3QUYC 5BS0D 1ZGLP 1LO0H 5FUCC 1BQHA 2X9XA 1JCKA 4LNRA 1A7PH 4L29A 5IIEB 1U3HC 1DANT 2YXFA 1F2QA 4OZHE 1OWRM 2BVYA 2BERA 4NUJA 5EWIL 2EE6A 2WW8A 1NCCH 1XGPA 1CICA 1NGPL 1HHHA 3EHBD 1TVBB 3ULVE 1UCBH 1E6OL 3VD7A 1SEBB 3S5LA 5IM7B 3PHSA 3EOAA 1Z9MA 4Y5XA 2YXMA 4YAQA 2XY1A 3MLXH 3TO4B 3CVIH 4X7CC 5E2TH 1IAOA 1RVFL 3V5DA 4EDWL 1RZ8B 5IROA 4FA8A 3FFCB 3T0EE 2ERJC 3UPRB 1MFEL 4XP4L 5GGTH 4IRJA 3OKMA 1FFNA 4AM0A 1X5JA 1KCRH 3G5YA 3MLZH 3D85B 3E6HA 4GRLB 3ZKMD 3BH9B 1EEYB 2IBZX 4LVOB 5C0ND 3LQZB 4TRPL 4HD9A 1DLFH 3P2TA 1CTNA 1KTLA 5CEYB 2BXZA 3RDTC 5ERWB 3DARA 2APBA 4E42B 1FZMB 1W72H 3WNNA 4RGNE 2F5AH 4NO0A 2OJZH 2R2CA 4GG6F 2DJ4A 3MRHA 3EO9L 1KTKE 3OQ3B 2JJSA 5E2JA 1DVFC 1WZKA 3WKML 4APQC 3BHBA 4P9MH 3Q5OA 1NBVH 3H9SE 3BWUC 4PJIF 4Y8DC 2R23A 3W0WD 3WUWG 1U0QA 2C9AA 5DR5H 4KTEH 3C6LC 5C09D 4JO3H 3ILQC 2HFFB 4M4RA 4NC1E 3UAJC 1V7NH 1RZGB 4AYFA 3TIDA 2DWEB 4OM1H 2VLKE 5KJRH 4PGEB 3WIIL 1VFAB 2O26U 3KPPA 2FH6A 4OAWB 4Z78A 4FQPA 4NQSA 1R0AL 1XCQB 1P1ZB 4PJ5B 4LPYA 1T03L 3WFCH 2HT2D 1B4JH 3TO2B 3L9RA 3OX8A 3OKOB 1RJLA 3OSKA 1TVHA 2EO1A 4FFZH 2HT4C 2NX5A 2XZAH 4AT6A 4ZS7L 1IAIH 1G7JA 3S4SG 5HYQA 2NZIA 4G43B 3QI9B 2DM7A 5KSUB 1KJ2B 3BO8A 1CZ8H 2HJFA 2BSSB 4N5ED 4BK4A 5EBLA 4DCQA 4LDLB 3M1BA 3U0WH 3O2VL 4G6FD 1MF2L 1PKQB 5LGKA 3MMEA 1N5AA 5GISH 5IB3B 1CFVH 4FFWC 5SWSB 3WFBL 1UYWL 2NY4B 3G5ZA 1UQSB 1FGNH 4JFYB 4OGXH 3S88H 1GOGA 2BOBB 1NCDH 3LN9A 4MA8L 1T1YB 4UT7H 5C0BB 1G7QB 2F53E 5D2LB 2ZWLT 5DRWA 1CT8A 2AV1B 5I17A 1UWXH 5FYLD 4EOWH 2JJWA 4XPAH 2ZCKH 4RGMB 4HIJA 1C7TA 3QXDB 2IADA 2AW2A 2R2HA 4MVBD 3QUXA 5F93C 4Z7QF 4GKZA 2OTUB 1OAQL 4L5FH 4AENA 3G5VB 2JB6A 3PDGA 4ZOAA 3ESUF 5DWUH 1HSAB 3IDXH 3VGAB 3UBXI 1OT1A 1CYGA 2P5ED 2YSSA 4P3DB 3O8XC 4OZHB 1A6UH 3DGGA 3IAGC 4H25A 1YPZF 4Q58C 1A9EB 5EO1B 1MEXH 4FQCH 4NKOB 3I85A 2ED9A 3O41A 4BQCA 4JGMA 4NRYA 2FR4B 4J8RA 5FKAA 3EIFA 3QO1B 1DQDL 3TJEH 4GS7B 3JV6A 1JGVH 1ZT4A 2RJMA 3QFDA 1M6OA 1DQTA 5IMOB 5DK2B 5HVHB 4R90H 1Q9KB 4H0IA 3E3QE 4HJ0D 3ZTJG 2R4RL 1SJXA 5FA4A 5FHAH 3DTXA 3QQ3B 1FL6A 1WAAE 4TULH 1UG9A 4XP9H 2YPVL 3T0EB 3NABH 5DEGA 3TBSB 4CVZA 5E08H 1F8TH 3GHEH 4NC2B 3G6DL 4BELD 3VRIB 5CZKA 2V5TA 2Q8AH 3B2VL 1S9YB 3UJIH 4WI2A 4ONHB 3C60A 3WE6A 2WQRA 2A1WL 3RWDA 4BH7B 1I8MA 3DRQA 4KY1L 3AMLA 3BD4A 4OM0H 4L8BB 2G9HB 4YGVB 3JBG7 3RBSA 4P59H 1NAML 1KB9J 2Y36L 2EE3A 2WWMD 2Y7QB 2DQTL 4R97B 1QD0A 2R8SH 5SX5H 1EJOH 4OFKA 3D3VE 2DIJA 3TZVC 4QRRD 3NCJL 2X4NB 1CBVL 2AJ3A 1EH9A 4WUKL 1RJYA 3MV7A 3X12A 4X8JA 3P77A 1CQKA 3GKWH 1H3WM 3JV4B 1T20B 3H9SB 4HPYH 2J7LA 4XNYL 3DUUB 1KPRA 1QLRB 1FCGA 5ABDE 4TUOA 1S7SB 3SQOL 5LGJA 4DVRH 1XGQA 3VMNA 3EYSL 1DQLH 2VLKB 4Z18A 4PRAA 4CJ1A 1NAKH 4WW2F 1GC1L 1DCLA 4HUWB 3U7WH 8CGTA 3CX5K 6CGTA 4OQTH 3QULB 1YECL 5F3BB 4MXWH 4W4OC 5FIEA 2E7LC 2IMNA 1W0WA 2X5PA 3VXUB 4FP8L 2XWJB 5BS0A 3DV4B 3DECA 1CL7H 3REVA 1T1WB 1R3KB 1GAFL 3GMPA 5CCKL 3C8HA 5T1KA 3PGDB 2B5IB 1K4DA 2PCPA 2Z92A 1OLLA 5GRJL 1OQXA 2VXVL 5I9QB 5JHDE 1PQZA 1KGCD 1U36A 1I1AB 5FYKE 5GGSY 4NN7B 5F88A 2CO7B 2X1PA 4KI5D 4OLWH 1RJZB 5BZWB 1I9RL 4F9PC 2A2QT 3LB6C 4H20H 2BMKA 5I19L 4WV1A 3MXWH 1E6JH 3IETB 3PWPA 4JFDA 4YFEA 1EHLL 2F53B 1RURH 5GS1B 1T21B 2BJML 1JZ6A 3S98A 4KH2A 3CXHJ 4MA1B 1MWAH 1ACYH 4I77L 2PYFB 3D5OF 4KUCD 5D1ZB 4JLRA 5E0QA 4I0KA 5JW5B 1A22B 3Q6GH 4I5BB 1T6WA 1J1OL 3SDXF 1OOAA 5KANG 4ZFOL 4IDJL 3ES6B 4GG6E 3U7AA 5HYSG 3MRFB 2FSEA 4G8GA 3VGEA 4MHHG 4PRHD 1HI6A 4DAGL 3MGOA 3V7MA 1WZ1H 3QR2A 5ESAA 3V95A 4PJIE 5D7JD 2NY2D 5DI8B 1IE5A 3BN9C 1FG2B 1EEZA 4OCYH 3BUYB 3CLEL 2KPNA 4JN1H 4X6CF 3PL6D 5EOCH 1FCCA 4JDVA 3I6GA 2ADJA 4JRXD 2EKSA 1QBLL 1QBMH 4RMTA 1XR9B 1FLRL 2NW2B 5ACLA 2MQCA 4HC1L 2RFXA 5HVWA 2OR9H 1KULA 2DD8L 3LZFH 4OF0A 4LARH 3DXAB 5C09A 5CD3A 1OCWL 3RUGF 2EYTA 2R69H 4H1LA 3CH8A 3GJEB 4OFYD 1LO2H 3FONA 2DKUA 4ALAH 1AKJB 2K1MA 3MFFB 1Q38A 2J8OA 4YNYA 4G6JL 1MHPH 4DN4H 4LHQB 1I7TA 1V3KA 5CJOH 5CJ5A 3WEXA 1F58H 1JK8A 2H26B 1OPGL 3L7FA 5ACZA 5JPNB 2DTMH 2MPAH 4K8RD 3HRZB 3MYJA 2VDLL 3GMRB 3RTQB 2KQMA 1A6AA 1G7LB 3C8DA 1NSNH 4D0BA 1U93A 3D3VB 4M5YL 5FV2A 5IQ9A 4OBRA 1QPXA 4WFGD 2Y25A 1U58A 5J11B 4P5KB 4G9FA 1A5FH 5L2KD 1U95B 3HZKA 3VDCA 2Y5EA 2H3NA 1F6AA 3K4AA 4P9HL 4Y2OA 3UTPE 4L8SC 4JKLA 4MJIB 1HH6A 4OLZH 2HMIC 2RGSA 3VXSD 4ZUUA 3K2MC 2AJUH 4Z7QE 5EFIA 3HAEG 1A21A 3FT4B 4PJ9C 3CZFA 1FDLH 4BJLA 3IFLL 5DMGC 4RRPA 1K2DA 2XY2A 3P4MA 2BVOB 1CFQB 4XXDA 2I9TA 5D1QD 3OJVC 1ZA6B 2VDKL 1YPZE 1DBAH 3OG6B 2HVKB 2NY5H 2E8ZA 5CZXC 1OAKL 5T1MA 1MCQA 2X4OB 1GGTA 2YD4A 4N90E 4GMSH 2XV6B 2DQHH 4YUEL 4ORGB 5IB5A 1CXHA 1DQQA 2P5EA 5IBUG 5SWQA 3K7UA 1U41A 3LEYH 2XWTB 4NNYA 5GRVL 4X4MA 2ZOLB 4MDJA 4ZUTB 2QSQA 2EDDA 1KCKA 5BRZD 4LMQE 1XFPA 4KTDL 5JHDB 3NZ8B 1CF8H 1HKLH 1LDPH 2VABB 1R24B 1RK1B 3HLAB 2X4RB 1D5BA 1CDHA 1PFCA 2DQFB 1RZ7H 4OJFL 4X4YA 3N06B 4N0FA 2DQCH 5GGVY 2B8OT 4AY0A 3ILPA 4S1RL 5E2VH 4HBCH 5IBLC 1N64L 1E27A 3TJHC 1KB5H 5EO0A 4P5MB 1WFUA 3L1OH 1I3RB 2H1PL 2YPLE 2B2XL 5AAMA 3NTCL 1WBZB 4ZS6C 4R2GC 1KN2H 4U1HB 3H3KA 2VLMD 1X4YA 3MUGB 1ZTXH 4OIIL 5J9PB 2YWZA 1BJMA 3FTGB 4BZ1L 4OZFB 1XEDA 5DK3A 2VQTA 3U4EB 1NCTA 1D6VH 1TCRA 3WIHA 2WZPD 4GG6B 4PP2B 3PWJA 4NO2A 1P7QA 3S6CA 3GRWA 1WLHA 5ISZE 3DO3A 1J05A 1TCMA 1LP9B 5A40E 4PJIB 3SCMD 4Z77B 3DPBA 5BZDA 3OMZA 5B4MD 3T0VA 2EH8L 1CG9B 4N0CD 5ID1B 1H15A 1QACA 3GMLB 4MNQD 4HKJB 5DVLA 3ZKXC 5FB8B 1XF2B 2FIKA 3IXTA 2QQKH 5C9KA 1NFKA 4HAFA 2IALA 3RBGA 3HC0B 2DS4A 4HGMA 3QDAA 5C70A 4PTTA 4UT9H 4BYHA 3L3GA 4XPHL 4Z8FH 3QZWB 1YQVL 1UWEH 3K2UH 5IW3A 4QY8A 2FWOB 1XR8A 5DHVA 2GY7B 5J1AA 5CJQH 3G6JA 3SY0B 3WL9A 3FOLB 2XT1B 4CN4A 3LV3A 4U7MA 1TQCB 1I3GH 1Z3GH 4JY6A 4OCNC 2XQBL 9CGTA 1MHHA 3M17A 3TN0C 4KXZI 3ARGA 3U83A 3WFEL 5DUBB 1C5DA 2OZ4A 3S5LG 4HX1A 3ZE2F 3D25A 1FC1A 4NNXA 5MEQB 5EZJB 5DA4A 4LCCA 5DVNA 4EN3C 4NQCE 2OK0L 4NHCH 4OIAA 1TJHL 3M8OH 4EVNA 1JV5A 1PY9A 1P4LA 5FM8A 4G7YL 2NY0C 1NEUA 5HYJE 5C7XH 1U92B 5KAQF 1UACH 4X0KB 2Z0BA 4Z95L 3ARBD 3BQUC 1SJEB 2VLJB 2AJZA 2A6JB 3K8KA 3NZHL 4NBYB 4QCIA 1NL0L 3CDCA 4JZOB 4Q9CA 3STLB 4LVNB 4DKEL 1CWVA 4M1DL 1IGIH 4ZSOA 3ULUH 4O4YL 1UXSB 4LHJB 3ARYA 3SDXE 3IFOB 35C8L 5ADPH 2YS4A 3IF1A 5BJTB 1JI2A 1NKRA 4YDLC 3S36X 5J6HB 4KKCD 3LSOA 3VG9B 3UZVB 2V17H 1IGML 2QHRL 1N0LA 5IESH 1W8NA 3RP1A 2FEDC 3QDJE 4KK8C 4X6CE 2LVCA 4M1GH 3OGCA 1BX2A 3VXOB 4J7RA 4OF3A 1NGQH 1JGEA 3RWCB 3FN0H 3LD8B 1MRFL 3S96B 3V6OA 1X3DA 1K85A 3S37L 3BSZH 4LHUA 5D7JA 4ZTOL 2ZUTA 3HG1E 4EEEA 4PJCF 5HHQA 4WFED 4TQEH 2A9MH 3PHOA 1RHFA 4JY4B 4KWUA 3RUGE 1ZHBB 3WFDL 5IB4A 4JRXA 3IFNL 2GJZA 2ADGA 4OKVA 3T3PF 4OKDA 1F97A 1F11B 2EIZB 4HMEA 1OW0A 1RSFA 2ICWJ 3O2DA 4QEGA 3VD9A 1CS6A 1II4E 4Y7MA 4HGWB 4HWNA 1G9NH 1KCVH 2JJUA 4F2MA 1OQOA 4JG1L 2FL5A 2XN9E 4Q6IB 2YMXL 1N6VA 4OFYA 4QXWA 4X80L 2YPLB 5DJ2B 3LS4L 4Z76B 4CDHA 3GI8H 3KPQB 2B1AH 5F7DB 5EOTA 4WFFE 4K71C 3L7EB 3W2DH 5E6ID 2XTJD 4UBDD 3K1KC 2J88H 2XIDA 3GI9L 1VDGA 1NUDA 2ICWB 1T5XA 3A6CL 5M95B 2C5DC 3QIBC 1QLEH 2PR4H 1A7QH 4GOSA 3LEVH 3TESA 2F19H 1U8IB 3V4VL 4GAGL 3RVVD 1NBZB 2IQAB 1HXYA 1MWAB 2ICEB 2PO6D 2VXTL 4H8WC 2FZ3B 2G2RA 2R1WA 1AGBB 3DJ9A 3P9MA 3FB5A 2EDXA 4X5XB 3LQAL 5L2KA 1R3LA 3HZVA 5ACMA 3QEGH 1I8IA 1FC2D 1NGZA 1QSEE 1QSFB 4FZEH 5DC4B 2EXWC 4NGHH 3KPNA 3GJFA 3PE9A 1M4KA 4H88L 3CDFA 4LLWA 1S9VA 3SE9L 4I3SH 4H8WL 1H3PH 3IGAA 4RGOL 3VXSA 2W65A 4Z7WB 2X89A 2NY7L 4LP4A 4O9HL 5F70A 4PJAA 3FB6B 3MRMB 3QNXA 1ZVHA 5T1LD 3DMMD 3BPCB 5DZNA 1RIVH 4F15C 1RU9L 2UWEF 4OZGB 1XF5A 5AZ2L 2G5RA 4I0CC 1SY6L 1F13A 1WEJL 4ODXA 5DUPH 3MREB 5TPWH 4AIOA 4OGZA 1J0IA 5TFSL 3GSXB 3BIBX 3BP7A 4NJAH 3MRCA 3O3EA 4WCYH 4HPOL 1YYLL 2I25N 2P8PA 5I6XC 1HK6A 3S35L 4NQCB 5I16A 3V7AE 1FNLA 4R4BB 4Z6AT 2YA2A 4C4KO 5LAXA 1EFXB 1FV1B 5HYJB 1XGYH 4TVPH 3X17A 5KTEL 2A38A 3BXNA 4LCWE 2ADIB 5C3TA 4ESKA 2GAZA 4J4PC 5I30L 2IWGA 3TPKA 3X3FH 4XAKE 4I18C 3F58H 2V2WB 1ZWIA 2WUCH 5F9JA 3VG0L 1JHTA 5TDNB 1MCPL 1QLFB 5TQ0H 3O9WD 2XQYG 3T2OA 4WEBH 5F44A 1BFTA 4WFHE 4ZDHB 2DYPB 3NH7H 1W8OA 1K8DB 2BY0A 2EC8A 2R9HC 5KS9F 1LE9B 1ZT7B 3R06A 4JRYB 3MA7A 4MD4B 4OGYH 3IDNA 5HHOE 1WBYB 3D2UB 3PV6A 4ZQKA 5HI3C 4HS8L 2VL4A 1HYSC 3QAZC 4G6AD 4JHWL 3BUTA 4CADB 1DEEA 3IXAB 4ELMB 3GNMH 1U91B 2NY1B 4X6CB 5F6IB 2ZPKH 4F7MB 5E8NA 3FO1A 4TN9A 1SHMA 2HJKA 5D96C 3HG1B 1EO7A 1DVFA 3EDDA 2AJYH 4R3SB 3GO1L 1KBGH 4N1CA 4OLVH 5E5MA 5FO9A 3VWKD 5ICYB 4JHAL 4U1JA 1BOGB 1IZJA 5B39B 3L3OB 3QEQB 3OB8A 1OAYL 3C6LA 3LKSB 4HCRL 2OBGA 4AQ1B 3WNLA 4HIEB 1BAFL 1FNEB 4GAFB 2CLVB 3OB0H 1ZLWH 2VR5A 3FT2B 2XN9B 2VAAB 4MAYD 1LEIA 1LNUA 5EA0H 1KELH 3EOTL 3RGVC 4HHAA 2WINA 3ZE2E 1YEIL 3CJJA 2VIRB 5BVPL 4P4RA 3BX7C 1C5BH 2F58L 4X7EC 1N59A 2BVQB 1KLFA 1IQDA 3S3JA 3D39D 3EOBB 1YN6B 5J12C 3O0RH 1PDKA 4LLQA 1DUYB 1I3UA 2XA8H 1CK0L 2VDPH 3LKRB 5JNYA 2ZOKA 4PLKD 2QLVB 3LIZH 4LLVA 3QP3A 5JOFA 3GGWB 1GGIL 2V2XA 3AREC 4K94H 2AEPH 1J8KA 3MRKB 5E8EB 2QSCL 5D1XC 3O2DH 3KR3L 4P3CH 3VFPA 4I0PB 2EH7H 1U8JB 3ZTJH 4WI9A 4TSAL 5D2NC 2IG2H 4BSVB 1N4XH 4ZNEE 5HHNB 5JORA 2ID5A 1I8KB 3C5JA 1ZLVK 2AERT 5IR1A 5I73C 5I76B 5L2JA 1QSEB 2BHUA 3IYLW 4PJDF 5EU7C 2RR3A 4LSQL 1KYOJ 2YK1H 4LLYA 2R1XA 3KYNB 5MI0B 2VWEC 3BZEB 2P8LB 2J8UA 5KG9A 4D0CA 4PGDB 3TVMC 4YPGA 2XNAA 1KFAH 4PV8B 4TTDD 2VXUL 4YJZL 4CKVX 4WNQB 2PF6A 2W59A 2VZUA 5HGAA 3DROB 3SDCB 3ALXA 3D0VB 3LPWA 3KXFD 3HE6B 3UPCA 1T0MB 3HC3L 3RZCB 4CMHB 3ARDB 4PJCE 1HHGB 1XCTB 4OV5B 3O8XA 3QHZL 1FVDA 4UB0H 3BISA 3FCTA 1A4KB 1TITA 3BP6B 4M6NH 3QEUA 2BNRE 3IJYB 1ITBB 3T3PE 2UV3A 1CD8A 3DIFA 4ZXBB 2ZSWB 2CKBL 2ZZUT 4GG8B 5C0AD 3ZDXF 3GMOA 4JVPA 3VFRA 2PXYC 1VGKA 2M8XA 4XP5H 3BPOB 4EIZC 3KPSD 4TUKH 4H1LG 1KB9K 1DUZA 4X9IA 1H8OA 4AG4H 5HTSA 4LSPL 2OI9B 4LCWB 4ODVH 1JUFA 4EDXA 1NEZG 3OXSA 5KVMC 5D6DC 2XZQH 4NPYA 1Q9LA 4LIQE 1WCBB 1QFOA 1A64A 2AK4E 1MAJA 1NAMA 5CHNB 3K0WA 5DHYA 3NAAL 4JKPL 4TVPE 3WHE1 5DJAB 4LLUB 3C09B 5CMAB 3L6FB 4K2UL 2DQGL 3U48A 4CGTA 3OKKA 4PJFF 2QTEA 5HHPA 1RZKC 1ZKAA 3SKNA 4QHLB 5BQ7B 1EJ6A 4AZ8A 4OLUL 1ZLSL 4JG0H 3OR7A 3ARTA 4NN5B 4M62L 3BKYL 1BFOB 4L4TE 3BIAX 2VDRH 1MHCB 4P4KB 3PHQA 4ZTPH 5D7SL 3QDME 3QRFM 4Z7VF 1EAJA 3TZVA 1LGVA 4XZUA 4NC0B 5I1EH 5F96H 2ZJSH 3DYMA 1H5BB 2C4FT 1ZVYA 4OD1L 1MRCH 1D5XB 5CWSA 5MEOA 2ENYA 4QHNA 1QFWH 5B38B 2ZSVB 5DQ9A 4KJPD 1MAML 4AEHH 4K7PY 2VE6A 3NFNB 3QNYA 5I74C 4PG2C 5T3ZE 1QYGL 2UWEE 3FB8A 3UJJL 1RUQH 1ADQH 4LEOB 4H5SB 1CFSA 5HVGB 5DRNB 5BVJB 1C1EL 1WT5C 1R3JA 2E6JA 5E2WH 5TF1L 1A6TB 2XWBA 3MNVA 4HXAH 4MNGE 5SX4I 3BE1H 3W9DA 4W4OA 2E7LA 4EUPA 4JQIL 1AXSB 3MROA 2V9RA 3HPJB 3L5XL 4MCYB 4O5LL 1JWSA 4PTUB 4X98B 4HIIB 3CXHK 4JPIA 2GSIA 4IRSD 3HKFA 3BRFA 1FRGH 5E4EC 1SYVA 5I1GL 4LK4A 1R6VA 3VFNB 2H9GA 3QPQD 3QJFB 3HR6A 4RFEA 3UBXA 3FO2A 4KKAD 3GSQA 5AYUL 3GSWA 1FNFA 5DJ0A 1EO5A 1S7QA 5DQJB 4WU7A 1XF4B 4YZFF 3ARFD 5FYKU 3W39B 3MBXH 4Y4HD 3VXTA 5C0CA 3LHPL 3VXNB 3QFJB 2IC2A 5IMLA 3EAKA 4S0SD 3FO0L 1CTOA 3VJ6A 1ZSDB 1MFCH 4KRPD 4M7LT 4U0RB 4ZFOA 5LCVH 2OYPA 1W0VB 5JDJA 3VGHA 5DXWA 3L3DB 4CVXB 3IU4L 3O11A 2IJ0C 2HN7A 2LFGA 4U6HB 1EEUA 2VLRB 4RNRB 4PRPD 2ORBH 3O6FD 1JZ8A 4Q2ZA 5MP6H 4U05A 1IAKB 1P7KB 3IJHA 4L8DA 5GQBA 5IJVA 4LRNL 5ITFB 3ZT7A 5EN2A 1I9JH 3MGTA 1KXVC 2LTQC 4A2MA 4UDUB 4YGAB 4JFOA 3HMXL 4PJCB 4XCFH 2JIXB 5DJXA 2VDNL 3RVWD 3C5ZC 2AJVL 2NY6D 5T3XL 3ZHDA 1SM3L 2BVTA 1OB1B 3AU1A 3ZKQD 2X4QB 3BZFA 1T5WA 1K8IB 2BNRB 2J12B 1V8HA 5E8DH 1PLGL 3B83A 4A2LA 4GXVL 3MNZB 5DMYA 2BSTB 1J86A 1JBJA 2Q76A 1MUJB 1BQLL 3ARZA 1NLDL 1Q72L 3HI6L 3P9WB 4J1UA 5E8PA 1T0NA 5IHUL 5D7IE 4YQXH 2BSRB 3WSQL 3HAEH 1MQKL 2ENSA 3QHFL 3T0DA 3TH2T 4IS6A 1SEQL 1WZMA 3ARVA 3L3HB 3I9GH 3WUWB 2AK4B 3VFTB 1DJSA 3CX2A 4PG9A 1I85A 4JJ5B 2D4DA 3B2UD 3I6LD 4WO4C 3WXWL 4JM2C 2PW2B 2ZNWA 1CCZA 1DE4A 2CK0L 2BNUB 3MLYH 1UA6H 1QR1B 1FYTD 5DD0H 2PW1B 2NXYD 5J89A 1P6AB 4G8IB 1IGTA 3ZE0F 2W0KA 4HIHA 4CNIA 4XNQB 5D72L 3WN5C 4P46C 1XGTB 5JIIA 4HJJL 1RUAL 1PYWA 5H37H 4PJDE 3D1MC 4POZC 3F12A 1MI5D 3S4SB 3U6RB 1J0JA 4IMLB 5IFHH 4S1DC 1JNLL 4JHZA 2HLAA 4WEMB 4FXLA 2QADC 3NACL 5KSAB 4DUXA 1DEDA 5F7MC 3WXVL 1NANI 2HT3C 5B3JE 4XNMB 1I9IL 3BJ91 3FMGL 3D6GA 5J3HC 3T04D 3B6SA 1J8HA 1LEGA 2UWEB 2APWA 1HKFA 4PYHA 2FGWL 3D9AH 3Q6FB 3PNWA 4G42A 5SWZE 2EEBA 2IAMC 4PJ9A 4U1KB 4P2OC 1UWXK 4CN6A 3V2AR 4MNGB 1UKSA 4Y16C 1NMBL 1FIGH 4PJ8D 2O5YL 2A6IB 2H8PB 2QQNL 3KXFA 1ZT1B 4BFIB 32C2B 3RWJB 3ZDXE 4YHYC 4MLSA 3KYOB 4G3YL 3BGFB 1JWUA 4KC3B 1KCSH 1OD7A 1MCFA 3ZT6A 4Y4KC 1MIEH 1I7ZB 5C0EA 5L9DH 3DV6A 1DBJH 3MBEB 2Z31D 3JTTB 5C0AA 3RA7L 3MV9D 1PW3A 4M8VA 3EYFA 4GW5A 3BMVA 1FO0H 3AB0C 5F9WB 1NDMA 1I7UB 3E2HB 2IGFL 4NM4L 2NZ9C 4GLRH 1S7WB 5FA3B 3P30L 1A7NL 4KROD 5EU6D 1OARL 1J1XH 5JXAL 4J3WA 4ODHH 2N4IA 4P57A 4OD3H 4PJFE 3TWCH 2ESVD 1ZS8A 4JPWH 1N6UA 1GVIA 1MVUB 4KMQA 1UZ8B 4ZYKB 1TZIB 3UYOD 1P4IL 5CBAB 5FDWA 1EERB 4Z5RB 1LE5A 1TQBB 2BVEA 5KZCB 2C7UB 1UXWA 3C5SB 3DBXB 1RPQA 4KV5F 5J13B 5JDSA 4RFOH 4Z7VE 1YEDA 2ZKHH 1P84J 2QHLA 1MNUL 1NLBL 1MLBB 1LK2B 2OMBA 4X6EB 3LRGA 4WWKD 2O61B 4YBQC 1HH9A 5E5UB 1FORH 1CU4L 2PTVA 4ZFGL 4U1GB 4MQXC 5GJSH 4M6ML 3TCLA 1L7IH 2AKRB 3QPXL 2UY6A 4P23D 5SX5K 4X6FB 4R8WL 3MRQB 5DUML 1BLNA 2PYEE 4QRTB 3R8BB 2FBJL 4KKLC 1CGTA 1YEGH 4ORZC 1U8LB 1TETL 1TVDA 1AO7B 3IRZA 5D7IB 3KLAB 3D18A 5DJ6B 5IF0A 5DF0A 3ZSSA 2C1OA 1CE1L 1NH6A 5DQDH 1SBSL 3MLVL 3KDMA 5K9OB 2P8MB 3TO4C 1KJMB 4EI6B 2FO4B 2JCCA 4OZ4B 4JFPA 1XZ0A 4U6YB 3UTPD 2DLFL 4JFXB 3R0MA 3TN0A 4LSUH 1BOYA 2Y72A 4X7SH 3GIZH 2UVFA 2W9DH 5KVGH 3QUYB 1A3RH 4FFYH 4JPKH 1RJCA 4JO4H 4GRLC 4BFEA 1VCAA 3DHJA 4YZFE 4LVOC 4EN3A 8FABB 1T6VN 1T22B 1NDGB 5T1DL 1T4KA 3VGBA 4PJDB 3LKPB 4HQQH 4RBPH 4N0YL 3VRJA 4NQXB 4PGCA 3NPZB 3MPCA 3ARFA 1IGYA 3L3KB 5F7NC 3WLBB 3BQUA 4GBXB 1XIWD 4OCXH 3BAEL 3HPLB 2EDHA 1A7BA 2CRIA 4MDIB 4HDIA 1XGUA 3LKQA 1X5IA 4MAUH 3ROLB 3PGFL 4IRZH 2VTFA 5DS8A 3H8NA 4M61A 4PLNC 3KVQA 5I1LA 2EIDA 1KT2A 1N7MH 2NW3B 4DKDC 3DX8B 3O3BA 5I1JL 4K3EH 1TJGL 4Y5YB 4ZG1A 4MD0B 1ZVSA 3I02B 4PRIE 2WIIB 3SOBL 4FS0A 5E99H 4XVSH 5MEPA 4U0QB 4QT5A 3H0TB 5EU4B 4UUJB 2X4PB 4FZ8L 5L88H 1UZ6F 4M5ZH 4KK9C 4LCUB 6FABL 5BV7B 1G7MB 4NKIH 3LEXA 3WHXB 5ALBH 4LCIH 3TV3L 3X14A 1A1MB 4XCNA 1MFAL 5HYSB 1IGJB 1OAXL 5LGHL 3BWAB 3QUMB 4L8CB 3QI9C 1UJTA 2PNDA 3MLWL 3RWGA 4APQB 1C5CL 1QEWA 2GY5A 1YEHH 5GGRB 2CLZA 5ELIA 1HDMB 2VUOA 4TYUA 3K4DA 1F4XH 2NY4C 1AR1C 3IDIA 1E4XI 1NBQA 2YPKB 3SE4A 1KTRL 4PJFB 4OGAD 4HIXL 4JQVC 4UQ3B 5DMJB 3HUJA 2IH1B 3ZE0E 5DFTA 2B1HL 3QIWB 2F8VA 5EU3B 1DN2A 3GMNB 4M48H 3MRIA 3V5KA 1HHKA 3FZUD 4LOUC 3Q2CA 1D9KD 1JGDA 5BMFH 4FQIH 2O5XL 4RGMC 4Z7VB 3KJ6H 1N5YL 3K8MA 5I71B 4HUUA 4MB3A 4FQ2L 1CVSC 2APVA 3R0NA 1AY1L 3QIBA 4HK3N 4NOFA 3GUTA 3W81A 3RIFF 3UTTD 2EYSB 3EYQD 5HGGS 3TYFB 5HY9A 4QOKA 1HZHH 2GJ6B 4RISL 5FYJU 4WW1A 3VW3H 4QHMB 2Q8BH 2PYEB 1HHJB 4QTIH 4UIMB 2X7LA 3ULVC 1BVKB 2AXGA 4HH9A 4MCZA 1SY6A 5IG7B 4GS7C 2W9EL 4K3HA 1EVUA 1BJ1H 5D7LA 5JZ7D 4J6RH 3SGDH 5F7EL 5HVHC 4OTXH 4YHNA 4KJQD 2HTKC 3HC4L 1X6LA 2E9IA 4Z7NF 4Y19D 1EXUB 4HSQA 1X9QA 4G8EB 1EFQA 1Q9WB 3MCLL 1JFQL 4JN2A 5EZIH 3T0EC 1XMWA 4NRZB 3DLQR 3HAEB 4X7FC 5DO2D 3E8UH 4U1IA 3U9PL 5KVFL 3X13A 4TPRL 3L3JB 1RAMA 1GGCH 4PR5A 3DNKA 1AGFA 4QRUB 3SDDB 4FQHB 5C0DB 2Z35A 4S1SL 4OSUL 1YJDC 1HXMA 2DQEH 3FN3A 1ZEAH 2P45B 1M7DB 2CSPA 1EO8H 3QXWA 4KAQH 5B8CA 4LLMA 4R97C 5IBUB 4HS6A 1RMFL 4RAVB 4N5UA 3MV9A 3QDJD 4XHJD 1YQ2A 4RGNC 4ETYA 1B6DA 5C2BH 3BP4A 3WJJA 4M7LH 2ZUQB 1ZXQA 4I18A 1TZHB 5EU6A 3C9NA 1EUTA 4F80A 5T3XD 3RNKB 3RWIB 1YJDL 1A7OH 2ESVA 1ZHNB 1AGDB 1N2RA 1JRHL 3ORJA 4NC1C 4WUUE 5DVKA 4HF5H 1UEYA 4P2QA 3RAJH 4OFDA 5ETUA 1X7QA 1CD9B 1NMAL 4KK6D 1J1PL 2BNQD 4UTBL 2NX5E 4OLXL 4Q9QH 1D5ZA 5EB9A 4PRIB 1A6ZB 5CEXB 3EYVB 3DETD 4HCRA 3QUKB 4I3RH 2E9JA 3RHWF 4DGVL 2GCYB 3QG7L 4MA7H 3UX9B 1KNOB 1IM9A 2A77L 2HRLA 2VC2H 1WBXB 3SJVD 3VFOB 2MSPA 3X3GL 4WTZG 1AD9A 1JP5A 1OSZB 1X5XA 1FZOB 3T1WA 2MQ0A 4KZEH 3JWDH 2ZUWA 5IEHB 2B5IC 3EDKA 4OB5L 2ILLA 1DZBA 4G9DA 3VXQA 5F21B 3KPMA 1I1AC 4U49A 1YMHA 4NN7C 5FYJD 5F1NB 2OJEA 3HZMB 4GKSB 4DGYH 4I2XA 4HFUH 4JPVL 1KYOK 3RWHB 3U36A 4E0RB 3RGVA 2F74B 1EV2E 4JO1L 3MA9L 3WLWD 5EBMA 1FO0B 4PY8J 1FNSL 4G8FA 5GS1C 3ZDYF 5I1IH 3SKJH 1LILA 2OLDA 4LNRB 2HWZL 3CCHB 3UBXG 3WYRA 5F9AC 3AS1A 4O51B 4MA1C 1WC7A 4XCEB 1RIUH 3RKDD 4F58H 5KVEL 4JDZA 5D1ZC 1X5GA 2C1PB 4ZFZA 2D9CA 2XRAL 3AREA 5J6GA 2QR0A 2W60A 5D1XA 1HINH 2F9BT 5AZEL 3S5LB 5D5MA 1F4YL 4KKNA 4UIKH 3RQ3A 1IKNA 4YAQB 4AIZB 3KG5A 1BBDL 3PWUA 1INDH 3ELAT 4GMTH 2I60H 4UDTA 5TDPA 3JWOH 4HS3B 3R1GH 5EC1B 1MOEA 5D71L 3AAZA 4JZJB 4I3GA 1A4JA 1T66D 4YHKL 4GSDL 5FUOH 4L3ED 4FABH 4RAHA 5IVXA 3DX6A 3TVMA 3OAZH 5D7KD 4NNPL 3PWVB 3E3QC 1U8QB 3HE7B 1IFHL 1U6AL 1HILA 1IC5L 4Z0BH 3U4BL 3OV6A 2CKBA 2NQCA 1UZ6E 4R96B 1QQDB 4XX1G 43C9A 5IW6A 2FB4H 1FNGA 2FJHB 1QVOB 3MC0A 1JYNA 4LLDA 3IU3B 1A7PL 3O3AB 3V0WH 4U2YA 2GFBB 4Z7UF 4N0UE 1N3NA 3RVXC 1R5VA 3RL1A 1MJUH 1F3RB 3HR5B 1NCCL 1VGEH 2ZCHH 1UCBL 3JV0A 2C3VA 1EA9C 1WFNA 3T0XA 3RTQC 1IL1B 3MLPA 5DJDB 2X1OA 3BESR 3MLXL 2X10A 3CVIL 3LKOB 1IC7H 4QRPB 2AK1H 3F65A 3VFVB 5J11C 5E2TL 1YY8A 3TIDB 5D6DA 3MZGB 2CDFA 5FK9B 3TA3D 5D70H 1HQRA 1JPGB 4MWFB 3T2NH 5GGTL 2NY3D 4NQSB 3ARUA 4WUUB 3F7YA 3HFMH 2OSLB 5DRZB 2OCFD 1KCRL 3NCEB 5BS0E 3G6JF 3L9RB 3MLZL 4D9RD 1RJLB 1MJJA 2OTWA 4P2RD 1DLFL 4YBQD 3I6KA 5FOBA 5KSVB 5I1AB 2VL5A 2YD1A 5IMKA 2I07B 4PGBA 4MZ2A 4JFEA 5F9OH 3FQWA 1W72L 3VXRD 4WDIB 3IDYB 1B0RA 1QRNA 4A6YA 1G7PA 2F5AL 2W1NA 2OJZL 1XGRA 5DFVD 5HI5C 5L8KB 4L3AA 4P9ML 1BMGA 1NBVL 4JE4B 3ARPA 4JANB 1PSKH 4FTVA 5CJXC 2BRRH 5E03A 5GZNC 5DD3H 4PJ7B 4KTEL 4JO3L 4PG2A 2HFEB 1A0QH 1KIPA 1V7NL 3BZ4B 4OZIA 1MIMH 5FGBC 4HWEH 4M7JH 4L8SB 3MRLB 4KI5F 4OM1L 3FT3B 5KJRL 5C0JA 1WT5A 2YUWA 2P49B 3CD4A 4HIJB 3SKOA 3VXMA 3CGTA 3QQ4A 3HMWH 3CH1B 3EO0A 3DSFH 3MZTA 3IFPB 4YDVA 2Q7NA 4JREB 3WFCL 3IKCB 1B4JL 4LASH 2Q7YA 5E7BA 1JPFA 4PLJC 3D85D 3PV7A 2VQ1B 4FFZL 2XZAL 5IQ7H 1U8MA 2E7MA 4NBZB 4O2FA 3GZKA 1IAIL 2NTFB 3MNWA 4U4BA 4CW1A 3TFKC 2DAVA 1C08A 2MCPH 1V05A 1CZ8L 3WNKA 3X11B 2KL6A 3U0WL 4P5TD 4RMVA 1WUNT 5GISL 4IBLT 1CFVL 2DB8A 5JO5B 3ZDZF 1BJ1J 4MNHA 1A8JH 2A6KB 5C09E 4B5EA 1MREH 5IW1A 4OGXL 3AC0A 3C6SA 3S88L 2GSGB 1NCDL 2QSTA 2A83A 1T04B 3MCKA 4UT7L 3HMXA 4D2NA 5L6YH 3ABZA 5F89A 4JR9H 2W0FA 1N8ZB 4GW1B 3MR9B 3IAPA 4EOWL 4YHLH 4XPAL 1A02N 4JAMB 2ZCKL 1AFVH 2IQ9H 2KBGA 2HLFD 4R2GB 5IK3A 4I1NB 1IEAA 4BKLB 3ULSB 4C83B 4L5FL 2DQIH 1AXTH 1AD0B 1TQCC 2OX5A 1LVEA 1ERNA 5DWUL 3IDXL 3NFSH 1CDJA 1SQ2N 3C5ZA 3MLRH 4UI2A 5ALCH 4N0UB 1A6UL 3SO5A 4YBLB 1MEXL 4FQCL 3TNMA 5LKNA 2E3VA 2DJSA 3H9HB 5CEZH 1TDQA 4L4VB 1OGAD 4OLEA 2EDTA 4NN6B 4PUBH 3SJVA 3TJEL 4TUJB 1H3VA 3V0AC 5C0FA 3DRTA 1JGVL 4DKAA 3FFDA 1KPRB 3GSUB 1CXEA 4R90L 3QDMD 1Z0NA 2NYYC 3B4NA 2HG5B 3NMEA 1YZZA 2DRUA 5FHAL 4ZUVA 3IB4A 5EBWA 4RQQB 4XNUH 3ZDYE 1NC4D 4TULL 4XP9L 3OB0K 3OR6A 1P9MA 5FYLE 2HAZA 1ZLWK 3KPTA 3NABL 2KUTA 3KS0J 5E08L 1F8TL 3FAWA 3GHEL 4YXKH 1LEKA 3GIVA 5A3IC 4LVNC 3VH8A 4WO4A 3I75B 3FRPA 4JM2A 2Q8AL 4HWBH 5DFWH 4PJXA 4G80B 1QKZH 2LU7A 3UJIL 2K7QA 4PJAF 5BS0B 1E28A 4XH2A 3MYZA 4UOW0 3BKCH 2WBJD 1U8PA 4XVUC 3PIQB 3BIKB 2P5EE 4OM0L 1ZHLB 4Q9RH 4FQXD 3WN5A 3SBWC 1IC4H 5DD1H 3VXPB 3N1MC 5TQ2H 3VG9C 3NIFF 3WIFA 4P59L 3MO1B 3KJ4B 5I0DA 5A16A 2R8SL 2CDGB 3VFGL 1EJOL 3LS5H 3T3MF 3A6BH 5ENWB 4YFDB 3QDHA 3SN6N 3LD8C 4PJGF 2O93L 3GKWL 3ZT5A 3PJSA 1CD1B 2I9LA 5GRXG 4W6WB 5KOVC 5HGHA 3RPKA 1HE7A 4QHKI 5I2IA 5JW3H 3GM0A 4U6TA 1F4WH 4YC2C 2CIKB 3FRUB 1R3IH 4NYLB 1X5ZA 1RZKH 1KLGB 4NT6B 4DVRL 1JZ4A 1NCAH 4LVEA