4GMTL

Crystal structure of heterosubtypic fab s139/1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQEKPGQSPKTLIYSASNRYSGVPDRFTGSASGTDFTLTITNVQSEDLAEYFCQQYNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Fab S139/1 light chain
total genus 52
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmtL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmtL01
2C26A 3D5OF 3MC0A 4WI6A 2X4RB 5F9WB 5DC4B 4PRHD 4F7PA 3LQZA 3OKMB 4X7SL 5CD3A 5I16B 3QUYC 5CMAA 5BMFH 1V3JA 2LFGA 3IFNH 5I73C 3DTXA 1P69B 3QPQD 1T1ZB 4NRXA 3RGHA 3CLFL 5AZ2L 4XI5D 1PZUB 1N0XH 1DANU 4OFPA 3AVEA 5DXWA 2E27L 4XGZA 4ONHA 2X6MA 3B5TA 3DO3A 4WI7A 5FM5O 3QQ4A 3MLSL 5ECJE 1T04B 1T66C 3Q1SH 3NMEA 3SE3C 2W38A 4ZOBA 5IMLA 1Z9OA 3V5DA 4LSSL 1F13A 3MUY1 2VXSL 5AYQA 3JV6A 4N8CH 4MGXA 3SDXB 4I48B 3ELAT 4HIHA 5JA8B 2VR4A 4R2GC 5D1QC 4DKEH 4GRWF 3AGVA 3F65A 4NNYB 3CFBA 4JZNB 4QKXB 1Y0LB 2N1KA 1VFAA 1XCQA 5CZVL 1IGFL 3PXHA 2ADGB 3VU2A 1UWXK 5FYKL 3HI6H 1HEZB 2ERJB 1V3LA 1I9JL 3NFPA 5FA3B 4OGAC 5DD3L 5E70A 4Y16C 3ARVA 5EORL 3IDIB 5ITBL 1KB5H 1KYOK 2V17H 2Y07L 3NCJL 1RZ7L 4L4TD 5FHAH 3BPNB 3MYJB 4EZMA 4DAGL 4D0BA 1KF9B 3FQTB 5IGXH 3TA3B 2BSTA 2PXYC 4GAFB 3MA9H 5HDQL 4RQQA 5GGQL 4LPTA 4H0GA 3QDMD 4MNQD 1FNEB 3P2TA 3ILQC 5JNYB 3HLAB 1J7VR 5EZJA 2BXYA 5BVPL 3REVA 3OKMA 4DVRL 1OQXA 1RUKH 2GJ6A 1F4YL 4F7PB 3VMPA 1KXQE 1R24B 3ZYIA 4PGCB 2R69H 5ANMA 4XP5H 5CP3H 1FH5H 2A6KB 1LO5A 4WI3A 5IT2H 5JLZA 3H3PH 1JV5B 3QEUA 2ICEB 3JV4A 1NAML 2HH0H 3NZHL 3PIQA 4L29A 1JGUH 5DC9B 4UU9B 5H35A 2R1WB 1T20A 1FFOA 3BXNA 4I18A 4BSJA 3ARBA 2JJWA 3FO2A 4OLYH 5AWNH 3O3DB 5C86A 1WT5A 2HN7A 4O9HL 3O3EA 2UY7A 3LRGA 4GG6F 4TTGA 2AXHA 1WEJH 3FO9A 1NDMA 5JPNA 5E00A 2G9HB 5INDA 1WBZB 5BV7B 1UZ6F 4Z0XB 4ENED 1HHIA 3DHMA 1WZKA 5IQ9A 2R1YB 1A7QL 5GIRB 4O2CA 3S36X 1MHCB 3I6LD 3T0AA 5HYQA 3OF6D 4PJCF 3RUGF 3W11D 4Z7VE 2PUQT 4G8EB 4H1LB 3MRDB 3PL6C 1KACB 1GPOL 4DGVH 5C0RH 1CIDA 4XHJD 5JOPE 1KJVB 5EB9A 3OX8A 5FGBC 4P2OD 3BJ91 5SWSB 3P9LB 4EBQL 4GKNA 1U8KB 5BZWB 4NQEB 5IG7B 1CTOA 1I7RB 2XTLA 3EJZC 4FXGA 4RGMC 2Q86B 4QXGL 3BP4A 1HHGA 4FXKB 4JFXB 3MA7A 4XAWL 4LCIH 1RHHA 2W9EL 3ZKND 2FH6A 1QR1B 5E2WL 5GJTL 2MQ0A 1MAMH 4OLUL 1TVBB 4DKDC 4JAMB 1FL6B 2CDFA 5FA4A 4JG0H 3IETB 5SWZE 1JPTH 3OKYA 1NSNH 3V7AG 2RCSL 1S9VA 4KTEH 4PP1C 2E9JA 1J05B 3PF2A 3MLWH 5FFLA 1AY1H 2Q8AL 4JQIH 2ZCKL 3SBWC 1YEJH 3ARFA 3TA3C 4YHZL 1UGNA 2XICA 5E8DH 1I85C 1UB6B 2FECI 5DI8A 3IXAA 4OUUA 3LVEA 1B90A 1U95A 2W0LA 3DUHA 3LN4B 4JPVH 1QSEE 5D71L 3UTSD 1JNNL 1XF4A 4TSCL 2J1KA 1CFTB 2A83A 4Z7UE 2H32H 4RWHA 1R3JA 3T4YA 2MSPA 3QIBB 5DD6B 3G6JF 2XWTB 5AYUH 4PS4L 2GT9B 3WN5B 2A77L 2P48B 1ZHLB 4HCRA 2EDKA 2VXTH 1FAIL 2B1AH 2VRAA 4FQLL 5ICZB 3IDNB 4EI5A 4U1NA 1HSAA 4XI5C 1UB5A 2WIMA 4ZUUA 3DX9B 4HJ0C 3GMOA 1IGIH 2VC2L 4HG4J 5EBGA 1X5JA 5MENE 3GSOA 4FQIH 5JDSA 5E8EB 5DRZB 4LHUA 1GOFA 2WBJD 3BWAB 1KJMA 3VWJC 3LS5H 3U1SH 1PLGL 2GSGA 4OCWH 2OL3H 3WIIH 3QNYA 5TQ2L 1U8IA 3BDYL 5JHLH 5K9OB 1W2KT 4MNGE 5KVFL 2J6EL 2NNAA 4JCLA 4G5ZL 4K7FA 1GZPB 1U8QB 4ZUVB 1FNHA 1G9ML 3P4NB 3SCMA 3MUHL 4LLYA 5GS2D 5EIIB 3WS6A 2OTUA 1JFQL 1FQ9C 4KUZH 4Z7WE 1LE5A 3DRQA 4S2SA 2V6HA 3EJYD 1FNAA 2HTKD 3EHBD 4R7DB 4GAYA 5ICYA 5HGGS 1U58B 1BOGB 2H26A 5IJVB 3NOIA 3TVMC 1CGSH 2H26B 4PJ5B 1UA6L 3ETBF 4NJAH 3LS4L 3HI1B 4OLWH 1A14L 2ITDB 3VFGH 4MDIA 2YMXL 2D9CA 3ET9F 2IPTH 1VKXB 2WANA 3EYVB 1OB1A 3PABB 4L4VA 5C7XL 8FABA 1GZPA 4WY7H 5IESH 4WW2A 1DUZA 4TULH 2VOTA 3L5WB 1HXMB 2GSGB 2GIYA 1YEIL 4HS8L 4I3RL 4DKAA 4LKXB 5F9WC 3BDXA 3I02A 4CU6A 3V8CA 4WWID 3UXFA 5DVMA 3RGVD 3QPXL 4DGIH 3RY6A 3BEVA 2DQUH 2OSLB 3KYKH 3VFRA 4M5YL 2P8MB 3OQ3B 2ZUTA 2EKJA 4NQDB 2R39A 3MLVH 5L9DL 3BP6B 3Q6FA 2Z92A 2X42A 1AI1H 4UILH 4YDJA 4XC1L 3ZKXB 2RFXB 1S78D 3B9DA 2O61B 5ESAB 2B39A 2NY4C 1MCQA 1TZHB 2EYSB 5HSFA 1H8OA 1OW0A 2DDQL 4QWWD 3WN5C 3T09A 3CFIC 3UTTA 5IW6B 1NQBA 1D5BB 3BW9B 1L7TL 4U1SB 3MNVA 1I1FA 5C0BB 1F4WL 2F19L 3BPCB 5I8CA 2ESVE 4N1CA 4NKMB 3WNNA 1NEZA 4G7VH 4LMQI 3O4LB 2L7JA 2O5XH 5TE4L 5EU4A 1S9VB 3EFDH 3FQWB 3OHXA 4NC1E 1QSEA 4MNHA 2DJSA 1OF2A 1ACZA 2C4XA 5FA4B 4NQDD 3I75B 1E4KC 4JAMA 2EICA 3CVIH 5GRUL 1JMZA 1KLGA 7FABL 2G75B 2VZTA 4QF1A 2HRPH 5FO7B 5LVEA 1YNLL 4UT6L 3ZYJA 1NFKA 3KXFB 15C8H 2Z8WC 1N5AA 4WFFD 1FGNL 3LQAH 1RHHB 2AJZB 4PRDB 5F89A 4KKLC 3UJTL 5FKPA 5KG9A 5IOPA 3E8UL 1BD2B 3RHWF 4JPWH 1I8IB 2VAJA 2FGWL 3TO4B 2QQKL 3KYNB 5K9QG 1JTOA 3TZVC 5GGTA 5LBSL 4JR9H 3LQAL 3K8KA 3LEVH 4ZFOL 1I3GH 3MRDA 1H3TA 3VGHA 5C6TH 1MLBA 3T0BA 1ORQA 4YPGA 2B0SL 3VA6A 1P4IH 5HYQB 1JPTL 4XH2A 4XVUD 1MFDH 1IAIM 1U8NA 3T0DA 4M1CD 3JSSA 5DSCA 4UQ3B 3PQYE 2F5BL 3PWJA 3V5HB 1RURL 4LIQH 3CD4A 4LCYA 2NX5D 1XFPA 2XKUA 5TE4H 2R23A 3QDJE 1I3GL 5EOQH 4Z76A 3PHOB 4UOW0 4YH6A 5LBSH 1PYWA 4IDJH 1D5MB 3JWOL 4UV7H 2R1WA 2RIKA 1N6VA 2A9ML 3MV8B 2X70A 3FMGL 4NWTH 1CE6A 1EEUA 4LK4A 1F42A 3JV4B 5EUKA 1BX2A 2X4PA 4NC2B 1BVKA 1UQSB 1U42A 2DMKA 4L9LB 3LV3A 1K2DB 3HZMA 3WV0A 4X6CB 2J4WL 1RQ5A 1KNOB 5B8CA 4UV7L 4ZS6C 2YN3A 4N0CD 3ME0A 3RU8H 5IFJB 4HGWA 5EZJB 4KQ4L 4PJDB 5DMKA 3IDJA 3LIZL 4X6EB 1NANH 2ZNXA 4JLRB 3QWRD 4MAYB 5ITFA 1E6JH 1ORSB 4KY1H 3GGWB 1BZ7B 4EKXA 3ES6A 3SDCC 5C08A 4LNVA 5F88A 1RJLB 2HG5A 3IS0X 2H8PB 1YEKL 5D1QD 5JW5B 5E8PB 3BDYH 5JHLL 2D2OA 4BKLA 1AHWC 5C2UB 5HYSA 4EDXA 2B4CL 3OXSA 4RGOH 3O9WC 4POZC 1ZKAA 2AQ1A 4K94L 3FZUD 1YYLL 1T2XA 5DZOA 5FA3A 3RUGE 4K3DL 5HPMA 1P84J 1UJ3B 1X6LA 5DMJB 4L8BB 2ADGA 4ZUTA 1OOAA 4NWUL 4Y1AE 4KZEL 4CRPA 5E2VH 5BV7C 2D7TH 1DEDA 5FYJE 4NNYA 1BFOA 5I1LB 3C2AL 5L9DH 2N7BA 4NJAL 4Z77B 1FPTH 3FCTA 3RDTD 4P46A 1B0GB 3W0WD 3TZVB 1J8HA 2PYEB 2CD0A 1RVFH 1T1XA 3VRIA 1XH3A 4C4KT 3FN0L 4OZHE 1T6WA 1Z5LA 1PKQB 3WIHH 5BOZG 3HPJA 4HMCA 3VG9B 2APFA 4H8WL 1FVEB 5B38G 3K0WA 1CBVH 5HGBB 4YNYA 3T04D 1CQYA 5ITBH 3FO1A 2HA1A 2IF7A 3SE3A 4BFEA 3LKRA 3VD3A 1YZZA 1IL1A 3MRBA 1FZKA 2AGJH 2NY3D 5T33L 4YUEH 5BO1L 1HILA 4OM1L 2NQCA 4F37F 2VDOL 3WDHA 3U0WH 1NLBH 4JFQB 1OSPL 1CIUA 1OD9A 2QQKH 1A6WH 2BNRE 5C0DB 2KQNA 4TOYL 4ORGA 4Z7QE 1UH3A 5GZOC 3HTLX 4QNPF 4Y16B 1DJSA 3ZLQC 4I5BB 3M1BB 2F53E 1KPUB 3TYFB 3QCUH 5F1IB 1NBYA 4JRXD 4XP9L 2EO1A 4JB9H 1K5NA 5F96H 1N0XL 1YN7A 3WE6B 1A6VH 1RZ7H 1ZK9A 4KK9C 3VXUB 3VH8B 1DBJH 2E7CA 2B1HL 3NPZB 3RI5K 1MSPA 2VLJB 4KUCD 2P5EB 2VE6A 4BM7A 3FFDB 3KPQB 1C8PA 3HAEA 4M8QA 4P23B 4UV4H 3VW3H 1AR1D 1FFPA 4PRID 5F1SA 4OV5A 1WWWX 5E1HB 5FGCE 1GGCH 3PWPA 3TN0C 5I1KH 3S3JA 3H9HA 3OGCB 1FBIH 1F11B 3DXAA 1RUAL 4OZFG 4ODSL 4RFOH 4ESKA 2XA3A 2VZOA 2APWA 4UMGA 4CMHC 2Q20A 4Z7QF 1LHZA 5K9KB 1A7OH 2FHFA 2N4IA 5CZKA 4XMLH 3O6FB 3QUXA 2EEDA 1AGCB 1E4KA 1LVEA 2NW3A 4FP8H 4JFFD 3F5WA 1Q9WA 1S7SA 4IOIB 3NN8B 5IB2B 3Q3GB 5DD0L 3QHTC 2LTQC 1GGTA 1J0ZA 4PLJC 1U8JB 5KSBF 2VZSA 4HULB 1U8LB 3PV7A 3QA3B 4B41A 4L8CA 3CK0H 3QIUB 5HI4C 5J11C 2X9WA 1CFQB 1HZHH 3IVKA 3G6DH 3T3MF 3RWEA 3GMLA 5IMMA 1T0MA 4EBQH 1OP5H 4POUB 4QEGA 4QRPB 1AGBA 5EU7E 5E94B 2R0ZL 1RUPH 4BYHA 2ED7A 3T1WA 1YEGL 1CDBA 3N06B 4XNQA 5I19H 1J9CT 3D1MC 3GJEA 4OKDA 3H42H 3T0EC 1PDKA 6FABH 3INUL 1AGDA 1VEOA 3BH9B 5E4IA 1VFBA 4Y2OA 1DQDL 5GGQH 1HXYA 1U93A 2AAVA 2EDEA 5EUOE 2IADA 1MJ7L 1ZGLA 2EE6A 4NZRH 1H15B 2DQEL 3SDCA 3DBXA 2DBJA 2F54E 2YN5A 4M43L 5DTFA 3GUTB 5KVGH 4IS6B 1WFNA 2CUHA 3HZVB 2H9GA 3A6BL 1BLNB 2D31A 2R2EB 3MZGB 3IU4L 2PW2A 4AH2B 2HLAA 1LO3H 5E8NA 4KV5E 3KLAA 2F53A 4QRQB 2GY5A 3SJVD 4Y4KD 2IFFH 4HCRL 4JZJC 5I75B 3IJSB 3G5ZA 3BN9C 1ED3A 5D72L 2K9UA 3FFCB 2GY7B 3PL6A 2ED8A 3X3FL 3VFVA 5DQ9A 1WITA 1T5WB 2VDKH 4WEBL 1ZT7B 1RPQA 5FIEA 3BHBA 4KMTH 5A2IH 4S1QH 4GT7A 2QSQA 5E4EC 3TBYA 3W9EA 1S9XA 3VGFA 4DOHE 2G5BA 2A9MH 5D6DA 5FF6B 3QZWA 5E1AA 2UYLA 5E5UB 3JWOH 3TWCL 3DSFH 4PG9A 3SKJH 5BJTA 4PRBA 1ND0B 4LCCC 4PJHA 1ZLUK 5JIIA 1B6DA 4KJWD 4NOFA 4JJHA 4CVZB 2AJXL 2R56L 5TQ2H 3IFPB 1RK1A 1JCKA 5K9JH 3OKEA 4OCWL 2NY4D 4FQ1L 4YFDB 4YDIL 1FORH 3BX7C 3T0EB 2B0SH 4ACPA 4X7DC 3LEYL 1CFVH 3QEQB 4G8GE 1JPST 2IAMB 3QQNA 3L5XL 4CDGC 1OGAD 1JJUA 2V2TB 1AXTH 3GRWA 2I07B 4OCSL 4PG9B 3RWHA 1T03L 2PETA 1CVRA 1UENA 4R0LB 3WXVL 5FF6A 4RAHA 1WCQA 4XCCH 4OFYA 1F4YH 3UTSE 1W0VA 1KC5L 3BZEB 1FNGB 1MJJA 2H1PL 1FYTB 4XC3L 3QUKB 1DBBL 5EZLB 4Y4HC 4ZFZB 3MXVH 2GTZA 1FGNH 2BHUA 4WJ5B 1JYXA 1JHKH 2B20A 3K7UA 5SX4H 4UTAH 2HKFL 2ESVA 2NY0C 4M1GL 3QXWA 2CLRA 1W0WB 5KSAD 2DLGA 2HLAB 5E8NB 2YD9A 5FGCB 3SGDH 5F7WC 2AJ3B 3TFKD 1RZGB 1FE8L 4MAYD 2DQGL 4JY6A 3V8OA 3HZVA 4H1LG 4KK8D 5IW1B 1P4BL 2JJVA 1NCCH 4NZJA 4MJ6B 3W5NA 5C0GA 4Z7WA 2P5EE 2XWBB 4OLYL 5AWNL 4MS8D 4ONOA 5FGBA 5T1KA 4G9FE 1BJ1H 3JWDL 4IBLT 1HXYB 2ENYA 1QA9B 4MJIE 3LKNB 4GRLD 1EFQA 4W6XB 1LD9A 4O5LL 4JKWA 1VACA 2EH8L 5BRZA 5HY9B 3WKMH 4OLXH 3QUXD 4YAQA 5HGDB 3IFOA 3PQYD 2HT3C 3C87A 3QHFH 3QB7C 5I17A 4N90D 4RNRB 4IRJD 4BZ2L 1KB9K 1MUJB 2LAGB 4PJ8A 1U8PA 2QSCH 1T0MB 4HXAH 3RWEB 2F5AL 1I7ZA 5I0DA 4K55A 3VXPA 4JVUA 4I77L 1F00I 2VKXA 3JV0A 4L8CB 4W4OC 3MV01 3MJ7A 2Y6SD 3FO0L 1CDCA 4OV6F 3KVQA 2AEQL 1U8JA 1FIGL 5BS0E 3L1OL 5HD8D 4OD3H 4P2RB 3ISWA 1UEMA 4PJIF 1QQDB 4HUKB 2XPGA 3UTQB 1EFXA 5A16B 3D3VD 3FB6A 2P5WB 4JZOB 3U7YL 3ULVL 2V7HB 4K3DH 2BVOB 4X0KA 1EBAA 2AKRA 4HIXL 1MIEH 2DKSA 4QHUA 3QUMA 1H5BA 1HCVA 4ZD3H 5BV7L 4PY8J 4JFHE 4HWZB 1G1YA 1QLEH 4PJFF 5D1ZC 1GGUA 4YGVB 3VFOA 1N6UA 3EUUA 4GBXB 4NRYB 4XBEH 5GS1C 4JRXA 3IJHA 3L3GA 2D7QA 3Q1SL 4ZO9A 4NHUB 1UVQA 3CZJA 1BZ9A 5ILTL 3RU8L 2ICCA 2D7NA 4JHAH 3HRZB 2EDHA 1IEAB 4J3TA 3BEWB 1FFPB 5C07E 1DQLL 1Q9OA 2JJTC 2A6IB 2PTTB 3WMSA 1TZGL 35C8L 4RFOL 2XXCB 2XZAL 4HUXA 3DV6A 3FFDA 5GGVH 4XHQA 3QJFB 1IJ9A 2VLKA 1WBXA 5LGHH 1RZKC 1T4KA 1P5VA 3VH8A 3S5LG 2ZG1A 5DD5L 5IFHL 2NY5C 1DEEB 3FMGH 3GMPB 3HI6L 1B4JH 2ZOLA 5IV2A 1VB9A 1KCVH 1Y18A 4OZIB 1EIBA 1KIRB 4FABL 4GS7B 3MRFA 4HH9B 4MJ5B 3W39B 1NBYB 4M6NL 1QSFE 2MQ3A 4N1HB 5ID0A 2NY5L 3LB6D 2OZ4L 5HHOB 2LTQB 4TUOA 2X09A 1JNNH 3NABH 2NMSA 1R3KB 1P4IL 1YMME 3MV9A 2B4CC 2X4SA 3NFNB 3QUYD 2OMBA 3SO3B 4J6RH 4K7PY 2E6PA 4G9DA 4X6CE 1MCEA 5EU6A 1YEEH 3HR6A 4WI4A 4FQJH 5KSBE 3GSVB 4KK5D 4LVOC 3NVQA 1HILB 1BFVH 3NABL 3NH7H 1AGEB 1JGVL 2F58H 3BN3B 3DVGB 1JRHI 3QQ3A 1AQDA 1LNUA 3UJTH 5F93C 3IS1X 4HGKC 3JWDH 2OQJA 1AXTL 1RUQL 2Q76A 1XF5A 4NPYB 5I74C 2KL6A 5IKCB 3CCHA 1WISA 4U6XA 3QAZC 4ISVA 4FQHB 4PJDF 3ALXA 1HHHB 5F72S 4HJJL 5C0JB 1BVLA 5C8JB 4D9LH 2AEIT 3FFCE 5BXFA 2RHEA 2BVQA 2JJSC 4FQXD 4AEIH 1CXLA 1KULA 2IMMA 2DWEA 4NOBA 5GJSL 3KPNB 2DQCH 4F9PC 5D7IA 4P46B 3KLSA 4YFLF 5I71C 1A3RH 1KIRA 4PJ7B 3FN0H 3BSZH 3JTTA 4PP1D 3SPVB 4XVTL 5D7LD 4UB0L 3W82A 1ZWIB 3FQXA 3CXDH 3HR5B 4RAUB 2DM3A 1MCJA 2CDGB 3IDGB 3O6MH 4JQVA 4Y2DC 4X6DA 1G9NL 1IFHL 3QCVL 3S35H 1DN2A 4XPAH 3D87B 5F1NB 5L2KE 5D72H 4MJIA 1OTSC 5C0ND 1Q9LA 3TIDA 1FNSL 1EJ6A 3HZKA 2BMKA 4D3CL 4OCSH 3PP3K 3AFLA 4M4PA 1UT9A 2DAVA 1DR9A 4R96B 1C1EH 1OLZA 4PBWD 5MEQB 3AREC 1UZ6E 4AT6A 1KTDB 5FOBB 3C5SB 4WHYG 1FG9C 5I1CH 4PJ9A 3PWPE 3QIWC 5DHVA 4GBXA 4NRYA 3ZKQD 4YGVA 3B5HA 3C5ZB 4QT5A 2MCPL 3WBDA 3IDJB 3WFDL 2FJFB 4HQQL 5HDLA 3RKDD 3MSPA 2IH3B 3TBWB 4RAVB 2R4RH 4NC1C 3UYRL 3DUUA 2E7LC 4QHUB 3WNLA 2G2RB 2VITB 3ILPB 5TDNB 5E2UL 2VQTA 1NGZA 3H42L 5SWSD 4HXAL 3C9NB 1UQSA 1FLRH 2EDJA 4WW2C 5EUKB 1IC5L 2Q7YB 4KQ3H 3RL1A 4OFVA 2H2SD 2XZQH 4W4NA 3VI3F 3VG0H 5LGJB 2UWEE 3JWOC 4LRNH 5FUOL 1IC1A 2O5ZL 4X4XB 3QG6A 4B53A 5C1MB 3ARRA 1EMTL 4GW5A 1A2YB 1KC5H 4HT1H 5AAMA 1X6NA 2AEPL 2VKWA 1C12A 3LPFA 2Z93B 4FFWC 4JKPL 3ARDA 4ZAKD 4ELKA 1A6WL 5E5MA 3SDDC 3IU4H 3IGAA 5C6WH 4JGUA 1II4E 4HEME 4PLOB 4G8IB 4I0PB 4MHHI 2YD8A 4YO0B 2VABA 1U36A 1CLZL 1CFVL 4NUJB 1GOHA 1KENL 4OCYL 4DKEL 1Y6MR 1V3MA 1NBVH 2YZ1A 2VL5A 1E27A 3LS5L 1Q72L 1TTGA 4MXVF 2I26N 1U3YA 1G7MB 4S11A 5HYJB 4JFEA 1ONQB 1JBJA 3RPKA 4UOJA 3VFUA 1NFDE 2COQA 5TE6L 1I1CA 3MFFB 3BUYA 1N26A 3T8XB 1ZOXA 3IKCB 5IVNA 1FGVH 3ARPA 4QHKI 5FHBL 4PV9A 4OZFH 4WVRA 1N4XL 3MRIA 3DYPA 5DWUH 2MTPA 5FO7A 2ED9A 2FWOA 5C0IA 3NCYP 2QQNH 1HZHL 5JXAL 3QFJD 1TIUA 3OHXB 1KXVC 1Z0MA 2NY4B 3VFPA 5DMYA 3MX0A 4FS0A 4MMXC 5EC1A 1I1YB 5JZ7D 5I30H 2YK1L 1BQLL 2APBA 3V52H 2QSVA 5LGKA 3S34L 2AS5M 3VGBA 1EA9C 3BT2L 2ZJSH 1T1WA 2KKQA 3OKKB 4U1GC 1D5BA 2QR0B 5FCSH 4P9HL 3QHZH 4OLZL 3SEPA 5LXGH 1WBYA 2YPVL 2DWDA 3QEQE 2DLFH 2O61A 2RFXA 4OLEA 3MTRA 2V2TA 1ZHNB 2WWMC 2FDBP 2V9QA 2X4UB 2QBWA 3QPQC 5D1XD 5TDOA 2Z92B 1X9QA 4WO4A 1HKFA 1MJ8L 5B38B 3B3IB 5F9OL 2GUOA 5CLTA 2Q7YA 5SV4A 4Y5VA 1JWUA 3QFJB 4JHWH 4UINL 5T3XL 2P8MA 5TE7H 4CMMB 1U3HC 3OKEB 3SY0A 4Z8FH 5BS0A 1E4XI 4UILL 3T3PF 3KLDA 5DJDA 3BWUC 3O2WH 5I1EL 5BZDA 4PJHB 4OM0H 1IGJB 3SE9L 3H0TA 3ARFC 2ENSA 3ARBD 4GKSA 5IW3A 3CPLA 3FQRB 4NO0D 4HZLB 4LGRB 3PGFH 1HH6B 2QHRL 1DUZB 4G43A 1EK3A 3EDJA 3VXMA 1HI6B 3ZDYE 3C5ZA 4QT5B 5E03A 4RFNB 5GZOD 2EDXA 1OHQA 1NJ9A 4GW4A 5LCVH 2OZ4A 3IXTA 3EOAA 5DQ9B 3GZKA 4C56A 3S37H 1I1YA 3RGVC 4BQ8A 2FL5B 5BVJA 5F7EH 1LILA 5DRNA 1NDGB 4JN2A 2OBGA 4XWGH 2GK0B 4P9HH 4PB9L 4WTZA 2C9AA 4WUUD 3IDYC 2P5WE 5ICYB 3L7EA 4GRWE 5CD5D 3U83A 5I1AA 2YZ8A 2FO1A 1DQMH 2CDGA 1QFWI 1NFDB 5CIPH 1DQJB 2OTUB 4HXBL 4U2ZA 1QEWB 5T1KD 1BQUA 4A6YB 1U8QA 3WKNA 4R4ND 2FIRT 1SYSA 4MYWB 4GRLA 5DDHA 5FO8A 3U4BH 3HS0B 1ONQA 3F6IA 1RV6X 1KJ3L 4R0LC 5D7IB 3TN0A 2GI7A 1E27B 3BWAA 3H2WA 3PJSA 4JO1H 4OD2A 2X44D 4MNGA 4NBXB 3VW3L 1HSAB 1NCDL 3U7WH 2YKLH 1GAFL 1YEFH 1HHHA 4RMTA 1L7IH 2B7DT 3OV6A 4ISVB 2W1NA 3ARBC 4TNWF 4JANA 1F4XH 1T7XA 4WUUB 3QCTL 3DIFB 5A2JH 4BSWA 2OQJB 2OX5A 4KY1L 3D39A 2GT9A 5J6HA 4YJZL 3EFDL 2XWTA 1C12B 3UTTE 2IPKA 1CFQA 3ZE2E 1SM3H 1R3HB 1P7KB 1MOEA 1GZQB 3P0VH 5GGRA 1IC4H 3TLRA 1EGJL 2CR3A 3FB5A 3PGDB 2QQNL 2UY6A 3TCLA 5JXAH 4WCYH 4LHQB 3O3BB 4Z7NF 5IJKA 1XAUA 1GHFL 5DZLA 1CICB 1XGPA 3F5WB 3TIEA 5D9SA 5DWUL 1ZMYA 4NO5B 4FFYL 4I18C 3BN9D 1DVFB 1HN1A 5FUCC 5TDNA 1XGTA 3ILPA 3CSYA 2EYRB 1ZLSH 1VDGA 4K3JH 3DYOA 4KJQD 3G6JB 1OSPH 3ZT6A 5K9KA 2CRIA 4L4VD 3CDGB 3FFCD 3OB0H 4Y5XC 4KKCC 2DTML 2EH7H 2P1YA 2J2ZA 4AM0B 1FYTE 1YEKH 2W07A 3UYPA 2AK4D 1MQKH 2GAZA 1AXSB 5DD1H 2C3HA 6CGTA 2ZG2A 4LLDA 4GMTH 3QFJE 2QEJA 4HEPG 1UKTA 5FYKD 2PCPB 2Y5TB 2V5YA 4JO2H 5K59E 1MWAB 2ADIB 3DV6B 1JGDA 4ALAL 5HGHB 4RA0C 3W9DB 2QV2A 5DJ2B 3RVVC 3TIDB 2F74B 3O11B 4I9WD 4Z7VF 5J1AB 5DEGB 3O6FC 4OCLC 5C7XH 2PCPA 1E28B 3BRDA 2WP3T 1VGEL 3SGJA 1R6VA 3FQXB 4JQXC 1J0IA 3BMWA 3F7QA 4RBPK 4DW2L 4HIEA 4DZBA 1QSFD 4XCEA 1JNJA 2VLKE 3OXRA 3QEQD 3VFNA 3WLWC 3IU3A 4AEHH 2E5EA 3RHWK 4TUJB 5JPNB 1INQB 3FO9B 5F21B 3G6JA 2BC4A 2Q7NA 1OCWL 5ID1A 5J11B 1LEKB 1CQKA 4WWKC 4I5BA 3FAXA 3GMNA 3LKQA 4R3SB 2WLZA 1DSFL 4NZTH 1YJDL 2MQCA 3X11B 4G7YL 1HQRA 1TQCC 4OIBA 5IKCA 5JLZB 1GYAA 4O2FA 2IANE 3DURA 1PLGH 4LVHB 1IC7L 3TO4C 1J86A 2X05A 5HVFB 5JIPA 1DLHA 1K3IA 3BYTA 2P24B 2VN7A 3EJJX 4M6OH 4C4KO 4QRRA 3PWVA 1I8MB 4LVOB 1S9YB 4QYOA 1FH5L 4PJ8B 4YLQT 1QBMH 1GGBH 1YMMB 2YD5A 1ZV5A 3CDFA 4OUOA 4RMQA 1SEQH 4PLKC 4LL9A 2A77H 3LHPH 5ACMA 3QUML 3UZQA 4M5ZL 3MV9B 3TJHD 4NKIH 3GMNB 4YZFE 3CFDB 3LRSA 5DK0A 4WUUE 4MLIA 5HY9A 1P2CB 1UH2A 4O00A 5E56A 3VXRD 2WBKA 3U9UA 4LLQA 1J8HB 2PYEA 2YRLA 1N6QH 1M7DA 3NIGF 5D1QB 5IB3A 3BZ4B 5HDQH 3ULUC 2DMBA 1GXEA 1FGVL 3SOBH 1JGEA 4FTVB 1HK6A 1HWGB 3HS0A 2FX8L 5JQHC 3ILQD 3FKUS 4RSVA 4TUKL 4AIXA 5D7IE 2LU4A 2OTWB 4TULL 4HK3J 3OXRB 3VFNB 4Z7WB 5C0GB 1Q8MA 4JFDB 2YHGA 1ZA3A 3THML 3BKJL 4M7ZB 1OTSD 3W0WE 5F6HI 1YJDH 4Z0BH 5F8QC 3DXAE 3BIBX 5ADPL 5EUOB 2DQFB 3DRTB 1NDGA 1LEGB 3JV6B 3BEWA 4EDXB 4Y4KA 5CFHA 5HYSB 1CGSL 5JPMB 1BZ9B 3DGGA 4PJGB 1T04A 4Q58C 5KSVA 4K3JL 3W0WB 2HG5B 5B3JE 1FRGL 4M3JA 3R0MA 4JRXB 1EXUA 4YHLH 1NJ9B 1EEQA 4YIQA 3BIKB 4EI6B 5ITFB 1T22A 4OFKA 4MD4A 5FB8B 4G43B 2XRAL 1FZMA 2NY7L 4HGWB 1O0VA 4HWZA 2BVYA 4PJFB 5HYEA 3BGFC 3EOBB 1PW3A 3ZT7A 2MJWA 3MNWB 4U1JA 4YHZH 1TPXB 4X0KB 3VD9A 4F37K 5BS0B 5D9SB 5GRWA 1CICA 1XGPB 3TIEB 3LV3B 1EVUA 4JCMA 2CR6A 3GBNH 5EBLB 2V7NB 1N59A 1QQDA 2FYYA 1OWRM 4GRMA 4PRAB 3KPOA 4JM4H 3TCLB 4XCFH 3UTSA 5E5RB 1A6TA 3U46B 1T3FB 4RCAA 1XR9A 1RJZB 1HDMB 2LE9A 2FZ3B 2FHCA 2VLRB 3CXHK 3QUZA 5GGRB 1OAUL 2H3NA 3RQ3A 4FQXB 3L9RB 1P53A 2FSEB 2HVKA 5E2WH 2HT3D 2IPKB 2WUBL 2WQRA 1X44A 2VDPL 3E6HA 1IAOA 5IFAH 3MRCB 3DO7A 4NP4H 3W9EB 1JWMB 4HPOH 4EI5D 3L5JA 5E0QA 2DIBA 2BSRA 1FL5B 1H3PH 3T0XA 3T77A 3UJIH 2DLEA 1MCOL 3IFOB 3QRFM 1YDPA 5T5FL 2JKXA 3FRUA 4IIQA 4D0CB 4OZIF 2BCKA 1DQML 3D69B 3KYNA 1FN4A 5GRJH 4GUPA 1NMBH 4OTXL 1WIPA 2F53B 1QA9A 4M7LL 4LSRH 4QRQA 4S1DD 5L6YL 4XVTH 3EYOA 4KDWA 1MFNA 1KPRB 2NTSP 5F7FA 3IF1A 5T5NG 4P2QA 3HMWL 5KSAC 4N8VA 1P1ZB 4V2BA 4QXUL 3A67L 4C59B 2QADB 4QHMA 3BUYB 2V17L 3STLA 1OAZL 2DYPD 4WFHD 1FYHB 1IM9A 3FT2B 4X80L 3C6SB 4ZFOA 1CCZA 3SDCB 4FQ2L 5DEFB 5EOCJ 3C8DA 2AJ3A 4G8FA 1F58H 3EO9H 1U0QA 2CXGA 5T3XE 4XNXL 3KPRD 5FYJH 2YMXH 2ESVB 2VL5B 3RDTA 3DVIA 2FL5A 4LU5H 4R9HA 2G60L 3MJ9L 4YC2B 1R3IL 3HMWH 2DJ4A 2XV6B 3MROB 4TN9A 1DN0B 5CBEA 4C56B 4NKMA 5JR1L 1OM3L 4HKZB 1JPSH 1IAIL 2WIIB 4LQFH 3QDJD 4FNLH 4OZHB 1FYTA 1IE5A 4G6ML 5KN5A 5C08E 1JWMA 1MHHA 3MRCA 3ARTA 1UACL 1G7IA 3SDDB 3INUH 3MRRA 5AAWA 2EYSA 3WUZA 3QDGD 4U6VL 3SN6N 4EIZC 3JTSB 4YDJB 4I13B 1JPSL 5DJDB 3IAPA 3T4AB 1UWGH 5MI0C 5D1ZB 1GC1H 3IT8D 3EIFA 3WJLC 4FQIL 4LPXA 5DJ8A 1PKQE 3GI9L 4ZQKA 1ZSDA 5E9DA 2HMID 1AGCA 2YD4A 3MNWA 3N9GL 3I02B 5EA0L 1J0YA 4PRNB 2PYEE 3T65A 1FDLL 1MCFA 4X80H 4TQEH 1NMCB 3V7MA 3FO0H 2ZCLL 3QZWB 5FECB 3IDXL 2APTA 3O4OB 3GIZL 4Z78B 4WHTA 4YIQB 4EI6A 3LB6C 4YHNB 5FM8A 1RHFA 3BHBB 5HHNA 4RA3A 4DN4H 2HKFH 4H0HB 2FHBA 2R56H 3FFCA 2Z31C 3LEXB 3Q5TA 4Z95L 5MEQA 3PWPB 1WLHA 3D0LB 3TT1H 3RX8A 1CD0A 3IJSA 3FQNB 4ZS7L 4GKZB 2BVTA 5C0IB 2BRRH 3HC3H 2DQFA 4R8WL 3HAEB 4U2YA 4X6FA 3HUJF 3HKFA 4N0YL 2HTLD 1LE5B 5FKAB 2X1QA 3OKDB 3FT4A 4JG0L 5L2KB 4N0FB 1R5IA 1G6RB 3H9SB 4KI5C 3T8XA 4KXZI 2WUBH 3F7VB 1FC1A 5CZVH 1Q0XH 3HCVB 1W72H 5C0CB 4XP5L 1BQHA 3U0TA 1KN4L 3E6FA 2MHAA 3W2DL 4HSQA 1M7DB 4X9BA 5AYUL 1YEDA 4JFZH 4TPRH 4LHUB 2NY6D 3GSOB 2DLTA 4Y16A 3GSRB 3PDGA 4X4ZA 3HG1B 1CICD 1EH9A 4K23H 4K8RC 5IHLB 1SJHB 3CCHB 4U6XB 5CILL 1XF5B 1Z3GL 1ZHLA 2J6EA 1KCUL 4JFQA 4P5MB 2BNQA 5E5MB 4E41E 4ELKB 4QYOB 5IMMB 1AXIB 1WK0A 4RX4D 1BEYH 4W6WB 5BRZE 1X7QB 4OCMC 4MQTB 4UOW1 4NQXB 2XKSA 3BO8A 4HWBA 2BNRD 5D7JB 4OKVA 4Q2ZB 1U6AL 1NSNL 5I19L 1HSBA 1CL7H 4MHHG 1T5XB 5A43C 4NT6A 3U30C 3IXAB 2VDRH 2AV1B 4NQSA 3D18A 5KSBB 1X5YA 4TTDC 3WO3B 3QJHB 4WNQB 2G60H 3LKQB 4PJEF 2YUVA 2Y9RT 5FGSA 5T1DH 3BQUC 1TCRA 3B2VH 4RRPA 3V9FA 2XA8L 3BGFB 3TZVA 2UV3A 3CK0L 2IH3A 3AS3A 1BD2E 3OL2A 2FJFA 4IJ3B 2P5ED 5CUSL 1Q94A 3TBTA 4J12A 1LGVA 3HI5H 4PJHE 1JF1B 2VERN 3EOTH 1W72A 4LAJH 1QSFB 5GSRA 4JM4L 4YWGH 3LKPB 5D70H 1BFOB 1BMGA 5BVPH 1F4AA 1T2QH 3QFDB 3WFBL 1OAQH 3LCYA 3VE0B 4AT6B 1TJHL 4FXKA 4ZUTB 5I18H 1MH5A 2IALA 5M7QA 2VLKB 3RWGA 1I7RA 1Z3GH 3P0GB 4PTTA 2FO4B 3BKML 2OS7A 3L7FA 4P23C 5DJYA 3X3FH 1A3RL 5F3BA 1CYGA 2X10A 1YNTB 4X6DB 4Y5YC 3WKML 1NFIB 3BPOC 2ZUQB 4RAUA 4YDKH 1DBML 4F7TB 3OAYH 3WUWB 2NXZC 1PQZB 2VO5A 5FUZL 4PGEA 4NKOB 3GO1H 3QNZA 3OAUH 4M6OL 1CTNA 5B4MD 4H88L 4PJ7A 5D96B 3R06A 4PJDA 4DVBB 4KVCH 4HHAA 4NBZB 4U1IB 1A21A 4QTHA 3ULSA 3MRGA 4XP6L 2FJHA 2DWEB 1KPUA 2CRYA 1RFDH 1KEMH 1RUML 2C7UA 3C6LB 1FFOB 5C8JA 3HZMB 4G6JL 3GSNH 5TDPB 1EHLL 3QJHA 1SMAA 3D18B 2YBRA 1WT5C 2X9XA 4JFHD 3KLHC 2WWKO 4PRPE 5DK2A 2UZIL 3WSQL 4Z7NE 3B9KC 5SWQB 2CO6B 4OKVB 1BIHA 4Q2ZA 4LDLB 4E5XA 4ODXA 4UI2A 4HPOL 1MFBH 1HIMH 2A1WH 3IFNL 4OD1L 4XC3H 4P5KA 5K9QI 1BVZA 1FBIL 5JORA 2UWEB 1TITA 1NC2D 3UTOA 1GOGA 5DSCB 1KT2A 2C1OB 3WHXA 1U3HD 5DF0A 2OJEB 4YPGB 1ES0B 4XX1E 5C92A 2DYPA 2BNQE 4MB5A 4MNGB 3MYJA 1CU4L 3FRPA 4X5WB 3DX8B 1YEDB 1LD9B 1NGQH 5IEHA 1YPZE 3OJDA 3P30L 3U0TB 5IHBA 1TZGH 35C8H 4Y5XB 4P0DA 1CWVA 2JELL 2P4AB 3TM6A 2Z31D 3DETD 4Y1AB 1TJGL 2Q1EA 2YD2A 3MLRH 1CLOH 1BBDL 3HCVA 5JMOC 1XCQB 4JHAL 1A7PL 4NZTL 3FHAA 4TUKH 3WS6C 4G8GA 1MCOH 1MI5D 3WUWG 4LBEA 3ABZA 3P11H 3QIBC 3KGRA 4TOYH 4I48A 3T3PE 2A6IA 2PTTA 3SDXA 5KVEH 5DJXB 1FL3A 4DGYH 3TCXA 1IAMA 4KK8C 4RMWA 3V5DB 3ZKSD 2NY0B 1B3JA 5FYKE 1GGCL 3ZZ1A 5BVJB 4Y0GA 5E8OA 3M45A 5EU4B 3RWDB 3UBXG 3MV8D 1F8TH 4FFVD 5ESVB 2ADFH 2YPLD 4WDIA 5BRZD 5I6XB 1ZEAH 4P59H 4JFDE 1GGBL 5HHNB 3QUKA 3ZKMD 3O6LL 1IVLA 3P0YH 3LQAC 4M02A 4PJ8C 5CGYC 1DBJL 4FQ2H 3HNTL 4MB3A 5KZCB 2I60L 1J18A 1RIUL 1J8HE 4ETQB 3QUMB 4TRPL 1IGJA 3OBAA 3GRWH 1K4DA 3CFKB 1DQLH 5IF0A 4HC1A 5E6ZA 3BYYA 1OGAB 2AXFB 4G7YH 5CKAA 3DV4A 1B2WH 3SY0B 1RIHH 4E9LA 4OT1L 3RJQB 3MXWH 3AY4C 1BX2B 2X4PB 1H3WM 4HWBL 4PRHE 3A0OA 3KPLA 3R1GL 4PD4K 3MJ7B 1KCLA 4FFWD 2DQDL 1VADB 3VXRB 1BF8A 3PHQB 4PRBB 1HHJA 2B5IB 3PHOA 1AI1L 4DCQB 3UO1H 1I7ZB 1HXMA 1YECL 1FFRA 3L5WA 3OKLA 4OZHF 1QFHA 3RUGA 4UZGA 3OAYK 3OKKA 5HDBE 3C60D 5KVDL 1AE6H 2FBJL 5FCUL 3ARGD 5IVXB 5H94B 5IQ7L 2GJZA 5BW7A 32C2B 4PB9H 1SBBA 3PP3H 3TVMA 3VFVB 1A3LH 3MROA 4O51A 4LNRB 2IMNA 1LP9B 4OD3L 4APQB 4Y4FC 2MPAL 3RDTB 5M94B 3KWWA 4NGHH 4KKNA 1U6AH 5C0AE 1DQDH 2ZJSL 5KBNC 2GJ6E 4LHJB 2P44B 4Q0XL 3ULVC 4U0RC 1IGCH 3LN5A 1AD9B 1BM3H 2H9GB 4KVNH 1IM9B 1V05A 3UZVB 1I3RB 4PFEA 3SKOB 2V9RA 3SCMB 4ODHH 4EI5C 3OG4B 1WVZA 4XPGH 1K8DA 5J1TC 2NNAB 3QRGH 2G75A 4QF1B 3G9AB 4FZ8H 4JGJA 1U93B 1TVHA 1W0WA 1G7MA 4WIQA 3E8UH 4IIQB 4D0CA 1AGDB 1NC4A 4ZYKA 3FQWA 5GRXG 5IB5B 2CIKA 4EEEA 2GYSA 4WHYH 5JDSB 2WBJB 1QFWH 1YDPB 4CGTA 4P9HC 2AW2A 2IQ9H 3OB0K 4I0PA 1HNFA 5D2LA 4Z18A 4WO4C 5CZXC 3VGAC 3IDNA 1T83A 4U1KB 5BO1H 1NUGA 3O2VL 4ZS6D 5L88L 2VMFA 4X7EC 2R0KH 5CAYB 2WINB 4OLZH 3NGBB 2DQHH 5D5MF 5GRUH 5B39A 4KROD 5JHDB 2WBWB 4N5EC 5DD6A 4KH2A 3GHBH 4FTVD 5A1AA 2NXYB 3K46A 4OLUH 5H8DA 2XFXA 4WU7A 4X4XA 1MAML 2E9WA 4NC0B 1HKLL 2R29H 3MRPB 4O2EA 5JUEH 2AQ2A 5CSZB 4P5TB 1U95B 1GAFH 2IG2L 4M6ML 2ZUSA 1KIQA 1KJ2B 1G7JA 4LQ1A 4XP9H 5IB2A 2FYYB 4HF5L 1N6QL 2UWEF 4CKVX 1MLCA 1ZVHA 4MA8H 1QBLH 4Z7OE 2FB4H 2R15A 2NW3B 3K4ZA 5EULV 4W4OA 4O02H 3ARWA 4GW1B 1TZIB 1RU9L 3EOBA 5I1EH 2OL3B 3ARXA 4MQXD 2CDFB 2CK2A 1I1AD 1FDLH 5DQDH 3CFJA 3P0VL 4K7PH 5FB8A 3O2DH 5DHXB 4AQ1B 3GI9H 3H9YA 4HWNA 4N9GB 3TVMD 1EXUB 1MRCL 1BJ1J 5CGTA 4MA3A 1IGTA 1KTDA 1YNKH 3MA7B 4R90L 5D6DC 5KSVB 3OGCA 3U2SA 4NDMA 3DGGB 4YDVA 3B4NA 4U49A 4PJ9C 3MJ8A 4WI9A 3STZB 3P9WB 1FP5A 3U7WL 5IB4B 2JJTA 5SWSA 4MJIB 3BP5A 5F1NA 3OB8A 1U58A 1LO2L 3DLQR 5IK3B 3EYUL 5FDYA 1B0RA 3JV5A 4U7SA 1XEDA 1K9TA 4F58L 2ZUXA 1JNLL 4GSDL 3FN9A 4XCNB 5DTFB 3KPMB 4H5SA 2OTWA 1WAAF 4FZ8L 3MLYH 4YXKH 1A4JA 4WEUD 4Z0XA 4XZUB 5K9OA 4F7CB 2WQ8A 1R3IH 5HYFA 3B9KB 4OSUH 1U2CA 1G9NH 3KPNA 3O3EB 4KQ3L 5CEZE 3TYFA 4PP2A 4HWUA 3VDCA 5IHZB 3GJEB 5BXFB 4OB5H 3ARQA 4F58H 3KPPA 4FMFA 5DGQA 4Q74A 2NPLX 3EYFB 4LSTL 3NA9L 4QRRE 5C2BH 3OJ2C 3KJ6L 5TE6H 1OAYL 2IH1B 1MRFH 1RIUH 2EIDA 4YZFF 4QXUH 3I50L 4QRUB 4XAKE 1PGRB 3GHBL 4CN6A 5DGRA 1S9YA 1QRKA 1K6QL 4GMTL 3KYMA 1R24A 3CU7A 2D0GA 1FHGA 4LCWA 2MCPH 4OZGB 5DD3H 1IT9H 3NA4A 1T80A 2DQHL 1L7TH 1B9ZA 1A47A 3MACL 3LIZH 3E1F1 1D9KB 2D0FA 5I1GH 4O2FB 4YNYB 3LN9A 3O3AA 5I76A 3V0VB 4OM0L 4G9DB 3N85L 4I0PC 5C0AD 1PKQA 3JVGC 4D0BB 3NH7L 4I4WB 2ADJA 3N1FC 4NCDA 1PY9A 2Y6SC 3EOYG 5C09D 4OCXH 4PUBH 4LSSH 2BC4B 3RIFF 1K85A 2ESVD 2X4TA 4UBDD 1QR4A 3BH8A 3D25A 5GRZA 4Q7DA 4XPBL 1INDL 3KHOA 4IDJL 4PJHF 1VFAB 4OI9A 1SM3L 5L2KD 1KPVA 3U1SL 1MIMH 1JHLH 4JO2L 1F11A 1T4KB 1HHGB 1TENA 2DQIL 1UJ3A 2NLJA 3QUXC 3I2CL 2P42B 1ZVSA 4KQ4H 3CLEH 2EE3A 4GAJH 3CFCH 4E0RA 1WIUA 3GI8L 5ENWB 2WLYA 4M8QB 1IEAA 1ZEAL 3DROA 5DVKA 4PJIE 4ZPVB 2R4SH 4JKMA 5DD5H 4PGBA 5IFHH 5IQ7H 4MS8C 1QRNB 3QQ4B 1C16A 3CZFB 3LSOB 5KOVC 2GAZB 3PQYA 4YXHH 1ADQH 1KJ3H 3PV6B 2R1XB 3WNOA 4PPTA 4FFYH 4MAYA 2ZWLT 1JNLH 1YN7B 3WE6A 3IFLL 4XC1H 5DMIL 4D9QD 3RP1A 1F3DH 2G9HA 4P4KA 5INDB 2D03L 2PO6C 2VAAB 3V5KB 4AMKL 1YJDC 2V5MA 4JFEE 1C7SA 4HH8A 4WW2F 2R8SL 1HHKB 2XQBH 3FB7A 3RKDC 4N68A 4X6CA 1XGTB 4Q9RL 4NN7C 3QBTB 2HJFA 2WW8A 3D85B 2P5WA 1DUYA 4JZOA 1BM3L 5TF1H 3SCMC 1DBKH 1G7LA 1MRDH 5C0DA 5SWZD 3JZ7A 5E2UH 3NPSB 4PLNC 4FZEL 4P2RA 3OPZL 2A6KA 3S34H 1A0QL 3K81A 5KANI 2FGZA 4TQEL 5EU3B 3NTCH 3VXTA 3UEZA 2R0WL 1KCVL 5E99H 1JE6A 4F2MA 1U92A 1PJ9A 3RZCB 1QSVA 2YC1B 4IMKA 2GJ6B 4Y5YB 2A2QT 5DQJA 3V4UH 4MZ2A 5ISZD 1AKJA 5I1CL 3HUJA 1YQVL 1FVEA 2R1XA 3MLXL 1B4RA 2VR5A 4GRWH 4ZTPL 2BSTB 3ZO0A 1JYNA 3RTQC 5MHSD 4I9WE 4RGNC 1Z5LB 3QO1B 2GK2A 5C09A 4PGBB 3VRIB 1RMFH 2D7TL 4ODVL 1RJYB 4D9RD 4YX2H 4XTRC 1P7QD 3ZKNC 1M71B 2Z91B 4FQPA 1RZJH 1YY8A 1QVOB 3GBMH 4ZFFB 2FEDD 3FCTB 1UWEL 4NHCH 2HRLA 1I9IL 4Z77A 4XP4L 3HFML 4A6YA 5HGAB 1RUMH 1VESA 1T6VN 1EHXA 1OGTB 3BVNB 3RWCA 5CEXB 2H6PA 3U6RB 2GJ6D 3CFBB 4LSQL 1NFDA 4P57A 3QHZL 4TRPH 3OKNA 1CDYA 3NIDE 1MFEH 3NCCB 2SEBA 5J12C 3WD5H 3RVTC 3L7EB 2MOVA 2NY5H 1MCSA 2DDQH 2HJLB 4IOSD 1OF2B 5DRNB 1QSEB 4MNHB 1X4YA 2DJUA 1C1EL 4M7KH 4YDKL 4AQOA 1OAZH 4OSUL 4WJ5A 2DQDH 5T1LB 2X89A 5EDXA 4K3HA 1JN6A 3MGOA 4XPFH 3T2OA 5KSUB 5C0EA 1QOKA 3O2WL 4K2UL 1OWWA 3O3AB 3BZEA 2A73A 4NCC2 5JQ6H 5J8OA 2HMIC 4KZEH 4PJIA 1KEGH 2XOTA 4QHNA 1HH6A 5IHUL 1I1RA 3QEHA 5I18L 4JM2A 4JPVL 3CPLB 3FQRA 1CE1L 1CK0H 5ESAA 3H0TB 3ROLA 2IG2H 5B8CB 2OI9C 1UM5L 1D5ZA 4G80B 4U1LB 3OTTA 3C09B 5MEOA 2ZZUT 1FVCB 5FDWB 1NUDA 4QRUA 3ROOA 4PGDA 1A9EA 5HHVL 3RNKA 1WZMA 1RURH 4LIQL 5HJ3B 1PZ5A 4LCCA 1JWUB 1R3LB 4H25B 3S4SG 4CUCA 5DYOA 3PNWB 4HKBB 5CSGA 4WO4B 4DJMA 1TXKA 3DARA 5ADOH 3H3PL 2X4OB 2DWDB 3X13A 4JR9L 1OAUH 2F54A 3WLBB 4HC1L 1NGPL 5L8KB 3JXAA 2AV7A 3ULVH 1A4JB 4P99A 2NZ9D 3DXAD 2NXYC 2VH5H 2FRGP 2VDMH 3KYOA 4PY8I 4KUZL 1ADQA 3KPMA 5DHVH 3ALWA 4X6DF 1NGXA 1ORQB 2IANA 2MNUA 3RWJB 4WFED 5GGVL 5DRWB 2EIEA 1VFUA 4MD5A 2FATL 3BPLB 3DSFL 4UT7L 5DUMH 1CLOL 1BBDH 4LSVH 2AK4E 4J23A 5ICXA 1X5LA 1CXIA 4DAGH 3GMRB 1BOGA 2F9BT 2GKIA 2J3SA 2NY2B 2DTSA 4WW1B 5FKPB 4ZDHB 2YS4A 3MLWL 1NCBH 4NBYB 4EUPG 1WJ3A 4KTEL 2AJZA 3I9GH 4S1DC 2V5RA 1QLFA 4WV1C 3GSWB 1CZ8H 2VLLB 4ZUVA 2FD6H 2R0KL 2VQUA 4M48L 3L6FA 1UFUA 9CGTA 3HMXA 1RZKL 4YHYC 5TQ0H 5KS9E 1U8IB 2X1OA 1I9RH 2B2XH 4HBCH 3BH9A 3HMXL 5D1XB 1TQBC 2W9EH 2HT4C 5KVGL 3DGCR 4JRYD 4Z6AT 1RZFL 3D39D 2VABB 5A2FA 1MLCB 4OCRH 1KGCE 3F6LA 1JYVA 4XNZB 3WNPA 2LABA 4N9OB 1NCWL 4Y4FA 5E08H 4ZNEA 4U05A 1CK0L 2FNBA 2Q8AH 2Z93A 3S4SB 5F7NC 2UUDK 2XFXB 1TZHA 3BQUB 3DX6B 5GGUA 1KEGL 3BISA 2XN9B 3LD8B 2CKBL 1FCCA 1JRHH 3V6OE 4Y4FB 1MVUA 3G5VA 4X7SH 1KCRL 2YUZA 1DDHA 1F6FB 4HFWB 5FYJU 2R4RL 3EO1A 4G6FD 3VFTA 5ESQB 2Q87A 3C5ZC 1K3ZA 2EDDA 2OSLA 3I6KB 4L3ED 3EW3B 1OL0A 4KC3B 4O4YL 5EA0H 2CPCA 2F19H 4O5LH 4P2QD 5CLWA 4IJ3C 3EO9L 2CIKB 2RAMA 1CGWA 2BDNH 3ARGA 3P3YA 3QDJB 4H26B 3EKCA 3HE6B 1ZANL 5CWSB 1JF6A 1TVBA 2GSIB 2AJYL 4LPWA 2F15A 4WW2B 1WCBB 3LEYH 1ZHKB 2ZG3A 2XNAA 2WAHA 1YUHB 1QR1A 3PABA 3MRJA 3SCMD 1NMBL 1I9IH 2YEZB 1G6VK 3GBML 1UXWA 2ITDA 5CJ8A 3M17B 2V2WB 5EOCL 5F9OH 4KI5F 4KJWC 4XVJL 1U8KA 5BZWA 3RL2A 1H3UA 1NCWH 1FZJB 2FX9L 4L8SA 5IWLC 5EU6D 4WWKA 4J6RL 1RUPL 2CLZB 4ZXBD 3PDDA 5CUSH 2QSTA 1N5YL 1OTTC 2EDYA 2WM0A 4FHBD 2NCMA 1ZS8A 2Y07H 4G8EA 1UCBH 3HR5A 4HFUH 4KMTL 5D93C 3W81A 3SJVE 1YQVH 1JGLH 2KZ1B 3SDYL 3RTQB 3BT2H 2BOCB 1XIWA 2GJZB 3IDMB 1YPZF 2DKUA 3P4NA 3CVHB 3ULVF 3KYOB 4LPCA 1TVDA 1MELA 1N2RA 4PRHA 4BSVB 5D7KE 4FXLA 2XYCA 1KTLA 1S5IL 3GI8H 1NMCC 4NQED 2V2XA 4GAJL 4DCQA 1AHWB 4X7TA 3VXQA 1UCTA 1RUKL 4IRSC 3C08H 4I77H 1X3DA 3OPZH 1UCBL 3PNWA 2VZVA 4X7CC 1LP9F 3VXOB 1INEL 5ICZA 1PY4A 4MVBD 3G08A 1J0HA 1TTUA 4WI5A 5JTWA 3P11L 1U41A 5DK3A 2Q76B 3O6KL 2I9LB 1AD0B 5D70L 5JO5A 4QTIL 3VGDA 4AMKH 3QIBA 3UC0L 1EAPB 1EX0A 3T4YB 5HI5D 4YK4C 5AD0B 4OCXL 1J1XL 1G6RL 1ZHBA 4NSKB 1EDQA 3REVB 3CLFH 3CMOH 1XF1A 1IM9D 1FNEA 1NBVL 3S7GA 3HNSL 3IYLW 5JOPD 4L3EA 1SJVA 3RWIB 5C0EB 5KSUA 5HHXH 3V6ZB 1CLCA 5JDJA 3MLZH 3I3BA 1L0YA 1LQSR 4XRCA 3V79C 2ICWB 4IM8A 3CDYA 1LO4L 5ISZE 1YYML 1F3RB 5HHOA 4G6AD 3NIFE 2FIKB 4EUPA 2DD8H 3AUVA 5GS0D 4HLJA 3HE7D 4R7NB 5JHDE 1Z0NA 3MQIA 5I1LA 5HHME 2D4DA 3MODL 4LSVL 4L4VE 2CKBH 3CGTA 4Y16D 4OB5L 1INEH 4L8BA 5DFTA 5J6GA 1PG7H 4PV8A 3QJFA 1K4DB 2PXYA 1OTUC 4R26L 5HPMB 3IRZA 5EZOL 4Q9CA 1EHLH 1Q9OB 4HW6A 2ZUVA 3OXSB 2I9TA 2IEPA 2A38A 1AIFB 4LQFL 1D5IH 4N8PA 1IKFL 3O81A 5E8PA 2EYTB 3MRNB 2CH8A 2H8PA 2ITCB 4CVUA 5J57B 5TF0A 3ULUD 2LVCA 1ZANH 4X4ME 4Y88A 2CLVA 1BZ7A 2JK5B 3PWNB 4U3HA 4KTDH 3BPLC 1T1ZA 4NRXB 4P4KD 4JFYA 3WD5L 4EXPX 4UTBL 3MBEA 3TJHC 1GC1L 5CD3B 3D0VA 5I16A 43C9B 1UWGL 3BIAX 4IMLA 4PGJA 4ODXB 5JOEA 3KPSD 1S9KC 4XPTL 5LAXB 4L3EE 5L0QC 5SWQA 5AEAA 3I9GL 1EFXB 3BKMH 5A16A 1YY9D 2Y06L 4XNUL 2NR6C 3O6ML 3MBXL 5L2JA 4L4TA 5L6YH 1EUUA 1OT2A 3DECA 4IEFB 1XIWC 1REIA 4QRPE 5GRJL 4JFFE 3VI3E 1KSRA 1AO7D 1IAIH 3C6LA 1LK2B 2IPUG 3WEXA 3MODH 5LWYH 5B21A 2XZCH 5GGTL 4DK6A 3VXQB 4DUWA 4L9DA 3EFFA 3ULSB 1KCSL 3ULUH 4XXDB 1KTKE 2CQVA 4JFYB 4NM8H 4TYUA 5IMOA 2A0LD 4LLMB 4PRHB 4BSVA 4I8DA 1J1OL 3V4VH 5MENB 3QWRA 3G04A 3KLHD 4NKOA 1JGUL 3PQYB 4PGZA 5CJXC 5I8OL 3RX5A 4DN3L 4OM1H 1HYRC 4ZMAT 2P7TB 2CRZA 5F3BB 3U7AA 1KTRL 3U4AA 4E0RB 1BWWA 1H3GA 2XTJC 4NQCB 5CINL 2IGFH 4WI2A 1A1MB 2BXZA 2FECL 5SX4I 2XY1A 5KG9B 3VXRE 4AIZA 2HVJA 4EJ1C 4EN3B 3MV9D 1C5DA 1SVZA 1KXTB 3ZL4H 1VCAA 1UACH 5C07D 3RY4A 1NGYB 5EN2A 3U9PH 5FV2A 3SHSA 1CLYL 3F58H 4BFIB 4JO3H 3LKPA 2NXZD 1UM5H 2PN5A 4KV5F 2RB8A 1QSFA 4F15C 2X9YA 2C4FU 4O58L 3B83A 3S96A 2W65A 3TBTB 4LLUA 4MLSA 3RIAF 2G5RA 2NY1C 3RBSA 4QXTB 3KR3L 1WC7A 3D2UB 5E6YA 4H26A 2Z8RA 3IKKA 4K9EH 2JB5H 1A3QA 4OI8A 5IMLB 4Y19D 5HHMB 1MY5A 1ULVA 4ELMF 3X3GH 4ODHL 1IARB 2ICWA 3MRLB 3SQOH 3L3HA 4ZFZA 2C5DC 3VFTB 3MLZL 2ZKHL 4DKFH 1YA5A 4CAGA 5CSBA 3CJJA 3G5XA 4GJTB 3GSQA 4JDZB 3WCYA 1I7UB 3SGKC 4MXWH 5ALBH 3KPSA 1MFDL 4MVBC 1RK0A 1EAPA 3N0PB 1DE4B 1I9EA 1N5YH 4ZPTA 3R4DA 4P2RE 4S1SH 1IQDB 1JK8B 1KIUA 2BNQB 5DS8A 3RPIB 4UT7H 4NQDA 5EO9A 4GQ9H 2IH1A 4OQTL 4D2NA 4AZ8A 4PUBL 1GGIL 2VLMD 1ZXQA 2HYMA 1SVCP 4L8SC 5IWLA 3ZDXE 5D5ME 2J8UF 4Y5VC 3UO1L 3ARYA 5IFAL 1FPTL 3BGMA 4RGMB 5A40E 5E1AB 2DKMA 2L7UA 4JPKH 1EZVX 1IZJA 2BY0A 5C0CA 2ARJA 2P8LB 5F7YC 4XNXH 5FYJL 3HC0B 2HRPL 4KDTA 4ONFL 4POYA 1CR9L 5SV3A 1BD2D 4LEXH 1D3CA 2CUIA 1EUTA 2JIXB 4KGJA 2W91A 1IAKA 4CADB 4OBSA 4J4PD 4D8PA 1G9EA 5IK3A 2Z8VC 2MCG1 1A6VL 1IILE 2CLZA 2MPAH 1CI5A 1MCDA 1JUFA 4NO3A 1EBPA 4AH2A 4MQ7A 3D0LA 4G6KL 1RY7B 4P2OB 4PJ5E 4U6VH 3ZHDA 4D9RE 1DP0A 5TPWL 3ZKMC 4EXKA 2BOBB 1I75A 3BAEH 3FTGA 4KI5E 1H8NA 2VDLH 3RJDA 3TT3L 2QJDA 5C6TL 1TTFA 1UZ8B 4U31A 5D5MB 4F15B 4V1DB 3LEVL 3QG7L 4K7FB 4J4PC 4HLZH 1T0NB 1HCFX 3WFZA 2PW1A 4P3WA 2HTLC 1KLUA 2P49B 5DJAB 1JP5A 3MLVL 1U3HA 3BESR 1QACA 3GNMH 2R2HB 4QY8B 3HNVH 4PRNA 4HK0B 4ZAKA 5CGYD 4PJ8D 4C83A 2UVEA 2GITB 3MCLH 4BFGA 1MJ8H 5DJ8B 2EIBA 1IT9L 5GS1A 1ITCA 3M07A 1DDHB 4HFWA 1HYSD 5E99L 4L4TE 1UH4A 3GRWL 3MRPA 4O2EB 2K3TA 1MY7A 3DETC 3QDGA 4M9OA 4ENEC 4X6DE 4TVSa 3GMLB 5FUCE 2CDEB 2B1HH 3TH3T 3TZVD 5I1JL 2Y36H 3K2MC 1R3JB 1RIVL 5DLML 5KOMC 4XXCA 1UXSB 3ROLB 2H32B 3P9MA 1EERB 5DC0A 1I7UA 4P46C 4XBGA 1XF4B 4QHNB 5B39B 1MCHA 2APVA 2Y7QB 1I8LA 5DI8B 3QR2A 4U1KA 4IHOA 5T3ZH 4LASL 4HKZA 1TMCB 5AZEL 4PREA 4FQCH 4NZDA 2N7AA 1DBBH 2FEEI 2AXGB 1I3VA 4C83B 43CAA 1J05A 4MA8L 3QSKB 2AK1H 2R2HA 2OR8A 3HZYA 3VWKD 4GSDH 4QXTA 1S78C 4KU1A 4PTUB 5L0QB 5A3ID 2ZPKL 4PJ9D 4XB8A 3HMXH 5F9JB 3MR9B 1CD8A 1ZLWK 4NQCE 1R5WB 3C6SA 4ZFOB 1UM4L 4NYLB 4JO4L 2OCFD 5F7UA 2D0HA 1DZBA 5EU6E 1NGYA 5EN2B 5T33H 4U6YA 1G0DA 4OZFB 1WWAX 1JI2A 5HGAA 5I9QC 1MQKL 3NIGE 5DD1L 1KEML 4OAWB 4AIZB 4AEFA 4R90H 3RAJL 4XVSL 1NCBL 4MA1B 4OV5B 4JDTL 1CF8L 2NTFA 3BKCH 4GUPB 3DSNA 4PY7A 1CU4H 1UM4H 5DVOA 3N1QC 2WNGA 4D8PB 5I30L 2OMNA 5D7KD 3SDXF 1INDH 2R9HD 4RWYH 5ANME 3NCYS 1P6AB 1D6VL 1RVFL 2FJGA 4HMDA 4MA1C 3H9SE 3WXWL 4UNTA 5IHUH 1RAMA 4WTXA 3LD8C 4K9EL 2P8LA 3TC9A 2FB4L 3DO7B 5IQ9B 1A14H 2JJSA 2AV7B 3V4PL 1MCLA 4ODBD 4LASH 1NMAL 5EC2A 4FRWA 5FHBH 4KWUA 3X13B 1MHPL 4N0UA 3EFFB 1JZ6A 3C09C 2BNUA 2BJML 5H2BA 3QUZB 3O4LE 2FZ3A 4C54A 3O41A 1XR8A 2W9LA 2L4OA 5EZIL 2VZ3A 5B39G 2APXA 3HE6C 2ZUUA 1G7LB 2JTDA 1NL0H 3ZE0E 5IF0B 5GRVK 3FB7B 4JFPA 4FG6D 3NIDF 2BX5A 1FYTD 3KPSB 1IL1B 1FZMB 5JNYA 4YK4B 3F12B 5HGBA 4MD4B 1WZ1L 4KI1A 4OI7A 4M61A 1DTUA 2AEPH 4R2GB 5GGVY 3RZWA 1PKOA 1EMTH 2GW5A 4U1HA 4DQOH 2DN7A 5CCKH 3FQTA 4NKIL 3MRNA 4PRIE 3N1MC 3W0WA 5L8JB 1AO7B 1AC0A 4QOKA 5DJ0B 1FVDA 1S7VB 1T1XB 2XZCL 5GGTH 1TQCB 4ZFGH 4N8VG 4ONGL 3ESUF 3DI2B 2EZ0C 4JDVB 5EZOH 2C3XA 2A74A 3SGKA 1R5VA 1FL3B 3CUPB 4HUUB 4EOWH 2IWGA 1MEXL 1MI5A 2W65B 3VA2C 4UAOC 2EDNA 1S7UA 4YBLB 4HUWA 1RIVH 5DLMH 4NUGL 5F3HA 1FO0A 1FO0B 3BVNA 4YBQC 2I60H 3P4MB 4EN3A 4GLRI 2YPVH 4Y1AA 2HVJB 4X9HA 2NY6C 1O5DT 3BKYL 3QP3A 2E9BA 4U6HA 4ZFFA 4NQCA 2X4TB 3CUPA 1J5OL 1R5VB 4K3EL 5D1QA 3T0VA 5IB3B 4NHCL 4EUPB 2NZIA 5DO2D 1RZJL 3VWJB 1EFXD 1S7VA 2J88L 1OCWH 5C09B 1FV1A 3LRSB 3MLUL 5EUOF 3S88H 3QO1A 1RJLA 4U1HB 2DYPB 2R69L 2ZSVB 5C08B 1BZQK 1QG3A 3KJ4C 2C1PB 4R6UA 5CS7A 2OXHA 4DTGH 1BPVA 2C1OA 3WHXB 2OI9B 2C3VA 4NNXA 1UKQA 5D7SL 1IFHH 3HPLB 3QCVH 4PJEE 1JYWA 1G9MH 3RZCA 2P24A 5D71H 4JM2D 1HQ4B 4HF5H 5E7FA 4F2MB 5AD0A 4URTB 1CGYA 4PJAE 3TBSA 1AP2A 4EQ2A 5E7BA 1LP9E 4GBXC 4QRSB 4XHJC 4ZTOH 5JO5B 5LXGL 3CH1B 5DK2B 5GS0H 3CFCL 4P2YA 3PWUA 1BVKB 5C09E 3GHEL 1L0QA 3G08B 2PNDA 1WIOA 5FYLL 3AREB 1FG2B 2YWZA 3ZE2F 3EYFA 5TDPA 3SE8H 4AEIL 3O8XD 2HJFB 4FFVC 1C08A 3O2DL 5IHZA 2BNUB 3TV3L 5FYKH 4R97B 4ZTOL 4KK6D 1WFUA 4LOUD 4Z7UB 2ICWJ 43C9A 4HHAB 3PWJB 3WS3B 4L5FH 3O8XC 2AXJA 1RZ8A 3KPRA 3R0NA 3ZDZE 3CVHA 5F9DC 3ARSA 1V8HA 4TSCH 5HHPB 4PGEB 1U8MB 5TH2A 4GRLC 4WEMB 2FJGB 1ZGLM 3D85D 2X40A 3DHJA 2M1KA 3DROB 5SWZB 4XPAL 3O11A 3QIWD 3OR6A 1NC4D 1I8IA 4M5YH 2FO4A 3O6KH 5IIEA 1BD2A 2W92A 1OLLA 3K1KC 3OZ9L 4GMSH 3U2SB 4G6MH 5DR5L 3VD5A 1KFAH 1OTTD 2YEZA 1N7MH 3WLWD 1ZTXH 4LLDB 3MRJB 4PG2A 5K93A 2WUCH 1HWHB 3QFDA 1N5AB 2YR3A 1URLA 4N9GA 1SJEA 1C5BL 1PEZA 5INCB 1QRND 1JF1A 3F7YA 4M7JL 3CFJB 3DUSB 3CDGA 5I8KL 4RGND 1QBAA 4I0PD 1WAAA 3VRLF 4I2XA 2B8OT 2CJUL 5T3ZE 1U91B 1YMHB 1TCRB 4ZOCA 3VGGA 5IUSA 2VIRA 2NYYC 1YC7A 3U48A 2BSED 3U4BL 3GB7A 4XNYL 2AV1A 4V2CB 2XZQL 3P73A 4EVNB 1GIGH 3ZHKA 1Z6JT 3V0VA 3PGDA 3GBLA 1AQKH 4LLVA 5CJBA 3WSQH 4DEPB 2ZSWA 5J3HD 4OTXH 2XN9A 4JFDD 4JHWL 4ZODA 5T3XH 4Q97A 1CFNA 4JQIL 2H32A 4OZGA 4R26H 2RJMA 1I1AA 3BQUA 4OJFL 5ETUB 5HHQA 3TNNB 3SE4C 1U9KA 4MAUL 1NBZB 2GFBB 3EOTL 4NGHL 3DI3B 5BQ7B 1T66D 2J6EH 3VFWB 3DIFA 5F7DA 1F5WA 2R0ZH 4YHPA 3WFDH 3C8KB 1MCPH 4BFBD 3NCJH 4D0DA 1P4LB 4MXWL 1OAYH 2IC2A 3GSRA 3ECBB 5DVNA 2GITA 5C2BL 3PJSB 4PR5B 4OZGF 3UTZB 4KPHL 2NW2A 2CIIB 1J1OH 1DFBL 3V4VL 4X98B 5E2JA 1KTLB 4A2MA 3PGFL 2HTKC 4IRSA 1NUNB 4PRPB 1P7QB 2O5ZH 4JPKL 1VPOL 2DI8A 3MLYL 4YXKL 1QLFB 1JF5A 5IROA 4N0FA 1ZS8B 4ZO6A 5FKAA 3T08A 3Q5OA 4MJ2A 1N4XH 1OAXH 1RIHL 3MJ6A 4PJ5D 4NM4H 3LMJH 3BUTA 2GK0A 1A7OL 1JMXA 3FQNA 3WFHA 3DWTA 4ZXBA 1VGKA 3MJ8B 4WV1B 3ZE1F 3ZTJH 1U3ZA 4MD5B 1WWCA 4O51B 3TVMB 2IANB 2UZYB 4MA3B 4UBDC 3SKUD 3O6LH 1A1NB 2HWZL 4GKOA 4QRTB 3SKNA 1JTTA 3VXMB 5IVZA 4DFHA 4Z7OF 5GHWL 5FECA 3PGCB 4M1DH 4X7FC 4HZLA 4IDLA 4Y4HD 5I8OH 5ELIA 4PYHA 1KJMB 3PHQA 5BZDB 1JPGA 4JKPH 1DANT 5KVEL 4FQ1H 1EHNA 4AENA 1RU9H 4P3CL 3GMOB 1A22B 4MXVE 1NEUA 1S7XA 4HFUL 2AEQH 4B7LA 2OTPA 1KN2L 2Q8BH 5F7HA 4ZS7H 1QFUH 1PG7L 4HMEA 2ZUQC 3DMMD 4WU5B 5F7DB 5CSZA 4CU7A 3G5VB 3MNZB 3ZDXF 1N8ZA 4Q9QL 1QTYT 2XG4A 5E8DL 4ODUA 4G80A 1I1AB 3JTSA 4EIGB 4PB0L 1J0JA 3U79A 3QDHA 5GGUB 5C70A 1EHAA 2EDRA 1MCBA 2ZSWB 4KJYB 4PRIB 1CGUA 1PFCA 3LN4A 4XBPB 25C8H 2ZCLH 3U30B 2DLHA 4K8RH 1AGFB 4GG8B 3MREB 2WIIA 5EO1B 2PO6D 3VXSE 3SDAB 2CMRH 1A3LL 1RZIA 1IKNA 3EJZD 5IB5A 2KZWA 1CD1A 3EYSH 1ZT4B 1JGLL 4OF0A 1K4CB 2XWJA 4XCYA 2FWOB 1MFBL 3VCLB 4JHZA 5B3NA 2OR9H 4LSQH 3PL6D 4LLWB 3ULVD 4L1HA 1NPUA 4BA8A 1QZ1A 3GSWA 2VXUH 3PUCA 2A6JA 3SKOA 2H6PB 5FYLD 2Z0BA 3MLSH 2EIZA 1C5DB 1KPRA 2Q86A 3VFUB 3AXLB 4GOSA 4FA8A 5JIHA 3O4OC 3UTPD 1A1MA 4GKNB 2W0FA 1M71A 3TP4A 3PE9A 1QLEL 1RMFL 3BZFA 1KB5B 3QULA 3FRUB 1JHKL 3OX8B 1I85A 3DX8A 4M6NH 4OQ1A 4MMZC 1F6AA 3VRJA 3D9AL 3Q6GL 3OAZH 1MHEA 1MQ8A 3S35X 1HYSC 3T77B 1IEHA 3NCFB 4OCRL 4KKBD 4WY7L 2FX7L 4YHIB 1X5KA 4JFED 5H94A 2CO7B 4R4FH 4XTRD 2ATKA 2XT1B 4ZUSB 3ZYOA 5FUZH 5GIRA 2NX5B 3T2QA 3ARDB 1YYLH 1IAOB 4Y2DA 3QEGH 3SQBA 2EO9A 4Z7UA 2B5IC 1U92B 5GHWH 1MVFA 2H3NB 3O3DA 1IKFH 4NZUH 3Q2CA 1ZTXL 1C08B 1RJZA 4BK4A 4UT9L 1B0WA 4LP5A 2FX9H 1DSFH 2YD7A 3AREA 2J8UB 5I1HH 4E42A 2ZOKA 1T0PB 1PZ5B 3KPOB 4N8CL 1JFQH 2AJXH 1JV5A 2VXVL 1X5HA 2ZUYA 5FV1L 3D85A 1NAMB 3QXTA 5T5FH 1FVCA 1PSKL 5ANMB 4ZAKC 2VXUL 5DO2C 5I75C 5MEOB 5LAXA 4RDQF 3AS0A 1A02N 4HV8B 3DUUB 1HQ4A 1TJGH 3W5MA 4QTHB 3D0VB 4U1IA 2GTWB 3EGSB 4PJIB 2HP4A 4B5EA 2VDKL 3FHQA 2PYED 3PV6A 3NAAH 4NCC1 4OF5A 3WXVH 3MRMB 1E4WH 1JN6B 3GK8L 4WDIB 1C16B 3CZFA 1RZJC 2R0LH 5JPMA 1LMKA 3I6LE 1TCMA 4JVWA 4AY0A 3MGTB 4ZPVA 4FFZH 4M7LT 2I25N 3DRTA 5DJYB 3ARUA 4DZ8A 1UM6L 3A6BH 5LGHL 2F5BH 1A6PA 2PXYB 4X4MA 3AS1A 4PV8B 4MA7L 3P4MA 4KUCF 4BQ9A 3V6OA 2FR4A 1L7IL 1SYVA 3FZUC 1G6RH 1GGIH 4BZ2H 4C56E 4CNIB 4HDIA 3SO3C 3TPUA 4BQ6A 4OF3A 2VXQL 1P7HL 4GG6A 4WI8A 5F7LB 1E6OL 4R7NA 4YHLL 2Z91A 1G0XA 4JDVA 1RJYA 4S1QL 4LLQB 3Q48A 2E8YA 5IR1B 3QDME 4MNQE 1SJXA 5BMFL 4NFCA 3EYSL 4R4NC 2VDOH 3U0WL 1CXHA 4XGZB 4WNQA 4DOHB 1IGYA 5KSBA 5ADOL 4YHMH 2OJEA 4N0CC 5T3ZD 3MRQA 1YMMA 1C7TA 2UWEA 2WZPD 3K3QA 5F1OB 2R2CA 1KGCD 5K9JL 2Q3ZA 4QRRB 4NSKA 2JB5L 3NCEB 4LCWB 4JFPB 1G7HA 4OZ4A 1HIML 2A1WL 1FSKC 3C8HA 3LY6A 1M4KA 1MCPL 1J8KA 1G7PB 4XPHH 3G6JE 5ERWB 3AM8C 1PX4A 4XNMA 1TDQA 4NKDA 4HS6B 2YBRB 4N5ED 3O4LD 4R3SA 3UYOD 4KROB 3S36L 5JHDD 3ULUF 4UAOB 3ZL4L 2ZNWA 5CD5C 4LFHD 5E08L 3UPRB 1H0DB 3GMQB 3O45B 4X7TB 2FJHB 2FLBT 3MRGB 1FRGH 2AJVH 3UJIL 2VAAA 2MHAB 3HI5L 3E6FB 1CDIA 4P4KB 2AK4B 4LF3A 2RBLA 1FLTX 1IBGH 2HT2D 4NQVB 5E95B 4XZUA 3HC4H 5IM7A 2VUYA 1F45A 2E6JA 2ID5A 4ZTPH 4OQTA 2ZOLB 1NAKH 3F8UB 1I4FA 1TPXC 3KYKL 4YFEA 4JJ5B 5I1KL 1CD9B 3LSOA 4U6TA 5L2KA 3OKDA 1I9RL 2VN4A 2X89D 5IP4A 1YNTA 3CX5J 1CDJA 5DEGA 1E0OB 4X6FB 3ARDC 4HUXB 5JW4Q 3DX7B 4WGWB 2XKNB 4UDTA 1MPAL 4CMHB 3FN3A 4PY7B 3V7AE 5ISZB 3W9DA 4WWKB 3NTCL 1W8OA 5DUBB 3RL2B 3FOLB 3S9DB 4NUGH 1NCAH 1JZ7A 1Q9KA 3S37X 1LDPH 1QRNE 3AAZA 3LEXA 3WL9A 4LSUH 4JG1L 4BH7A 1N64H 4POZD 1IGTB 1KPVB 3RI5F 2PR4L 1YUHA 3KPSE 1MHPH 1Q1JL 4JGMA 3D25B 5I2IB 3EAKA 2GSIA 4YWGL 3FB8A 2R8SH 3D39E 1A1OA 4PTUA 1B88A 1GCFA 2D03H 1SQ2N 4UQ2A 3QDJA 4LPYA 3T65B 4U1MA 4GW1A 5F6HJ 4KRPD 4G9FD 3U0PB 2ADJB 2EC8A 4BJLA 4NJ9H 4ZQKB 5C3TA 2MMXA 1RUAH 2YPKA 2YRPA 1AFVH 3MUZ1 1KN4H 3VGAB 4MQXC 1NGPH 5HHOD 2VSCA 4APQC 5KTEH 5ESQA 5GGSY 2X4NA 4L4JA 4PIRF 1KIQB 1KJ2A 3VFSA 3VXMD 4UDUA 2Y7QA 3A6OA 1D9KA 3T4AA 1HSBB 5D1ZD 5EWIH 5D8JL 4WU7B 4CW1B 1R3HA 2OJZH 5I6XC 3CFEA 4UIKL 4FP8L 4MDJB 3BKYH 3BO8B 4M9PA 4NO2B 4PRPD 1GVIA 4DEPC 2EEBA 1OTUD 1ZAGA 3S4SA 1U8PB 4X6BA 3SJVB 2WINA 2QQLH 4EDWL 3TBVA 4AL8H 1BEYL 4F3FB 4JANB 1BP3B 2NY3C 2BY1A 4CL7A 3KPPB 3L3JA 3O6FD 3QCUL 4YAQB 4EOWL 2P5WD 5BRZB 4HK0A 3VH8G 4WRLA 4PP2B 5JQ6L 1DL7L 3REWA 3NGBC 2W59A 1VGEH 1QO3B 3ARZA 1GL4B 4LPUA 5FYJD 5FO8B 2Q6WB 3VG0L 1D6EB 5CEZH 2DF3A 2Y23A 3HUJE 1K8DB 1LK3L 3PDOA 5IEKB 3FT2A 1MFCL 4HUVA 3WHE1 3STLB 3KDMB 3B6SA 1L6ZA 3F7VA 1T7ZA 3UBXA 3FTGB 4P9MH 4N8VB 1UEYA 3MGAA 4P2QB 5DRXA 5GISH 4LEOB 1V7NL 1NCTA 5KS9F 4OCNC 4KKCD 1QPXA 1I8KA 3LRHA 2O5XL 5DR5H 1SY6L 3W11C 2OYPA 5D8JH 3DOSA 3BKJH 4PJEB 4Q9RH 3QXDB 3PWLB 1A6ZB 4X4YA 5DRWA 4X8XA 2GTZB 2JE8A 2I5YL 4M3KB 3O9WD 32C2A 5KVDH 5KS9A 3KJ4B 4XT1C 4PYGA 5CJQH 1FNGA 1MJJB 1WUNT 4DN4L 4Z78A 2ARJB 3RWFB 2WBJC 5JXEA 1JZ5A 3LAFA 4FNLL 3TPKA 4UT9H 1NGWB 1XF3B 3GSUB 2EKSA 4XNZC 4OF8A 5DJZB 3QWOA 1FO0L 1MCWW 2AJYH 3FRPG 4IRJB 2X4OA 2FSEA 1F2XK 4I2XE 1JVKA 4JRYA 4G9FA 4HG4K 5D4QA 5C0RL 5E9DB 1G7QA 1OPGH 1Y6KR 3CSPA 4HS3B 1J5OH 1XR9B 4Y2DD 1T3FA 3WO4C 4WHDA 4OZIE 3VJ6B 5D2NA 4LCCB 4UIMA 5EFIB 1NUFA 5C0CD 3DVFA 3DV4B 5DS8B 2Y36L 1LO2H 1ZLUH 5FDWA 2VZUA 1C5BH 3WFEL 1DE4A 5DD0H 4KHXL 1I7TB 1WBYB 3QWOB 2KQMA 1CICC 4IRJA 2Y72A 4GAGL 2IAMC 5I8EB 3G5XB 3GSQB 4XP4H 1AO7E 3V6BR 1MHHB 3HG1D 2JCCF 5I15H 4LAQL 3KAAA 4OLWL 3HNVL 4RZCB 2XIDA 1ZT7A 3B8SA 3L3HB 3CSGA 5EC1B 5AUMA 1SEQL 5I66A 5KSAB 3VXSA 1S9WB 1MAKA 5CJQL 2XTJE 2YPLA 4WFFE 5DJXA 4WTZG 3CAFA 1XGRA 3EYUH 3QPXH 4DGIL 4F57H 4LEOA 4PV9B 1BIIA 2ILLA 1CXEA 2QHLA 2YUWA 1T7VA 4U1GB 3GUTA 1P1ZA 3VD7A 1PEWA 3HB3C 1AD9A 4MX7A 2V5TA 4XCFL 3VDAA 3MBED 1CF8H 3BKCL 3MV8E 3HNTH 4Y5XA 3K8MA 1QVOA 1QO3A 4Q6IC 5GISL 5JW4N 2DQJH 4C56D 4AEEA 3AC0A 2BCKB 3D69A 4MWFA 2ZKHH 4DKFL 4I0KA 4RISL 4IOFC 4HJJH 3S5LB 1P5UA 4Y8AA 1FCGA 1JZ2A 4XNQB 1XIWD 4HIIB 3JWDC 3MMEB 5IJKC 1A4KB 2ICWI 1ES0A 3RY6C 4LP4A 3C2AH 5IVXA 3IGAB 4DGYL 4F3FA 3CC5B 1T89A 3IFLH 4Z8FL 4P5TC 3QUYB 4PJCE 2J5LB 2A6DA 2GEEA 3PWVB 4Y5YA 3C60A 5DQJB 3GEWB 4J2XA 1GHFH 1UC6A 1QSZA 4NFBA 1FNFA 3CFEB 4PJ7E 3GJFH 3QG6B 1VADA 3VXRA 3VXTB 2W60A 1U8LA 5IVXE 1LK2A 4QRPD 2BVUA 2F8XC 4P4KC 4LCWE 3DURB 5L2JB 3BPNC 5EU7C 3WIFB 2BK8A 3C9NA 2E6QA 3VRLE 5CINH 3I2CH 3STBA 4LPVA 1LEKA 2VITA 5T1MA 2QKIB 4P2CG 1OP9A 2HFEB 2NY6B 5F9AC 4IMLB 4BQCA 4JFFA 2PXYD 5GS0L 2CGRH 1L4IA 2ZPKH 3SGJC 5I2IA 1F4WH 3SOBL 3IU3B 4QO1A 1T22B 2MKWA 2JK5A 3QNZB 4M6AA 1J87A 4PJ9B 4HIEB 3C6LC 4DZBB 1MCRA 2ITCA 3L3DB 1NFIA 1UA6H 3B9AA 4PJBB 3OAZK 4Y4KB 4HAFA 4LARL 1C5CL 5EPMB 1PBYA 2JCCB 1WV7T 3QUZC 1QBML 5ENWA 1Q9LB 2CGRL 2PR4H 3H9SD 2BVEA 3PXJA 3C5JB 2QSCL 2QQLL