4GMTL

Crystal structure of heterosubtypic fab s139/1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQEKPGQSPKTLIYSASNRYSGVPDRFTGSASGTDFTLTITNVQSEDLAEYFCQQYNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab S139/1 light chain
publication title Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmtL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmtL01
4RMTA 1EXUA 2YKLL 3VFUB 1NAKH 5CINL 2C26A 4R2GD 1OPGH 2DJSA 3B2UC 2XN9D 2BXYA 1P2CA 2BOBB 1OGTB 3CXHK 5EBLA 2NY5C 4O2CB 5FYJD 3QHTC 3KPRE 4WEBH 1M4KA 3V4VH 2ADFL 3SDCD 1S7TB 4KROC 4U7KA 3GMNB 3ARDB 4WJ5A 3SDAA 1RURH 4OCMC 4PYGA 2A0LD 2HG5A 1EEZA 2VZOA 3GNMH 4PRID 1HHGB 3D0LB 2VITB 1OQOA 4OF6A 3ULVF 5ENWA 5LG1A 3HLAA 3G6DL 1FG2A 5C08B 3IDMB 1AE6L 4YH6A 2P7TA 2DWEB 5F21B 4PR5B 3V6ZA 4XCCL 4LLUA 4DKFL 3IDGB 1BBJA 1R3LA 4XZUA 3DIFA 3OXSA 4HC1L 2FO1A 1Y0LA 2EIEA 5I8KH 3ABZA 1LP9A 3TLRA 1QEWB 4KC3B 4P5TB 4HUMB 1T1YB 5JXEC 4DVRL 4MQSB 4R9HA 1O5DT 3FQUA 1A64A 2VLRA 1W0WB 1X5FA 4YIQB 3CVIH 3BPLC 5C2UB 6FABH 1ZT7A 5FUOL 2PTUA 5JDSA 3WLBA 3A6BL 1TIUA 1JZ8A 2VDNL 1YPZB 1TZHB 4LLDA 1I9EA 1JTOA 2V9QA 4RCAA 2AK1L 5LWYH 3HB3C 4GAGH 4P4KA 1M6OA 1BMGA 3P9LB 3ARVA 4M48L 2IMNA 1JYXA 1KT2B 4L5FH 4IRJB 1P7QD 5KS9E 1F4WH 1KTDA 4YHYB 7FABL 2BVUA 2J8UB 3U0TB 3MFFB 3O8XC 4LCWE 5DJ8B 1QRND 4F33A 1I7RB 1NMBL 1CR9H 1A1MA 4FNLL 1NCCH 4KKLC 5D1XD 5I73B 5HHQB 3BIBX 4HG4J 4ZUVB 3GO1L 3O4OC 4X4YB 1KPVB 4JFOA 1TJHH 3V4UH 1WBYA 5HGBA 2DS4A 3WL9A 1S7SA 2QL1A 1MCOL 4M6OH 3FB7B 5HHNA 1JZ4A 2DOCA 3S34H 3PQYB 2X4OA 3OAZH 4OFDA 1PBYA 4J3VA 4TUKH 4A2MA 3IETB 1MJ8L 3HFMH 1KIRB 4LCCC 2DQEH 4PRDA 2YWZA 4JHBA 1M1SA 4XXCC 2OYPA 3UTTA 3ARBC 3GKWL 2VLKA 4IMLB 4APQD 1AP2A 2VDOL 4MCYB 1CLCA 5A2FA 2Q87A 1FE8L 5BS0E 5IVXB 4U1MA 3MLUL 2B1AL 3FFDA 1G7PA 3WUZA 4NYLA 4NJ9L 4KK5D 2A6IB 2LTQC 1SYSB 1JHLH 2NYYC 3VH8B 4RGND 4I0PA 1S7QA 5IP4A 5EORH 4HF5L 2PN5A 3WD5L 4D0DA 5DC4B 3G5ZA 2VXTH 2QSVA 1ZHKA 5GS0C 4PRPE 3ILQD 3TN0C 2CO6B 4FQIH 1ONQA 2HRPL 3JWDL 4N68A 3IAGC 2QHRL 3WBDA 5KOMC 4M4PA 5HHXH 4JQXC 2DQGH 4P3CH 4XPAL 3B5GA 2D7QA 4X99A 4HH9B 1BPVA 4Z7VE 3U2SB 5C0AE 1E6OH 2R23A 1QBAA 1VB9A 1F42A 1I4FA 4N5ED 5DLML 4POYA 3BO8A 3JWOL 4P46A 1EMTH 2G9HB 1HWHB 1TENA 2V2WB 2DQHL 4X7EC 1JUFB 4P9HH 4WTXA 4YDIL 1V05A 1IILE 4OGXL 3QIBC 1ZLSL 2VLJE 4LNVA 1V3LA 4N8VG 5KVEH 4WUUB 3KWWA 1V3JA 2DMKA 2OLDA 5CEYA 1BBDH 3HMXH 2CK0H 3MNWA 4XCEB 3V6FB 4HKBA 3R8QA 5C8JA 1NGWA 3FT4A 1L7IL 3GSNB 3N85L 2R2EB 3QUKB 1RIUL 4EI5B 5DSCB 3W39A 4G6AD 5EBGA 4OZFG 1MRDL 1VGKA 5EZIL 3TO4A 1DBKH 3NA9H 1RJYB 4LFHG 3QUZB 1P7KA 1KB5B 2NXYC 4PJDA 5MEOB 2WQ8A 5T3ZL 2VZUA 1EGJH 3QDJE 3GJFA 3KPMA 4JVPA 2AK4E 5D70L 3S35X 1K5NB 1Z3GH 1TZIB 2L7UA 3WS6C 3RZCD 1KACB 3GBNL 2DL2A 4MNQD 3BPCB 4FQHB 1Q9OA 4J3UA 1WIPA 4FQ1H 1JWSB 1F58L 4LSTH 3DX7A 4I4WA 1OP9A 3DSNA 1PG7H 4PY7B 5AYUL 1UB5A 4PGEB 3QO0A 3ZHKA 4L4JA 3P73A 2PW1B 4K07A 4JJ5B 4PJCB 4U7MA 1K8DB 5F3BB 4Z77B 3H9SB 3QUYA 5IOPB 3GFUA 5IIEA 4GAFB 5E7FA 2FZ3A 2AKRB 1JYNA 5DJ6B 5JORB 3LVEA 3RAJH 4LBEB 4MDIB 2VYRE 3NIGE 2AJUL 1ODAA 1R5VB 5GRVK 5D5MA 1RMFH 2DL9A 4JRYA 4OCWH 4EUPH 4P23B 4AIZB 2O61B 1DTUA 4LMQI 4WO4A 4JCLA 5EO1B 1HINL 2Q3AA 1DEEA 3DVGB 5TE6L 2H2PC 1F97A 2HLAB 1JJUA 2QKIB 1JPFB 3CVHH 1N0XL 2DLEA 5SWZA 3D3VD 4QF1B 2FX8H 2DQCH 2DYPB 3UYPA 4TRPL 4WHYH 3BMVA 2X4SB 1FFQA 2OJEB 1OM3H 15C8H 3B9EA 3LKOB 1FDLL 4GXUM 3UPCA 1HQ4A 3RGHA 2R0KH 1FAIL 1C1EH 5CUSL 1WGOA 4PJFF 4X7TA 5H35A 5IB2A 4NNYA 4HDIB 1T22B 3P2TA 4TVSa 5C6WH 3NGBC 1Z0NA 4MVBD 3CZJA 4G3YH 3RWFA 3X3GH 5ERWA 1C8PA 2PO6C 5GGSB 1XF3B 1QFWL 4TQEH 4GG6E 2MCG1 5B38G 3OF6A 3QHFL 2UWEA 1IGCL 2GAZB 3EO1A 1Q9WA 1NCBL 3VXUD 2JJWA 2L0DA 4K9EL 1U8IA 3DI2B 4Z7WE 5I17A 3GDBA 2ATPA 2Q8BL 1NQBA 1AD0A 2CLVA 4JM4H 2BP3A 2X1OA 3WHXB 2QSCH 1EIBA 3JV0A 4KKBC 4YR6A 1N5AA 4NFCA 4PJ8D 2RCSH 2NTSP 3H3PH 4FFVC 1QLEH 3RWJA 2Q76A 5DFWH 1GGYA 4YEFA 3LRSA 4MHHI 1MI5D 4YHOH 5C07A 5EG6C 1FH5H 3FAXA 3DXAB 3SQOH 1WCBB 1UWEH 4W4NA 2BVOB 1I9RH 2XA3A 3QNZA 2Z0BA 2VDML 3O3AB 1INQA 1RUMH 4XBPA 4ZO9A 1BECA 3GSVB 2MHAB 4GXVH 5GRXG 2I5YH 1WBZA 1X5JA 3AMLA 2N7AA 2V9TA 2IFGA 4B7IA 3M07A 5E9DB 5C09A 2NY6C 3PJSA 4JM2F 2LVEA 1OAQL 1RUQH 5GSVA 1SBSH 3TZVC 1F5WA 3V8OA 3FONB 1WUNT 3X13B 4PRNA 4EDXA 4J4PC 2NNAA 5DZNA 3KXFD 2AJZA 3SDYH 4DAGL 3A67L 2YA2A 1CXHA 4MDJA 5EZJB 1JZ2A 4MA1C 4PJ7F 1T83A 2PR4H 2A6JA 1G7MB 5E8DL 2VSCA 3WKML 3PXJA 5TH2A 1UA6H 3ZL4L 4QXTB 4WTZA 2J8HA 4J6RL 2ZOLA 1XF1A 2OJZL 2JB6B 4X9BA 2CXGA 4G8EA 3C5ZA 4RQQB 1NFDB 5K9OA 1F6LL 2R0WH 4J8RA 4K23L 4KI5F 5HHOA 3ZYIA 1BJ1J 1YC7A 1T0MA 2YBRA 1U9KA 3H3BC 1J87A 1U91A 2QQQA 3QA3A 1GHFL 1UH4A 5HDLA 1JZ7A 3CDGB 5KJRL 3QXDA 2H8PA 1NJ9A 2K1MA 5MEQA 4U7SA 3BHBA 1RHHB 2Q6WA 5GS1B 3QXAB 3M1BA 1YY8B 1KLGB 3CH8A 5SX5H 1HKFA 2ESVE 3VWJC 1OSZA 4LHQB 1LILA 3UTSB 1FPTL 1KNOB 3BN9D 4R7DA 1F00I 1B0WA 4K7PL 4XVUD 1XGYH 3ULUF 3MUGA 4G43B 1NMCC 4G6KL 4DGIH 1QZ1A 4ALAH 3HUJA 3D69A 5GS2H 3O2WL 5K9QI 3H2WA 3EYFA 4Q9QL 3I85A 4YEEA 2R39A 4HXAL 1NC4A 4JGJA 5C1MB 4HFWA 5IB5A 5F97E 5HY9A 3STLA 1LK3L 1IZJA 4JY4A 4XBGB 4YFLF 2IWGA 1A7QL 5I19H 2LFGA 3MYZA 3MOQA 5FUZL 3DX9A 4XI5D 2LU7A 4Z76B 1IAKB 5IHUH 4X98A 2AXFA 2VH5L 2Q7YB 4CVWA 3RWGB 2HJFB 4QTHB 1OTUD 1S8DA 2C3XA 4LKCB 1ZV5A 5MEPB 4R0LC 1NGYA 1MF2L 1S5HB 4M61B 1BHGA 2DWDA 4JVWA 3LQZB 4M5YH 4HQQL 4OLZL 1CD1B 1NC2A 1I9IL 4CNIB 4M6NH 4JFPB 3MXWH 2YUWA 4YFLI 1EJ6A 4GSDL 4U3CA 4QTIH 1X3DA 2XWJB 5FKPB 5T1KA 4C54A 4PGCB 3C60C 2BERA 4GBXB 2P5WE 3FRPA 3B5TA 3I50H 2W92A 1OGAA 2GSIB 4M62H 1SBBA 2CUHA 4NO5A 1SHMA 2XWBB 1ZSDB 4Q6IC 4FQXD 5I66A 5J12C 4KJQD 4ZAKC 4HIHB 1BQLL 4XPBH 1QSFD 3HPLB 4LNRA 5DD6A 3SKJH 2UZYB 1Q9KB 5IW3A 1HQRB 5EZOL 5I18L 5JW5A 1BFVL 3QWRD 1XIWC 2WBJB 2F74A 2XI9A 1BD2B 4NQXA 2GT9B 2X4NA 3QFJD 1BZ7B 1U8HB 2HYMA 4JZOB 4NQED 5J3HC 4ZMAT 2R0ZH 3P0VL 1GZPB 2ITDA 4NNPH 4TPRL 1T7YA 3TBYA 1IQWL 2LV4A 2EYSB 3ZKND 1UH2A 3FN0L 3V5DA 1UM6L 5KSAA 5FKAA 4E5XA 1JHKL 3QFDB 3G08B 4HJ0D 3OR7B 1T4KB 1IRAY 3QDGE 1HSBB 5GHWL 3VFUA 5BQ7B 2UUDH 4YX2L 5ADPL 4Y8AA 3QG6B 3JTTB 3QISA 2ARJQ 2Q20A 2BOBA 4K7FB 1OGTA 5AZ2H 4S10A 2HKFH 4GG8A 1G9NH 5IB1B 2XT1B 3WYRA 1S7TA 3GMNA 3ARDA 4CVXB 1LO4L 1MFAH 2IANB 4WFFD 3NPSC 1HHGA 1IKNC 5ACLA 4AEHL 3D0LA 1QD0A 2VITA 1JPSH 1RUPH 4EIGB 4C56D 4NQCD 5C08A 3IDMA 3UTOA 3WLWC 1PKQE 2Z4QB 2DWEA 4PR5A 5JDJA 2HJKB 5IWLC 3IDGA 4LCYB 3CMOL 1T03L 4ZNEA 2R2HB 2OR9H 1MIEL 5IJVB 1QEWA 2DD8H 2HRLA 4P5TA 2FD6H 1ND0B 1T1YA 4OBSA 2O5YH 2YMXH 3F65A 5I1GL 4QXUL 5BVJB 4I9WD 4XBEL 2FGZA 1W0WA 4YIQA 5C0FB 3QCUH 4LAQH 5MHSD 2OI9C 5B3NA 1DN0A 5C0NC 1CDJA 1AQKH 1I3GH 1Z5LB 1YPZA 1TZHA 3R1GH 1GC1C 3TVMA 2Y4SA 5IQ7H 1JRHL 4UMGA 1MFCL 3HC0B 3OG4B 3SGEH 1FVCB 1EH9A 5TE4L 5L88H 3KPRB 3GSNL 3P9LA 1S9WB 2WINB 2XZQL 4M3JA 4BM7A 3NBNA 4MMXC 3C6LD 1LP9F 2GJZB 1KT2A 3AC0A 5E4EC 4GO6B 2B2XL 2QQLH 2HMID 3OKLB 3NN8B 4WWKC 2QQKH 3BP6A 12E8H 1QR1B 1ORQB 2FJHB 1AR1D 5I1DB 5JW4R 1KB5L 2J8UA 3U0TA 1HEZB 3MFFA 4XVJH 5F7KC 5DJ8A 4TN9A 4QXGH 1I7RA 2ZSWB 2OQJB 1DVFA 1EVTC 3MV01 5HHQA 1YECH 1MPAL 1A7PL 3AB0C 4X4YA 1PG7X 1M71B 1M7XA 4B0MM 4O5LH 5F7EH 43C9B 1HHHB 3PWNB 4Y2DD 3RY6A 1MEXL 2ERJB 1LGVA 1S7XB 4WRLA 3PQYA 5GGUB 3JWNC 3IETA 5IJKC 1KIRA 3PWUB 3SY0B 3B9KD 3C5JB 2PETA 2QQNH 4NN6B 1FYHB 3U1SL 4KAQL 3CPLB 4NDMB 4XP4H 1LO5B 4IMLA 3T3PF 4TNWK 4HWUA 4ZO7A 5DMGD 4HS8H 4MCYA 4FFYH 5IVXA 4J3XA 5I9QB 2EH8H 3UZEA 4OIIH 5HDOA 2CUIA 4QGYA 4M43L 2E7LC 3VCLB 3EDEA 2P8LB 3VRIB 2A6IA 5KS9B 1YY9D 4MA3B 1TJGL 3T2NH 3G5VB 3VH8A 4MSWB 3VFPB 4LCWB 2CPCA 3LN9A 2A38A 3NCJL 2P5EE 3OSKA 4TOYL 3LS5L 3SE3A 2UZIL 4HWBL 1OCWH 1M05B 1KCRL 4GKZB 2QTEA 5IVOA 4D9RD 4CAGA 3BDBA 3NCFB 3QXUA 4HT1H 3UBXB 1UACL 4K3HA 5DVLA 1S9YB 2VR9A 3W2DH 3B2UD 4KK8C 3Q6FB 2YPLD 4OLYH 1CQKA 3SOBL 4K3GA 3LQMA 2NR6C 4YDJB 5C7XL 2DDQL 3DRQB 4HH9A 4HK0B 4TSAH 5KG9B 4NCDA 3STBA 1INDL 1IC7L 3U2SA 3IS0X 3VDBA 3ZT7A 4KROD 1X5HA 32C2B 1YEDB 1W8OA 2G9HA 2V2WA 4JPVL 1JUFA 3GI8L 5BS0B 4FG6D 1Y6MR 4UILL 3PABA 4NQTA 1LO3L 4Z18A 3GBML 1B4JH 4WUUA 3EO9L 4RRPG 5BW7C 1KJ3H 4DW2H 5LXGH 3FB8B 2E6JA 4XNQB 5L0QB 4P59H 1ZS8B 4PRIB 4CGTA 5HI5C 2EDJA 4XCEA 1MREH 3ARFB 4YE4H 1WITA 1QP1A 3UO1H 3NOIA 2X4PB 3GSNA 4A2LA 3GMMB 4OB5L 4EI5A 5DSCA 5FA4B 5IFAL 1WLHA 25C8L 4PJ5E 4U05A 4R7NB 1RJYA 5CMAB 4PRPB 1YEGL 3BKYH 5JXED 3QUZA 1KB5A 2EZ0C 4V1DD 3WIFB 5MEOA 3LZFH 5CP3A 1QVOA 4ODXB 3PIQB 1MRFL 1XMWA 4P5MB 5DMYA 5JR1L 1TZIA 4NZDA 4KUCD 3HB3D 4FXGB 1Z0MA 3WFHB 4Z7VB 5C0AB 1MJUL 3BPCA 4FQHA 4Q0XL 4PGBB 3CIQA 3WCYA 1JWSA 5BJTB 1JF1B 2R0LL 4PY7A 3DV6B 4NKIH 4PJDF 2JELL 2VLJB 2Z8WC 1RZJC 4LLAA 3O8XD 3RNQB 4PJCA 2PW1A 2QV2A 4JJ5A 1K8DA 5F3BA 4KKLD 3H9SA 5IOPA 3DURB 5FYKH 3VA6A 4X5WB 4HXBH 5FO7B 1AFVL 4JDZB 1T5WB 5IK3B 2AKRA 4RGOH 5DJ6A 1YNKL 1IAIM 2NY1D 4YZFF 4OI8A 4OFYA 4LBEA 4RGMB 1CLYL 4MDIA 1QACA 1IT9H 1GC1H 1H5BB 1U92B 5E0QA 1M7DA 1R5VA 2O61A 5MI0C 4P23A 4AIZA 4Y4FD 3G5YB 5EO1A 2V5MA 4RFNC 3ZKSD 3DVGA 4E41D 3L3JB 3OAUH 3IDIB 4P48A 2HLAA 1LO0H 1PYWB 3QDJB 4HWBA 5EZLB 1JPFA 4EUPG 3SGJA 3L3GB 2F5BL 4GLRI 3M8OH 4RAHA 3ARBD 4LVNC 4MQXD 4QF1A 4UOJA 2DYPA 4L3ED 2N1KA 2X4SA 3MGOB 4MJ5B 2OJEA 2PF6A 4MJ6A 1YQVL 3RBGA 3FO0H 3LKOA 2K9UA 4WHYG 5C0IB 5D5MF 4L1HA 2NYYD 2BRRL 1T22A 1ZLWK 1KCVL 5I1LB 3MRDB 3H6JA 5MP6L 2P8PB 5GGSA 1XF3A 3FZUD 3QHZL 4N8VB 1IARB 2GAZA 4I3GA 4NRYB 3WN5C 2X2YA 1OB1B 3TN0D 3DVNB 3A6CL 2CMRH 4L4TD 4LEXH 3WHXA 5DVKA 2G2RB 1CFQB 4QOKD 5ILTL 3VGDA 4D94A 4F15B 1XCQB 3W0WE 3MLXH 3B8YA 5ALCH 2E7MA 5GGQH 2O5XH 2MCPH 4OZ4A 5GRYA 1JYWA 3SJVA 5KW9H 4HAGA 1GXEA 1EHXA 2UWEF 1A7RH 4XPHH 3DXAA 3U82B 1NCAH 1G6VK 1KEMH 3T0BA 5DXWA 3LEVL 5CILL 5DVOA 3RVTC 2GTWB 2NY4C 4JDTL 1WCBA 5BV7C 2BVOA 3NFNB 5DMJB 2AJSL 3QIBD 1WF5A 3O3AA 5CS7A 1U8NB 1U3HB 1ETZB 2C1OB 3GSVA 3MLWH 2MHAA 4MNGE 4PTUB 1NMCB 2F53E 3VW3H 5E9DA 1DSFH 4NBYB 1FO0L 5HI3C 4CMMB 3MOAH 4KHTL 4HWEH 4JE4B 4OQTH 3ZT6A 5T1DH 4GG6B 3FONA 2QADC 1G9MC 3WJLA 3X13A 2VTFA 1P4BH 5JA8B 3TT3L 4Z7WB 3QZWG 1D9KB 1NEZA 1WEJH 4W6WB 2GW5A 1RIVH 2NXYD 2WUCH 4L9DA 3SBWA 2BNRE 1FFNB 2VQTA 5EZJA 3GM8A 1UWGH 4NZRH 1G7MA 4JANB 4CVZB 2H1PH 1C5CH 2F58L 5DHVA 4ZS7H 3WUWG 4QXTA 4DFIA 4FFZH 3BIKB 4QHLA 4GQ9L 1H3PH 2ZCLL 4JO3H 2PXYB 3VXRD 2JB6A 3FRUB 3Q5YA 4K2UH 4GRLD 1NFDA 4RQQA 5GGRB 3V0AC 1RIHL 4AQ1B 3TT1L 5I1HH 1JGLH 4I5BB 5GS2D 1UCBH 5F7DB 1KN4H 1R3JB 2DIAA 3CDGA 4F7TA 1QKZL 1WAAA 3C60B 5C0CD 4G7VL 4G9FD 3QSKB 1RHHA 3MRGB 3QI9C 5GS1A 3BSZH 3QXAA 1CLZL 5EU6D 1YY8A 1KLGA 4Q6IB 3AREB 1QYGH 1NLDL 4GRMB 3SKOA 1AHWB 3RRQA 4X6BB 3UTSA 1KNOA 1KXTB 3UYRH 1MFNA 2H2PD 2ZUQB 5IV2B 4AK1A 5DEGB 1A3QA 1N64L 1OF2B 4G43A 4YBHA 1MCRA 4RDQF 4WW2B 5C0BE 4XP6H 4AT6B 1F90H 3IVKB 3NFSL 4KQ3L 3L3IB 4Z7UB 1X5YA 5DZLA 2MNUA 2XNAB 1DLFH 3DRTB 2VDQH 5MERB 4TULH 3CFEB 2R2CA 1H15A 3CAFA 1MWAH 1QRKA 1Y6KR 3E0GA 2X1QA 4JRXA 2CLZB 4UV4L 4XBGA 3WFEH 3MX0A 3O6LL 2NZ9C 1MAMH 3LS4H 3PDGA 2DRUA 2Y25A 3TP4A 2PO6D 4Z76A 1IAKA 5INCB 4Y7MA 5M94B 3HUJF 2FHFA 5SWSD 1CL7I 2Q7YA 1AH1A 3MRKA 1RI8A 5LQBH 3RWGA 2HJFA 5KVDL 1MELA 5LCVL 3OKKB 1MNUH 3MTRA 4PG9B 2V17H 3K4ZA 1FVDB 3I3EA 2ESVB 4KKBD 4W81A 2BY0A 3BDXA 1CFBA 4LKCA 1S5HA 4M61A 3QEQE 4FFVD 2WSKA 3LQZA 4JN2B 1CD1A 3W5NA 3BDYH 2GJJA 4CNIA 4JFPA 4XVSL 5GISL 3GMLB 2B5IB 1YEEH 5HD8C 2FATH 5FKPA 2XWJA 2J6EA 1ULVA 3GRWL 3X3FH 4GBXA 2HA1A 2HP4A 5GRWA 4CMHB 2GSIA 1C7SA 1UH3A 2HT2C 1MI5B 2XWBA 1ZSDA 1ZGLB 4WCYL 4Y0GA 4LSRL 5EU4B 3HTLX 1KENH 3RDTC 1A6VH 1LEKB 4HIHA 1E4WL 3HPLA 5ESQB 2BC4B 2DQUL 1YYMH 4G6ML 1I1FB 3PF2A 3CFBB 5ESVB 3QRFM 2EIZA 2NY6D 1Q9KA 3FMGL 1HQRA 1DANT 3QDME 3TZVD 1HZHL 2W60B 4OLWL 1O7SA 2AK4D 3MNZB 2WBJA 4HIXL 1BD2A 5F9OL 4F9LA 4J4PD 4YHZL 1BZ7A 5J13B 4JZOA 4KRPB 3MUY1 3TWCL 5D7LD 1GZPA 5EA0H 3O6FC 1FP5A 3MLZH 1EO8H 4TTDC 3GSQB 5HGGS 3VXNB 4GW4B 2VABB 1ADQH 5GJTL 3ULVH 4V2CB 3MA9L 2EDRA 3HNSH 3VG0H 4M93C 2HH0H 4HMCA 5BV7H 4UTBL 4BQ6A 4WWKB 3P30H 3BFOA 3VXME 4EOWL 3QFDA 1INEH 2CO7B 3G08A 1GPOL 4OTXL 1NSNH 2H45A 3OR7A 4A6YH 3O6KH 1G9EA 4MXVF 5KSBE 2XWTB 4X0KB 1NEUA 1T4KA 3IJSB 4PB0L 2WZPD 5BQ7A 2P5WB 4JKWA 1NCWH 1YJDC 3QG6A 1DQJB 3JTTA 4JO1L 4K7FA 1TZGL 5F44A 1G9MH 5IB1A 4YXLL 1F8TL 1JTTA 3O3EB 4OUOA 5T5NF 5J06A 3E1F1 4RMQA 4CVXA 5TE7H 5DMKB 2IANA 5FOBB 4M1DH 4DOHE 2G60L 2E7BA 4LLMB 3IFLL 3UJTH 1IMHC 4XNMB 3GSOB 2XA8H 4M7LL 4BZ2L 1IFHH 4KDTC 4HBQA 4HIEB 4KRMB 4DCQB 2X41A 3VWJD 5AAMA 1AQDB 2Y6SC 1RZFL 1DQML 2BHYA 3K4AA 2Z4QA 1YEIH 1EZVX 1ZEAL 1CDYA 1ED3A 4LVHC 4GXUN 3MACH 2HJKA 1I9JL 4LCYA 3QUXC 2JCCE 3G5XB 3T2OA 2R2HA 4NC2B 4OLVH 3MV7D 1LDPL 1FGVL 1ND0A 3BGFB 3F58L 5BVJA 5BCAA 4ZYKB 2WLYA 5FYJL 4G8GD 2H26B 3PWPE 5C0FA 5CCKL 1AIFB 3QDGB 1VCAA 2LE9A 2LQRA 4QRSA 3GHEH 2JF1A 1Z5LA 1ZHNB 2D03H 3D85A 1CBVL 1ACZA 1MSPA 1MJ7H 2DN7A 4KRNA 1WFNA 3HC0A 5IROC 1FVCA 3LD8C 3QEUB 1S9WA 1PKOA 2WINA 5FGSA 4NQDA 5E8PB 1CLOL 3S5LG 2GJZA 5C0RH 2JB5H 1H3WM 4KVNL 1EJOL 3NN8A 3V0VA 2OZ4H 4R4FH 5FA3B 1QR1A 1ORQA 2FJHA 5I1DA 1A6ZB 3VRLF 1HEZA 5F89B 4E0RB 4ZOCA 3R4DA 2OQJA 2AJYL 1YPZF 2AGJL 1IKFH 2BVPB 3DNKA 5DWUH 1G1YA 1TETL 4DK6A 5HDBE 2VL4A 4XP9H 1M71A 3ARGA 4NRZB 2F8VA 3AM8C 2FWOB 5CJQL 5E8OB 1SEQL 43C9A 4PRBA 1HHHA 1RUKH 3PWNA 3ALXA 5HHMD 5FGBC 4HJGB 4GJTB 4LHUD 1S7XA 3NZHH 5D1ZC 4NCC1 1MVUB 4NRXB 3U9PL 3DARA 3IXTB 5GGUA 2HTLC 2IALB 2LAGB 3IT8D 2J8UF 1EO5A 3PWUA 3SY0A 5ISZE 4QT5B 4Y4KC 3C5JA 1YEFH 4HGKC 5B39G 1NBVH 5BO1L 4YUEL 3DJ9A 4JM2C 3L5JA 4ZAKD 3CPLA 4HW6A 4CW1B 1VPOH 4NDMA 2DKUA 1LO5A 4CN6A 4ENEC 3BH9A 2FSEB 3OMZA 1OP5H 3QXWA 3K1DA 4MQTB 3VCLA 2P8LA 3VRIA 5KS9A 1G7QB 4MA3A 3NH7L 3VDAA 3O6ML 3G5VA 4X7SH 1J0IA 1Q0YH 3VFPA 5GJSH 3O2DL 3D0VB 4XPFH 5HVFB 3UPRB 4JFED 3KR3L 2EKSA 2ZP0T 4KUZH 2Y5EA 4PGZA 5AWNL 4YXKH 1M05A 1JE6A 1OHQA 3B9DA 5FHBH 1J1OH 1WTLA 4O58L 4GKZA 1MFDH 4LHUG 4F58L 4PJAE 5FO9B 2A74B 3CFCH 5IVXF 3UBXA 2FJGB 2R4SH 3IU4L 4K94C 5CIPH 4KI5C 3SKUD 3ZTNL 4S1RH 4MLIA 2Y5TB 3EYOB 1S9YA 4EN3C 4PJGB 1F4YL 1TVDA 4X6EB 3AROA 3Q6FA 4UV7L 1NCNA 3MRPB 3F7YB 4XAKE 3KLSA 2W0PA 3DRQA 3NTCH 4HK0A 3D6GA 5KG9A 1NH6A 2HVJB 1JZ6A 1HHIB 3T8XB 1SVCP 4QKXB 32C2A 4P49A 1YEDA 4Z78A 2FEEI 2P24B 4ZFOL 1OAUL 4ZUTB 4XMLH 5BS0A 4HLJA 3BQUB 1BM3H 5F7FA 5F72S 1W72H 3PP3K 4TNVK 5L8KB 3FB8A 3I3BA 4XNQA 5CWSB 5DRNB 2RIKA 3V6OA 3VFOB 3ULUC 1ZS8A 3WLWD 4PRIA 2BCKB 3IGAB 5J1TC 4DEPC 4ODVH 3ARFA 1REIA 2HKHH 3HC3H 3GMMA 2P5EB 1RZ7H 5FA4A 5CFHA 4JPKH 1CK0L 2B4CL 2H9GB 4XX1G 5F7WC 5E5RB 3BE1H 4PRPA 4UB0L 1BWMA 1A1OB 3CCHB 3L3DB 4PIRF 3QQ4B 4LCIH 4N9GB 3JTSB 4CU6A 4Y5YC 4ODXA 1HXMB 3PIQA 4P5MA 5DT1L 1S3KH 5C6TL 4QRRD 4RFEB 4WWID 3WN5B 3LHPH 3SCMB 4FXGA 1AY1L 4YK4C 4Z7VA 5C0AA 4Q2ZB 1PEZA 4PGBA 2EIBA 1V3KA 5BJTA 4M1GH 5B8CA 1JF1A 3CSYB 3DV6A 4X4XB 1BGXL 1EERB 2VLJA 4P0DA 5F93C 5FUCC 3RNQA 1QFUL 1CU4L 4KU1A 1TQCB 3DI3B 5EDXA 2VLRE 2AI0L 2IFFH 3DURA 5JZ7C 3ZKQD 4X5WA 5DD5L 5FO7A 5D7IE 1JV5B 4JDZA 1T5WA 2JJSA 5HJ3B 5IK3A 4C4KO 5CZKA 3CGTA 2C3HA 4R97C 5D8JL 4PJ5B 3VDCA 1H5BA 3WJJC 3I6LD 1U92A 2VQ1B 4PJ9C 4HUXB 2PCPA 4WFGD 4FXLA 1BIHA 5IW1B 3G5YA 4HKXB 3V4PL 5E2TH 3L3JA 2HFFB 4S1DC 3IDIA 4J23A 4PJCF 1PYWA 3QDJA 2FCBA 5EZLA 4WDIB 4P2OC 1SJHB 4K8RH 3L3GA 5LBSH 3O3UN 2YD5A 4LEOB 4MAUL 3MV9D 5KN5A 1OTTC 3MGOA 5LGJB 4ETQB 5D2LB 4QCIB 4KPHL 4IBLT 2CLRB 1I1AB 3T3PE 4Z0BL 2PYED 2H2SC 5C0IA 4EBQH 5E6IC 4PREB 1C5BL 3QUMH 5I74C 5IUSA 1JF6A 1CWVA 4HIIA 1IGTB 3VI3F 2FX7L 5I1LA 3MRDA 4BJLA 3TV3L 4XMKL 2R4RL 2VXSH 4L9LC 2XG5A 3PGFH 4GS7C 4Q7DA 5A43C 3S37H 2P8PA 1HSAB 1N6QL 4KV5E 4N8VA 5DMIH 1N59B 8CGTA 4NRYA 3UTTE 1OB1A 5DJ2B 3WS3B 3DVNA 3GGWB 4P2CG 4C83A 1JIBA 4XXDB 2VLKE 3DUUB 1UENA 3BAEL 2G2RA 1CFQA 1J88A 4H1LH 4ODTL 3PV6B 4CKVX 2F5AL 5I1CH 1VESA 2CIIB 5I75C 1JNHB 3BXNA 1XCQA 4LPCA 2ARWA 5EB9A 1JGVL 4OFVA 5CP7A 5FYKE 5AG8A 4KK8D 2UY6A 4G6FD 2DLFH 2NR6D 2VDKL 1GGBL 1J1PL 2IG2L 3MC0A 3STZB 2KUTA 4OI7A 1FGNL 2P8MB 2E7CA 3NFNA 3GK8L 2KQMA 4LSSL 1WFOA 1HKLH 1U8NA 3RU8H 1U3HA 4ZTOL 5KVGH 1ETZA 2C1OA 3HMWH 4PTUA 1XF2B 3MMEB 4KK6C 2ENYA 4LASL 3SDAC 4CMMA 5DJYB 3EDFA 3WIIH 1V7MH 1BQHB 3OGCB 4GG6A 2APWA 2Z31D 3T08A 5JMRA 4Z7WA 3DROB 3S35L 1D9KA 2CGRH 3D87B 3VA2C 2J1KA 2ARJB 4AG4L 2EZ0D 1YYLL 3MR9B 3HC4H 1FFNA 1U8QB 4GFTB 3UTPE 3ALWA 3EHBC 4TSBL 3FFCE 1J05B 4JANA 3W0WB 4CVZA 3INUL 5FCUH 3KG5A 1WQVT 3UZVB 3BIKA 4NZUL 2BNQD 3IDJB 2PXYA 1FL3B 5F9AC 4H8WC 5IM7B 3W9EB 4PLKC 3QIWB 3FRUA 2J7LA 3TBSB 5GGRA 4EUPB 3VFNB 2GSGA 3RZCA 1A4JB 5K9JH 3KLHC 2FIRT 1DR9A 4I5BA 4I3RL 5JHLL 3G6AB 4P4KC 4MNGB 4NHCH 1CFNB 5F7DA 4Z8FH 1Q72L 4PJDE 1R3JA 4PUBL 1UM5L 2C9AA 2D0GA 3FTGB 3FB5B 5F6IB 5T1LB 3MLYL 3T0EE 4WFED 2QR0B 5DEZA 2PW2B 5IW6B 1LHZA 3AREA 4U6YB 1CYGA 2EC8A 3SE4A 4HPOH 4PV8B 3OJ2C 1NFDF 4GRMA 4YZFE 2FR4B 4WNQA 1AHWA 4X6BA 2NY1B 2BNRB 5B38A 5I8OL 4OSUH 3FT3B 5DEGA 3E8UH 1A0QH 3L1OL 3SE9H 1OF2A 4Y4FB 1GAFH 4WW2A 1WAAF 2D2OA 4AT6A 4GW5B 2IGFL 3IVKA 2B8OT 3L3IA 3PGDB 5LGHH 2CKNA 4Z7UA 2XNAA 3BN3B 4JO2L 4TVPL 2R9HC 5DRZB 3RIAF 5MERA 3CFEA 1L4IA 3L95B 5C0JB 5T3XE 4PS4L 2YK1H 2H32H 1GL4B 2CLZA 3KJ4B 3P4OB 1KBGH 1N4XH 5IQ9A 2R29L 4M5ZH 4ODSH 5KAQG 1KC5L 2W9EH 2HTKC 1Q9LB 3D2UB 2FECI 3OAYH 5F1NB 5INCA 4ZPTA 5F7HA 1NMAL 3FO9B 3IRZA 3ZE2F 4DQOL 3P0YH 3RKDC 1B0RB 3VE0B 5C86A 5SWZE 4LLVB 3OKKA 4I0PC 4PG9A 4XNZC 2AEPH 4EI6B 1YEKH 3B4NA 1FVDA 4J1UB 3RA7L 2ESVA 4IOFC 4ZD3H 2AEIT 1DL7H 3BPNC 3FB6B 4DUXA 2ZJSL 1CVRA 1G6RL 4W68A 2X9YA 4JN2A 5JQ6L 2AJVH 3N1PC 4XNYL 5F9WB 4I13B 3DO7B 3GMLA 1QPXA 3ILPB 1CT8A 2RBLA 4YDVB 3RWIB 4AENA 2CDFB 4FS0A 1AJ7H 2NY3C 5C0BB 4JHWL 3ULVD 4CJ0A 3RVTD 2YD9A 2NY4D 3MBEB 3RX7A 1MI5A 4JY5H 4LVHB 1I8KB 5JIIA 1ZGLA 3BT2H 5IB4B 4LQFL 5EU4A 1J5OL 1LEKA 1E6JH 1KLFA 4I0KA 2BC4A 5ESQA 1I1FA 5ESVA 3CFBA 2ADGB 1A3RL 4ZQKB 4RNRB 1S7RB 4P46C 1C12B 1Q0XH 4EKXA 5HI3D 3LEYL 5EUKB 3U30C 4RMVA 3MNZA 4TUJB 2QADD 1NGPH 2BFVH 2DTSA 3S97C 5CAYB 4YHLL 4Z7NE 4WHTB 1D5ZB 1J1XH 3VXNA 3O0RH 4GW4A 2VABA 3NFPB 2XICA 4XNUL 1V8HA 4O9HH 1WTGT 5EOTB 1KCUL 5T3ZE 2DIJA 4Y89A 3K8LA 3HNTL 3LKNB 4ZOBA 3TO4C 2ADIB 3O11B 4PRHE 5LAXB 5TDOB 3DMMD 2LU4A 2XWTA 4X0KA 4BH7A 3VFGH 4OM0L 3IJSA 2P5WA 1YUHB 5J0BA 1NAKL 4YQXH 1DQJA 5I0ZA 2JIXD 3D9AH 1JWMB 5I71B 1OPGL 4MJIE 2XYCA 4Y5VB 3OBAA 3RWDA 2WK2A 4WEBL 4GKSB 4RA3A 4JFHE 3V4VL 4ZPVB 5DMKA 4G7YH 1MRCH 1QFPA 3QI9D 1IEAB 2F54D 3D18B 3GNML 4LLMA 4XNMA 3GSOA 5DF0A 1D5IH 4HIEA 3U7WH 5C0CB 3MRHB 2WUBH 1AQDA 1I3VA 4L29B 3FOMB 3QUYC 1T1ZB 3VWKB 1LWRA 1IGMH 4H8WH 2F9BT 4UU9B 2EEBA 3G5XA 1VFAB 4KTEH 5DO2C 4L4VD 3ARRA 5HHOE 1D5XB 5I8KL 1MHHA 5TF1H 3ARWA 3VXMB 2EYRB 1GYAA 4ZYKA 5IBUB 3MOBH 4WO4C 2H26A 5DJZB 2ZNXA 5KSBB 3QDGA 3CVIL 3MGTB 1CFVH 5C9KA 1TMCB 3CNKA 4UT6H 6FABL 1ZHNA 1MCIA 2O26U 5IMKB 3D39D 1II4E 1J9CT 5EOCH 5LWYL 3JWDC 4GAGL 4Z5RB 5E8PA 3U6RB 2VDRL 5I15H 4NC1E 2KH2B 5E1AB 4OF5A 5FA3A 4L5FL 3QQ3B 5EWIH 4DOHB 3VFRB 1A6ZA 1F4WL 1FZJB 5F89A 3VFMB 4WU5B 1CR9L 1CXLA 2BVPA 5EC2B 1NCCL 2N56A 4JFZH 2EE6A 3E2HB 1YN7A 2JLLA 2JCCB 2ED7A 4NRZA 2FWOA 5E8OA 4DGVH 2GIYA 3IU3B 1TJHL 5HD8D 3AU1B 2ZUUA 2F53D 2XACC 4HJGA 2DKMA 4FQPA 3QJHB 4JHAH 1MVUA 4JZNB 4M6OL 4NRXA 1CD0A 4DEPB 3MRQB 3S34L 4MLSA 2IALA 2HT2D 4TUKL 3OWEA 5A2JH 4XCNB 4QT5A 3HFML 4ZDHB 3ZDXE 2DQEL 3RDTD 4CW1A 3WO4C 2FEDC 3C08H 4X4ZA 5F88B 1QG3A 3ARUA 2FSEA 3TO2B 3F6LA 1EUUA 5D71H 4JO4H 4Y5YB 3T65B 1G7QA 5H37H 4WY7H 4W6XB 3O6FD 1EHLH 4TTDD 4ODWB 1JHLL 3D0VA 3UPRA 3G6DH 1OVZA 3MNVB 1RFDH 5EORL 4MZ2A 2MTPA 1U42A 2VXTL 3CH1B 2EDDA 3BVNB 5FO9A 2A74A 3NCEB 3VXQB 2WW8A 2FJGA 2GJ6D 1JMXA 4N90E 5E70A 5CD5C 4FQIL 1XGQB 3RHWK 5KS9F 1SM3H 1T83C 4HULB 3C2SA 2Y5TA 3EYOA 3MLVH 3O2VH 1S7VB 1PX4A 4PJGA 3S37X 1ACYH 4X6EA 1QSZA 2E8YA 5ISZB 3MRPA 3F7YA 5HHXL 2DQGL 4Y16D 4P3CL 2ZKHH 4N1CA 2D7MA 5I8CB 2HVJA 1J10A 4YHNB 1HHIA 4NM8H 4S1SH 3T8XA 1WSST 1EFXB 2P24A 1DN2A 1J8HD 3KNBB 4ZUTA 2ZUYA 3C5ZC 1EMTL 3MUZ1 1XGRB 2Y7QA 3BQUA 4NKDB 4P9HL 2R56H 3VMPA 4JZJA 3P4NB 1DEDA 2EDBA 3DTXB 5KVEL 5CWSA 5DK3A 3VFOA 1S7UB 2Y6SD 4YHKH 2A77H 3TJHC 3IGAA 3S5LB 1YMMD 2K3TA 2C4XA 3BPOB 1BBDL 3HMXL 2CK0L 2BSSB 2G5BB 2HLFC 3QUXD 3LKPB 5F1OB 5D6DA 3GJFH 3O4LD 5CEZH 1TITA 2H9GA 2ZSVB 4LSQH 1S78D 1FFOB 3N0PB 3DHMA 3BMWA 3O3DB 4PJAB 3NA9L 1A1OA 3CCHA 1AO7D 2FGWH 4NC1C 4TYUA 3QQ4A 3VGBA 4N9GA 2VAAB 3FN9A 2WWKO 4H20H 5FV1L 3TF7C 1HXMA 1EHNA 3UBXI 1EGJL 2VLME 3MV8D 4I8DA 1MQKH 4F7MB 4RBPH 5E2WH 2IJ0C 4RFEA 3RX8A 1Z3GL 3SCMA 2P47B 1KTKE 5F1SA 4X9FA 2ED9A 4Q2ZA 5TDPB 3REVB 5I76A 3QEQD 1R0AH 2VDOH 5GRJH 4U1IB 1IGFH 3CSYA 3GMOB 2IPTH 5E08H 4FQ1L 5HYIA 4X4XA 4LSTL 4DZ8B 1PG7L 2WV3A 1EEYB 1HIMH 2V5YA 4UOW0 1JI2A 3ZZ1A 5I1KH 1HH9B 1JPGB 2GITB 1QBMH 1JPST 2HFTA 4G9DB 1JV5A 3HG1D 4OFIA 3RY5A 4GUPB 4RMUA 1L0QA 1S9XB 3KPLA 2APVA 4Z7VF 1E4KA 4LP4A 1BAFH 4F7PB 4PJ5A 2EO9A 2YPVH 2VQ1A 4P2QE 5TQ2H 3RAJL 4LMQE 3ALPA 5GXBB 5D1ZD 4HUXA 4YLQT 1QSED 1H9VA 4L8BB 5DEFB 5IW1A 2HTLD 1RMFL 4OCWL 2GY7B 4ODUB 2HRPH 4HKXA 2BHZA 2H41A 3QDMD 2HFFA 3FQXB 3N50A 4Y4KD 1FC1A 2E3VA 3S88H 4J3SA 4WDIA 2E6PA 1SJHA 4JM2D 2J8UE 1H3GA 3EYVB 3CVHL 2FX8L 2DQCL 2VR4A 3K8MA 4ENED 1J0JA 1DDHB 5LGJA 3RJQB 4ETQA 5D2LA 2DM3A 2YUVA 4U6HB 4QCIA 4ZXBD 3T0WA 2CLRA 1I1AA 4RA0C 3S3SA 4LLUB 1OM3L 15C8L 1Y0LB 3L5XH 4G80B 4PREA 5IMOB 1IGTA 4LDEB 2R0KL 1RHFA 1C1EL 5KZCB 2DF3A 2NW3B 1TPXB 3PQYE 1J0YA 5JQHC 1HSAA 1U3YA 3MJ9A 4WVRA 2F19H 4G3YL 3X3GL 5D7IB 4HD9A 1N59A 4TQEL 4RRPA 1RIUH 1AGDB 5DJ2A 3GGWA 3HHRB 1I75A 4XXDA 3DUUA 3JUZA 1RUAH 3OGOE 4KI5D 3H9HB 3IS1X 4JM4L 4AEEA 3PV6A 4D9LH 2CIIA 2QSCL 1JNHA 5IVXE 4EN3D 1CDBA 5I6XB 3X17A 4YHPB 2RCSL 1A9BB 5KSAC 3H3PL 5DVMA 4H1LG 1QLEL 1CF8H 4OFKA 3VRJB 1KTDB 4NZTH 2DQTH 3TBWB 3WFCH 5AG9A 1VERA 3STZA 1EPFA 4ZNCD 3ZYZA 1FH5L 1JZ5A 3RY4A 2P8MA 3SQOL 4BYHA 1UJ3B 3GBNH 4AIOA 1UWEL 3BESR 2RR3A 5E99H 1Z9MA 1A7BA 4NO0D 1U8LB 3NIGF 2X44D 3AY4A 1EGJA 1E4XH 1WBYB 1XF2A 3ULUD 2ILLA 3MMEA 4GXVL 2PTTB 2I5YL 3ARDC 3PWPD 5CJ5A 2B39A 4K3DH 4WI2A 5DJYA 3VFSB 4PLJC 1BQHA 3OGCA 3CLFH 1RUQL 1SBSL 4PRDB 4KHXH 5CJ8A 4U33A 5F6HJ 1WIUA 3DROA 4I18B 5ITFB 3UTTB 3OG6B 2ARJA 3SDYL 3WKNA 3MR9A 1DP0A 1U8QA 1T20A 1AP2B 5K9QG 2B1HH 4MAYB 1J05A 2P43B 4N0UA 3NAAH 2PR4L 5EBWB 4OD1H 1KELH 3WNLA 4P5TC 1UA6L 5EO0B 3WV0A 2MPAH 3IDJA 1FL3A 4XNZB 4GG6F 5IM7A 1CL7H 3W9EA 3QIWA 5DD1H 4AIXA 3LDBB 4Z7WF 1QHOA 5F7NC 2VKXA 3TBSA 3G5ZB 5ID0B 4EUPA 3ET9F 3VFNA 1SY6A 3SGEI 4HS3B 1A4JA 3SDDB 2R0WL 3TVMC 3G6AA 3ARXA 4MNGA 1CFNA 4MJ2A 1I7TB 1ONQB 2NY2B 3O9WD 5CUSH 2YXFA 5JZ7D 3FTGA 4JKPH 2XQYK 3L5WB 3FB5A 5T1LA 1PAMA 1KIQB 4YHYC 4R26H 4FTVD 2QR0A 2PW2A 5IW6A 4PY8I 1DBMH 4U6YA 4PJ9D 4PV8A 4RMSA 2FR4A 1DVFC 5I73C 1Q8MA 2Y23A 4W70A 2BNRA 3FT3A 4S1DD 1FFPB 4ZSOE 3FFCB 4P2OD 1XGYL 4Y4FA 4F80A 3RY6C 1RJZB 2X7LB 4GW5A 4PJCE 1I8IB 4RAUB 4H25B 1OTTD 4DGIL 5CEYB 4ALAL 2YD4A 3MRRB 3AAZB 1TDQA 5DRZA 4OQ1A 1EUTA 3L95A 2H2SD 5C0JA 1XR9B 3L3HB 1YA5A 5E6ID 1UCTA 1IAMA 3NCYS 3P4OA 3K0WA 3MJ6A 2YN5A 3TH4T 1FNHA 1Q9LA 3P3YA 3D2UA 3TYFA 3LEXA 3KAAA 4Y5XB 3EO0B 5I19L 3VI3E 5F1NA 4WW2F 1AGFA 1NGZA 4LSVL 2XQBH 5E2UH 2YEZB 5IHUL 4Z7UF 3VE0A 3T0EB 1J8KA 4LLVA 1BFSA 4EI6A 1X5ZA 4J1UA 1VADB 2D9QB 4UQ2B 2ZG3A 1OAXH 1I3UA 3SE3C 3FB6A 2ICWB 2CJUH 4QO1A 4L4TA 1X5LA 1IC4H 4N0RA 3W11D 4M5YL 3DO7A 3V7AE 2K7PA 3P4LA 3ILPA 4QHNB 4M6NL 3GSRB 4YDVA 3MXWL 3RWIA 2CDFA 3Q5TA 4R8WH 5C0BA 3T0AA 4HBCH 4NZJA 2APFA 5F71A 3BD4A 4QTIL 3RBSA 3MBEA 2ZUVA 3I50L 4N1HB 1HCVA 1I8KA 2HT3C 4M62L 2DQFA 3EDDA 5IB4A 4OIAA 2YUXA 3C8DA 4W4OA 1ZVHA 1WICA 3C09B 2ADGA 4XPBL 4ZQKA 4KK6D 4RNRA 1S7RA 3RUGB 3SDAD 3SKJL 5EUKA 4WO4B 4M7ZB 4K3JH 4TUJA 5GZNC 4KZDH 2COQA 2QSTA 3JXAA 1VA9A 3SJVE 4WHTA 1EZVY 5SWZB 2Q8AH 1D5ZA 3QPXH 2R0ZL 5TQ0H 3NFPA 4NNPL 2Z31B 3EHBD 4OLEA 5EOTA 1MCHA 3OJVC 4CDHA 4EI5C 1OD9A 5CLWA 1U8PB 1MQ8A 5DTFB 4J7RA 1MCBA 4O51B 3KLAB 3X12B 3LKNA 2ADIA 3O11A 3GSWB 4Q9RH 3QUZC 5LAXA 4XRCB 5TDOA 5H35B 2VLRD 3MBXH 1BEYH 1P53A 5SV4A 2A1WL 1A2YB 2KZWA 1YUHA 1JTPA 1JWMA 1I1RA 3KLHD 4Y5VA 5I17B 3LH2H 5AZ2L 4P4KD 2HKFL 1AD0B 5DA0B 5EUOE 4GRLA 1G9NL 3MZGB 1CXEA 1ERNA 4GKSA 3ROLB 3FQTB 2D0HA 3BIAX 3TESA 3N06B 4ZPVA 4LSDA 4UOW1 2NX5E 2I9LB 1IEAA 1MFAL 1RZ8B 1J0KA 3LOWA 1JPSL 1RUPL 1QBLH 3B2VH 3MRHA 5C0CA 1MWAB 5KVFH 1TFHA 1U93B 4LARH 4L29A 2QHLA 3FOMA 1RZKH 1T1ZA 3VWKA 4XP1L 2AXJA 4UU9A 2CIKB 1D5XA 4JG1L 4NOFA 2OR9L 3UTZB 3VXMA 2EYRA 2CDGB 3TCXA 4PRHB 2FD6L 4P23C 1WBZB 2O5YL 4B7LA 2YMXL 4X80L 3P40A 1OARH 5DJZA 3UYOD 5KSBA 2R9HD 4X5XA 1P4LB 3QCUL 1RU9H 4U1HB 1KCSH 3MGTA 4LAQL 4KJWC 1FZOB 4MQ7B 3SGJC 3CC5B 5IMKA 1AQKL 5F7MC 4MJIB 5EOCJ 5JOPE 3R1GL 2XZZA 2E27H 5IQ7L 1EK3A 4AM0A 1NDGB 3A0OA 2YRPA 4Z5RA 3LPWA 2HTKD 4MDJB 5L88L 3U6RA 1WC7B 1IAII 4L8SB 4D2NA 5E1AA 1XF4B 3QQ3A 3RKDD 3IDXH 1UKTA 2QQLL 2FX9H 2QQKL 12E8L 4TUOA 5C92A 1FZJA 1BFVH 3EFDH 1IGJB 3VFMA 1P7HL 4XVJL 4WU5A 4IOFD 5SWSA 4LSPH 4QXGL 3G9VA 2BZDA 5EC2A 5K93A 4ZO8A 4ISVB 4NWUH 1YECL 3IFNH 1R3IH 4G8EB 4KJYB 2EECA 3WFZA 3CUPB 4JRXE 3WSQH 2ZCHH 3AFLA 3IU3A 3AU1A 2YBRB 4O5LL 4JFFD 1BJ1H 3IXAB 2OL3H 3QJHA 4JZNA 2OTWB 3MRQA 2XXCB 2A9NH 3RI5F 3QXDB 5J6GB 4F8QA 1S9VB 5M95B 3V95A 4ZDHA 4KY1H 3RWHB 3KHOA 3DVIA 4OLUH 1W8NA 4U2ZA 1KB9K 3H0TB 2QQNL 4JG0H 5F88A 3VXSE 4P46D 4XP4L 4FN0A 3TO2A 2EXWC 3C8HA 4HS8L 1CIUA 1A9EB 4A6YB 4FFYL 4N9OB 4X4MA 2EH8L 5J4MA 4NOBA 2FIKB 4OIIL 3T65A 4JFDB 1E27B 3T2NL 2VZVA 3DV4B 4ODWA 4PFEA 3K7UA 3B5HA 3MNVA 4NQSB 1KIPB 5A2LH 5IB3B 2DJUA 5HGAB 1QNZH 5H37G 5D7LA 3OR6A 4OD2B 3MRBB 3NZ8B 4WI3A 3WJLC 5IEHB 2AV1B 1NC4B 1OCWL 5L2KE 1Z6JT 3CH1A 3KYKH 3TO4D 3BVNA 2AW2A 1KOAA 3VXQA 5F70A 4U1KB 3SBWC 1MCWW 3WIHH 4DKEH 4F9PA 4HT1L 1XGQA 4UDUB 2VNCA 1S7VA 3K80A 5EU3B 5CEZD 2BHUA 2R1WB 3W2DL 5L8LB 3DO3A 4JFQB 5ISZA 4Y19D 4V2BA 3P11H 4IDLA 3S4SB 3QRGH 4OLYL 5HYSB 5I8CA 4YHNA 1OT2A 4P2YA 1EFXA 5EIIB 1IM9B 4HFUH 2X9WA 1F3JB 3NMEA 2ADJA 3KNBA 3RGVB 3X11B 4YGAB 1XGRA 3GMQB 1A6WH 1EAPB 5JW3H 3P4NA 1NC2B 5SWQA 1B4JL 3DTXA 5A3IC 4PJGF 1S7UA 1KJ3L 3S5LA 4DW2L 5LXGL 4P59L 3QUYD 5DJDB 4XHQA 5BMFH 1MREL 4YE4L 1VHPA 3P4MB 3UO1L 4LLWB 3LKPA 5DO2D 5GS1C 3JUYA 3T04D 4Y2OA 1F4XH 1L0YA 1GCFA 1FFOA 2XZAH 1BJ8A 3O3DA 4PJAA 4D9QD 4JRYD 1Z2KA 3RL2B 1X6NA 4HCRA 3BKYL 1RZGB 2ICWJ 4LNRB 2CR6A 4JQIH 3LZFL 5D7JB 2VAAA 2X4QB 3MRJA 3U9UB 3CLEH 4XB8A 5F3HB 5H94A 4F7MA 1AKJD 4XMPH 3P9WB 2ITDB 5DQ9B 5FYJU 3B8SA 4F2MB 5HPMB 5TDPA 3MRMB 4PB9H 4M7JH 2D3VA 2XTJB 5K9KB 4WI8A 4U1IA 3GMOA 4HK3J 4DZ8A 4UUJB 2VDLH 3Q1SH 1EEYA 5FKAB 4NKIL 3CSPA 5CZVH 1HH9A 2MSPA 4OF0A 1T7XA 3LRGA 4G9DA 2DIBA 2VWEC 4KWUA 3O81A 3OZ9H 4GUPA 4O4YH 5FYKL 1S9XA 4BZ1H 3SQBA 1JGUH 1KJ2B 3VGEA 4RGOL 4S0TD 4F7PA 4X6DB 4TNVF 4QHMB 4GG8B 3E6FB 4IDJH 3QNYB 1IT9L 1GC1L 4K71B 4L8BA 4NQDE 5DEFA 4PJXE 4DGYH 4ODUA 3FQXA 3ROOB 1UB6B 3OAUL 4RX4A 1A7OL 1LO0L 5D96B 1LMKA 2VERN 3EYVA 5C07D 2CRMA 2FEDD 3M8OL 1P84K 3HZYA 3VXPB 2DDQH 1DDHA 4GBXC 1VSCA 5JHDD 3KPSD 4U6HA 1GGCL 5CIPB 4MD4B 2ZUTA 1XGTB 3VFVB 3FO0L 1BVKB 2OSLB 4G80A 3K81A 5IMOA 4UILH 4UAOB 1CXIA 2NW3A 2HVKB 5C09D 3EOTH 1G0XA 2D9CA 4NGHH 3IAPA 5D7IA 1L7TH 2WBJC 1DN0B 4F9LC 2N7BA 4GRWE 5E6ZA 1AGDA 3TNMB 5D2LF 4KQ4H 3TVMB 4PBWD 3KS0J 4OM1H 5I0DA 3CXDH 5CD5D 5DD3L 3H9HA 4P2QB 1T7ZA 2CMRL 2QSQA 5IVNA 3I9GH 1EEUA 4YHPA 3TM6A 1RAMA 1A9BA 2NZIA 5BRZB 5D2NE 3BP6B 3VRJA 2FBJH 2O5XL 2MCPL 5L8JB 1KGCD 5JR1H 3TBWA 1EX0A 5KW9L 4MXWH 5CSGA 5DS8A 3PGCA 4HGWA 4IOSD 1KPRB 1A7RL 4XPHL 1DVFB 1NCAL 1KEML 3ZSSA 4MS8C 5DJAB 3MA7B 3C5ZD 1UJ3A 2CRYA 4GKNB 4LVEA 5HHOD 2Z9TA 1BLNB 1U8LA 4UINH 4LIQH 1MVFA 4N8CH 4L1DA 3VGHA 5J6HB 3TJHD 3MLWL 2PTTA 3U0WH 3VW3L 3RVVC 1C16B 2HLFD 3VFSA 1DSFL 1MFBH 4YHMH 4KTYA 4Y1AD 2C4FU 4HWEL 5BZWB 4OQTL 1YMMB 5T1DL 1KXQE 3F8UB 5ITBH 4I18A 5ITFA 1BFTA 1WEJL 2XN9E 1T66C 5GGVH 4CUCA 1RIVL 2R8SH 2WUCL 4MWFB 5DD0H 4IIQB 4MAYA 5FYJE 3AVEA 1F2XK 1UWGL 5T3XL 5I30H 4NO3B 4NZRL 4LDOB 4BSVB 2GUOB 4WTZG 5EBWA 3PHOB 5CSBA 1JN6B 2H1PL 4S1QH 1C5CL 4NQUA 3EJJX 3V6OE 5EO0A 2CQVA 4PRIE 4ZS7L 5IGXH 1QBBA 1U95B 1GGUA 4FFZL 1MLBB 4HZAA 1H3PL 1H8NA 4AMKH 3MCLH 3QIUD 1Z9OA 3FQRB 5J11B 4N5UA 5ID0A 4HS3A 4K2UL 3SDDA 3T0VA 1KCKA 2G75B 1A7NH 3BD3A 5E8EB 2BNUB 4RDQG 5I1HL 1JGLL 1IEHA 1JHTB 2DQJH 1I7TA 4QRTB 1UCBL 4OZHA 1KN4L 1GOHA 1NCUA 4HGMA 3L5WA 3UEZA 3S36H 1KIQA 3RTQD 1WZMA 3BSZL 4HC1A 2ZPKH 4YC2B 3HG1B 1K6QH 1UADC 4KUCF 2MOVA 1QYGL 3QUMB 5JUEH 1H3XA 3OKOB 3BUYA 2CRIA 3LQAH 4ERSH 4YWGH 3B9VA 3UYRL 3D25B 1FFPA 3FFCA 1TJIH 2IAMD 3ARGC 4F57H 3PABB 1XR8B 5IBLC 1H3TA 5DUBB 2FJFB 4R4ND 3NCYP 1RJZA 2X7LA 2ERJC 1I8IA 3B9AA 1R3HB 4RAUA 4H25A 5GS3A 4PLNC 1J0ZA 1KB9J 4XP6L 1F90L 4CADB 4IRSD 3MRRA 2DTMH 3AAZA 1OGAD 1DLFL 2DBLH 4H1LB 2VDQL 1XR9A 3L3HA 4L8CB 3F6IA 4TULL 4NN6C 3LV3B 4ZS6C 1AGBB 1MWAL 4RWYH 2UYLB 1G1CA 2R2BB 5FM5O 3WFEL 2NY5H 2EDEA 1MAML 3LS4L 2F15A 1YN6B 4Y5XA 3EO0A 5I9QC 3U7YH 5DC0A 2YEZA 1GGIH 1QVOB 2I25N 4MYWB 3T0EA 2AERT 5LQBL 1A47A 2EKJA 1DANU 1VADA 1MNUL 3ZKMC 2V17L 4UQ2A 2NLJB 2J6EH 4KH2A 4BFIB 2ICWA 3EZ8A 3SHSA 5HGDB 2Y06H 5KSAD 3BYTA 4ZSOB 1K8IB 4JPWL 3V52L 5JNYB 3BDYL 2IPUG 4QHNA 3Q6GH 3GSRA 4OCRH 2HT4C 1YEEL 3EW3B 1HYSC 3IDYC 2FATL 5INDB 3X3FL 4RGNE 1CD9B 2FNBA 4XWOD 4MJ4A 3BEWB 1KTLB 4JQVA 1X5IA 5C0GB 1JGEB 1KENL 1A6VL 5I2IB 1M7DB 3ARDD 1YYML 4C58B 3HR6A 3RUGA 2V7HB 3WFDH 4HIJB 3IFOB 4PLJD 1N5YH 1AXSB 4B53A 4ZG1A 5L0QC 2NPLX 3V6OC 2NXZD 2AEQH 5C08D 3TYGL 5EA0L 1TTFA 3ARFC 3MLZL 1EO8L 3PHQB 4Q6YA 5T5NG 2Z31A 1ADQL 1BOGB 1U8PA 5DTFA 5K33A 2JJUA 3ULVL 4MJ6B 4D8PB 3HNSL 1FNSH 3VG0L 4O51A 2HH0L 3KLAA 3X12A 5BV7L 1IEBB 5CBAB 1DE4B 4P5TD 1K4DB 3GSWA 1NDMB 3P30L 3WHE1 4XRCA 1A14H 1INEL 3HN3A 2W9DH 1NSNL 4A6YL 3O6KL 3QBTB 4XT1C 4WHCA 4XH2B 4KQ3H 4FQ2H 1A2YA 3LRHA 5HYFA 5DHYB 4O2EB 5DQJB 5DQDH 4CU7A 1NCWL 5T33H 4NKQB 1B6UA 5FYLH 3BZ4B 3KYNB 1G9ML 1NBQA 3ROLA 4ZOAA 3FQTA 5F7YC 5D7SH 4IRJD 5B8CC 2I9LA 5TE7L 1RZ8A 3O9WB 1S5IH 3L7EB 3IB4A 4M1DL 4S11A 5GSRA 4OZ4B 4JVUA 3UJTL 3SJVB 2XA8L 1MWAA 2J2ZA 1U93A 3DHJA 4ORZC 1IFHL 3ESVF 1C08A 4LSUH 3U0PB 3CXHJ 1BVZA 4GW1A 4NWTL 1TVHB 1YEIL 2L7JA 2JJSC 4OKDA 4GOSA 2HFGH 2X4RB 3MACL 2CIKA 3EYQC 2EDXA 3ESUF 3BP5B 4RGMC 4MNQE 1H5BC 3UTZA 4OLVL 2CDGA 5GS0H 4PRHA 1FSKB 3PQYD 2P48B 5JPMB 4OF3A 1P84J 1P4LA 4U1HA 3SDXB 4ONFH 1W0YT 1FZOA 4MQ7A 3CC5A 4IS6B 4MJIA 4EJ1C 2D03L 3NCCB 1NEZB 3P77B 1WZKA 1NDGA 2E9BA 5EUOB 1E4WH 5J8OA 1UKQA 1WC7A 2DQUH 3K46A 4L8SA 3C8KB 2YC1A 3LPGA 2GTZB 1XF4A 3RIAK 5C0RL 1RD6A 2JB5L 2NX5B 2OS7A 5HYJB 2OZ4L 4R4FL 5JW4N 1L9MA 5KSBF 5DHVB 1CI5A 1IGJA 5C2BL 4Z7UE 5IHBA 4QHLB 2NY0B 4GMTH 4OV6F 2J8OA 5DK0B 3H8NA 5T1MB 1EV2E 3D3VE 4ISVA 1IKFL 4KJYA 1IGYB 5DWUL 3MA9H 4JKMA 3CUPA 3I3DA 3PL6D 3VG9B 1MCWM 4XP9L 5DR5H 5L9DH 4YGVB 4ZTPH 1JMZA 4XPGH 3IXAA 1RUKL 3Q0HA 5HXMA 2BRQA 2OTWA 1I7UB 3NZHL 4F15C 3ILQC 4F7TB 3VXTB 3L6FB 4MB5A 4P2RB 5J6GA 2HT3D 1ADQA 1S9VA 3SE8L 3RWHA 3WXWH 1NBVL 4LCUB 3LN5B 4UZGA 4BQ8A 1EDQA 3H0TA 3S96B 2WAHA 3LIZH 3N1GC 1VPOL 2JCCF 3SKOB 2W07A 5HTSA 4PP2B 1MIMH 1XCTB 3QH3B 3WNNA 1A9EA 4A6YA 1KJ2L 5GZND 3VH8G 3MQIA 2FIKA 4N5EC 1U3HC 4WUUD 3F62A 4JFDA 3FHQA 1E27A 4FZEH 4U2YA 2YD6A 3DV4A 4X7SL 3IFPA 1Q0YL 2VXVH 3OL2A 3D48R 5GJSL 4C59B 4XPFL 4NQSA 1KIPA 5IB3A 5HGAA 4EI5D 1PDKA 2BJMH 5ANMB 1MI5E 1NPUA 5F6HI 4OD2A 4KUZL 3MRBA 3NZ8A 1WFTA 1X7QA 5JIKA 4YXKL 5IEHA 2AV1A 4U0RB 1H15B 5E1HB 5HI4C 5FHBL 3T4AB 1L9NA 1J1OL 3PV7A 1D9KC 1CDGA 1MFDL 1OD7A 1T2QL 4JRXB 3ZE1F 3QUZD 3T1FB 4U1KA 1AXTH 3RZWA 4J3TA 2Y72A 3CFCL 3DYPA 1FIGH 2R4SL 4UDUA 4S1RL 1N7MH 5EU3A 2R1WA 1PFCA 3DMMA 5DDHB 4JFQA 4Z7QE 3MRKB 3S4SA 3CSBA 4OGAC 2XY2A 1UYWH 5HYSA 3SGKA 3NTCL 2PXYC 1A6AB 1TQBB 2EDOA 2JIXA 3VXSB 5EIIA 5HDBF 1IM9A 3KXFE 5MENB 1F3JA 3RGVA 3X11A 5CKGA 5D93B 3GMQA 3RZCC 3T3ME 1FO0B 4XMLL 4G5ZH 1EAPA 1JGDB 4KDWA 1BM3L 1G7IB 3E3QE 1FORH 3NACH 4RAVA 5EN2B 1W72L 1RK1B 4URTB 3H9SD 4RMRA 5DJDA 4ODVL 2H6PB 4OGYH 2WP3T 3P4MA 3BEVB 2HKHL 2P42B 3GSUB 3HC3L 4LLWA 1RZ7L 1MHCB 4JPKL 1ZLUK 5L2KB 3MJGX 3AREC 4LLQB 3SE4C 4N1EA 5D1QB 2VUYA 4Q58C 1XT5A 4U1GB 3BE1L 4P23D 1AHWC 3RL2A 4WI5A 1A1NB 1RZGA 1U3ZA 2EIZB 2LVCA 5D7JA 2ZUQC 4IOIB 4TVPE 2X4QA 4LCIL 1ZE3C 3TA3B 3U9UA 4YDLB 5E5MB 3L5HA 5F3HA 1S3KL 1QPPA 4WW2C 4EQ3A 2X05A 2DYPD 3QG7H 2OTUB 3DGCR 2MFNA 3LHPL 1TCRB 2VQUA 1DFBH 1FLRH 3PUCA 2DM2A 5D7KD 5DQ9A 5EFIB 1AI1H 3RHWF 4F2MA 5HPMA 5BVPH 3MRMA 4LVOB 5TF0A 1MHPH 4POUB 4UIMB 5K9KA 4PJAF 2V7NB 3PG2A 1QOKA 4M1GL 4UUJA 1MY5A 2AXGB 3GMRB 3O6MH 3H9ZA 2BOCB 1BP3B 1P69B 2A9MH 2IFFL 4J3WA 3KYAA 4ETYA 3W81A 1KJ2A 4HKZB 3J7HA 4KGLA 4Z6AT 4X6DA 1IAOA 3AUVA 4QHMA 3RVUC 3CFIC 3E6FA 2QEJA 4DN3H 3QNYA 1UFUA 4NJAH 3WXVH 4BK5A 3ZTNH 1KIUA 1NUFA 3LB6C 4GAJH 3ROOA 1UB6A 3QAZB 4WFHD 5E2TL 4DN4H 3HRPA 4Y4HB 2B5IC 2CSPA 5DUPH 4K8RL 5LBSL 4KJPC 3EYUH 4NO2B 3DXAD 4U6XB 3VXPA 1XAUA 2EXWD 4CMHC 1FCGA 1BOYA 3K4DA 5CIPA 1ED3B 5E6YA 4MD4A 4HUVB 1XGTA 3VFVA 1YZZA 1BVKA 3NABH 2OSLA 2NY7H 5HGHB 3KGRA 1XGPB 3ZKXC 4EBQL 4U4BA 5B21A 3QUML 4NN7B 3QB7C 3DSFH 1FV1B 4KZEH 2HVKA 5E9DD 4HMEA 3OKMB 3SN6N 3HE6B 5HHVH 2ZOKB 2VXSL 5J57B 3PGFL 1DLHA 4M3KB 3S37L 1GH7A 4QRSB 5DMIL 2W59A 5J13C 4RFOH 3TNMA 4KRPC 1FYTB 3D85B 1DQLH 2YSSB 1V7NH 3U79A 4P2QA 1SMAA 4JB9H 4NQDB 1AGEB 4PJXB 5D72H 5I1CL 1QSFE 1ZLWH 5CJOH 5BRZA 3V0VB 1FL5B 2KPNA 1I7ZB 2R1XB 2DLFL 4D0BB 1WT5A 1Q38A 1OWWA 1PLGH 1QO3B 5D7IF 4FMKA 2MQ3A 3OKDB 3R8BB 1KPRA 3QFJE 4Y19B 3GJEA 2NMSA 4Y16A 5DJAA 3MA7A 1FZMB 3QDAA 4I3SH 4GKNA 1BLNA 2GK2A 3ARGB 3VFWB 1HKLL 3RU8L 3QQ9C 4H26A 5A3ID 5J6HA 5KVGL 4PRBB 3HMWL 2IQAA 4QRPB 4WENB 1QFUH 1C16A 5JTWA 4PJGE 4JKLA 3JSSA 3WNOA 5BZWA 1YMMA 3WIIL 4LDLB 1V7ML 3I2CH 4CN4A 4GRWB 1KUMA 1VFMA 3GUTB 2VSDA 2CGRL 3UTSD 1IC5H 2VDPH 5FF6B 3VD7A 1DQDH 2Q1EA 4MWFA 3BH9B 4IIQA 3GIZH 3HC4L 4PPTA 5FEBA 1P9MA 3HAEH 3HCVB 4NO3A 3IRPX 4BSVA 3SPVA 1ZT1A 2GUOA 1AO7A 3PHOA 4KMTL 1JN6A 5DRXB 4Q97A 5D2NB 1KG0B 4M6AA 5FCUL 4LPXA 3BGFC 4WFFE 4PJIE 1U95A 3HE7B 4KV5F 1MLBA 3DUSB 2EKSB 1AKJB 1URLA 3DUHA 3FQRA 3KYMB 4KI1A 1F2QA 4C56E 1T1WB 2EH7H 4NQCE 5EPMB 3TIDB 3GBLA 2G75A 5I1IH 4UNTA 5E8EA 5K9JL 2BNUA 2V5TA 5C3TA 1JHTA 1NUGA 2J12B 4QRTA 4NHCL 4Z8FL 1T6WA 3IDYB 3QULA 5E00B 4HH8A 5I1AB 4XMKH 1OP3K 4R96B 3CMGA 1P6AB 1R6VA 4I9WE 1F13A 1FL6B 1CICB 1I8LA 5MHSE 3HG1A 3EDJA 4XNXH 3PWVB 3QUMA 4R2GB 3OKOA 4HPOL 3CJJA 2XN9B 4Z78B 3PXHA 1OTUC 3D25A 3U7AA 1A6UH 1XR8A 3EDKA 5DUBA 2FJFA 3E8UL 1A0QL 3SDCB 3SE9L 1MFEH 5C6PB 1X5GA 2NTFA 3OPZH 1SJEB 1GAFL 1R3HA 4UDTA 4GBXD 2CKBH 4CADA 3QWOB 5LGHL 2V2XB 3KJ6H 5LJYH 4KMLB 2VXUH 2X4UB 1UEYA 1LO2H 4H1LA 5HBBA 2R69H 4L8CA 1FGNH 1ZGLM 3LV3A 2ENSA 1AGBA 2YK1L 4LSSH 3KPSB 2UYLA 1A5FH 4ZXBA 3NA4A 2R2BA 1CGXA 1N4XL 1KBGL 2I07A 4QEGA 4ODSL 5DYOB 1CDHA 1YN6A 4ODHH 1AD9B 2W9EL 2WBJD 4MX7B 1BD2D 4D0CB 5EU5B 2GY5A 2I24N 3G6JB 4LRIA 2EDKA 3P0YL 2I60H 4JJHA 1G84A 1B9ZA 3U48A 1YEJH 1HH6B 1X44A 2AEPL 2NLJA 1A3LH 1YEKL 4FOMA 5D2LE 3G9AB 4BFIA 5HVHB 1DBAH 1J86A 2C3VB 3VJ6B 4ZD3L 4BFEA 4DTGH 1DL7L 3AS3A 5HGDA 1VFOA 4ZSOA 2W9LA 1K8IA 3SEPA 5B8CB 4OT1H 4O00A 4YFDB 5JNYA 2AJVL 3QCVH 2YA0A 3ULSB 2FLBT 1FNEB 5E5UB 1P7QB 5INDA 1AJ7L 3G04B 1YMHB 4KGJA 3UX9B 3S9DB 4XC1H 4FXKB 4HJ0C 3EYSH 1B0GB 3BEWA 1KTLA 5IG7B 4BKLB 1QRNB 4JY5L 2HFEB 1BX2B 2DKSA 1IBGH 3BT2L 5C0GA 1JGEA 5HVGB 5D1XB 1E6JL 5I2IA 3F7RA 2V7HA 2PCPB 3OB8A 3RVVD 2IH3B 4D9RE 4K3EH 4HIJA 2IAND 2JJTA 3UJIL 3IFOA 3BQUC 1AXSA 4JZJC 5FYLD 2YXMA 1G7LB 2BMKB 2YZ1A 3UC0H 3CSGA 1NGPL 2BFVL 1T66D 4Y1AB 1DCLA 3PHQA 5KN5B 3BI9X 1J1XL 2YPLE 3O0RL 2X42A 1BOGA 4O9HL 5D6DC 4Q74A 2MKLC 1PSKL 3CDFA 2V2TB 4D8PA 5I8OH 5TPWH 1UWXK 1IEBA 4APQB 1G0DA 1CE6B 5CBAA 1DE4A 3RUGF 1S7WB 1IAIH 5ADOH 1K4DA 4GMSH 1NDMA 1LK2B 4P5KB 5CGYC 5CKAA 4HIIB 4N0YH 2YS4A 2VB5A 4X8JA 4AEIH 4XH2A 1YDPB 3VFGL 1QFOA 5DHYA 4RGNB 4O2EA 1E0OB 4U1JB 2D4FA 4AJ0A 5DQJA 4ZFOB 3GM0A 4YQXL 3C87A 4QYOB 5E8NB 4AL8H 5GS0D 1ZWIB 3SCMC 2IH1B 3BZ4A 2D31B 3KYNA 3QIUB 4C83B 3KPRD 3THMH 1MCPH 3QO1B 1CDCA 1GGTA 1RZIB 3WDIA 1WWAX 1QQDB 5F8RC 5FOJA 4N0UE 1MHEB 1T3FB 3BXNB 4PJEE 4KMQA 4OZFB 3UDWA 4V1DE 5CP7B 3DPBA 5HDQH 4G7YL 3O9WA 4HUUB 1MRCL 3L7EA 5AAWA 4OV5B 4EDWH 3KVQA 2P44B 4CBPA 1TQCC 2H32A 3GZKA 1D5IL 4FQLH 2D0FA 3U7WL 3U0PA 2WUBL 4LF3B 3RTQB 4FTVA 4HUWB 1TVHA 1VACB 4UIKH 1B90A 3C2AH 1H0DA 1RY7B 1IGML 2X4RA 4H8WL 5L7XH 1F11B 3GB7B 3BP5A 1E4KC 1T2XA 2C1PB 3ZDYE 2W65B 3AS2A 8FABB 5TF1L 4ZODA 1ZLVK 2IEPA 2IAMB 5JPMA 3MCKB 3RPKA 3MOBL 1VGEH 2XTLA 5DZOA 3SDXA 4Z7NF 4IS6A 4ZS6D 4IRSB 1CFVL 4UT6L 4WV1B 3O45B 3SGDH 4NKOB 1B88A 3P77A 5EUOA 1WZ1H 1D5MA 5EOCL 5K59F 2AABH 2ZCKH 3V6BR 3C8KA 4O2FB 2ZUWA 1U8KA 3NIFE 1I1AC 1NANI 2GTZA 4OAWB 5C0DB 5I15L 2NX5A 3BGMB 5HYJA 4AZ8A 5TGBB 5EWIL 1BQSA 2WQRA 4RISH 1VDGA 4KTDH 4LCWD 3ZKMD 1YY9C 1UM4H 5DK0A 4BSWB 5T1MA 4JKKA 3H7LA 5F96H 5F7LB 4C55A 4L3EE 2AJ3B 4JFZL 4XNUH 1IGYA 3TCLB 1GOFA 2W38A 2GSGB 4XPTH 3RZCB 3L9RB 1T21B 4NKMB 4YGVA 3GKZA 4MNQB 4DGVL 2HT4D 3UTQB 1HYSD 3NPZB 1I7UA 2BX5A 3O3BB 1EEQA 4JHAL 3VXTA 3L6FA 4P2RA 2RQ8A 3QXTA 2W0LA 1MCQA 4HEPG 3T1WA 4LCUA 3LN5A 1CFSB 3S96A 1BF8A 1HILB 5EIQA 4HHAB 4OCXH 3TPKA 3C08L 1F3DJ 4WNQB 4PP2A 1XCTA 5BS0D 3QH3A 5B38B 1E4XI 4L4TE 2CRZA 3AY4C 4P9MH 4QOKE 1N26A 5D71L 3MROB 4JO4L 1T1XB 4FG6C 4WY7L 1RZJH 3VD5A 1EHLL 3ARFD 1SJVA 5ANMA 1QFHA 1RFDL 1V3MA 2NXZB 3D3VB 3UBXG 3SKMB 3T4AA 3RP1A 5IFHH 4PJHE 4PRPD 2FHCA 2KL6A 3HI6H 3ZE0F 3T1FA 1YEHH 1HHJB 3EIFA 1NKRA 5IQ9B 4MD5B 2GQHA 2DLGA 1WVZA 2FB4H 4OIBA 1SM3L 3MPCA 5DFVC 3MLVL 3O2VL 2ITCB 4ZPTB 5DDHA 3FAWA 4OKVB 2X09A 1FFRA 4M6MH 1ACYL 2VISB 4BQ9A 3P0GB 3HI5H 1UZ6F 5H2BB 2FHBA 1A6AA 5C0AD 2ZKHL 3REWB 3H42H 3QIWC 3WMSA 3VXSA 3Q2CA 4NM8L 4S1SL 3VXUB 5MENA 1Y6NR 3BGAA 1HI6B 1DBJH 2PKDA 3CDCA 4NC0B 2GFBB 2VDRH 1FO0A 2VN7A 3OB0K 2VLJD 1JGDA 2AJXH 4JFXA 2LABA 2R56L 1G7IA 4PJ8B 5EN2A 1CT8B 2BVYA 3BJ91 1Q1JH 1RK1A 4AENB 4YHKL 2A77L 1QFWI 1HN1A 1KPUB 5C3LD 2H6PA 3K8KA 1UKSA 3ZDXF 3BEVA 5F6IC 3GSUA 4NP4H 1WCQA 3EYQD 4U31A 5KTEL 1MHCA 3JVGA 3VXRE 5C9JB 3DBXB 5L2KA 5ACZB 4LLQA 3LKQB 4WI9A 1LD9B 5CEZL 2VO5A 5D1QA 4OZIE 3I84A 3ZKXB 4NCC2 4Y88A 4LSQL 4MB3A 2EDHA 4LRNH 1A1NA 2NY1C 5LGKA 2FGWL 4HJJH 1RK0B 5DJ0B 3PP3H 4IOIA 1VEMA 3TA3A 3QDJD 5GRUH 4H20L 4LP5A 5E5MA 4Y4FC 2APXA 1MQKL 1DUZB 5C0CE 1L6XA 5E2WL 2OTUA 4X9IA 1CN4A 1TCRA 1OAZH 4G9FE 4DJMA 5EFIA 5EU6E 4MQXC 4UIMA 2WWKT 3KXFB 4KVCH 2OL3B 1Q94B 2YD3A 1RJLA 1R0AL 2V7NA 5CHNB 4BQBA 1RULH 5GRJL 1IGFL 2AXGA 3KJ4C 3MLRH 2IPTL 5E08L 1YNLH 4IJ3B 3K1KC 3GMRA 5GZOC 2PNDA 1RVFH 1HIML 5DI8A 3T4YB 1B2WH 2BOCA 5I1KL 4QLRA 4BH7B 3ARTA 4MA7H 4F8TA 1QBML 4P4RB 3JV6A 4NQVB 1XEDA 4HKZA 1KN2H 1CGTA 2WIMA 1NAMH 3FZUC 1BAFL 1UZ8B 1MCJA 2MMXA 4ZUUB 4FQJH 3L7FB 2YPVL 5TQ2L 3RWDB 3TJEH 4QRUB 3MODH 3KHQA 3PL6B 2ICES 5GGTH 5F9WC 4JFFA 1CGSH 4LFHD 4Y4HA 3S88L 4ZOEA 2V6HA 5L6YH 3RVWC 4U6XA 4NO2A 1G7HB 4M9OA 3QEGH 5FHAH 5SWSE 1X4ZA 4LPTA 1OSPH 2UY7A 1JNJA 3MBEC 3TBVB 4X6DF 1IQDB 3RI5K 2GYSA 3MJ9H 4HUVA 1U3HD 5HGHA 1MLCB 2X1WL 1XGPA 1A22B 3VU2A 4W4OC 5IVZB 3L5XL 2G5RA 1NGQH 1MHHB 2P49B 1FV1A 5D9SB 3VGGA 3OKMA 4JLRB 3HE6A 1N6VA 2X89D 3BH8B 2ZOKA 3BRFA 5TFSL 4IRZH 2F19L 4Z7OE 3UJJH 5HI4D 1G6RB 3DYOA 3EZJB 2J88H 1FYTA 2EE9A 1D9KD 2CDEB 3GSXA 5CBEB 2YSSA 2VXQH 1R5WB 3QCTH 1RUAL 4FP8H 4GAYB 4ZUWA 1AGEA 4PJXA 3ZE1E 1BJMA 4D9LL 1WWBX 3GRWA 3LMJH 3TGXA 4X4ME 4HZLA 4I0CC 4DZBB 4LPUA 1FL5A 1DQQB 4OGAD 1I7ZA 2R1XA 4D0BA 1CF8L 2D7TH 1QO3A 2PXYD 2KQNA 4NZTL 3HS0B 2DQTL 3OKDA 3WFCL 4Y19A 5D7LE 4OJFH 2B20A 1FZMA 4WUKH 2Y1VA 2AQ1A 4JFYB 4K7PY 1YN7B 3RL1B 5I71C 1FBIH 4ONHB 4ZFZB 4Y5VC 5E99L 3VFWA 1NCTA 1TCMA 5ICZB 4GRLC 1E4XL 35C8H 4ONGH 4QRPA 3C60D 2VLLB 3IYLW 3L5IA 4NUGH 3RFZC 2WMPA 1FRGH 1U6AH 4KK9C 4K3DL 4KXZI 3CLFL 2VE6B 3ARED 2A2QT 4KHXL 3GUTA 3HPJB 4YDKH 4R4BB 1J18A 4LLYB 5FF6A 1OLZA 3BZEB 3V79C 3VWKC 1BZ9B 4FQXB 4NBXB 4BK4A 1KFAH 2B1HL 3HCVA 5EO9B 1QSFB 2W0FB 4EXKA 5JIHA 4NN5B 1SY6H 3NAAL 1KULA 5J56B 1XIWD 4KDVA 5DRXA 5D2NA 1KG0A 1T7VA 4XAWH 5J3HD 4OD1L 1KELL 1GJIA 3BJLA 4R90H 1E4JA 4QY8B 3HAEG 3HE7A 3HZVB 43CAB 3DUSA 2MPAL 1AKJA 3KYMA 1CL7L 4NQEB 2V5SA 3QFJB 5DD1L 1T1WA 1BIIB 2IBGA 5EC1B 4ZO6A 5EPMA 3CFDB 3TIDA 3FO2B 1CXKA 5ECJE 2AAVA 1L0XA 1ORSB 2HWZH 4XC3H 4X6FB 2FLRT 4OZGB 3MV7E 5E00A 5I1AA 1B3JA 1NGXB 1JFQH 2OBGA 3GHBH 4R96A 4JKPL 1SEBB 1FL6A 4G8GE 1CICA 4R26L 3RVUD 2IQ9L 4EVNB 2ESVD 1DBML 3CDYA 3PWVA 3KDMB 2E8ZA 2XN9A 1X5XA 5E24E 2GHWB 3E2HC 5FYKU 3LB6D 5CZXC 3IKCB 3PWLB 2HN7B 3MRNB 2Y7QB 1LEGB 3SDCA 1W2KT 5LKNA 5IESH 4JZJB 2FL5B 4YXHH 1SJEA 4KJPD 4H88L 4HKJB 5AEAA 3LSOB 4FZ8H 2PTVA 3OTTA 3ARPA 3QWOA 4PJIB 3OAZK 2V2XA 2ICEB 2X4UA 2DQDL 4DUWA 4C56B 1IGIL 1R24B 2DLTA 3LY6A 4NQCB 1YJDH 4EEEA 5JHDA 3KPSA 3UROR 3B83A 5IFJB 1P4IH 5JA9A 2RGSA 2XZCH 1T5XA 5DYOA 1NFKA 1AD9A 1JNNH 1OWRM 4X7FC 5HHME 5JOEA 2Y07H 4JN1H 4MX7A 1D6VH 5C0ND 3BD5A 3MLPA 4D0CA 5EU5A 3QR2A 4FQCH 3G6JA 4KRPD 2XQBL 4OD3H 5E2UL 2DBJA 3RNKB 2J4WH 2DQIH 1TTUA 5EH1A 1CGWA 1HH6A 1G9NC 2C3VA 3VJ6A 3RIFK 1K4CB 4AH2B 4NHUB 5I76B 1OAXL 1JNLH 3BWAB 2CJUL 1U8MB 4WWKD 1FNLA 3WFBH 3ZTJH 3DX8A 2I26N 1IC4L 2VIRB 3ULSA 1FNEA 3C6LB 3KPOB 2IADA 4ELKB 4F9PC 3ISWA 1P7QA 3G04A 4R8WL 2P5WD 4HBCL 1OAYH 1YMHA 6CGTA 4FXKA 5H8DA 4JREB 1B0GA 5IBTH 5IG7A 4BKLA 1QRNA 3KPLB 4JFEE 1JRHI 1BX2A 2HFEA 3RWEB 3QQ9D 5D1XA 5DUMH 1GIGH 2P4AB 5A1AA 4RZCB 1FNGB 1OAKH