4GMTL

Crystal structure of heterosubtypic fab s139/1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQEKPGQSPKTLIYSASNRYSGVPDRFTGSASGTDFTLTITNVQSEDLAEYFCQQYNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterosubtypic antibody recognition of the influenza virus hemagglutinin receptor binding site enhanced by avidity.
pubmed doi rcsb
molecule keywords Fab S139/1 light chain
molecule tags Immune system
source organism Mus musculus
total genus 52
structure length 213
sequence length 213
chains with identical sequence M
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmtL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gmtL01
1IEBA 4HK3J 4YDKH 1YEKH 1LNUA 3FMGH 3PDGA 1OGAB 1I75A 2CRYA 2YOCA 3B2UD 1FZKA 1I7UA 3P4MB 4NQVB 5HHNA 4BZYA 3HFML 2CR6A 3RHWK 3VI3F 3EOAB 1D5MA 1HE7A 2FO4A 2BNQB 4QEGA 4P46C 5DGQA 2XTJC 4OCRH 4BELD 5D70H 2EKSA 5KZCB 3LPWA 1I4FB 3MC0A 2VLLB 4U7SA 3ARGD 4F15C 4JRYE 4IHOA 3I3BA 3OV6A 4QXGH 2H2SD 1A9EB 1I8LC 2BY2A 5D72H 3EJJX 4LSPH 4UDTA 4D9QE 3MCG1 1NMBH 1B6DA 2VRAA 3EOBB 3GK8H 3UTZB 4HBCL 3VH8B 1A6WH 4JM4L 3VRJA 5AD0B 3EGSA 5C0DA 2CO7B 3RDTA 1QFWM 2NNAA 4OJFH 5HVHC 2EXWD 5JR1H 1EAPA 1R0AH 4IIQA 1K4DB 3OTTA 5E08H 1Q0XL 3OZ9L 2QEJA 2V9TA 5BZWB 5BV7C 3ARBD 2DKMA 2QQKL 4QRRD 3SQBA 5I1HH 2V7HA 3CPLB 1DVFA 1G7JB 1HEZB 5ISZE 4JRYB 5FGCB 3NPSC 5ESAA 3RPKA 1A5FL 4XGZB 2FL5B 4XBGB 4X6DB 3VI4E 3FONB 2HRPL 1IC7H 5K9QI 4DVRL 1IGFL 2XOTA 4PGBA 3SO3B 1WT5C 2ZP0T 3MNZA 2Z31B 1ULVA 2BERA 1I1FA 1G0DA 1I9RL 4N8VB 1GGCH 3O9WD 4YQXH 3S37X 4HJJH 4D9LH 5HYJB 1AGCB 2EH8H 3AY4C 4ELKA 3LKSB 1F6FB 3SDXF 2COQA 4HWEL 1GZQA 5DR5H 1FV1A 1YUHB 5FB8B 5LGJB 2YPVH 3S36H 3TGXA 4MQ7A 1SY6A 2FB4H 1G9MH 5ISZA 5ICXB 2RHEA 1AGBB 4OM1L 4YNYA 5BVPH 5C0AD 3ZL4L 1NL0L 4GAYB 5AUMA 2XZAH 3RKPA 5A40E 5JXED 3BP5B 3DMMD 3F12B 3KYOA 3TPUB 5IR1B 3L3OB 3B9AA 4PJGB 3O6LL 3VWKB 1QO3B 3SE4C 3WD5L 4N1HB 1NMCC 4JPVL 4X83A 3ZLQC 4MVBD 5GSVB 5DMKB 4IRJD 1ZHNB 3UXFA 1OCWH 4YDIH 5DD0H 4IRSB 4BH8B 2YXFA 3VRIB 5I9QC 5CD5D 2PNDA 3W11D 1P69B 3DUSA 4TUJB 5CEXB 4QXWA 1KCSL 5E2WH 5ESVA 4HWZA 1FH5L 1CGTA 1FNEA 5MEQB 1RZFH 3O2DH 5CJOH 1SM3H 2GQHA 4XNUL 1BQHB 2JJSA 2HJFB 1ZT7B 3GHEH 4Z7VE 5C08E 1YEJL 5TQ0H 4JFXB 4K23L 5DSCA 1HKLL 3WXVL 2B2XL 1ADQA 3S7GA 4F7PB 1FNGB 2A73A 4FFVC 4K3EH 1YPZE 5DUBA 1NFKA 3T0EC 2MNUA 35C8L 5E95B 4ZUWA 4I4WA 5IV2A 5A2LH 2XZQL 5F9DC 2CLZA 4NWUL 4YE4L 3L3IA 3TO2A 1KELH 1YEFH 4WDIB 2XFXA 4AG4H 2WQRA 2MKWA 3QQ4A 2AXGB 3MXVH 3OKKB 2R4RH 2HJKB 2X4OA 2P8LA 4OUUA 2FEDC 4H8WH 2J88L 3QO1A 3T8XA 5L0QC 3GRWL 4G6JH 4AJ0A 1MQKH 1YYMH 1B3JA 2AEPH 2XRAH 3ULVD 1DQML 3J8F7 4Z7WB 5C07B 3S4SG 2VLJD 5C08A 2M2DA 1KJ2A 3BKCL 1WEJL 2D7MA 2K9UA 1J0JA 3PF2A 4Z7VB 1DN0B 4URTB 12E8H 3QEQE 3RVVC 3WYRA 5KW9H 4RA3A 2VSCA 3DNKA 5DVKA 1YPZA 4RAUB 5D8JH 5HHME 1JIBA 2D03H 1UJ3B 1A22B 3F5WB 4PJCE 4LLYA 1EGJA 1B9ZA 2IALB 2X4NA 5F9OH 4MB5A 4MS8C 4V2CB 5E9DB 4NRXA 2J1KA 4IMKA 2JJWA 3CFJA 1EO7A 2NLJB 5F7NC 4XVUC 1RMFH 4GRLD 3VA2C 1TZHA 3NZ8B 3OR6B 5IM7A 4QWWC 1GOHA 2A74B 5FGRA 4DTGH 3U7WL 5L2JB 2OI9B 1MCRA 2WWMC 5JW3H 2FR4B 5DTFA 1JZ7A 2EIBA 5T5NF 4Z7QE 1VADA 2NPLX 1D5IH 5C0GB 5HYSA 1VFBB 4G42A 3QEQA 5HGHA 4R2GC 4LKXB 3IT8D 5HYSG 1YJDC 4S1QL 1V7NL 4JO3H 2GIYA 2P46B 4P4KA 4UTAL 1D9KD 1P4LB 1RULH 4PJCA 2L4OA 1XZ0A 3U2SA 2R1YA 1JUFA 1G9NL 4MNHA 1WFOA 3TV3H 1S7QB 4BZ2L 3WS6A 1YMMD 4QHKI 5C2BH 2E8ZA 2ZCLL 3DYOA 3TVMB 2I5YL 1DE4A 3M1BA 4P5TB 1FFNB 2WINA 4LK4A 1QG3A 3DSFL 2GK2A 4G7VL 4QGTA 3BVNB 4X98A 5B39G 1KPUA 4WO4D 3QPXL 3DECA 4ZAKA 4KFZC 3MLUL 5FOJA 1BVLB 4TUKH 4JN1L 4MDJA 2J4WH 2MQ0A 2YA1A 3KNBA 2DM7A 4KPHH 1U8IA 4M1DH 2DMKA 3MJ9H 4V1DB 3VXSA 3W9EA 5IMLA 2D2OA 2PXYA 1J1PH 4KXZI 4JFOA 3CC5B 5LKNA 2Q86A 3PWJA 2EE6A 1HXMA 3BGFC 3IJHB 1OD9A 2Z93B 4BM7A 2V6HA 4LARL 2V2WA 5IGXH 4OBRA 3TN0C 4G8IA 4PJ8A 3AB0C 4YDLC 4KDWA 4ZXBC 3ULVF 1T7WA 3OKNB 2BVOB 1F00I 1TPXB 4F7TA 5IHZA 3GMOA 1DBKH 1GAFL 2DQDH 2OR8A 5CSGA 1CGVA 2QHRL 4ODHL 3QUZB 1M6OA 1HHIA 3CVIL 4XP5H 4ZFZB 2NX5B 2GUOB 5DWUL 1WFUA 3CFIC 5GGUB 3TO4C 1T6VN 3A6CL 2AKRA 2Y7QA 1I9EA 1G7LA 3ZYOA 5IFJB 3HMXH 1MIMH 3GHBH 1YECL 3ARFD 3QI9A 3CZFB 1BBDL 4P3DB 2F19H 2Q76B 3MCLH 3HZKB 5T1KA 1T1WA 5CJBA 2HG5B 4GKZA 3U4AA 4YC2B 4P2RD 4I3GA 4HIXL 1PZ5B 1AQDB 3GMPA 5IVZB 2DYPA 3IJSA 2CGRH 2WP3O 5T1DL 4LAQH 5DEFA 3LEYH 4EI5D 2BSED 2P24A 4I5BA 4ZPVB 5KS9E 1EXUB 1WBZB 4OLWH 1FP5A 5CZXD 4OZFB 3AGVA 2Y72A 3V7AG 2VDNL 5DJDB 2Q6WB 1C12B 3KR3L 1P7QA 2UY7A 4GRWB 1FORL 4DGYL 1J5OL 3CXDH 1LEIA 2DDQL 4S2SA 4PJDE 3L5WB 3PWVA 5C8JB 4NNYA 2JB5H 4RFNB 2CD0A 3MUGA 4PJFF 4M61A 2XV6B 2PO6B 4HT1H 4NJAL 2ATKA 3U83A 2J3SA 2YS4A 4H26A 4F80A 4WNQA 2ADIA 2X4QB 1W2KT 2NY7H 4QHLB 5EU6A 3TT1H 4XB8A 4JO2L 1QPXA 4L8BA 1RFDH 1U0QA 3CJJA 4JM2D 4NQCD 5KTEH 1QBML 3OJVC 1OVZA 1R5VA 1U2CA 5KS9A 4NFCA 5JXAL 4D8PA 4MQXD 4P23C 2IWGA 2NZIA 3V4VL 1TLKA 2OL3B 2X5PA 3MA7A 2BRRL 4R26L 1FPTL 4HAFA 5IQ7H 5F3BA 1A7OH 1F5WA 3OWEA 3T09A 1VDGA 3MRNA 4IJ3C 2FIKA 3Q5TA 4LCWA 4ZPTA 3NMEA 1E6JH 3QXAB 4S1DD 3LD8C 1OAQH 2OL3L 4FOMA 1XGYL 4PJDB 2BJML 1CLCA 2P8MB 2QTEA 2QADD 1EERB 4DGIH 1NGXA 1Q9LB 1JN6B 5I74B 3RI5F 5DK0A 1F6AA 2GJ6E 2YZ8A 5T3XH 3C60C 3WSQH 3HZYB 4HPYL 4B53A 4W70A 4HWBL 5ENWA 1QFOA 5I0DA 3Q3GA 4YJZL 3QCUL 4ELME 2FSEA 3HE7A 3QNZB 5LQBL 5D6CA 1ZLWK 2D7TL 4WFGE 4Q7DA 4QRSB 2R69H 5DD5H 4ZUVA 5ADPH 4KK8C 5ITBL 2DOCA 5FCUH 3CMGA 3U0TB 1B88A 1RUPH 4I0CC 1HHJB 1YA5A 2WAHA 4CAGA 4I0PD 4YGVB 5I1DB 1BLNA 4EUPB 3ZTJH 1FFPB 4K8RH 2YSSB 2D0GA 1PYWB 4RBPK 2YUWA 1R3HA 4O02L 1GC1L 3MRIA 2BC4A 3JV0A 1I7ZB 4G43A 4I2XB 5DHYA 1A21A 1DL7H 1NC2D 1X9QA 1FO0A 5FKAB 2I9TA 3O6FC 3AREB 3MRFB 1FLRL 1T1XB 5HYEA 1R24A 4LNRA 1NAMB 3V8OA 2GI7A 4YUEH 4RMWA 2ZCKL 3I3DA 5SV4A 5JW4N 4ELMA 4I77L 1WZKA 3SCMA 3FAXA 3MOQA 3SGDI 1JRHL 3O6MH 5D1ZA 4D0DA 4NYLB 6FABL 1NAML 3V6BR 4XCNB 1EPFA 1J0YA 1HQRA 1EEQA 1F4YH 1YEEH 3QPQC 4D3CH 4FABL 1ZANL 4LF3B 5F88A 3ECBA 4DKFL 4X4XB 4BJLA 2SEBB 2AV1B 4AH2A 1S7UA 4KZEH 4F2MB 2VO5A 1NCWH 5E03A 5IFAH 4YHNB 1ONQA 5T33H 4HLJA 4UNTA 3KJ4C 3ULUL 3QEGH 5EOTA 3DBXA 3RZCA 2ZUTA 3QIUA 1ACZA 5CFHA 3G9AB 4M62H 1FSKB 4KUCD 2Y07H 3MREB 3KYAA 1GGYA 1C8PA 2CDGB 1CICC 3MYJB 4JM2F 5DHVA 5EOQL 4KRPC 3MACL 4ZYKA 1K8IB 5C1MB 5F1IB 3W39A 3O3UN 2MCPL 3VXRE 3HNVL 4X4ME 2ORBH 1BPVA 3NABH 4M1CC 4PTUA 4XMKL 2ICWJ 1ZT1A 3FZUC 4XCCL 3PL6A 3DRTA 1F3DH 5HGDA 3CDFA 3HCVB 1ZLVH 4JFEB 4R7NA 4WFHE 3C6LC 3M17B 5AG9A 2N56A 2ZOKB 4ISVB 3LV3A 4U1NA 4JHBA 4G3YL 3ET9F 4KJQD 3C2AL 4G6AD 4X5WB 3CDGA 3QUYB 1PY9A 4BQ8A 5D7LB 4MJ6A 1DEEB 5FO7B 1F3JB 2DQUL 3KJ6H 3JUZA 2R0WL 1W8OA 4N5ED 4QT5B 2FRGP 4KI5C 3BQUA 4NQXB 5FUCE 3VXRA 4ZAKD 4X4MA 3PWPE 5GHWH 3BE1H 1QLRB 2B4CC 2ZUQB 1OT1A 1S9YB 1LEGA 3GMRA 5IBLD 4LHJB 4KKLC 3ZE2E 1OF2A 4LGPB 2X40A 3QEUB 1BFVH 1X4ZA 1V8HA 1SEBB 4LL9A 4MD0B 4NNPL 3ZE1E 1JL8A 4HUXA 3WV0A 5JDSA 4N0YL 5J6HB 3QZWA 5C0RL 5KSBA 1WCBA 4X8XA 2ICWA 3O11A 3L95B 3D39E 3O8XD 4JO1L 4K9EL 5I1EH 1MRFH 4APQD 4OGZA 3BEVA 3HE6B 3RUGE 3UO1H 1A1OA 1I3RB 5ALCL 2E27L 3GJFA 3MLVL 2C3VB 2OTPA 3IDXH 1HXYA 5DFVC 3PWPA 3T0BA 2IAMA 4YFDB 1U58A 4P2QD 4Y4FA 2CSPA 1T04B 3IRPX 1FBIL 3N1QC 5BQ7A 4PJXE 3IDNB 1AO7B 2J6EL 4FXKB 4KKAC 5BV7H 5JW4R 2B1AL 5CINH 4DN3H 3SDXE 1UM6H 3RDTC 4JZOB 1KT2A 3NACH 4UOW0 3WFCL 4NQTA 5T1KD 3OJDB 4KUCF 3BP6B 5F9WB 3U6RA 5I1GH 2EYSA 1RIHL 3D39A 3MBEB 5I16A 4XAKE 1HHGA 5CHNB 3RUGA 4U33A 5T1LD 2IH3A 2KQNA 3MRBA 3SY0A 5IB2B 3N9GL 2DWDB 5D6DC 1OARH 4FG6D 4UB0H 3QG7L 4LSRL 4OLYL 1E6OL 4L3AA 4PJXA 1EK3A 1Q0YL 3ZTNH 2EO1A 3VXQA 3NIFF 3SO3C 3EJZD 5IJVA 2B8OT 5T3ZL 1MHHB 4RFOL 5E4IA 2X9WA 4X6CA 4Q74A 2BXZA 5EC1A 3SDXB 5F9JB 3VD5A 3EZJB 5EU6D 5LBSH 3HUJF 4N0RA 1CT8B 1W0VA 2VXSH 4MNGE 4NQED 5F6HJ 5LAXA 1RK1A 4ODXB 4OGAD 4K94C 4N68A 2D7OA 5I6XC 3GMLA 4P2OA 1ERNA 4MXQC 4XPGL 3T2OA 3KPSD 1CZ8L 3V95A 4NWTL 2DLGA 2XWTB 4E5XB 2WLYA 4PRBA 4GMSH 4HZLB 4U0RB 1FE8L 3NIGE 4JPIA 5DEGA 1AGDB 4LCWD 5CILL 1G7PA 1FRGL 3Q5YA 4L29B 5TE7L 2HFTA 3MXWL 2VE6A 4OFVA 3BZ4B 1CFSA 5IT2H 4Y1AA 4PY8J 3VFNA 4IRSC 3X17A 4JY5L 4C83A 4MNGA 3WHXA 2F5AL 4YXHL 5EU4B 2EYRB 5AYUL 3FFDB 1T22A 1JZ2A 1DLFH 2VKWA 4M5YH 3EOTL 4LLVB 1HHHA 5IB3B 2AJZA 1HZHH 5H35A 2J8HA 1I3UA 1A14L 4U31A 1XGRB 4WW1A 4F3FA 2CQVA 3S88L 4ORGA 2A6DB 4LCCB 1UG9A 3NCMA 5IOPA 4YHOH 4QF1B 4BFBD 1RUAH 4UIMB 5IQ9A 2JJSC 3H9SD 4ONFL 4LNVA 4DGVL 3K2UH 4CVZA 1NDMA 5GS0D 2E6QA 3FT4B 4OKVA 1PAMA 3V52L 1NAKL 2CK0H 3PWLA 4HF5L 3ARBB 1RD6A 4RFEB 4BA8A 4P2YA 4QRRB 4NKDB 3WDJA 3CUPA 4H5SB 3WFBH 3LKOA 1QLEH 3I9GH 4FQJL 1J0ZA 3O3DB 2ZCHL 2PYFB 1CGUA 2QR0A 3U0WL 4QGYA 3GSNH 3HI1A 1SBSH 3C5ZA 1QKZH 1HCVA 1QFUH 3FHAA 5I8OH 4IOSD 1KNOB 5FHBH 5J3HC 1JE6A 4PUBL 2B1HH 1JGEA 4L4JA 2OP4H 3O9WB 4HH9A 1BM3H 3STZA 2GSIA 1A6UL 1R6VA 4QCIB 1JGDB 3OHXA 4KK5C 4PFEA 4DZBB 2QQLL 4QHMA 1UJ3C 1KB5A 3QIUD 5BZDA 5D7KE 1EJ6A 4JHAH 3ES6A 3IGAA 3IDIA 2ICWI 4V2BA 3LVEA 1ZVSB 4MD4A 1ZHLA 2ID5A 3RGVA 5IJKA 1HH9A 5B4MD 5C0AB 3I6GA 1P4BH 1KLUB 4KDVA 2VDPL 4TUOA 1MH5B 3TA3D 3VG0L 1YJDH 3NN8B 5GQBA 1MHPH 5EBWA 4PGZA 2OI9C 3VFRA 2HFFA 4O9HH 7FABL 2WIIB 1S7SA 2IMMA 2YPLE 5C0FA 3O4OC 3QDMD 4G7YL 4NN6C 1BJMA 4TNVF 5LVEA 1M7XA 4NKQB 2BDNH 5F97E 4DK3A 4IRJB 1JP5A 4XVTL 2WLZA 3RA7H 3WS3A 4CUCA 2H26B 4XP4H 4MQSB 5CZVH 3P30H 5ICYA 2VZVA 1AGFB 3HI5L 4OM0H 2UV3A 2I25N 4Y2DD 1CBVH 1UQSA 5DMJB 1KJ3L 2X4RA 3QQNA 4Y8DC 2C4FT 4XNMA 1CTNA 1UXSA 5EO0A 5FGBC 4MJ4A 1TCMA 4JDVA 4AEHL 4NM4H 1A3QA 3FO0H 3FB7B 5HYQB 3TVMC 1DANU 1F4AA 4OFYA 4HV8B 4P5TC 4WJ5A 1VESA 2PTUA 3K4AA 3T3MF 3X12A 4WU7B 1BVKB 1AI1L 1UB6A 3MRCB 5FF6A 5CIPA 3LRSA 1JHKH 2YPLA 4FZEL 1T7YA 2VC2L 3MRJA 1HSAA 1XT5A 1Y6MR 1IKFH 2RR3A 5I76B 2OTWA 4GAJL 3RNKB 2ARWA 1WTLA 3G5YB 3GMNA 2UUDH 1TVBA 3C6SA 4WV1A 2C1PB 3HR5B 1N59A 4O4YH 1I8KB 1INEH 3OR7B 3KPLB 3TYFA 2W1NA 2WBJA 3CSPA 3C8KB 5IFHL 4PJ9D 5EZLB 3PV6A 2O61B 1NGZA 5KSUB 1HKFA 3BDBA 3TLRA 4B0MM 4UILL 1L9NA 2VLJB 1TNMA 4LASL 4WTZA 5I15L 2P45B 1L7TL 5FV2A 5FHAH 1A4JA 4ENED 1G7IA 1CLYH 1KOAA 1J1XH 2P1YA 1SVCP 3ULVL 1WLHA 1U9KA 1T2QL 3BPLC 4PRHE 3SGEI 5IBTH 2ZSVA 4G6KL 3WIHA 4WCYH 2ED9A 4N1EA 4GLRH 2P5EE 4M7KH 3QUZC 5IWLA 1D6VH 4XPAH 1J12A 5D1QD 3DURB 4OIAA 2QL1A 5HPMA 2PETA 3RQ3A 3ZKND 3V7MA 2RCSL 4GXUN 3ILPA 3NCFB 2FJGB 4HGKC 4MNQE 1GHFH 3RKDC 4GRLB 1PQZA 1RIVL 4I3RL 3SDAA 4PYHA 1GGIL 5DXWA 2DKUA 5EZOH 4G80B 2NY0D 4NJ9H 3FT2A 4NUGL 4JZJA 5I19H 1JV5B 4YC2C 3MGOA 3MLSH 4GS7B 1CLZH 5M94B 5HJ3B 1PX3A 1KXQE 4PRHA 2QSQA 3QUKB 4X6EA 1RVFL 1N5AA 4O5LL 2NXZD 3EYOA 2N1KA 1YEDB 5E24E 3FCTB 1D9KB 1LILA 2XI9A 3RL2A 5CBEB 2CLVB 3CDCA 4XZUB 2UYLB 4CVXA 4PJFB 1NLDH 3V5HA 5DD6A 1FYHB 2MQ3A 5JTWA 1YMMB 2R4SH 1U8MA 4MNQA 4E0RB 2JJTC 5EORH 3EO1A 2DJUA 1UWGL 2PO6C 2XPGA 1L7IH 2IGFL 5FYJU 1WIUA 2WBWB 3BN3B 5FA4A 4ETQB 1P1ZB 4BSWA 5E2VH 5JNYB 3TBYB 1KIPB 4XMPH 4WO4B 3VW3H 2W0FA 2AVGA 5ACZA 2BNRA 3PGCA 3RHWF 1CDGA 2P48B 1T20B 3REVB 1I7UB 1ZHBA 4HUUA 1VA9A 3IFOB 4LP4A 4LSTH 5FYKU 2FWOB 3BIKB 1D5MB 4G9FE 4HWNA 3CD4A 5FYLD 5E4EB 2WUBH 2FO4B 3TBWA 4A6YA 4NCDA 3VXPB 5EZIL 1A4KB 3UTPD 1J7VR 1F02I 5KSBF 1ZT4A 5EC2B 3CH1A 3IRZA 2HJLA 3UMTA 1OAZH 4L5FL 4Y5YA 4IHOB 2BP3A 3OKDB 4IRZH 2UZIL 2VOTA 1N6UA 4OD3L 5DJCA 1DBAL 4UMGA 1OTSD 5I74C 1DFBH 4PJAF 1N4XL 5E8PB 4LEOB 2XN9D 3HPLA 4PGEB 1CFTB 5H94A 1AIFB 5K33A 2X4TA 1S5IL 3TJHC 2W9LA 1TZIA 4FNLL 5I1KL 3HE7C 3KWWA 4L8DA 4O58H 4G9FA 1GC1C 1KJVA 5DVLA 1TETL 3MTRA 4YHZL 1MCPH 5C0ND 4OV5B 1VGKA 3ARFB 4LDLB 5JW4M 1FL3A 3ARTA 2J2ZA 3BEWA 1OWRM 2B7DT 4LLAA 3ARDB 1ZLSH 1LDPH 4U6XA 2EDXA 3RVTC 1IE5A 3X3FL 3LZFL 2EYTB 4P2RB 4JLRB 1NBYB 1RU9L 2ADFL 4NQCE 3AREC 1RJZA 5ITFA 5JHDE 4PREB 5DJAB 5DRWB 4E9LA 2F15A 4HXAH 3O3EB 2V7NA 1TTGA 4EI5B 2R23B 3QXTA 5IROA 3C5ZD 3LSOB 4HCRH 3T77B 1SYSB 3MV9E 4FQIL 3UAJC 1DJSA 2YC1B 1RUML 3SCMC 2AK1H 3QIWA 1D5XB 4K71C 3WKML 3S34L 5GZNC 3LIZL 1MFCL 3GMMB 4JDZA 2F8XC 5EUOF 2GJZB 3CFEA 5BO1L 2GK0A 4RISH 4ELKB 4DVBA 1AFVL 1DQJA 4F57L 3SGKA 1MRCL 1HSBA 1SJHB 3KHOA 1FFOA 4NHUB 5I1LB 3U48A 5I1IL 1OAYL 2F53A 2ZG1A 1WWAX 3DROB 4J6RH 5JW4Q 1DLHB 3SDYH 3HC0A 4NCC1 5HI5C 4F8QA 3ZDZE 3OPZL 5JHDA 2VZ3A 4Y4KD 3TBSB 4JM2B 3GSOB 1CDUA 4QXUH 1FSKC 4NQCB 3PABA 4Q9BA 4QY8B 3ILQD 3MR9B 4JFFD 3FTGA 4S0SD 1IM3B 3MV9A 2BVEA 1KIRB 4PP1D 2QSCL 1Q9OA 3VE0B 5JLZA 2A77L 5FYJH 3JV4A 4YBLC 3DJ9A 5C0EB 4Z76A 5SV3A 2Z35B 2VDOL 3HR6A 4TSCL 1MJJB 3H9HA 2QADB 1EHXA 5H2BA 4G5ZH 3VFVA 1EVTC 2LVCA 4QYOA 4R6UA 3FB5A 4UINH 4EVNA 3KPOB 4FQQB 3PL6C 4OCLC 1FNEB 4XRCA 4P99A 1PGRB 4FQ2H 1SYVB 2EC9U 3E3QE 1P5VA 5HVWA 5IVNA 1XH3B 4MB4A 5EUKA 5B8CB 2B4CH 2HH0L 2LU3A 1ZTXL 3HFMH 1ES0A 1OAKL 4JFHE 4QRQA 3TZVA 3NFNB 43CAB 1AD0A 1FVDA 4I0PB 1HQ4A 1FVCA 1T89C 3QUMB 3U46A 4RCAA 2WUCH 4B7IA 2BSRB 2L7JA 5HVGB 5E6IA 1WAAF 3AXLA 4FQXA 3EDKA 4DK6A 3GSWB 3WJLA 5A2FA 4BYHA 3QUML 2D4FA 4U6HA 1G7MB 8FABA 1NC2B 5JOFB 4PD4J 3UBXI 1LGVA 3VXOB 5BMFH 4RAHA 3WLWD 1P7KB 2FGWH 2X4OB 3D3VD 3LKNB 4K9EC 4DW2L 4KVNL 1CQKA 3QO1B 4JM4H 2DIJA 3FB8B 3S4SB 4XXCC 3K2MC 3VMOA 1MFAH 3AAZB 5DJ0A 4ZNEE 3D18B 5CUSL 2NY6C 3W2DL 4W81A 5HDQL 1PKQE 3LQZA 4AIOA 5DO2D 4HUMB 1JNLL 1OOAA 5C09D 1Q0XH 4Y4HD 4BFIB 1MREL 3RWCB 1JYXA 2QQKH 3JZ7A 5TJWK 3BRDA 4Y7MA 5IEKB 4ZTOH 5FUCC 3CVHB 4K07A 4MX7A 4Z7OF 3LN5A 2VABA 1IFHH 3PGDB 3ZE0F 3QAZB 5GGTL 4C57C 2IAMC 5MHSD 4M7LT 1RZIB 3L5JA 1N8ZB 3CFJB 5I75C 2H3NB 2Y4SA 1NCBH 3CVHL 4HIIA 2IFFL 4HUWA 2A6KB 4X7TB 5K59E 5E2TH 1QACA 2W0LA 1AJ7H 2PCPB 3D6GA 3LDBB 5KVFL 1I9RH 2BVPB 2X1XR 3TEUA 5GPRA 3DRQA 5E00B 1Z9MA 1FZJB 4LSQH 1CLOH 1PKQB 2APXA 3K46A 3KLHC 2Q8BH 2XKNB 1WWCA 4HWEH 4NO3A 3D0LB 2E6PA 4J4PA 3P40A 3FQNB 5HGAB 4H0GA 2DQGL 4FFYH 4R8WL 1YC8A 2YK1L 1ZSDA 1JZ5A 1YN6B 1XZ0B 3KPNB 3U2SB 1FCCA 1BZQK 4KMTL 2KKQA 4MNHB 4OM1H 4KXZH 3DX7B 4WI5A 1C7TA 4D94A 4X8JB 3GEWB 5E94A 3IDMB 1NL0H 4K94H 4WHTA 4JREC 1IAOB 2ZPKH 1Z2KA 1P5UA 4O51B 2VB5A 5HHPA 3HUJB 5B39B 1JNNH 4DUVA 1DQLL 5D7IE 1SY6H 3VXUE 1B90A 5IBUG 3WD5H 5DRNB 5HI4C 5B38B 1DTUA 5DS8B 4OAWA 3MO1B 1U42A 3PIQB 5C0BD 5D1XA 3VDBA 3F62A 2IAND 1WV7T 1MY7A 4HUVA 1DDHA 3MV8D 2OTUA 5D2NB 1U8OB 1KCRH 1XF4A 3HZMA 4P2OC 1IMHC 3W9EB 3PGFH 4GAGL 4OBSA 2NR6C 1K5NA 3QWRD 4OIIL 1FH5H 3SKOA 5DK2A 4MCZB 2B39A 3QHFH 4U0RC 1LP9F 4XNUH 3TP4A 3L1OL 2X9XA 5DT1H 15C8H 3GB7A 5MEOA 2P47B 3FKUS 1BZ9A 3RU8L 5F44A 3HG1E 3O8XB 4ONHA 4K23H 1MEXL 4F37K 1HKLH 1NFDF 4WHCA 1FG2A 2ZKHH 4APQB 4ONGH 2PW1B 5D7IA 2FHCA 5DJYA 1UXWB 3VXUA 4JDTL 2CLRA 1JFQL 4LLUB 1B2WL 4ETYA 4KY1L 4OV6F 2BHUA 4XCFL 2G75B 4NWUH 1URLA 2ITDA 1IGTA 4YE4H 4ZUTB 1JGUH 1HHIB 1LO0L 3MV7D 4P2QB 1EBAA 1ADQH 1MUJB 4U1GB 2NTFA 1G7LB 1OB1B 3H3PL 5F96L 1QRND 3GGWA 4LCCC 2R0LH 2J88H 4QRUB 3I50H 1DBJL 3EBAA 3P73A 3QXUA 1MVUB 1ORQB 2ARJB 2X4PA 4E41A 3IDJA 4HS3A 1UKTA 4CU6A 1DQMH 2DQHL 3PNWA 5CGYD 5T1KB 3VGDA 2R2HA 4NO0D 3CFDB 2X70B 3BKCH 1D7FA 3HG1A 3BFOA 5BVJB 3ARBC 4FFZH 2H45A 2OM5A 2D9CA 3EYFB 1MFEL 1T03L 2OZ4L 5T1LB 2OR7A 3QFDB 1VACB 2Y5TA 3HZVA 4X4ZA 3M07A 5KANG 4EIZC 5GGRA 1LK3H 1KJ2H 3VGAB 3DO3A 3RVUD 1YEGH 3UTSD 2R29H 4Y16D 1CGWA 3ZYZA 1QSEE 4OLZL 5JPNA 2ZOLA 5ACLA 5IMOA 2HN7B 4NNYB 4ZFOA 1UCBH 3U4EB 2P42B 1ZS8B 5JW5B 3WXWH 3VJ6B 3A6BL 3O9WC 3U7WH 4W4OA 4H26B 3SJVD 1VPOL 2M1KA 3BMVA 3CFCL 2EC8A 2F53D 4HKJA 1TJHL 3BZDA 1EH9A 1O5DT 1EZVY 3P9LA 4NQEB 3QG6A 5INDB 3A67H 3LH2L 2HT2C 1IAKA 3QNXB 5E1AA 3SN6N 1NDGA 4FQHB 1GH7A 4N9GA 5EA0L 3SKJL 4JAMA 4S1QH 4D8PB 2J8UF 4JFPA 3KPSB 2DTML 1VCAA 3VFWB 1HILA 3VFPB 2DAVA 5IJKC 1JWSB 2GY5A 1I9IL 3U1SH 4BZ2H 4OGXH 2V5MA 2IF7A 4LLMA 4LCWB 3UYOD 1QSEB 5HDBE 1LWRA 1L9MA 1EBPA 4XPFH 2X2YA 3PQYA 1INQA 3B9KD 1IM9D 3IF1A 2X1QA 2BMKB 4G7VH 1XF5A 5J89A 5DK0B 3EDJA 2VL5A 4GW4A 4HGWA 3GO1L 4LLWA 3MLUH 1Z5LA 1INDH 4WWKA 2CIKA 2NW3B 4NN5C 4Y0GA 5JPMB 5I17B 1D6EA 3H2WA 1IAMA 4YDJB 3TZVD 1YYLL 1F11A 4WI7A 2FATL 3SGDH 4R4FL 3RBSA 1M7IA 4RMUA 1WBXA 1HDMA 1MLCB 1NGYA 3H9SB 4TTDC 4JZNA 2O5ZH 2NY5H 3JVGA 2BNUA 3RBGA 4GRMB 1XGPB 4PRPD 1X5IA 1CI5A 3GSXB 5F3HA 1FO0B 2DLHA 1I8IA 4MHHG 3DVNA 1Q9KB 5DLML 1UM4L 3HI6L 5GS0L 5D7JA 3NA9H 5FO9A 3O3AB 3MRLB 4L3EE 4PRID 2Z91B 3MLWH 4LCYB 5IB1B 1FO0L 2ZUXA 4WV1C 2XG4A 5DWUH 5E8NA 4QNPF 3L3DB 3MOBH 1H3GA 5CMAB 3LRHA 3ZKSD 5HYIA 4LPWA 4HIEB 2WBJC 4PR5A 5FECB 4GXUM 1YECH 3CLFH 1X5YA 3BZEB 4QRTA 5LCVL 3VD4A 4WVRA 1NCDL 5F88B 3SKMA 5I8EA 4NPYA 1YEIH 4K7PL 5KVEH 4ODTL 4LKCB 4XT1C 3HPJA 1TDQA 1MFDL 4QTHB 4X6FA 3QIUB 1MQ8A 2GTWB 1CE6B 1TENA 1Q1JH 4FTVD 3WO4B 3UTOA 1N64L 4L3EA 3VRLF 1A6TA 1SMAA 1WUNT 1M71B 4XHJC 4Y5VB 2JJUA 1J5OH 4GRLC 3UYPA 5FDYA 3QRGH 3TA3B 5DMIL 2OK0L 4S10A 4WFEE 4Y5XA 4Z7UF 1IGIH 4JGUA 3SDAC 4AM0A 4GG6E 4MA3B 1RJLB 5DQJB 1RZJL 4J4PD 1N3NB 4GS7C 3QDMB 3SE8H 4ODSL 4Z8FL 3KYMA 1BECA 1MCJA 2AJSL 4LSSH 2CDEA 3UTQA 1ED3B 3RY6A 1XCQB 1T66D 2EH7H 1JGLH 5FKPA 2AJUH 3UZQA 1QBMH 1U8NA 1D9KC 3ARXA 2CXKA 1LE5A 2DQIH 4ZMAT 5JXAH 4Y2DB 1BGXL 4MJ6B 5I71B 3V4PH 3RZWA 3P4OB 3V4VH 2BRRH 5IF0A 2MKLC 1UEYA 3MCKA 2F74B 1XF2B 3GI8L 3WFEH 4GUPA 1QA9B 2NY3C 1X5HA 1WZLA 2IG2H 5ID0B 3GBLA 3TNNB 1XGYH 4GG6A 3BKMH 5F1NA 4RIRB 3GMRB 1RI8A 1OF2B 1X7QB 1S7WA 4OGYL 4WTWA 5F6IB 5E6YA 3QNYA 3FQUB 1UZ6E 5EO1B 3PWNB 5JO5A 4O2FB 3LKQA 5E4EC 1CU4L 1T5XB 2GY7B 2D7TH 2HT3D 4N0FA 4NZTH 1I1AA 4PLJC 4UU9B 5E8EA 5EZJB 1NGWA 3BIAX 4PLKC 3NCYS 5HHVL 4PJ9B 4NT6A 3D0VA 5C3LD 5MEPB 2EDNA 4YR6B 4POUB 4PJEE 3IU3B 4PJAB 3UZEA 1ZGLB 3NAAH 4XTRC 4ODUB 4EDWL 2DLIA 4O02H 1YQ2A 5A2IH 3ULSB 3HC3L 5K9KA 3FN0L 3C08L 2Q7NA 1NCAH 1ZA6B 4PJIE 3O0RH 1K8DA 1NBVL 1FLRH 2YD4A 3RVWD 5D1QB 2R0ZH 2H1PH 3G04A 1A0QL 4YDVA 5TF1H 1EHAA 3ZHKA 3V5DA 4M93C 1EEYA 1KEML 2ZJSH 3FB6B 4NZUL 4X7SH 4I77H 43C9A 3VXTA 1G7HB 4EN3A 3ARFC 1FL6A 3T3PE 3X13B 4PB0L 3OKOA 1NAMH 3VCLB 1B4RA 4AEEA 4GMTL 1JPFA 4DZ8A 1R3JA 3UYRH 2BOBB 3ARDC 2PW2B 2NY0B 4FABH 3FRPG 1JBJA 1ZANH 4MCYA 1RPQA 3MUZ1 3IETB 5ETUB 4P5MA 4PJEA 1IL1A 1CFQB 4LCUB 3G6DL 4LGSB 1L4IA 5MENE 4I0KA 5FAAA 3EYVA 1BBJA 4PJIA 3L9RB 1MCIA 3BP4A 1EX0A 2UWEA 4M6ML 2NXZB 1RSFA 3QB7C 3VXMA 3I6LD 1BEYL 4R9HA 3VWJA 4RNRB 5EUOB 4LIQE 5F8RC 2Q3AA 5CP7B 1U8LA 5EOQH 5SWZD 1QLFB 2VIRB 5D7SH 4U1LB 4Q9RH 5F7HA 1U8QB 2MCPH 3BGMB 2R0KL 3S35L 3SGKC 2VZTA 5DHVH 1J0KA 2V2TB 3QXDB 4NO5A 1ZHKA 5L8LB 4NFBA 1ZK9A 4R7DB 4U1MA 5MENA 4JM2C 1ZEAL 3IJYA 3T4AB 3OXRA 4UDUA 1E4XL 1G6VK 2FZ3B 5EPMA 4KQ3H 3SPVB 3D25B 2I24N 3I75B 2HWZH 5LWYL 2D7PA 2JELH 3KPMB 2Q7YA 2AP2A 1BF8A 2DQCH 3M8OH 2DWEB 2DM3A 2R2BA 1R3KA 3E6FA 4EBQH 2DQTL 2EECA 3PQYD 1F4WH 3LS5L 2JCCE 3FFCE 1T1YA 5CBAA 4S1DC 1UENA 5FYLL 1C16A 3D85A 3QDJD 1FNHA 2QADC 4C83B 2ZZUT 4OZHE 4X7DC 2Q8AL 1JHLH 1XGTA 2BVTA 3SKNA 4WRLA 5SWQB 4X4YB 2XN9B 1U41A 2DIBA 4HKBB 1S9XB 5HY9B 1PLGL 4LDOB 4OB5H 5B8CC 5IOPB 4PBVC 2VUYA 5CEZE 3QFJD 5E7FA 4JKKA 3EYUL 4N0YH 4MWFA 3ZKMD 2VR4A 2W0KA 4JPWH 4RGNE 5ANMA 4I0PC 2WBKA 1NDMB 3L3GB 4QHUB 4ZTPL 1J8HA 2AAVA 4OKVB 3TF7C 3BDYH 4EOWH 2JCCA 3FFCA 5DFWH 3FOMA 3E6HB 1EUUA 1FFQA 2O5YL 1DUZB 1JPGB 2X4UA 2ZSWB 3LKOB 4OZHA 3KPQB 3D87B 3H7BB 3F7VB 1OQOA 4HKXB 3WJLC 2R1XA 2A2QT 1IQWL 1RJYA 1IEAB 2Z92A 2MQCA 2VH5H 3P77A 3OF6A 5I2IA 4FXLA 3FQRA 4WHYH 1OL0A 1BOYA 5D5ME 4JKWA 3QO0A 3GJFH 5EO9A 4PJHE 4FP8L 2V2XB 4JR9L 5D96C 1NC4A 3E3QC 1U91A 4FQLH 5IB4B 4N0UE 4H20L 4KTDL 2BVQB 2X44D 2XNAA 3WFCH 4XNXL 4ZDHA 3NFSL 1AXSB 2CRZA 3C09B 1JMXA 4BH7A 1I1CA 2GAZA 3BIBX 5E5MA 3HMWH 1CF8H 2DL9A 2IPKB 3GBMH 1B0GB 5FM5O 4AENA 4F9LC 3AM8A 4PG2C 4OCMC 4NKOB 2YD6A 2D31A 2KDGA 3MLZH 1V7ML 2F54A 4R0LB 1MWAB 3LB6C 4Y4KB 3G5XA 3ZTJG 2BX5A 4MAYD 1E6OH 5D5MA 2B0SH 4JFFB 1YN7A 4OLEA 1EO8H 4PJHA 4XXDB 3HRZB 4BSJA 3LDBC 1MWAL 4XH2B 2FJFA 3OBAA 1WK0A 2C3GA 3PWUB 5KVDL 1QEWB 4N0UB 5GGRY 1WIPA 4OZ4A 3MJ6A 3BP7B 1H3PL 1N7MH 2GCYB 2P8PB 1J8KA 2VXTL 5BS0E 1OW0C 1F3DJ 1KF9B 5I1AA 5AAWA 2R15A 1MHEA 4RRPG 5EBMA 5ALBL 2YHGA 3MOAH 2RGSA 1GGUA 3EYQD 3O4LE 4YEFA 2CJUH 4FFWC 4WWID 1NSNH 4G6AC 2IBZX 4LRIC 5E6ZA 3V6OE 4MB3A 2GHWB 3ARRA 2WIMA 1TQBB 1Y6KR 4GKSA 4HPOH 1EDQA 4F7CB 5BRZE 5DI8A 4EDXA 5TE7H 5ID1B 1FHGA 4N5EC 5CD3A 4LHUG 2E9IA 3S9DB 4LQFL 4L8CB 5DDHB 4O00A 1T21B 1MLBA 1MCCA 3L3JA 2AXHA 3SGEH 5JIPA 2DLFH 2OTWB 5BS0A 3SE3A 3V6ZB 4U1KA 3GSRB 4ZO6A 2HVKB 3S97C 5D2NC 4CKVX 1TVBB 4PJ5E 3EO0A 1MHCA 1LP9B 2N7BA 1A3RL 4JJ5A 1IGYB 3O4LA 3D3VB 4OZIE 4C56E 2KPNA 4KKNA 4X6BA 2XTJE 1KYOK 2OJZL 5HI3D 3S88H 3ISWA 2PUQT 1NFDB 2P5WE 5CKAA 2AQ1A 1VEPA 4GKOA 5KSAC 1GZPA 4OQTA 4IS6A 3BWAA 3V6OA 1MAJA 1NGQL 4APQC 5BRZA 4PPTA 2VMFA 5K9OB 4MXVE 2XXMB 2F5BH 1UKQA 1NJ9B 4JB9L 1C5BH 5C09B 1LE9B 1TVHA 2CMRL 32C2A 4Y4HB 3C5SA 2RAMA 3HS0B 1V3MA 4PV9B 2VDRH 2AXFA 1K4CA 1HIML 5A16B 1BFSA 1OSZB 3JV5A 4U1GC 3FO9B 3MPCA 4PJ5A 3KYNB 1T0PB 1TCRA 4C56A 3U0WH 4IOFD 3CMOH 3S3PA 2GT9A 1NLBH 1I8MB 4KAQH 2P44B 2P5WA 3RVXD 4JZJB 5F89A 1UA6L 3U7YL 2CKBA 4KJYA 5A2KH 5JORA 1TJGL 3TT3L 4Z77B 3QULA 4KTEH 1I8LA 1D5ZB 4YPGA 1KPRA 3PHOB 3MV8E 1W72B 3RWHB 2FGZA 4KVCL 5T1MB 2IJ0C 3MRPA 4XC1L 4K7PY 4HK0A 4HJGA 2EDTA 3MRQB 3VXMD 3VGAC 5GJTL 1KPVA 1JNHA 3T1FB 3MQIA 5LGKA 1W72L 5EU7E 1XF3A 4WY7H 4LOUD 2PYEE 4WFFE 4I3SL 4EQ3A 2K1MA 2PTTB 3MYZA 6CGTA 1HYSD 2NYYD 2O5XH 4J3WA 3OG4B 4U3CA 2W65A 1KB5H 3ZYJA 3H0TA 3VG0H 1TIUA 4NQDD 1KJMB 3W0WE 3KVQA 2H2PD 2XPGB 4QRPD 3WL9A 4MXWH 4P4RB 3KLDA 2DB8A 3JTTB 4OIBA 4JQIL 2NW2A 3IVKB 4W4OC 4BSWB 1UJTA 1NBZA 1KBGL 1P6AB 4G8EA 4J23A 4M4PA 3IFLH 3MRDA 1QFWH 3QIBC 2VAAB 3U0PA 2J8UB 5C0BB 4OGAC 1K2DA 2Z9TA 3MRRB 2EE3A 4RGOH 3RNQB 4XVTH 1SJEA 2IANB 4NM8L 4KJWD 3NZHH 3JTSA 3MV8B 4TULL 3O3BB 3MMEB 1EHLH 4WIQA 4LPTA 3BHBA 1AKJA 2PYEA 1HOCA 3V0AC 4U6VH 2XT1B 4FXGA 3FT3B 4QOKE 2C26A 3L7EA 4YHIA 1UWXH 2R2EB 5T5FH 4WU5B 2X09A 1DBBH 1T0NA 2BCKA 2QBWA 5GRJH 4D0BB 1EMTL 2XA8L 1DBMH 1MAKA 3D85D 4NNXB 4M6NH 2W60B 2X7LB 2HT4D 1OGTB 2OSLA 4CNIA 5IESH 1QSFD 4GW5A 3VMNA 1FQ9C 3HHRB 4UV7H 3MJ8A 2IQAB 3U30B 3S96A 2AEWA 4R90L 1B0RA 4Z78A 2X4SA 4Q6IA 1S7VB 1IGMH 5IEHB 3G6JE 4WWKC 3UP1A 3MV7B 1JPSH 4KRLB 1QTYT 2VDQH 3P9MA 5E2UL 1QRNB 4G6ML 3RWDB 3X14A 5I18L 4L4VE 1AD9B 1QVOA 5GGSB 5IFHH 3SE4A 1P7HL 1H3VA 4PJBA 1MIEL 4QOKA 4ALAH 1FNAA 4U6XB 4XCEB 4CW1B 2HKFL 4NO0B 1CIUA 4DFHA 3DVGB 1L7TH 3JVGC 7CGTA 2XQBL 1OP3H 4U0QB 2YD7A 5ITFB 4GG8B 2VXVH 1H8SA 4LVNB 4TVPE 4G6KH 1QR1B 1F8TL 3LMJH 5IHBA 5F7DB 5IIEB 4HFUL 5J13B 5DA0B 5D7JC 1IGJA 1G6RB 4J3TA 3G6JA 1QR4A 4L9LA 3UTSB 1WQVT 1JWMB 3GIZH 4Y16B 3MRHB 1QNZL 4HC1A 3GJEA 1FGNH 1BOGA 1X44A 3MSPA 3CH8A 5I8KL 4L4VA 1G6RL 2GK0B 1N6QL 4HQQH 4OCSL 2LU7A 3WO3B 4BZ1L 1RZ8A 1YDPA 1JZ4A 4NUJA 5FA3A 3T0EA 1IZJA 1RAMA 5EIIB 5HHQA 3SJVB 1H15A 4Z95H 3BPCB 2F53B 4XBPA 2AEQL 2V17L 3JWDH 4U1JA 5AZ2L 4AZ8A 4K8RD 3OKEB 3TNMB 2YEZA 1MELA 4GBXD 3DO7B 3SHSA 1E27A 4O5LH 4G8GD 2OQJA 1IAIL 4ZD3H 4Y5VC 4Z7UB 4AIZB 3TYGH 2ADJA 4JRWA 1BJ8A 1NCTA 4YHYB 3TA3C 3HNTL 4J12A 3V0WL 4MA1B 1S8DA 2LAAA 3QDHA 3CSYA 1QBAA 1ACYL 4P0DA 2B5IB 2F58H 4KROD 2DQJL 4S0TD 1BVZA 4MDIA 2EE9A 4MAUL 1S5HB 1A7NH 3OGCA 2G5BB 3QH3A 3KPRE 1BAFL 3B9KB 4H25B 4UBDD 2R56L 1IM9B 3I85A 5C6TL 4XVSH 5TFSL 1I7TA 4WUKH 5DD1H 4F7EB 5I73B 4X9IA 4BKLA 1P6FA 3U36A 5ERWA 5A1AA 2AI0H 1XGUB 3S3JA 1YMHB 3MROB 4I48B 4OTXH 3SE9L 4RWYH 3ZDYE 4MZ3A 4NOFA 3N0PB 3LN4B 1KV3A 3OMZA 1EFXA 5F9AC 1U3HD 3CSBA 5LGHL 1SQ2N 3L5XH 1DSFH 1A1MB 4K2UH 3TZVB 2AW2A 2C7UA 2XZCL 4LHUD 3DYMA 2I26N 3F58L 3T2NL 1N0XH 1WBYB 3BKYL 3MZGB 4JFYA 4PS4H 5EBLB 1U2HA 1UACL 1VKXB 1MCOH 5LXGL 1UH4A 5GRUH 2DBLH 1U95A 1KTLA 4YBHA 4L5FH 2BOCA 3STLA 2UZIH 2ICEA 3DIFB 3JV6A 4J3XA 4JQVC 3KPRA 4A6YH 4PRPB 3ARQA 2DI7A 3WLBB 4YHKH 5DUPH 5JOPD 1M05B 3RIFK 3IXTB 1E4KC 1MCQA 4TOYH 3QISA 3QXWA 3DETD 4PRIB 4JPKH 4CADA 2LTQC 4G9DA 1S5IH 4LBEB 1RZKL 5KOMC 2IADB 4LSUH 1MCBA 5HSFA 2AABL 4FNLH 3SGJC 2GTZA 5I1KH 4C4KO 4KZDL 3GI9L 4YHZH 2E8YA 1MAML 1HHKA 4ODWA 5KG9A 1Q8MA 4EI6B 3W81A 4M3JA 3LQAL 1A2YA 3F7YB 1UADC 1CK0H 1DP0A 4XP9H 1BF2A 4ENEC 1XR9A 4CMMA 1VFMA 3X3FH 2EIZB 3LZFH 5MI0C 1ORSB 3Q6FA 4Y19D 3B2VL 4UV4L 4UT6H 1E28B 5E8OA 1EJOL 4P46D 1T1ZB 4I9WE 4WENB 1QQDA 4FTVB 3MFFA 1SEQH 4HK3N 3GSVA 3RWFA 2FJHB 5EFIA 4DQOL 4DOHB 1G1YA 5EU3B 2Y36H 2APBA 4YIQA 3LIZH 1RURH 1R3LA 4OLVL 1CXEA 4OZGE 3WJJC 4YZFF 1DUYA 1AFVH 4L9DA 1MRCH 5L6YL 5CSZB 4ZSOB 1A9BA 1FIEA 2X10A 3EYSH 1OLLA 1G84A 3OPZH 2NXZC 3TO4A 5BJTA 4M6OL 1Z9OA 1M7DA 1ZKAA 5BXFB 2QQNL 3WEXA 5IBUB 3QDGD 3PJSB 2EEDA 3DXAD 3EHBD 2I60L 5E8DL 3CLEL 3KPPA 2AGJL 4YXKH 1YNKL 3FJTA 1P2CA 5DGRA 2VUOA 4JRXD 1KXVC 1C5DB 4JFZH 1SJXA 4P3CL 4R3SB 1U8JA 3IFNL 5TE6L 1FYTD 4KGJA 3TIDA 3B8YA 4IMLB 5IK3B 1K5NB 1AKJD 2CDFB 3CU1A 3S5LB 2GITB 3FOLA 1FIGH 3C8HA 3KXFE 1EEZA 5MERA 2MPAH 2YD5A 2CIIA 4KHXL 3QHZH 3OX8A 2IEPA 4PRNA 1IAII 5IHUH 2KZWA 4F37F 5CCKL 1ZTXH 4YBQC 1OAKH 1BZ9B 1UWEH 5J1TC 4M00A 5FM8A 3FQWA 4P9HL 5DJYB 5F1KC 4OF3A 5DJXA 1MI5D 3EFFA 5EU5B 5C0CD 1HH6B 3OKLA 4PRDA 1U92B 5INCA 1OTSC 2R1WA 4UQ2B 1KENH 1IGTB 3QEHB 5GIRA 1MFNA 4NRZA 5KSVA 3T4YA 3HAEA 4F8TA 5FOBB 3N1FC 2L0DA 1XMWA 2OXGA 2JB6A 4P23A 1I7RA 2UVFA 4XX1G 2G2RB 1JZ8A 5F70A 3KXFA 4MSWA 4IBLT 4L4TD 3IFPB 5CJQL 4HS3B 2Z4QA 1X4XA 3FQXA 3DGGB 3KDMB 1P84J 1AP2A 2H9GA 1UZ8A 4WI4A 5GS1B 3KAAA 4RGMB 4J3VA 5HDQH 3TBVB 2E9JA 3VFOA 3P4LA 2ATPB 4W6YB 1H0DA 3QWOB 1JNLH 4M7ZB 4YO0A 1CFBA 4YDKL 4X80L 1YEKL 3FMGL 2NY1D 1G0YR 4YHMH 2VLKD 1UB5A 3C60A 1KCUH 1G0XA 3O2VL 3U9UA 4TNVK 5DMGC 2DQEH 5HHOA 4GW1A 2X42A 3U4BH 2FLRT 5IKCA 3S37L 3AU1A 4R4BA 3CVHH 4HHAA 1AHWB 3BXNB 3UC0H 3U9PH 4FFVD 4QXGL 3T0ED 5SWZB 5D72L 5KVFH 4JGJA 4PLNC 2NXYC 4LSPL 3C09C 1FL5B 1NMBL 4HLZG 1FN4A 3N1PC 3GK8L 5EN2B 3V4UH 1ZE3C 1A6WL 2VWEE 1GGBH 1MJ8H 4K3DH 1A6ZB 5EWIH 4UAOB 2YBRB 3P11H 1LD9A 4MJ5B 3O6FA 3GSUA 25C8L 4P59H 2IFGA 4ZUSB 2MHAB 4D0CA 3AM8C 2AJVH 1A1NB 3GM0A 4OJFL 2A6JB 3SDDA 4Y4KC 2R8SH 1MJUH 1X5AA 4JN2B 4P9MH 1A7QH 1JYNA 3VFUA 3ROOA 5E08L 1BD2D 5E70A 4OD2B 2XICA 2VDKH 3W9DA 5D2LE 3D1MC 4HX1B 4M7LH 3PQYB 5FK9A 1CE1H 1CDYA 4WW2C 5CP3H 1U8PB 1S9KC 4HCRA 2XWBB 3MX0A 1H9VA 3GFUA 2E9WA 3QDJB 4XWOD 3AMLA 4HGWB 1FG9C 3OXSB 1AGEB 4MS8D 1Y18B 1YQVL 5J9PB 1IC7L 1YY8A 4ONOA 3FL7A 1TQCB 1U8KA 3GMQA 3DI2B 4XVUD 4QWWD 1S7RA 1VFUA 4F58H 1GGCL 3KLAA 2GFBB 4OIIH 2WWKO 1FGVH 2WWMD 3BUYB 4O2EB 1DZBA 3QFJB 4HJJL 3WFDH 2ESVE 4D9LL 3CX5J 1S7TB 1TQBC 4YK4C 1KTKE 2YPKA 4UOJA 5DR5L 3L3HA 3RU8H 5D2LA 4X99B 2FBJH 3S36L 2DN7A 5TDPA 4ZUUB 5HGBB 2FB4L 1GGTA 1G9ML 4Q2ZB 2FD6H 1OQXA 4H1LA 2VXUH 5BVPL 4OT1L 3WUWA 4KY1H 1OGAE 3C6LA 5FO8A 4Z0XA 1EIBA 3WLWC 1CXFA 2BNQE 3NPZB 2AK4D 4HKZB 4UUJB 4KJPC 3H3PH 5EB9A 1BWMA 2W92A 2P49B 1NEZG 5HHXL 3IXAB 3VMPA 2FEEL 5DRXA 2ESVA 2YMXH 5IW1A 1OCWL 5TDOA 4YDIL 1WZ1H 2FX8H 3BPOB 2FX7H 3FO2B 3SKMB 1PVHA 5E2WL 2YN5A 3O6KH 2H6PB 1BIHA 3NA4A 4NKMA 5GGSY 3O2DL 5CJOL 4X6FB 5L9DL 4XI5D 5I8CA 1OGAA 3P4MA 4NQVA 3QJFB 3D9AH 4CVUA 2W91A 3GHEL 2CUMA 2DTSA 3MNVB 4QHKJ 1WF5A 5F1OB 3EOAA 2BNQA 1V05A 4MAYB 4PG9B 1JZ6A 2Y06H 3LEXB 4GQPH 3TN0D 4K3EL 4ZXBD 1I4FA 5DYOB 3VGEA 2VLLA 2ERJB 4HZAA 4X0KB 2YA0A 4CGTA 2DM4A 4WUUD 1KELL 3EFDL 3TJEL 4PTTB 5SWSD 1YEFL 4AG4L 1KGCD 4XP1H 5KOVC 2DKSA 3CFCH 5FGCE 4JFQB 3MXVL 1TJHH 4LP5A 2R4RL 3EOBA 4KKCC 3UTZA 4H8WL 1QRKA 4X6DE 5AD0A 2ADGB 2XZZA 4X7FC 4G6JL 3ZDXE 1MQKL 3GJFK 1YYML 2XRAL 2AEPL 3QJHB 1ZGLP 3V5KB 2PKDA 1L0XA 4HIHB 3K1DA 1A6PA 1JF6A 2G9HB 1K4DA 12E8L 1I9IH 5HYJE 4OKDA 4MYWB 2H8PB 5BZWA 3NIDE 1HINL 5D8JL 2AQ3A 5FM5M 2D03L 3EW3B 4PJ7F 3IS0X 4NZJA 5ICZB 1ZMYA 3CPLA 1G7JA 1HEZA 1IC1A 4JRYA 5CJXC 5D6DA 1EEUA 3G6AA 5J8OA 4JFDE 4H0IA 3UTTD 1YNLH 4XB7A 2J12B 4P5KB 3PG2A 2FL5A 4XBGA 4X6DA 4ZS7H 3FONA 1RV6X 5JO5B 4DTGL 3DVIA 2Z31A 4PJGE 3GUTB 5JW3L 3DTXB 4N8VA 5E8EB 5EU7C 4CJ0A 4R4FH 1D5IL 5L2KD 3MLTB 4LSVL 5HYJA 1AGCA 5TPWH 3LKPB 3GDBA 3CFKB 3LKSA 1SHMA 2BRQA 1U8HB 4JO3L 4B5EA 1OTTC 1YUHA 5FB8A 1H5BB 5LGJA 4N90E 5IVXF 1OAUL 4P23D 4ZFFB 5ICXA 3VGBA 3TV3L 1AGBA 1T7ZA 3WN5B 3HI6H 4GAYA 4I18C 4Q6IC 3MBXL 4JFDB 5C2BL 3BP5A 1BHGA 1XIWD 5ILTH 3TPUA 5IR1A 3T0DA 4PJGA 3VWKA 1TZGH 1PEWA 1QO3A 5C92A 1MCKA 4DZ8B 1L0YA 1LO5B 5CGYC 5GSVA 4DN4H 4TUKL 5DMKA 5LCVH 1ZHNA 3ELAT 2J4WL 4IRSA 1KLGB 4BH8A 3C60D 3VRIA 5IMKB 1BFTA 2IH1B 4KPHL 4TQEH 5CEXA 2HLAB 4K7PH 1LO4L 4M1DL 4CVWA 3MJ9L 4KK6C 4LVNC 5HHOD 3EIFA 1J1PL 3QCVL 4UIKH 5MEQA 1NGPH 5B22A 3R1GH 3VXMB 4M02A 5D93B 3BYYA 4Z7WE 1BQHA 3PP4H 5C07E 2HJFA 4U4BA 1W0WB 1ZT7A 1HNGA 2A6IB 1N64H 1QUNA 5IGXL 4XWGH 2GKIA 4JFXA 1XF1A 4L9LC 1FC1A 2EO9A 4RX4A 2E7LA 1S7XB 1NPUA 4JJHA 2W38A 4F7PA 1FNGA 2OK0H 4NQDB 1Y0LB 2FEEI 4QRPB 4RDQG 3ZKXB 1DBKL 3DHJA 3RX5A 1QFPA 3O6FD 4KK9C 3GRWA 4RZCB 4U2YA 4XP5L 3ALXA 4ODSH 4WDIA 1DN2A 5E9DE 3ROLB 2AXGA 3OKKA 3QCTH 4YWGH 3OAYK 3HMXL 1T2JA 2HJKA 5DEZA 3KYKH 4AMKL 1MCNA 3S36X 2F19L 3NH7L 1ROWA 2YKLH 4OUOA 3MCLL 4Z7WA 2R2BB 5C07A 3UPCA 4MA1C 1R5WB 4Z7VA 1DN0A 3TBTB 3MRGB 4PBXA 3D85B 1GPOH 5EOCH 3IU4H 3LEYL 4RAUA 3GIVB 4OLWL 1UJ3A 1FNLA 3SKNB 1QSFB 3D69B 4JO4H 1CGXA 1HI6B 4UNVA 5FUZH 2UZYB 3F5WA 4X9BA 5I73C 5TE4H 2IALA 3R0MA 5DF0A 3CXDL 1F4HA 1CICD 2IPUK 4OGYH 4YAQB 4ZO7A 2IQ9L 4KRPD 4JY6B 3QR2A 2NLJA 1JTOA 4ZFGH 4LLQB 3OAZH 1C08B 1JF1B 1XR8B 3NZ8A 3OR6A 1ETZB 2A74A 4HT1L 5L2JA 3CCHA 2FR4A 2G60H 3RRQA 4MJID 4NOBA 3RWGB 2RFXB 5C0GA 1YY9C 4YHLH 1VFBA 5TF0A 3TCLB 4EDWH 4LKXA 3C6LD 5FYJD 1RZKC 3QQ3B 1WFNA 3RP1A 1RIUL 4V1DE 3SBWA 2JIXD 5DURD 4Z7NE 1P4LA 2NCMA 3JBG7 3BO8B 5J6GA 4GKNB 3AS1A 5JQHC 4OLUH 5IQ7L 1A7OL 1S7QA 3D2UA 3LQAC 3U7AA 5FGBA 1U91B 1VFAB 1UWXK 3BISA 1E6JL 4PRAB 5TH2B 3TVMA 1OAQL 2XNAB 3INUL 4NZUH 3BW9B 4P5TA 5H37H 1FFNA 4KI5D 5FYKD 4AL8L 5I1CL 5IW6B 3VFSB 3NCYP 1CD1B 3BVNA 1KIQB 2A38A 2JJVA 4A2MA 3WSQL 4KKLD 4QXTB 1BVLA 1J1OH 4RMRA 1JF5A 2NX5E 3MFGB 2R69L 5DD5L 3VFMB 1MFBH 5ADPL 5FCUL 4V1DA 1F4XH 1ND0B 4GBXB 4E42B 3CC5A 3EOYG 5GGVH 4G8GB 3QUXC 1QBLH 4M48H 1LK2B 3IJHA 4K8RL 3FAWA 4RQQB 1OD7A 3CGTA 4HS8H 2EDRA 3DI3B 4OZ4B 5FFLA 4NQSB 4JKPH 5E56A 1DL7L 1OP3K 5DFVD 3OKNA 2BVOA 4PY7B 1M1SA 4EIGB 2XWJB 1FVEB 4HS6B 3MRMB 2R0KH 5JUEH 3S35H 4QHNA 4D9RE 2APFA 4YUEL 4KKAD 3QUZA 3T2QA 2HFEB 4M8VA 1XGQB 1BFOB 3E2HC 4GRWE 4ZFZA 3RL1B 2NX5A 1CDCA 4DCQB 2KZ1B 4JQXA 3DPBA 3O6ML 5GGUA 3RDTD 1S9WB 5IFJA 4ZG1A 1U3HB 1YEEL 4D3CL 3CZFA 4P3DA 3IKCB 4WEMB 5LWYH 4X5XA 1A64A 2Q76A 2NY2C 4LHUB 2WANA 3HZKA 4KZEL 1Q9WB 3G5ZB 2HG5A 1NCWL 2DQTH 4OD1H 5IFAL 3P2TA 5T33L 4JRYD 1PZ5A 1AQDA 5IVZA 3VGGA 1DVFD 1NBQA 3BX7C 3C9NB 4RMSA 2FO1A 4D9QD 1NCCL 3SOBL 4ZPVA 3SDCC 1I1YB 1EXUA 3B6SB 4OZFA 4LIQH 5DK3A 2EDOA 3CZJA 3K80A 2Z0BA 5DJDA 2Q6WA 1YNTB 1C12A 4W68A 3DUUB 3REWB 4ERSH 1PLGH 2QJDA 3L5WA 5C8JA 3NABL 4U1IB 5FM4A 3HNSH 4IS6B 2JJTA 4N5UA 2PO6A 5I66B 3K7UA 3MLXL 2X4QA 3G5VB 32C2B 4KI5F 4XPTH 2QSTA 3B3IB 3L3KB 1OSPH 3LEVH 9CGTA 4TVSa 4FMFA 5ISZD 2UZXB 2GEEA 2Z8RA 1A7BA 1I85C 1N2RB 3V0VB 4HEME 1FJ1B 4NHCH 4Y19B 4R96B 2LE9A 4WEBH 4PV8B 2OL3A 4P46B 2APWA 3KJ6L 1TXKA 2HVJB 3NCCB 4M8QB 4RGMC 3VFTB 3BKJL 3QXAA 2BZDA 2OCFD 1FNSL 4PJDA 4IRSD 3ZKQD 2P8MA 4I2XE 4HWBA 1DQQB 1Q9LA 4MGXA 4S1SH 1JN6A 2MFNA 2EIEA 3HTLX 1NQBA 5FCSH 1MRDH 1BFVL 3WIIH 3RJQB 4HULB 3HZYA 4KV5E 5CEZH 2CKNA 5A2JH 1RZGB 2V9RA 4Z0BH 1UGNA 4XP6H 3QNZA 2PF6A 4NZRH 1FAIH 3OSKA 4LU5L 4QRSA 1XCTB 2B20A 1WWBX 4RX4D 2AS5M 3N85H 3U0TA 5HVHB 5I1EL 4LLDB 1HHJA 4J3UA 4MJ2A 5F7EL 3V6FB 3RWJB 4YGVA 3UO1L 5I1DA 4EUPA 1KCVH 3L5IA 3ULUE 1FFPA 3QDGB 4J8RB 3IDXL 3T0VA 2YSSA 5BV7B 4GXVH 3DXAB 3Q5OA 1OAXL 4W4NA 1I7ZA 5J1AB 2PTVA 4I2XA 2VN7A 3AREA 1KTDB 5BV7L 3MRFA 5JMOC 4JRXB 3MRKB 1T1XA 1R3IL 5CINL 4DN3L 3WDHA 3UDWA 1NAMA 2HTKD 1F13A 3QRFM 3WNOA 1ZLUK 1FYTB 1UM6L 1X6NA 2GJ6A 4Q0XH 3F7RA 5F8QC 1AKJB 3IYLW 3SDDC 3PHQB 3Q0HA 2Y5EA 5I1GL 5J3HD 4NYLA 5A3IC 4XCNA 5C08D 3R4DA 2V5TA 3SQOH 1FZMB 1IC4L 4Q9QL 5TGBB 2D9QB 4PB9L 4X4XA 5ABDE 2SEBA 2AV1A 5F72S 1OARL 4F2MA 1OLZA 4TSBH 4YHNA 4JFEE 5C70A 1MI5B 4U7KA 2N7AA 5C0CB 2FX9L 2EDYA 5AAMA 2VWEC 3PXJA 3MREA 4HIJB 5D7LE 3MYJA 3SKUD 1K8IA 4L3CB 2AV7B 2XKUA 2QKIB 1CTOA 4TRPH 5I30H 2OJZH 4G6FD 4L4TB 5LBSL 3ZKMC 3FO1B 3JWOC 3VI4F 2VXSL 1C5CL 4MA7H 4JANB 5JIIA 3QEQD 2JK5B 4UTBH 4Q97A 4GOSA 1NFIB 4FS0A 4XPBH 4AEIL 3QHTC 4KTYA 5HHMD 3VI3E 2CMRH 2K7PA 1WIOA 5DZNA 1ZWIB 2NY1B 3HCVA 1A7PH 3RTQB 3M17A 2VLKB 1RY7B 4P4KD 5DJ8B 3P4NB 2ZOKA 2ICCA 4GMSL 4OQTH 4ISVA 4Y8AA 3D2UD 5GSRB 3GKWH 1OM3H 1HIMH 1VGEH 4QLRA 4X5WA 3QUYA 4YEEA 2QLVB 5D7LA 1DEEA 5FO7A 1BOGB 3DV6B 1F3JA 1Z9LA 4KUZL 3BH9B 4NIKB 4BSVB 2JLLA 4QT5A 2E9BA 1T89A 4TSAL 3RPIB 5C7XH 1BX2B 4NQXA 3T0EB 4RDQF 1RJCA 1UA6H 1DLFL 2VLME 4XBPB 1QLRA 3TT3H 1JHTB 1S9YA 1HZHL 1AO7E 1WWWX 4UI2A 2DQFA 3QEUA 1SEBA 4MD0A 5D9SB 5EULV 4RAVB 3VXSD 3G08B 2PXYD 4YHOL 3WIFB 5L0QB 4NDMB 2UVEA 1RUAL 2CKBH 4PGCA 4XXCA 5FUOH 1T0MB 5J6HA 4M5ZH 4MAYC 3KLSA 5IB5B 3K2UL 2VLRE 4K3JH 3UJIL 1AC0A 4OCNC 3L95A 2LV4A 1BD2B 1S78C 2C9AA 3EAKA 4F7MB 2CK0L 2ZNXA 3HE6A 4KHTH 4PJ8D 1K6QH 5CWSB 5HDOA 3QZWG 1I3RA 3THMH 1Y6NR 4H8WC 1BIIB 4S1RH 3VGFA 2C3VA 3GSNB 4YXLH 4LHQB 2YA2A 3LS4L 3PDOB 4WHYG 1QLEL 4M03A 3I9GL 5T3ZE 2ARJQ 2C3XA 3P0VH 3IDGB 3OGOE 1T04A 3EZ8A 3R8BB 1YPZF 2WM0A 1AO7A 3IDNA 3GSNL 3MNWA 1SBSL 1QKZL 1QFUL 2DI8A 5I8OL 5DJ6B 4F33B 1T7VA 2NQCA 5FHBL 3RIAK 3QI9D 2B1HL 1BM3L 3BP6A 1IRAY 3MBEA 4PJ7B 4LEXL 4XCYB 2VLRB 5DQDL 2A9NL 3PE9A 5CHNA 2XA8H 1NUGA 4J1UB 2VDMH 2ICEB 3ARWA 3QSKB 4POYA 2DYPD 5IB2A 3FRUB 4OI9A 2DWDA 1AXTL 1IGCH 3RIFF 2Q20A 1I3GH 1MJ7H 3X11B 1PKOA 5C9JB 2RIKA 5DRZA 1RHHA 4PD4K 3EKCA 4ZODA 1CFVL 4R90H 2FCBA 1P7QD 5JA9A 1YJDL 4YHPB 1PSKH 2VISB 2QQQA 4OFDA 1MHHA 3K81A 2AJ3B 4O9HL 4PJCF 5JQ6H 2V5RA 2VR9A 2Z31C 2AK4B 3T2PA 5L88L 2X41A 4G6MH 2A83B 1PW3A 2LU4A 3SDXA 5F9JA 2BDNL 1JRHI 1A2YB 5SWSE 4MA8H 1CT8A 2YN3A 1GCFA 1T3FB 4RBPH 5IVXB 4ODXA 4XP4L 5CZVL 3P30L 1AY1H 5DJZB 5GRVK 1H5BC 4XBEL 4OM0L 4LGRB 2Z8WC 1CBVL 3L5HA 4Z7QF 3H3BC 2QSVA 3ABZA 3QBTB 3TC9A 4XMLL 4NM4L 3TCXA 2XWTA 1T5WB 4E5XA 5ESQB 5FXCH 4HZLA 5GRZA 5EFIB 3BGFB 3GNMH 4LPCA 1X5JA 3UCRA 4L29A 5DUMH 4JG0H 1QNZH 3TN0B 4L8SB 1JHKL 3AB0B 5SX5H 3VWKC 3BZ4A 4YDLB 4ZXBB 5I8KH 3RVXC 5DJ2B 2I07B 1G6RH 3L6FB 4N0CC 4QRRE 2JE8A 2WSKA 4ZNCD 4WUUB 3T1WA 1BZ7B 3FFDA 5SWSB 3UTTE 3ARGB 2RB8A 1K3IA 3K74B 4HC1H 4LLVA 4O4YL 3MODL 5IB3A 3OKMB 1INEL 1U3YA 1IT9H 2ZUYA 3HE7D 2OLDA 1XGRA 5D93C 3LAFA 2BVUA 2A6DA 4LCCA 1PG7H 1U93B 4QF1A 4UIMA 1HYSC 3AMKA 3DV4B 3DHMA 5FHAL 5MP6H 3RVTD 1J1XL 2C1OB 3FT4A 5GRXG 2E7LC 3H42H 3NFPB 2H2PC 2MSPA 5IBTL 1U6AL 4TVPH 1MOEA 4MLIA 3IAPA 3ARBA 3ARED 4RFEA 1KG0B 4XAWH 3LHPH 4MAUH 1D6VL 3GZKA 4QRRA 4NKDA 2AERT 4H5SA 2R56H 3O41B 1Z3GH 1SVZA 2GJ6D 2W07A 2Y6SD 5C6TH 2VDLL 5TDNB 5C0AE 3LKRB 3UAJD 3O3DA 3UTTB 2PYFA 1TVDA 3PUCA 1NKRA 2ENYA 2EZ0D 3CFBB 1GHFL 4YH6A 1EA9C 2FYYA 3SCMD 4NO2B 4WFGD 5GZND 5D1ZD 5EZOL 3OX8B 1JZ3A 2VXQH 4NJ9L 1H3WM 1KNOA 2X9YA 3RWEA 3VXNB 3F58H 3I6KB 3T2NH 3O9WA 1CVRA 5L2KB 3BAEH 1CLZL 1IBGL 1CR9L 4QCIA 4DZBA 4NP4H 4JY4B 1DANT 5HI5D 1J05B 4M7JH 2A1WL 4PGDA 3UJJH 4NRZB 5KSVB 3Q6GL 4U1SB 2DD8L 2IPUG 3RZCD 1MCHA 1ZVSA 2QV2A 4P23B 3BJLA 4TPRH 1NLDL 5DA4A 5C0AA 2ZUWA 4GSDH 2VKXA 2HFGH 1KLUA 1AH1A 1B6UA 3FQTB 1MH5A 5EORL 3NN8A 2Z4QB 5JXEA 3H9ZA 5KS9F 2EICA 1L7IL 1UZ8B 4GO6B 4AEFA 1XIWB 2D0FA 2I9LA 5L7XH 1PG7X 5J4MA 2IPTH 4U1HB 3DMMB 2WIIA 3E1F1 3OAUL 2CH8A 4XMPL 1H0DB 3VW3L 1RUKH 2YD3A 3UJTH 4IRJA 3VGHA 1F90L 3PL6D 3AC0A 5I1JH 1PDKA 2M8XA 4Z5RB 4LDEB 2H26A 1G9NC 1AGFA 4I8DA 4JG1H 1AC6A 2R2CA 3DOSA 5C0JB 2WUBL 5HHOB 4MD5B 5IG7B 4XPHH 5CKGA 3SBWC 3PP3H 5DVNA 3UPRB 5GJSH 1N5YH 1LMKA 1LEKB 2W9DH 3TFKC 4XHQA 3AU1B 3FB7A 3ULVE 5HYQA 4O2CB 2EDWA 2VQUA 2VLJE 4HV8A 4IRZL 2J5LB 4DQOH 1BVKA 4NSKA 3MZTA 3K8KA 3NOIA 4Q58C 3BQUD 1YEHH 3VXRD 1DFBL 4NRYA 4OCXL 4JHZA 3T65B 4OLVH 4X9HA 1P4IH 3O6FB 4JVPA 5I76A 2EXYC 3RNKA 3ZZ1A 3MLYH 4D0CB 2P7TB 4WFHD 2C1PA 1I8KA 2XKSA 3OR7A 3VFGH 5IW3A 2NY6D 3C8KA 3QQ9C 5EZLA 1UVQB 2O61A 5KSUA 3RWIB 4ZOCA 5C3TA 2MMXA 3I02B 1ZLSL 1LDPL 4ELMF 3WHE1 1A6AA 1IVLA 3WMSA 2I60H 4OI7A 3QA3B 4G8FA 5GISH 3CLEH 4HXAL 4HXBL 1TPXC 1YNKH 3PWPD 3KJ4B 4UBDC 2VQ1B 4WTZG 2IAMD 1CD0A 4Y4FD 1VENA 2BSSB 3VD9A 3C87A 2GSGB 3DURA 3S98A 2C4XA 1S7RB 4PJFE 2AK1L 4JQXC 1CICB 3BZFB 3CSGA 2FJGA 4KRPB 1YMME 1U3HC 4DEPB 3BRFA 5FYKE 3NCBB 4GRLA 4RISL 1RK0B 2OJEA 3D39D 2D3VA 3Q1SH 3WFHB 3KLHD 1JV5A 4XNQB 4J6RL 4MJIB 3CK0H 3WNMA 5TDPB 3SDYL 5ADOH 3AS3A 2VITB 3ARUA 5HJ3A 3NTCL 5AWNH 4YFLF 3QUKA 3C6LB 4JHWH 1H3TA 5JZ7D 4PP2B 1JGVH 5FDWB 5IMMB 5TQ2L 3L7FB 1YEDA 4MMZC 2JIXB 3FCTA 5DURB 1D9KA 2J7LA 1NEZB 2P5EA 4WI3A 5CBEA 2UYLA 4K7FB 1T4KB 3UEZA 2BFVH 4PJFA 4KGLA 4U6YB 5FYJL 1YMMA 4E0RA 5HI4D 1CFNB 3UBXA 4RFNC 5AEAA 3HAEH 3R06B 3X3GH 4G5ZL 2HKHH 4XAKD 1P1ZA 3UBXG 4ETQA 5JNYA 1B0WA 1MCWW 1KIPA 3EO9L 4FQ2L 1KUMA 4X80H 5FYKL 4P2OD 5I8CB 1A6VL 1IEBB 2NR6D 5KAQG 1T20A 3REVA 5C86A 1LNUB 3DARA 3O2VH 2B4CL 3C5JA 3IFOA 3OAZK 4I13B 1FZKB 2FWOA 3BIKA 5HHNB 1IKNC 3VXPA 1C1EH 1A4KA 4UT9H 4X7EC 3BT2L 3S37H 2ZG3A 5E99H 3DX8A 2WUCL 5EC2A 3WBDA 2EKSB 1O0VA 1KN4H 5GS2H 3OKDA 3NCJH 4U49A 4Y1AD 5KJRL 3B9VA 3A6OA 4P2RE 3NBNA 3O2WL 5BMFL 2OR9H 2FGWL 5E8PA 4UDTB 4LEOA 4PGEA 3WUZA 25C8H 4JVWA 1CFTA 3VRJB 1AIFA 4ACPA 1MFAL 3EGSB 5C0DB 4DKEH 1PFCA 4PGJA 1TTUA 1KEGL 1PD6A 1OY3B 3RDTB 4GQ9H 2PR4L 1I3VA 1S9VA 1XFPA 3ZE2F 4OV5A 2NNAB 4TYUA 3ARFA 4IDLA 1EAPB 3ZE1F 4IIQB 3BOVA 5IHLB 3EHBC 3E8UH 2BY0A 3ARDA 4ZTOL 1LO3H 1KFAH 2EYTA 4J3OC 1IFHL 4JLRA 4P2RA 1NBYA 4XC3H 4HFWA 3G6AB 2V7HB 4PREA 1DVFB 5DJAA 5DRWA 3RUGF 1RQ5A 3O3EA 1UKSA 1NCBL 4EI5A 5ESAB 2R23A 4NBXB 1YQVH 3UDWC 5E2TL 3LSOA 3T77A 1SYSA 1AJ7L 2W59A 3HB3D 4XVJL 1S3KL 1MVFA 3DX6A 3HKFA 3HC4H 3MLRH 2YC1A 5DD3H 4PGBB 4UNUA 2UY6A 3MNZB 1D5XA 1Q94A 4PJXF 1I1FB 3GMMA 1DQDL 2EC9T 2V5YA 2GJZA 4LSQL 1CLOL 3LPFA 2Q8BL 1F6LL 1SJHA 4X6CF 3ULUC 4NHUA 2HT2D 5I1LA 2YUZA 4FFYL 4RMTA 1GZQB 3DROA 5I6XB 2VZ1A 1FV1B 1DLHA 1WISA 3JWOH 4KH2A 4OT1H 3TBSA 4MQ7B 3VDAA 4JM2A 5ISZB 3GSOA 1UYWH 4K94L 4NQCA 3RGVD 3TH3T 4YNYB 2ZPKL 4QY8A 3MR9A 2DS4A 4RSVA 5AUMB 1IM3A 1JNNL 1CGSH 1KIRA 1SY6L 3KYOB 4N8PA 4DAGH 2X1PA 4H1LH 3VE0A 4MQTB 1KIUA 4P2CG 5C0EA 5HHXH 3T08A 5E7BA 2Z35A 2F9BT 4EXKA 1QYGH 5AZEH 1MJJA 2MTPA 2FH8A 4XNYH 1KCRL 3KPOA 4FQQA 2NY1C 1GOFA 3PGFL 3RTQC 3ESVF 3DUSB 4KQ4L 5D7KD 3V9FA 1SYVA 3QHFL 5ESVB 5L9DH 4HWZB 1XH3A 2HLFC 2NMSA 2CUHA 5DT1L 5B8CA 1MCFA 15C8L 3B4NA 3NFNA 3QUYC 4W6WB 3BN9C 2H32H 4OFYD 4TTDD 43CAA 2ZKHL 1RUQL 4ONGL 4I0PA 5E5UB 1JI2A 5DSCB 3QUMA 2J8OA 1N0LA 4R4ND 2A73B 2BSRA 2YPLD 3NIGF 3W82A 5DUBB 4ZUWB 4AYFA 1JGUL 4I4WB 5IV2B 4CDGC 3EFDH 3GSWA 1MNUL 3TJEH 1ODAA 2CLZB 3L3IB 2ZUQC 1G7MA 1ADQL 3TO2B 5CEYA 1NC2A 5JOFA 1JPTL 2VERN 3VXOA 5GZOC 5KN5A 2XFXB 1P7KA 2IBGA 3LKNA 3QQ4B 1J0IA 2R0LL 3BDXA 3I50L 4KKBC 4C59B 2G5RA 1NANI 2P8LB 3FB8A 3S4SA 4M3KB 1Q72L 4OUUB 4HBCH 2WBJD 3T8XB 3AAZA 3A0OA 3D18A 2DMBA 4LAJH 1WZMA 3GBNL 4FFZL 5C08B 4K3HA 1KJ2B 4L1DA 3HE6C 4OLXL 1LQSR 5GGTA 4BFIA 3RWCA 3BH8A 1HINH 2X6MA 4CJ1A 3OZ9H 5IEKA 1YPZB 3VG9B 1LK3L 3CVHA 1DR9A 1KJ2L 4F9LA 4XWOC 3NIFE 4PG2A 3PGDA 1YEGL 5CJ5A 2R29L 2HP4A 4LLYB 1RZIA 1K9TA 2X4NB 1N8ZA 4XHJD 2H3NA 5IVOA 1UCBL 4NRXB 4X7TA 2A6KA 1A5FH 3Q48A 3WXWL 3HUJE 4CL7A 1TZHB 1EGJL 2HRPH 5IM7B 3SDAD 5J06A 2PCPA 4DVRH 3CCHB 1IGFH 2BVPA 2C5DC 4LVOB 5F9WC 4G6FB 3U82B 2NZ9D 3O4OB 5DTFB 4ZNEA 5E00A 4X5LA 3MBEC 4LSVH 1FZJA 4NN6B 3A67L 1VADB 5DHXB 1PKQA 2XKNA 5HYSB 1OW0A 4G42B 3D0LA 3QEQB 5HGHB 1TJIL 3FQNA 4PRHD 4UQ3A 5D2NE 5HGAA 2A0LC 3KG5A 3VXSE 5HHMB 2P5ED 1OAUH 4HUKB 2KUTA 1YN6A 3JSSA 3KPNA 4P4KB 5J6GB 4PJCB 3U1SL 3DX7A 4M1GL 4JEGB 3D2UB 3U79A 4OGXL 4X8JA 5CP3A 3IDMA 2R1YB 1JUFB 1IAOA 3MBXH 3ZL4H 4O51A 4LRIA 4MNQD 3RAJL 5H8DA 1G7QA 3HUJA 2NY3D 4XPFL 5B39A 1DE4B 3M1BB 1J11A 2WINB 5DRNA 5B38A 3O6LH 2CUIA 5DS8A 3MO1A 3PIQA 3P0YL 4PLOB 4JPVH 4X98B 1KPUB 1INDL 4CDHA 5B38G 4ZAKB 4MDJB 2BNRD 4P2QE 3MV11 5D2NA 1U8OA 3KNBB 1LO4H 4XI5C 3ALPA 5BOPA 1KCLA 1U8IB 3QCVH 5KVGL 4MCZA 1KCSH 5IMLB 3VXSB 2PXYB 1PJ9A 4PLJD 3VU2A 1LO2L 3B2UC 4PLKD 4JFOB 2OYPA 2Q86B 3PWJB 1HXMB 2O5ZL 3LOWA 2NY5L 5KSAA 4L8SC 3O8XA 4LFHG 4XTRD 2Q3ZA 4Y88A 5JIKA 2V2WB 1YEJH 4APQA 4G8IB 2PW1A 4J3SA 4PJ8B 1UXWA 4LLUA 1M4KA 3WXVH 3V7AE 3BPLB 2B2XH 2N4IA 4M4RA 4Q9CA 2X05A 2RJMA 4F7TB 5IHZB 1GIGL 5JA8B 3ARGC 4QHNB 3NA9L 2H2SC 3UPAA 3GMOB 2G75A 1WVZA 35C8H 3RX7A 4ZUTA 3MLWL 1ZLVK 1IAIM 2XZQH 4FN0A 5AYQA 4P2QA 1M6OB 3MOBL 1AR2A 1MUJA 1LDSA 1OB1A 4AMKH 4G9FD 2AKRB 2Y7QB 3CLFL 4QRUA 4CN6A 3NH7H 1MVUA 1ORQA 2ARJA 4X5XB 3QI9B 3GRWH 2OZ4A 2VR5A 3ARDD 2OMBA 2EXWC 3STBA 3CFDA 4BUGA 2X70A 1YEIL 5KVEL 5EU6E 1T1WB 2HA1A 5BVJA 2A9ML 4NQEE 4GKZB 1QFHA 3EYFA 1WEJH 2ZNWA 5L8JB 5T1LA 3QFDA 1VACA 3GMPB 2DYPB 2KQMA 3IJSB 1Q1JL 1W0YT 1X5LA 5DEFB 1I9JL 2P24B 4I5BB 3KPSE 4J7RA 2YXMA 5J7CC 2W9EL 5I0ZA 1P7QB 1TITA 1JVKA 2NY4D 3H9YA 3QRGL 2IQ9H 4HJ0D 1ZXQA 2D0HA 4LCWE 2HN7A 1IGIL 3QIWD 4BUHA 1GRWA 5L8KB 1LEIB 1NEUA 4S2SB 2LQRA 3PWVB 2CPCA 4I1NB 3U4EA 1ZS8A 5JW5A 3VJ6A 3MUGB 4M61B 3SE8L 2ATKB 3K1KC 4WNQB 4LSSL 2ADIB 3QIBA 4NQEA 5INDA 5EU6B 3QNXA 2EH7L 1JGLL 1IEHA 2AJUL 4FQHA 4L8BB 5JHDD 5KAQF 1WICA 3I2CL 2DQIL 1A8JH 1RIUH 4JCLA 1R5VB 3V4PL 1A3LL 3KPSA 1V7NH 1AQKL 5KS9B 4RMQA 3T3ME 5KBNC 3VFWA 3VFPA 4UTAH 1JWSA 3MV9D 3MA7B 3WFEL 1XIWC 3H9SE 1G9NH 5F3BB 5JXEC 3MJGX 1QSEA 2FHBA 3DMMC 2IG2L 3MRNB 3INUH 2FIKB 4ZPTB 3BKML 1WSST 2ZCLH 4AL8H 5I1CH 2I5YH 1JCKA 2BMKA 5JHLL 1NGXB 4MVBC 1BJ1J 3JXAA 3DSFH 4IRJC 1F6AB 3QPXH 3IAGC 2NW3A 5JPMA 4OCYL 5CD5C 3W11C 5I17A 3UROR 4JN1H 5ENWB 1DEDA 3PHSA 4KMQA 4YDJA 3Q3GB 1UH3A 4NZTL 2FSEB 1JTPA 1ZVHA 3HE7B 3QWQB 5D6CB 2BHYA 4YX2L 4ZUVB 4B50A 2J5LC 1MLCA 1BLNB 5CSBA 3NAAL