4GMVA

Crystal structure of the coiled-coil, ra and ph domains of lamellipodin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
269
structure length
260
Chain Sequence
b'KAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-associated and pleckstrin homology domains-containing pr
publication title Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 77
structure length 260
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gmvA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gmvA01
4PS8A 4GZUA 3L54A 4HAXB 3ML8A 1XX0A 1WJMA 2MBOA 3DCGA 4NAWA 3PLUA 4JIOU 4TYZA 1XKEA 1TXDA 3V61A 1ZM0A 2NZ8B 3JSVA 1GC7A 1MPHA 4DBBA 2BWFA 2KZRA 1KLVA 4ZRIA 3B1LX 2J0KA 3D32A 3R7RA 2MSED 4GOCA 3M1IB 2LXAA 1X1FA 4KSKC 2D10A 4HDQA 1W1GA 2MBEA 1V80A 2IY1B 3C0RB 2JF5A 3LJ3A 3UQBA 4HAZB 1J0GA 2QKLA 4E74A 1P6SA 5G55A 3RZFA 2MRPA 3UINB 3UZTA 3H7SA 5KHQA 1BTKA 2PE6B 3WA0A 4A6HA 5HKHA 2VKIA 3G9WA 4CHJA 3ZO5B 2WX1A 2MLBA 2KO3A 4MJSA 3UGBB 2BYVE 4GIVA 2RGFA 3ECIA 5FI0A 2ROVA 2BF8B 3L17A 4K17A 2CY4A 3V6EB 1NBFC 3SNHA 4URKA 3ZRFA 3PSEB 3CSFA 4I6PA 4GSWA 2DYQA 4H8SA 3P6AA 2DAJA 4IM2A 2D3GA 4HXDA 1M94A 1KM7A 3MDBC 4YONA 1V81A 1RRBA 3TO1A 4DK5A 4MDKE 3QQ8B 2DYOA 3ZDMC 5HE0A 2MBQA 2C7NB 5AZFA 2KFKA 2RLOA 4RM9A 4Z2MB 4MJSB 1P3QU 2RNRB 2ZNVC 3L0WB 4F8CB 1Z87A 2RD0A 2QHOA 1IP9A 3GYPA 2LOXA 3DXCA 2MWSB 2N9XA 4K2PA 4BBNC 3A4RA 3M3JA 1AARA 2MW5A 1TTNA 2JZZA 3JYUA 1FHWA 5EDSA 5FR6A 4AOFA 5DIFB 4WSFA 3A9KA 3VH4B 1YIWA 1Z5SB 2G4SA 1GC6A 3JVZX 3OANA 4HDOA 2RVBB 3NSUA 5JLJB 1AQCA 1MIZB 5BO4B 4KIKA 4WQOB 4IG7B 3VAWA 1BTNA 2NR2A 5DHFB 4WVFB 3PRMB 2V1YA 4G50A 1KJTA 1K5DB 3VTVA 1B55A 2GJYA 2D11A 3EFUA 4AJWA 2DYNA 3APDA 2FAZA 2GS0A 1V9JA 2ROZB 3PPAA 3SDLC 5IA7A 2IZVB 1ZGUB 5CLQB 2CAYA 1ZKHA 1WE6A 3Q3FA 1J0WA 5KQ4A 4MSQB 2P0FA 3PGEA 2DX5A 5LOPB 2Y5BB 2ADZA 4RMAA 4IAPA 2N1VA 2B3AA 3HHMA 2D9YA 3NOBA 3JW0X 2J59M 1WRDB 1YX5B 3IBEA 2M1MA 3VFKA 3FSSA 5L83A 1EF1A 1Q67A 2DFKA 2P0HA 2BWES 2K2JA 2D4QA 2KTRB 4B9KA 1MKEA 1LM8B 2OTXA 3PZDA 1WMHA 1WM3A 4N9F4 3H6NA 4HLEA 1IPGA 2CU1A 3PT2B 1PFJA 2DX5B 4ANVA 3QCAA 2XQNM 2KXJA 1WJ1A 1M7EA 3ML4A 1K8RB 2DKPA 2CR5A 2Y8FA 3SV1A 1RJ2A 2L0FA 1FHOA 2MFQA 2YF0A 4IM0A 4EFOA 3BY4B 2DHZA 2RR9A 3KYDD 3WALA 3AI5A 1HE8A 1TQZA 1L7YA 3Q3JA 4DBGA 5JHGA 4KHAA 2Z0EB 3DXEA 3V5WA 3QC8B 4MGIE 3RUIB 3SUZA 3KYCD 3H7PB 4BFRA 1WMHB 4HB0B 3TVVA 2DTCA 1H4RA 3X23A 1SIFA 1S3SG 2BYFA 1V86A 4JQWC 2EKEC 2K8HA 4HAVB 2FUHB 2L1CA 5AZGA 1UELA 4DWFA 2I1KA 4K1RB 4CHKA 5AEKB 4KSLC 4NSWA 1SE9A 2G3QB 2ZPNA 3DOWA 1WXVA 3R66C 2KJRA 3H9DA 1E8XA 3WAPA 4K2OA 5JHBA 2DYMA 4GDKA 3A1QA 4TKNA 2FCMA 2MP2B 1A5RA 2J0MA 1UPQA 4IM3A 1BT0A 1WF9A 4AWJA 4KDIC 2W2WA 1EVHA 3QK0A 3ZKJC 2YS1A 2NBVB 2K00A 2IBIB 1V49A 1KZGA 3CXBB 3B08A 1UGMA 2J7QB 4W9IA 4NJ6A 2JWZA 4RM8A 3SO6A 4LDTB 5C5BA 2GCLA 4W9HA 4J6IA 4GPTB 1J8CA 2FIFA 3PG7A 3VTWA 2W2XD 2DKQA 3VOQA 4P7IA 1WI0A 3PS6A 2JP2A 1UBIA 3A8QA 1WGQA 2VRRB 4NPNA 3RD2A 2UZRA 1I2HA 3AULA 3ZDTA 1V5OA 3CMMB 4Y94A 3N32A 4HCNB 4W9LA 4WWOA 2HE7A 1ZW7A 3V60A 2KOXA 2Z0PA 2YT1A 3TCAA 2LGYA 4WAAA 2DZMA 1U27A 3U7DA 1PLSA 3F0WA 2DHKA 2IO1B 4BKTA 2HTHA 2CY5A 3LJUX 2EC1A 2IYDB 2KVRA 2O2VA 5JH5C 1WY8A 4GDLA 2OQBA 5C5BB 4II3B 3L13A 5D94A 1E90A 3KVFB 4HHVA 1Q1OA 2IY0B 3OJ4B 2PZ1A 2KWCA 2ZPYA 1VCBA 1V89A 2V4LA 4CHMA 2K1FA 4C0AA 3DDCB 1WM2A 2KDEB 5C23A 2COAA 1W1HA 2C9WB 1VD2A 2REXA 1PMSA 2L7RA 4HB2B 1WR6E 1C1YB 3BINA 1BAKA 2G35A 2N9PC 2Z0QA 2WX0A 3LDZE 2HTHB 2KX3A 5GOWB 1WI1A 2K6QA 1ZSQA 1WZ3A 5E6PA 3P7ZA 3VTUA 4GDLB 2DZKA 4BKSD 5D3WA 4HPMB 1WXSA 1U2BA 3W1SC 1U5GA 2LZ6A 4IWQA 1FGZA 1FOEA 1U29A 2D2QA 3RCPA 2C60A 3DVNU 4W9CA 1V5TA 3HM6X 2WWZA 2NVUI 2N4FA 2D9ZA 2CKHB 2I5FA 3MHSD 4KZ0A 4NAWB 1WGGA 2K8BA 1UNRA 3MJWA 3JSVB 3WAOA 4BBKA 2NS5A 2KCJA 2OOBB 3DPDA 2CS4A 5AZHA 1GG3A 4LDTD 4IOYX 4ICUA 1I7AA 4AJYB 2LKOA 4AP4C 4MY6A 2K25A 3DVNV 4DXAB 4D0NB 1X11A 1YQBA 2R09A 3ZLZA 5DH9B 1EAZA 2YRYA 1SGHA 1CMXB 1WXMA 2MBBB 1WJNA 4GB9A 4I6NB 4M8MA 1WGUA 2J0JA 2GCJA 2LWPA 2MCNB 3ZNHB 4KDLB 4IC7B 1N3HA 4GU2A 2BGFA 4K7WA 1H10A 2KLCA 3QA8A 2I1JA 1QC6A 1E8ZA 2LVQA 5CHVC 2KQSA 1OY2A 2N23A 3N7CA 4NQLB 5J18A 3TJPA 2M38A 2KMCA 3DVGY 2ASQA 2ZZPB 2IFSA 3QAQA 4LJOB 1Q5WB 2HD5B 4MGYE 2YS5A 3PTFC 2LG1A 3SHQA 1MAIA 3PHWB 2L76A 3KRXA 4CO7A 4KHOA 4EZLA 2QKMA 2KMAA 1WGYA 1WVHA 2CRFA 1KOTA 3RZWC 3V62A 4F7GA 4A3PA 2L05A 2KFKB 2DHIA 4FHJA 1UH6A 3IG3A 3S2AA 3GOEA 5DPRA 3PEGA 4E3CA 1RAXA 3KSYA 3D8FA 1WYWB 3D8EA 1NDDA 2LD9A 2KTFA 5JHHA 3VUXA 5G2NA 4PS7A 4WJ7A 2ZCBA 2MDXA 4M8NA 1V5UA 2N9EB 2JVCA 2ZCCA 3PRPB 2JT4B 1UZXB 5HE3A 2RSGA 5DCNA 3MPXA 2DZJA 3A9KB 2L3ZA 5L81A 1WFYA 5HE2A 4G0NB 3L16A 1R4NI 4F7UP 4KIKB 5J3TA 2GBMA 2KC1A 2DN6A 3ULBA 2DENB 1UNQA 4F1SA 4MM3A 3T06A 3W1YA 1UBQA 2PE9A 3DBHI 5D3YA 5JZEB 2BYEA 2NCNA 2RGNB 1WGHA 4OVVA 4W9JA 1WIAA 2KFJA 1Z2MA 2M14A 1DDVA 4CYEA 3TFMA 1NTVA 4MT7A 5D3XA 4GMVA 4HATB 5JP4A 2KK8A 2ZVNA 4K7UA 4WJPA 1P0RA 3RULA 3PHXB 4HCPB 4MH0E 1QQGA 4KVGB 3HM3A 1WE7A 5KQ1A 3DBRI 1EO6A 4HPLB 5J17A 2D9WA 1X1GA 3QBVB 2UWQA 4DX8A 3N3KB 3FEHA 4XWXA 3QIJA 1EF5A 4XZ4A 2FCNA 4MSMB 2R2OA 4XX5A 3KH0A 2ZEQA 1WXAA 1H8CA 1DBHA 2NBUA 1FGYA 5C16A 4FJYA 3TBLD 5J3QA 2XEWA 3KW5B 1ZVRA 3SYXA 3UIOB 4AUQC 2RSUA 5HE1A 4W9GA 1WX9A 2DX1A 1S1QB 3D8DA 1P5TA 2G45B 1G6JA 3KUDB 2FCQA 3QWZB 4ANUA 2JXXA 4A6FA 5LONB 2H7DA 3TW1A 4X57B 5LLIA 2M4NA 1X1MA 2JRIB 1YX6B 3L10B 4ZDVA 2L0TA 2VSZA 2KUPA 1EUVB 3PVWA 2V3SA 4FA6A 3MTNB 1GNUA 2ZNVB 3QX1A 1X05A 5C1ZA 5KCVA 4DDID 2JZ3B 3QHTA 2XK5A 3A4SC 2FJLA 1WX7A 2KX0A 4HK2A 1LFDA 1KI1B 5LXIB 3RT3B 1MIXA 2VRWB 1WGDA 2LGXA 1R4MI 3PP2A 4EEWA 1JRUA 4GDKB 4IWOA 3A1QB 2WDTB 2K6DB 4B6WA 2MX2A 3EC8A 1RFAA 2DLWA 3GZNI 3GYOA 1NI2A 4WJNA 2A4ZA 3CIKA 4DHJB 1XQQA 1XD4A 4TUUA 4A20A 1MG8A 2KGXB 3NZSA 2PEAA 3P2BA 1V5PA 3AU5A 2IO2B 1GUAB 4EJNA 2DAFA 2BKRB 1KZ7A 4Z2NA 1NTYA 1QZEA 4MK0A 4PNKA 3KZ1A 3A8PA 2GOWA 5KHOA 1SHCA 1DROA 2UVMA 3HK0A 1UD7A 2N7DA 2YLMA 3WIMA 2ZVOA 1U5DA 3F5RA 2DZIA 2OJRA 5J3YA 2FCSA 1XODA 2W9NA 4FHKA 1V5MA 3ODOA 1FXTB 3ULCA 1EGXA 1T0YA 4GMXB 2JUOA 2DYBA 4ANWA 2KWUB 2N7EA 4HAYB 2D9VA 3OLMD 3BJIA 2P8VA 3DBLI 2Y8GA 5CLLB 2R2QA 4PYUA 3DBSA 3UQAA 2COCA 1V2YA 3K9PB 5J2RA 4M0WB 1IYFA 4TQ1A 4ANXA 1Y5OA 1WJ6A 1W1DA 2O2VB 2LVPA 1V88A 2DA0A 4F7HA 2W2XC 4GXBA 1MK9B 4GGQA 3ZNGC 3M62B 2MBHA 1C3TA 4G11A 4FADA 4NQKE 2LRUA 3ALBA 2EMSA 4IFSA 1Q0WB 2AWTA 4FJVB 3SU8X 2P0DA 2X18A 5CHFA 4II2B 4WJQA 4FULA 4ZYNA 1OQYA 3B0AA 3TIXA 5C79A 5DI9B 3RCZA 4MGKE 2MQJA 4JL9A 1U4AA 4BVUC 3U30A 2JY6A 3ZTDA 2L00B 1ZC4B 2NPTA 5D6JB 3H1UA 2CHZA 2JRHA 2UZSA 4TQ0A 2KLGA 2N1WA 1LB1A 4BOSC 4IW0A 1D3ZA 2XBBC 2NBWB 2LRWA 4B95A 5LXHA 4JGHB 3M63B 2CODA 3O65B 1XD3B 4HAWB 2JPHA 2M8SA 2Y7BA 3KUCB 2H7EA 3ZIMA 4A6KA 2KJHB 3A33B 3KRWA 2ZJDA 4HWIB 4BBNF 4K81A 3HIZA 3ODXA 4BKGA 2AL3A 3ZW3A 3TL5A 2YVCA 2LYDA 3OJ3A 4DHJD 2C7HA 2BKFA 2MA9B 2RUKB 4EZJA 4YL8A 2YS3A 1RRPB 2LOZA 4FN2A 2LI5A 2NPTB 4HB4B 4KHBB 3IFWB 3NHEB 2GBRA 1UEFA 1LQBA 2KHWB 1WX8A 5DPWA 2HJ8A 3NY5A 4DX90 1FHXA 2L2IA 4EKUA 2Z59B 2KDIA 2IYBA 1E8WA 3EECA 4PS3A 4WWPA 2EJ8A 3QJZA 4JLCA 1DYNA 2C7MB 3V6CB 2C5LC 1XT9B 2L8JA 1TGZB 4EOYA 2AYOB 2KN5A 4L6EA 3DVGX 5DPTA 3ZUNA 2GBNA 3DQVA 5D2MB 4IWPA 3WANA 4NNJB 4DHZE 1P9DU 2LASA 2LULA 3EHVA 4W9KA 2ELBA 3ENEA 1V6EA 1U5FA 2Z0OA 2KDBA 2FNJB 4HAUB 4WJOA 2ELAA 3PV1A 5E6OA 3L08A 5DPSA 2EMTA 3T9LA 4IUMB 1WGRA 5CX3A 1IRSA 4W9DA 1ISNA 1WH3A 4KAXB 3K9OB 2IO0B 4PYZA 2M17A 1DDWA 1NU2A 2D9XA 3PVUA 3ZRCA 1WJUA 3PLVA 2O6VA 4DDGD 3W1SA 2KTRA 3AU4A 2CHXA 2V76A 1LW3A 4KZCA 3VXWA 5DHAB 3APFA 3RYTA 3ML9A 1AWEA 1J19A 3KUZA 3VVWB 2KJ6A 4EUTA 3VHTC 4EZKA 1FAOA 4F7ZA 3A98B 4B6HA 2IO3B 4W9FA 1WZ0A 2GBKA 4W9EA 2E2XA 3VIAA 4FBJB 3ZVRA 1OMWA 5E6NA 3PSCA 4FJZA 5GMVA 1E5WA 2LXCA 1I35A 2D07B 2Z0DB 1DDMA 2K8CA 2O6VB 3ZTCA 1LXDA 2BPSA 1P3RA 3DXDA 3HQCA 3VH3B 3KY9A 4LJPB 3WAMA 2K2UA 4ICVA 3H7PA 4HVBA 5IAAC 3ZNID 1U5EA 1BWNA 4DHZB 2LJ5A 3APCA 2COFA 1TZ1A 2I5CA 2AL6A 1F9JA 2YT0A 1YJ1A 1E8YA 3CF6E 3IHPC 4FLHA 1E7UA 2KWVB 1I42A 1E7VA 1OQNA 3I3TB 4NY0A 1MK7B 4BKSA 3VDZA 4G3XB 2CHWA 2K39A 4GN1A 4PQ0A 3SD5A 3NS8A 3ZNZB 2KQ7A 3R7QA 2KD0A 4MGZE 2MP2A 3VUWA 1OTRB 4WWNA 3TMPB 5C6RA 3ODWA 5D27A 3U8ZA 4A5KA 4MELA 3A9JA 5CHWA 4ZRJA 5D3VA 1WG7A 3QARA 5FI1A 5TR5A 2UYZB 3PVLA 1Y19B 1X86A 2DHJA 3VUYA 2LVOA 3VQIA 1FB8A 4ZRKA 3OAWA 1RLFA 2N0YA 2YSZA 4I6LB 2KKCA 3T8MA 1GJZA 1XR0B 1OGWA 4A3OA 1UPRA 1K5GB 2G4DB 1PQSA 1TJ6A 2FIDA 3M95A 3A9JB 3N30A 2R0DA 2GBJA 4K7SA 3NZUA 4MEMA 4XC2A 5EFXA 2KDFB 3AXCA 2NMBA 1ZC3B 4HB3B 2KC2A 4KV2A 2KANA 3CSTA 2LGDA 3FM8C 4A6FB 1Y8RC 5JHAA 1OEYA 1M7RA 5L95C 1P1AA 1UNPA 5CTRC 2KNBA 2PJHA 1TBEA 3O96A 3IVFA 2O6VD 3WYFB 3X0WA 4LCDE 2GMIC 1WR1A 2XK5B 3HW2B 4BOZB 3QWMA 1WJ4A 1L2NA 1P98A 2AEHA 1OEYJ 3R3MA 2LUEA 2M0XA 3PREA 4E71A 4TV3A 2Q13A 2BCJA 1YD8U 5D7GA 2MWNB 4NJ7A 3ZVVA 2PPHA 3UIPB 4HJKA 1V61A 1XCGA 2MKRA 4EMOA 3PRZA 2A5UA 4OVUA 2WYQA 3UF8A 2RPQA 4ASWC 3ONSA 3AJ4A
chains in the Genus database with same CATH superfamily
4PS8A 4GZUA 3L54A 4HAXB 3ML8A 1XX0A 4IOIE 1WJMA 4KGTA 2MBOA 3DCGA 4NAWA 1MI0A 3PLUA 4WH4A 1LGRA 4JIOU 4TYZA 1XKEA 1TXDA 4FXCA 3V61A 1ZM0A 2NZ8B 3JSVA 1GC7A 2W3RA 3MFGA 1MPHA 4C00A 4DBBA 3T3OA 5HI1A 2BWFA 4L2YA 2KZRA 4XWTA 1KLVA 4ZRIA 3B1LX 2J0KA 3D32A 2DLBA 4WIPA 2K0PA 4PT5A 1V1OA 4LNFA 3R7RA 2MSED 4GOCA 1SSNA 5HFYA 3M1IB 1UWXA 2LXAA 2KT7A 1X1FA 4KSKC 2D10A 4HDQA 1W1GA 1JMLA 5FK9C 2MBEA 1V80A 2IY1B 3C0RB 3ZGZA 3DHHC 2JF5A 3AE1B 3LJ3A 3MC8A 1N62A 2ZW0A 3I5JC 3UQBA 4HAZB 1J0GA 2QKLA 4E74A 1C9FA 1P6SA 2CU3A 5G55A 3N1XC 4WQMA 3RZFA 2LHDA 2MRPA 3DWGC 3NW8A 3NWFA 3UINB 3UZTA 3H7SA 5KHQA 2JX5A 2X8XX 2PIAA 1BTKA 4ZRQA 3N1YC 2NTSA 2PE6B 3WA0A 4A6HA 3BVZA 1DOXA 5HKHA 1VZ8A 3HSAA 3Q69A 2VKIA 3G9WA 4CHJA 3ZO5B 2WX1A 4KGRA 2MLBA 2KO3A 2WU2B 4MJSA 3UGBB 2WXPA 2BYVE 4GIVA 2RGFA 4NAMA 1F0ZA 3ECIA 5FI0A 2ROVA 2OEDA 1EWCA 2BF8B 1J7BA 1KLGD 3L17A 4XGAB 2W82A 4QXAB 4K17A 2BQQA 2I2YA 2CY4A 4YWGG 2MH7A 3V6EB 1NBFC 3KWVA 3SNHA 1RFKA 4URKA 3ZRFA 3PSEB 3CSFA 4I6PA 4GSWA 2DYQA 1ET9A 4H8SA 3P6AA 2DAJA 2JZPA 4IM2A 2D3GA 2YEPB 4HXDA 1M94A 1KM7A 3MDBC 4YONA 1V81A 3Q3NC 1SF0A 1RRBA 3TO1A 3HVDA 4DK5A 4LNNA 4MDKE 3QQ8B 3NVVA 2DYOA 3ZDMC 2KWDA 5HE0A 2MBQA 1C78A 3SFEB 2C7NB 3HVZA 3HIEA 2WXRA 5AZFA 2KYWA 2XN9C 2INPE 2KFKA 2Q5WD 4IDIA 2RLOA 1C4AA 4RM9A 4Z2MB 4MJSB 2QSDA 3SR6A 1P3QU 2RNRB 2ZNVC 3L0WB 2GLSA 4OZAA 4F8CB 1Z87A 2RD0A 2QHOA 1IP9A 3GYPA 1AN8A 2LOXA 3DXCA 1K51A 2MWSB 4OZBA 2N9XA 3LYYA 2M56B 4K2PA 2PLPA 4BBNC 2IJ0A 4HJGE 1LO5D 3A4RA 3M3JA 1AARA 2MW5A 1TTNA 2JZZA 1ZDVA 3JYUA 1YJIA 1FHWA 5EDSA 5FR6A 4AOFA 5DIFB 4WSFA 3A9KA 1E9MA 2JXTA 3VH4B 4ARIA 1YIWA 1Z5SB 1MPEA 2G4SA 1GC6A 1F52A 1CZPA 3JVZX 4OW0A 3OANA 4HDOA 3AN1A 2RVBB 3NSUA 5JLJB 1AQCA 1MIZB 5BO4B 4KIKA 4WQOB 4HEA1 4IG7B 3VAWA 1BTNA 2NR2A 5DHFB 4WVFB 3PRMB 4D6WA 1XLPA 2V1YA 4G50A 1KJTA 1K5DB 3VTVA 1B55A 2GJYA 2D11A 1VLBA 3EFUA 1D5XC 4XDCA 4AJWA 2DYNA 3APDA 2FAZA 2GS0A 1V9JA 2ROZB 2G9HD 3Q8EA 3PPAA 4LNKA 3SDLC 5IA7A 2IZVB 2Z4DA 3E56A 4GLSC 1ZGUB 3SFDB 5CLQB 1I4PA 2B76B 2CAYA 1ZKHA 1WE6A 3Q3FA 1J0WA 4RNAA 2Z14A 5KQ4A 1EU4A 2JWUA 1TKYA 4MSQB 3I57A 2P0FA 3PGEA 5G5GA 4P1CC 2DX5A 1N5XA 5LOPB 3CIRB 2Y5BB 4ZHPA 4P6VF 4IKGA 2ADZA 4CQNA 1I4RA 4RMAA 1PFDA 4IAPA 2N1VA 2B3AA 3HHMA 2D9YA 3P4RB 2IGDA 3NOBA 3JW0X 4OT1A 2J59M 1WRDB 1YX5B 3IBEA 2M1MA 1P7EA 3VFKA 3FSSA 1L4ZB 3BYYB 1VZ7A 2QILA 5L83A 1EF1A 1Q67A 2DFKA 2P0HA 2BWES 2K2JA 2JQRB 3RNFC 2D4QA 1D5MC 2KTRB 4XE0A 2AX5A 3MP9A 4B9KA 3U12A 1MKEA 3AE9B 3BWUD 1LM8B 5IKCM 4S17A 3IT4B 2OTXA 3PZDA 1WMHA 1WM3A 4N9F4 3H6NA 3ZQ4A 1IPGA 3ETRA 2CU1A 4HLEA 1D6EC 4RH6A 3PT2B 1KTKA 3BK1A 1PFJA 4HSIA 2DX5B 4ANVA 3QCAA 2XQNM 2KXJA 1WJ1A 2ZW1A 1M7EA 5BYRA 3ML4A 5HHDG 1K8RB 2DKPA 2CR5A 1MHXA 2Y8FA 3SV1A 1RJ2A 2MJEA 2L0FA 4MACA 5IO9A 1FHOA 2MFQA 2YF0A 4IM0A 4EFOA 3BY4B 2DHZA 2RR9A 3KYDD 3WALA 4C80A 4ZOHC 3AI5A 1HE8A 3AE2B 4O1NA 4YXDB 1V8CA 1TQZA 1L7YA 3Q3JA 4DBGA 5JHGA 1XXGA 4KHAA 2Z0EB 1DYQA 1PYWD 3DXEA 3V5WA 3FKYA 2WXJA 3QC8B 4MGIE 3RUIB 4BAXA 3SUZA 3Q3MC 3KYCD 3H7PB 2TSSA 4BFRA 1WMHB 4HB0B 1VDVA 3TVVA 1C76A 2DTCA 1WYGA 1H4RA 3X23A 1SIFA 1S3SG 2BYFA 1V86A 4JQWC 3VR8B 1ZDXA 2V3NA 4YSYB 2EKEC 3OG5A 2Z13A 1FMAD 2K8HA 4HAVB 4A55A 2FUHB 2VH1A 2LMCA 2L1CA 3NJTA 5AZGA 1UELA 1JWBD 4DWFA 2I1KA 4K1RB 3AEBB 4CHKA 1PGAA 3Q8BA 5AEKB 4KSLC 1FXIA 4NSWA 1SE9A 1IGCA 2G3QB 2ZPNA 3DOWA 1WXVA 1E10A 3R66C 1SE4A 2KJRA 3H9DA 4GNKB 1VRAB 1E8XA 3I63C 3WAPA 2WU5B 4K2OA 5JHBA 2DYMA 4GDKA 1JWUD 3A1QA 3AECB 4TKNA 4XYCA 3HUIA 2FCMA 2MP2B 3RN9C 1A5RA 3R2TA 1D4BA 5E6JA 4KKJA 1WSPA 3GB1A 1CJEA 2J0MA 1QKZA 3Q8FA 1UPQA 1XF5L 3BYTB 4IM3A 1IBXA 5H8YE 1BT0A 1WF9A 2QDFA 4KDIC 4AWJA 1NEKB 2W2WA 1EVHA 3QK0A 3ZKJC 1YNTE 5M4YB 2WDQB 4ZYSA 2YS1A 2WXHA 2NBVB 2K00A 2IBIB 1V49A 1RWSA 1KZGA 3CXBB 2WXQA 3B08A 2N0SB 3ZJTA 1UGMA 1SXTA 2J7QB 4W9IA 4NJ6A 2JWZA 4RM8A 3SO6A 1MG4A 5BYQA 4LDTB 5C5BA 2GCLA 4W9HA 4J6IA 4GPTB 1J8CA 2FIFA 3PG7A 2PVOD 4OHJA 3OWEB 2H89B 3VTWA 2W2XD 2DKQA 1XLOA 3VOQA 4P7IA 1WI0A 3PS6A 2JP2A 5I2SA 3T3NA 1UBIA 3A8QA 1WGQA 2VRRB 4NPNA 5TSSA 1QT9A 3RD2A 2UZRA 1I2HA 3AULA 3ZDTA 4ITKA 1V5OA 3CMMB 2FE8A 4Y94A 4KX6B 3N32A 1ROEA 4HCNB 4W9LA 3ZYYX 2E6XA 2E3TA 4WWOA 2HE7A 1EWYC 1TS5A 1ZW7A 1IBXB 3V60A 2KOXA 2Z0PA 2YT1A 3TCAA 2LGYA 4YSXB 2FJUB 4WAAA 2DZMA 1U27A 3U7DA 1PLSA 3F0WA 2DHKA 1ET6A 2IO1B 4LTUA 5C2TB 4C56C 4BKTA 4M0WA 3GE3C 4H2AA 2HTHA 2CY5A 3LJUX 5FKAC 2EC1A 2IYDB 2KVRA 4RGOS 2O2VA 5JH5C 1SIJA 1WY8A 3Q8CA 2GRIA 4GDLA 2IGGA 2OQBA 3P4QB 2L52A 5C5BB 1TS3A 2WS3B 3N1ZC 1HTQA 3IAM1 4II3B 3L13A 4LK0M 2J53A 5D94A 1E90A 3KVFB 4HHVA 3U4EG 4AS1A 1Q1OA 2IY0B 2Y5CA 3OJ4B 1HXYD 2PZ1A 2KWCA 2ZPYA 1VCBA 3L4PA 1V89A 2V4LA 1F2RC 5G5HA 1I4QA 4CHMA 2K1FA 4C0AA 3DDCB 2X38A 1WM2A 2KDEB 1FCLA 4D2KA 3I9V1 5C23A 2COAA 2ICIA 5EE3A 1W1HA 2C9WB 2KUQA 1VD2A 4JE3B 1FPYA 4XWWA 1MJDA 2REXA 4LLGM 1PMSA 2L7RA 2WXGA 4HB2B 1WR6E 3EUB2 2BS4B 3ZJVA 1C1YB 3BINA 1BAKA 3C19A 2G35A 2N9PC 1TKEA 3WCQA 2Z0QA 5EE1A 1L6UA 2WX0A 3VR9B 3LDZE 2HTHB 4A8XC 4C4VB 2N9LA 4HKQA 2KX3A 4P16A 5GOWB 2BS2B 1WI1A 1IGDA 1ZSQA 2K6QA 1XCQL 3EFCA 1WZ3A 5E6PA 3P7ZA 3VTUA 3W9CB 4GDLB 2DZKA 4BKSD 5D3WA 4HPMB 1WXSA 1U2BA 3W1SC 1U5GA 2JSVX 4QJ4B 1T0RC 2DBYA 1P7FA 2LZ6A 4IWQA 1FGZA 1BMLC 1FOEA 1U29A 2PKOA 2D2QA 3RCPA 2C60A 3DVNU 4W9CA 2ACZB 2QEJC 1V5TA 1FNWA 3HM6X 2WWZA 2NVUI 2WNMA 2N4FA 2D9ZA 2EELA 5C3JB 5LG4B 3BIID 2CKHB 2I5FA 3MHSD 4KZ0A 4NAWB 1FFVA 1WGGA 2K8BA 1UNRA 1K52A 1OQQA 2G1EA 2K22A 3MJWA 3JSVB 5AUIA 4KHBA 3WAOA 1FXAA 4BBKA 2NS5A 1HEZE 2KCJA 2ONQA 1STEA 2OOBB 3DPDA 2CS4A 2KAJA 5AZHA 1SE3A 1GG3A 2M19A 4LDTD 5EE9A 4IOYX 2Z59A 2K3UA 4ICUA 1I7AA 4AJYB 3J9CA 3VRBB 2LKOA 4AP4C 1FD6A 1T5XD 3KLSX 4MY6A 2IGHA 2RPVA 1BUIC 2K25A 3DVNV 4ARCA 3A58A 4DXAB 1HQRD 4D0NB 2LUMA 1X11A 3MC0B 4RGMA 1YQBA 1TYGB 2R09A 3ZLZA 1JWAD 5DH9B 1EAZA 2YRYA 4DQOC 3AE4B 1SGHA 3BVGA 1DOIA 1CMXB 1WXMA 3IAS1 5AUKA 1M4VA 2MBBB 1WJNA 4C7YA 4GB9A 4I6NB 2V3PA 2WDVB 4M8MA 1WGUA 2J0JA 2GCJA 2LWPA 3NVZA 2MCNB 3ZNHB 3BZDB 4KDLB 1YMHE 3FC4A 4IC7B 1N3HA 2BB6A 3KWLA 3PO0A 2IPKD 2BGFA 4GU2A 4K7WA 1H10A 2KLCA 3QA8A 4N59A 1ZOYB 3W2DA 2I1JA 4TMAB 1QC6A 1E8ZA 2LVQA 1WGKA 1UNSA 1R4NB 5CHVC 2KQSA 2K49A 3U52E 1OY2A 2N23A 2M0AA 3N7CA 4NQLB 4QJ3B 5J18A 3TJPA 2M38A 2KMCA 3DVGY 2ASQA 1TS2A 2ZZPB 2IFSA 1PDXA 3QAQA 4LJOB 4LNIA 1Q5WB 2HD5B 4GOUA 3AE6B 4MGYE 2YS5A 3DBHB 1L6VA 3PTFC 2WP9B 1ZXIA 2LG1A 1QOBA 2PW9A 3SHQA 1MAIA 3PHWB 2QCZA 2L76A 3KRXA 4CO7A 4KHOA 1NVID 4EZLA 2QKMA 2KMAA 2WQYB 1WGYA 4L1BA 1WVHA 2CRFA 1KOTA 3RZWC 3V62A 4F7GA 2KDMA 4A3PA 2L05A 1UGJA 1ZXHA 2KFKB 2DHIA 4FHJA 3Q6BA 1F77A 1UH6A 3IG3A 3S2AA 1GPXA 1MI1A 3GOEA 5DPRA 3PEGA 4E3CA 1RAXA 3KSYA 2JU6X 3D8FA 1WYWB 3D8EA 4MH8A 1NDDA 2LD9A 2KTFA 3AEEB 5JHHA 3VUXA 5G2NA 4WJ7A 4PS7A 2ZCBA 2MDXA 4M8NA 4DIXA 1V5UA 1C4PA 2N9EB 2JVCA 2ZCCA 1AW7A 3MHZA 1PGXA 3PRPB 2JT4B 1UZXB 3NWDA 5HE3A 2RSGA 3AE8B 5DCNA 3MPXA 1YN5A 3ZJUA 2DZJA 3A9KB 2L3ZA 3W5VB 4US8A 4OZCA 5L81A 1WFYA 5HE2A 3AEGB 4ZRPA 4G0NB 3L16A 2BW2A 1R4NI 2OJWA 1ACCA 4F7UP 3NG0A 4KIKB 5J3TA 3HRDD 1NYQA 2GBMA 2KC1A 2DN6A 3ULBA 3P63A 3FVCA 1UNQA 2DENB 4F1SA 3RPFC 4MM3A 3T06A 3RNGC 2KIEA 1ZP0B 3W1YA 1UBQA 2PE9A 3DBHI 4RFBA 1E6EB 1TJEA 2J42A 5D3YA 5JZEB 1C4CA 2BYEA 1L4DB 2NCNA 2RGNB 1WGHA 4OVVA 4W9JA 5EE0A 1WIAA 2KFJA 4KGSA 1Z2MA 2I38A 2M14A 3AE5B 4C7ZA 1DDVA 3NWAA 4CYEA 3TFMA 3NUHB 1NTVA 4MT7A 1E7PB 5D3XA 4GMVA 2N9KA 1K50A 1YOVB 1FEHA 4HATB 5JP4A 2KK8A 2ZVNA 4K7UA 4WJPA 3U7ZA 4DXFA 1P0RA 3RULA 4HRSA 3FAHA 1L0XB 3PHXB 3VRAB 4HCPB 4MH0E 1QQGA 3ABVB 4KVGB 1WE7A 5KQ1A 3HM3A 3DBRI 1AYFA 2D3BA 1EO6A 4HPLB 5J17A 1WXQA 5HG2A 2D9WA 1X1GA 1CK1A 3SEBA 3QBVB 2UWQA 2W55A 4WAFA 4DX8A 3N3KB 2V0GA 4M01A 3FEHA 1GB1A 4XWXA 3QIJA 5BMHA 1EF5A 2EKIA 4XZ4A 2FCNA 4MSMB 2R2OA 2BS3B 3KH0A 4XX5A 1JALA 2ZEQA 2D5GA 1WXAA 1H8CA 2WXKA 1DBHA 2NBUA 1FGYA 5C16A 3V05A 4FJYA 4B0EA 2QJLA 5JXVA 3TBLD 4AQ7A 5J3QA 2XEWA 3N20C 3B9JA 2KN4A 3KW5B 2FBWB 1ZVRA 4BZAA 3GZNB 5FR3A 3SYXA 3UIOB 4AUQC 2ZKMX 3BK2A 3AM9A 2RSUA 5HE1A 4W9GA 1WX9A 3LXFA 3Q14C 2DX1A 1S1QB 3D8DA 1P5TA 2G45B 1G6JA 3AEDB 3GS2A 4HPPA 3KUDB 2FCQA 3QWZB 4ANUA 2JXXA 4A6FA 5LONB 2H7DA 3TW1A 4X57B 5LLIA 2M4NA 1X1MA 2JRIB 2WHIA 1V1PA 1I4HA 1YX6B 1HA5A 3L10B 4ZDVA 5H92C 2L0TA 2VSZA 2KVZA 2KUPA 1EUVB 2GB1A 3PVWA 2V3SA 1VZ6A 4FA6A 3MTNB 1N6ZA 1GNUA 2ZNVB 3QX1A 1X05A 3AE7B 5C1ZA 5KCVA 4DDID 2JZ3B 1KLUD 1UWMA 3QHTA 2XK5A 1N60A 1ZUD2 3A4SC 2FJLA 2RDHA 1TY2A 1WX7A 2KX0A 4HK2A 1LFDA 1KI1B 5LXIB 1DGJA 1JRPA 3RT3B 1MIXA 2VRWB 1KH0A 3RNCC 2W3SA 2R61A 3DBLB 1WGDA 1RYJA 4WWMA 2AQ2B 2LGXA 1R4MI 3PP2A 4EEWA 1JRUA 3GE8C 1L5PA 4GDKB 4IWOA 3R8BA 1QOFA 2WDRB 3A1QB 2WDTB 2K6DB 2SAKA 2MX2A 3EC8A 4NJCA 4B6WA 1RFAA 4REZA 2DLWA 2QIEB 3GZNI 3AEAB 3GYOA 1NI2A 4WJNA 1T77A 2A4ZA 3CIKA 4DHJB 1V1PB 4OSNA 1XQQA 1XD4A 4TUUA 4A20A 2K8EA 1MG8A 2KGXB 2OHFA 3NZSA 2PEAA 2NMQA 3P2BA 1V5PA 3AU5A 1JROA 5D3DA 2IO2B 1SBBB 1GUAB 4EJNA 2DAFA 2BKRB 3N9YC 1KZ7A 2HTME 2WXMA 4OVZA 4A90A 4Z2NA 1YQ3B 1NTYA 2INNE 1QZEA 4MK0A 3TEYA 4PNKA 4YSZB 2HJ1A 3KZ1A 3A8PA 2GOWA 2XNAC 5KHOA 1SHCA 1DROA 2UVMA 3HK0A 1UD7A 3TEWA 4JWUC 2N7DA 2YLMA 3WIMA 2ZVOA 1IUEA 1U5DA 2PVGC 3F5RA 4ACFA 2DZIA 1JWMD 1KFYB 4HKZE 2OJRA 5J3YA 2FCSA 1XODA 2H88B 2W9NA 1E0ZA 2K9XA 1N61A 4FHKA 1V5MA 3ODOA 1FXTB 3ULCA 1EGXA 5GXGB 1T0YA 1C79A 4RGTA 4GMXB 2JUOA 2DYBA 4ANWA 2KWUB 1MFWA 2JYTA 2N7EA 4HAYB 1MHHE 2D9VA 2Z8LA 3OLMD 3BJIA 3OHMB 2P8VA 3DBLI 3EA6A 2DWQA 2Y8GA 5CLLB 4TSSA 1SE2A 2R2QA 4PYUA 3DBSA 2L83A 3UQAA 2COCA 1V2YA 3DHGC 3K9PB 5J2RA 4HROA 3Q8AA 4M0WB 1IYFA 1XLQA 4N58A 4TQ1A 4ANXA 3PZ7A 1Y5OA 1WJ6A 1ZYIA 1W1DA 2BT6A 2O2VB 2LVPA 1V88A 2DA0A 3P1MA 1T0SC 4F7HA 2J52A 1VR9A 1OFFA 2W2XC 4GXBA 1MK9B 4GGQA 1SEBD 1V97A 2L1AA 2MBHA 3M62B 3ZNGC 1B1ZA 4G11A 4FADA 1C3TA 4NQKE 5I2MA 2LRUA 3ALBA 2EMSA 4IFSA 1Q0WB 2AWTA 4FJVB 2YT2A 2BYTA 3SU8X 2P0DA 2X18A 5CHFA 1J7AA 1FIQA 4II2B 2VZKB 1Y56A 3RFZB 4WJQA 4FULA 4NZLB 2LEKA 4ZYNA 1OQYA 3B0AA 3TIXA 1F1HA 5C79A 2UU7A 5DI9B 1QLBB 3RCZA 4MGKE 1T0QC 2MQJA 1XO3A 1KRHA 1RM6C 2NTTA 4JL9A 1U4AA 3B2GA 4BVUC 3U30A 5T8IA 2JY6A 2INDC 3ZTDA 2L00B 1ZC4B 2NPTA 5D6JB 3H1UA 2CHZA 2JRHA 4M02A 2UZSA 2RMMA 4TQ0A 2KLGA 2N1WA 4R3DA 1LB1A 4BOSC 4IW0A 1D3ZA 2XBBC 2NBWB 2LRWA 4B95A 2LJIA 5LXHA 4LNOA 1WRIA 4JGHB 3M63B 1J7CA 2CODA 3O65B 1XD3B 4HAWB 2JPHA 2M8SA 2Y7BA 3KUCB 4S0RA 2H7EA 3ZIMA 4A6KA 1TT5B 2KJHB 3A33B 3KRWA 2ZJDA 4HWIB 4BBNF 4K81A 3HIZA 1FNUA 4KKIA 3ODXA 4BKGA 2AL3A 3ZW3A 5BMIA 3TL5A 1HZ6A 2YVCA 2LYDA 3OJ3A 4DHJD 2C7HA 2BKFA 2MA9B 2RUKB 4USAA 4EZJA 4YL8A 2YS3A 3DHIC 1RRPB 1XCTL 2LOZA 4FN2A 2LI5A 1EM7A 1C77A 2NPTB 1QILA 1FRRA 4HB4B 4KHBB 1UUPA 3IFWB 3NHEB 2GBRA 1UEFA 3EGRA 1LQBA 2KHWB 2Y3AA 5IN7A 1WX8A 2V4IB 5DPWA 2HJ8A 4WURA 3NY5A 1TIFA 2AQ1B 3RNEC 2WGSA 4DX90 2W54A 1FHXA 3P4SB 2L2IA 4EKUA 2Z59B 2KDIA 4UDUC 2IYBA 2PMVA 1E8WA 1DOYA 3Q2AC 1PGBA 3EECA 3NRZA 4PS3A 4WWPA 2EJ8A 3QJZA 4JLCA 1DYNA 2C7MB 3V6CB 2C5LC 3URYA 1XT9B 1TY0A 3AV8A 2L8JA 1TGZB 4EOYA 2AYOB 3ZXRA 2KN5A 3GP7A 4L6EA 4K3CA 4EE2A 2AQ3B 3DVGX 5DPTA 3ZUNA 2GBNA 1JW9D 3DQVA 5D2MB 2LFIA 2MJ3A 4IWPA 3WANA 4NNJB 4DHZE 1P9DU 2LASA 2VH2A 3UI3A 2K5PA 2LULA 3EHVA 4W9KA 2ELBA 3H8HA 3ENEA 1V6EA 4QAYA 1U5FA 2Z0OA 1SB3C 2KDBA 2FNJB 4HAUB 4WJOA 3Q3OC 2ELAA 3PV1A 5D3IB 5E6OA 3L08A 5DPSA 2EMTA 1I7HA 3NS1A 2FUG1 3T9LA 1XLNA 4IUMB 1GOZA 1GAQB 1WGRA 1NENB 5CX3A 2BB5A 4A9AA 1IRSA 1T3QA 4W9DA 1ISNA 2PTLA 3NVWA 1WH3A 4KAXB 3K9OB 2IO0B 4PYZA 2M17A 1DDWA 1NU2A 2D9XA 2VZKD 1I4GA 3PVUA 3ZRCA 3C8YA 4J3OD 1WJUA 3PLVA 1N63A 2J4XA 3DBRB 2O6VA 4DDGD 3W1SA 2KTRA 3AU4A 1K53A 1OQRA 2CHXA 3KQ4A 2V76A 1LW3A 4KZCA 3B2FA 5DHAB 3VXWA 3APFA 2MJDA 3RYTA 1YN4A 3IT6B 3ML9A 1AWEA 1J19A 3KUZA 3V3XA 3VVWB 2BVCA 2KJ6A 5MPOA 2LHEA 4EUTA 3VHTC 4EZKA 1FAOA 4F7ZA 3A98B 1QOGA 4QJ5B 3AEFB 2R2YA 1QF6A 4B6HA 2IO3B 4A6QA 4L1RA 4W9FA 2KQ4X 1WZ0A 1ENFA 2GBKA 4W9EA 2E2XA 3VIAA 4FBJB 3ZVRA 2LGIA 1OMWA 4YTPB 1CQVA 5E6NA 3PSCA 1FCCC 4FJZA 4N6EB 1E5WA 4RGNA 5GMVA 1JQ4A 2LXCA 1I35A 2D07B 2Z0DB 1DDMA 1QOAA 2K8CA 1FFUA 2O6VB 3FILA 3ZTCA 1LXDA 1I4XA 2BPSA 3TSSA 1P3RA 1TKGA 3DXDA 3HQCA 2L32A 1Q10A 3VH3B 2IDYA 3KY9A 4LJPB 3WAMA 4JPSA 2K2UA 1TZOA 3H7PA 4ICVA 4JWSC 4HVBA 1KF6B 5IAAC 1WWTA 3ZNID 1U5EA 1BWNA 4DHZB 4YT0B 1QQRA 3BVMA 1JCKB 2LJ5A 3APCA 1YQ4B 2COFA 1TZ1A 2I5CA 2WXNA 2AL6A 3RNBC 1F9JA 2YT0A 1YJ1A 1E8YA 4MM3B 3CF6E 3IHPC 4FLHA 1NYRA 4RF0A 1E7UA 1VJKA 2KWVB 1I42A 2KR0A 1E7VA 5IRSA 4DXGA 1OQNA 3I3TB 4NY0A 2N7JA 1MK7B 1FNVA 2YEPF 4BKSA 1F2RI 4Q2JA 3VDZA 2MHJA 4G3XB 1EU3A 2V9HA 2CJOA 2CHWA 2K39A 3B77A 4GN1A 4PQ0A 3SD5A 3NS8A 1R4MB 3FILB 3ZNZB 2KQ7A 3R2IA 2KD0A 3R7QA 2ON8A 4MGZE 2MP2A 3VUWA 1XEEA 1OTRB 1UF0A 4WWNA 3TMPB 5C6RA 5I4DA 3ODWA 5D27A 2KMMA 3U8ZA 4A5KA 4MELA 4CSQA 3A9JA 4K3BA 3TEXA 3P42A 5CHWA 2WXLA 4ZRJA 5D3VA 2KIGA 1WG7A 3IXSA 2Y5PA 3QARA 5FI1A 5TR5A 1PUTA 3P4PB 2CJNA 2UYZB 2NBVA 4JX1C 3PVLA 1Y19B 5BMGA 1X86A 4XDDA 2DHJA 3VUYA 3O13A 2LVOA 1FM0D 3RNAC 4ZHOA 3VQIA 1FB8A 4ZRKA 3OAWA 1R7SA 3AH7A 2WLBA 1RLFA 2N0YA 2YSZA 4M00A 4P1BC 1YN3A 2INCC 4US9A 4I6LB 2QC8A 2KKCA 3T8MA 3ZXVA 4B0MA 2KACA 1GJZA 1XR0B 1OGWA 4A3OA 1UPRA 2GI9A 3PZ8A 1K5GB 2RDGA 2G4DB 3MJ5A 1PQSA 1HTOA 1B9RA 1BXTA 1TJ6A 3NZ3A 2FIDA 3M95A 3AE3B 3A9JB 4YTNB 1L0YB 1FRDA 3MC9A 3N30A 2R0DA 2GBJA 1FO4A 1A70A 4K7SA 4MT5A 3NZUA 4MEMA 2DNFA 4XC2A 5EFXA 1NI3A 2KDFB 3AXCA 1SJHD 2NMBA 3RI7C 1ZC3B 4HB3B 2KC2A 4KV2A 2KANA 3CSTA 1JWSD 2LGDA 3FM8C 4A6FB 1Y8RC 5JHAA 3DWMA 1OEYA 3U2SC 1M7RA 2HDEA 3CWIA 1ZE3D 1ZPSA 2MEKA 5L95C 5LNK1 1P1AA 1UNPA 3AB5A 5CTRC 2KNBA 2PJHA 1TBEA 2D3AA 3O96A 1T6BX 3IVFA 2O6VD 3WYFB 3TUOA 3X0WA 5BYSA 3AMZA 4LCDE 3LB8C 4RCOA 2GMIC 1YJJA 1WR1A 2XK5B 4YTMB 3HW2B 4BOZB 3QWMA 5IOIA 1WJ4A 1MVKA 2LGSA 1L2NA 3DCXA 1P98A 2AEHA 1OEYJ 1D5ZC 2LUEA 1ESFA 2M0XA 3R3MA 2SEBD 3PREA 2WXFA 2WXIA 4E71A 1L0VB 3W5UB 4TV3A 2Q13A 2BCJA 3E9SA 2GUMA 1YD8U 2BBCA 5D7GA 1N5WA 2QMTA 4RF1A 4C4VA 2MWNB 2D3CA 1HZ5A 4NJ7A 3ZVVA 4PK1A 2RRFA 2BTEA 2PPHA 2WXOA 1SJED 3UIPB 4HJKA 1V61A 1XCGA 2MKRA 5IP4D 4EMOA 3PRZA 4L23A 3TEZA 1TS4A 3RMKC 2A5UA 4OVUA 2RDBC 2WYQA 1AWDA 2JYEA 3UF8A 3NVYA 2RPQA 4ASWC 3ONSA 3AJ4A 1GB4A
chains in the Genus database with same CATH topology
4PS8A 4GZUA 3L54A 4HAXB 3ML8A 1XX0A 1WJMA 2MBOA 3DCGA 4NAWA 3PLUA 4JIOU 4TYZA 1XKEA 1TXDA 3V61A 1ZM0A 2NZ8B 3JSVA 1GC7A 1MPHA 4DBBA 2BWFA 2KZRA 1KLVA 4ZRIA 3B1LX 2J0KA 3D32A 3R7RA 2MSED 4GOCA 3M1IB 2LXAA 1X1FA 4KSKC 2D10A 4HDQA 1W1GA 2MBEA 1V80A 2IY1B 3C0RB 2JF5A 3LJ3A 3UQBA 4HAZB 1J0GA 2QKLA 4E74A 1P6SA 5G55A 3RZFA 2MRPA 3UINB 3UZTA 3H7SA 5KHQA 1BTKA 2PE6B 3WA0A 4A6HA 5HKHA 2VKIA 3G9WA 4CHJA 3ZO5B 2WX1A 2MLBA 2KO3A 4MJSA 3UGBB 2BYVE 4GIVA 2RGFA 3ECIA 5FI0A 2ROVA 2BF8B 3L17A 4K17A 2CY4A 3V6EB 1NBFC 3SNHA 4URKA 3ZRFA 3PSEB 3CSFA 4I6PA 4GSWA 2DYQA 4H8SA 3P6AA 2DAJA 4IM2A 2D3GA 4HXDA 1M94A 1KM7A 3MDBC 4YONA 1V81A 1RRBA 3TO1A 4DK5A 4MDKE 3QQ8B 2DYOA 3ZDMC 5HE0A 2MBQA 2C7NB 5AZFA 2KFKA 2RLOA 4RM9A 4Z2MB 4MJSB 1P3QU 2RNRB 2ZNVC 3L0WB 4F8CB 1Z87A 2RD0A 2QHOA 1IP9A 3GYPA 2LOXA 3DXCA 2MWSB 2N9XA 4K2PA 4BBNC 3A4RA 3M3JA 1AARA 2MW5A 1TTNA 2JZZA 3JYUA 1FHWA 5EDSA 5FR6A 4AOFA 5DIFB 4WSFA 3A9KA 3VH4B 1YIWA 1Z5SB 2G4SA 1GC6A 3JVZX 3OANA 4HDOA 2RVBB 3NSUA 5JLJB 1AQCA 1MIZB 5BO4B 4KIKA 4WQOB 4IG7B 3VAWA 1BTNA 2NR2A 5DHFB 4WVFB 3PRMB 2V1YA 4G50A 1KJTA 1K5DB 3VTVA 1B55A 2GJYA 2D11A 3EFUA 4AJWA 2DYNA 3APDA 2FAZA 2GS0A 1V9JA 2ROZB 3PPAA 3SDLC 5IA7A 2IZVB 1ZGUB 5CLQB 2CAYA 1ZKHA 1WE6A 3Q3FA 1J0WA 5KQ4A 4MSQB 2P0FA 3PGEA 2DX5A 5LOPB 2Y5BB 2ADZA 4RMAA 4IAPA 2N1VA 2B3AA 3HHMA 2D9YA 3NOBA 3JW0X 2J59M 1WRDB 1YX5B 3IBEA 2M1MA 3VFKA 3FSSA 5L83A 1EF1A 1Q67A 2DFKA 2P0HA 2BWES 2K2JA 2D4QA 2KTRB 4B9KA 1MKEA 1LM8B 2OTXA 3PZDA 1WMHA 1WM3A 4N9F4 3H6NA 4HLEA 1IPGA 2CU1A 3PT2B 1PFJA 2DX5B 4ANVA 3QCAA 2XQNM 2KXJA 1WJ1A 1M7EA 3ML4A 1K8RB 2DKPA 2CR5A 2Y8FA 3SV1A 1RJ2A 2L0FA 1FHOA 2MFQA 2YF0A 4IM0A 4EFOA 3BY4B 2DHZA 2RR9A 3KYDD 3WALA 3AI5A 1HE8A 1TQZA 1L7YA 3Q3JA 4DBGA 5JHGA 4KHAA 2Z0EB 3DXEA 3V5WA 3QC8B 4MGIE 3RUIB 3SUZA 3KYCD 3H7PB 4BFRA 1WMHB 4HB0B 3TVVA 2DTCA 1H4RA 3X23A 1SIFA 1S3SG 2BYFA 1V86A 4JQWC 2EKEC 2K8HA 4HAVB 2FUHB 2L1CA 5AZGA 1UELA 4DWFA 2I1KA 4K1RB 4CHKA 5AEKB 4KSLC 4NSWA 1SE9A 2G3QB 2ZPNA 3DOWA 1WXVA 3R66C 2KJRA 3H9DA 1E8XA 3WAPA 4K2OA 5JHBA 2DYMA 4GDKA 3A1QA 4TKNA 2FCMA 2MP2B 1A5RA 2J0MA 1UPQA 4IM3A 1BT0A 1WF9A 4AWJA 4KDIC 2W2WA 1EVHA 3QK0A 3ZKJC 2YS1A 2NBVB 2K00A 2IBIB 1V49A 1KZGA 3CXBB 3B08A 1UGMA 2J7QB 4W9IA 4NJ6A 2JWZA 4RM8A 3SO6A 4LDTB 5C5BA 2GCLA 4W9HA 4J6IA 4GPTB 1J8CA 2FIFA 3PG7A 3VTWA 2W2XD 2DKQA 3VOQA 4P7IA 1WI0A 3PS6A 2JP2A 1UBIA 3A8QA 1WGQA 2VRRB 4NPNA 3RD2A 2UZRA 1I2HA 3AULA 3ZDTA 1V5OA 3CMMB 4Y94A 3N32A 4HCNB 4W9LA 4WWOA 2HE7A 1ZW7A 3V60A 2KOXA 2Z0PA 2YT1A 3TCAA 2LGYA 4WAAA 2DZMA 1U27A 3U7DA 1PLSA 3F0WA 2DHKA 2IO1B 4BKTA 2HTHA 2CY5A 3LJUX 2EC1A 2IYDB 2KVRA 2O2VA 5JH5C 1WY8A 4GDLA 2OQBA 5C5BB 4II3B 3L13A 5D94A 1E90A 3KVFB 4HHVA 1Q1OA 2IY0B 3OJ4B 2PZ1A 2KWCA 2ZPYA 1VCBA 1V89A 2V4LA 4CHMA 2K1FA 4C0AA 3DDCB 1WM2A 2KDEB 5C23A 2COAA 1W1HA 2C9WB 1VD2A 2REXA 1PMSA 2L7RA 4HB2B 1WR6E 1C1YB 3BINA 1BAKA 2G35A 2N9PC 2Z0QA 2WX0A 3LDZE 2HTHB 2KX3A 5GOWB 1WI1A 2K6QA 1ZSQA 1WZ3A 5E6PA 3P7ZA 3VTUA 4GDLB 2DZKA 4BKSD 5D3WA 4HPMB 1WXSA 1U2BA 3W1SC 1U5GA 2LZ6A 4IWQA 1FGZA 1FOEA 1U29A 2D2QA 3RCPA 2C60A 3DVNU 4W9CA 1V5TA 3HM6X 2WWZA 2NVUI 2N4FA 2D9ZA 2CKHB 2I5FA 3MHSD 4KZ0A 4NAWB 1WGGA 2K8BA 1UNRA 3MJWA 3JSVB 3WAOA 4BBKA 2NS5A 2KCJA 2OOBB 3DPDA 2CS4A 5AZHA 1GG3A 4LDTD 4IOYX 4ICUA 1I7AA 4AJYB 2LKOA 4AP4C 4MY6A 2K25A 3DVNV 4DXAB 4D0NB 1X11A 1YQBA 2R09A 3ZLZA 5DH9B 1EAZA 2YRYA 1SGHA 1CMXB 1WXMA 2MBBB 1WJNA 4GB9A 4I6NB 4M8MA 1WGUA 2J0JA 2GCJA 2LWPA 2MCNB 3ZNHB 4KDLB 4IC7B 1N3HA 4GU2A 2BGFA 4K7WA 1H10A 2KLCA 3QA8A 2I1JA 1QC6A 1E8ZA 2LVQA 5CHVC 2KQSA 1OY2A 2N23A 3N7CA 4NQLB 5J18A 3TJPA 2M38A 2KMCA 3DVGY 2ASQA 2ZZPB 2IFSA 3QAQA 4LJOB 1Q5WB 2HD5B 4MGYE 2YS5A 3PTFC 2LG1A 3SHQA 1MAIA 3PHWB 2L76A 3KRXA 4CO7A 4KHOA 4EZLA 2QKMA 2KMAA 1WGYA 1WVHA 2CRFA 1KOTA 3RZWC 3V62A 4F7GA 4A3PA 2L05A 2KFKB 2DHIA 4FHJA 1UH6A 3IG3A 3S2AA 3GOEA 5DPRA 3PEGA 4E3CA 1RAXA 3KSYA 3D8FA 1WYWB 3D8EA 1NDDA 2LD9A 2KTFA 5JHHA 3VUXA 5G2NA 4PS7A 4WJ7A 2ZCBA 2MDXA 4M8NA 1V5UA 2N9EB 2JVCA 2ZCCA 3PRPB 2JT4B 1UZXB 5HE3A 2RSGA 5DCNA 3MPXA 2DZJA 3A9KB 2L3ZA 5L81A 1WFYA 5HE2A 4G0NB 3L16A 1R4NI 4F7UP 4KIKB 5J3TA 2GBMA 2KC1A 2DN6A 3ULBA 2DENB 1UNQA 4F1SA 4MM3A 3T06A 3W1YA 1UBQA 2PE9A 3DBHI 5D3YA 5JZEB 2BYEA 2NCNA 2RGNB 1WGHA 4OVVA 4W9JA 1WIAA 2KFJA 1Z2MA 2M14A 1DDVA 4CYEA 3TFMA 1NTVA 4MT7A 5D3XA 4GMVA 4HATB 5JP4A 2KK8A 2ZVNA 4K7UA 4WJPA 1P0RA 3RULA 3PHXB 4HCPB 4MH0E 1QQGA 4KVGB 3HM3A 1WE7A 5KQ1A 3DBRI 1EO6A 4HPLB 5J17A 2D9WA 1X1GA 3QBVB 2UWQA 4DX8A 3N3KB 3FEHA 4XWXA 3QIJA 1EF5A 4XZ4A 2FCNA 4MSMB 2R2OA 4XX5A 3KH0A 2ZEQA 1WXAA 1H8CA 1DBHA 2NBUA 1FGYA 5C16A 4FJYA 3TBLD 5J3QA 2XEWA 3KW5B 1ZVRA 3SYXA 3UIOB 4AUQC 2RSUA 5HE1A 4W9GA 1WX9A 2DX1A 1S1QB 3D8DA 1P5TA 2G45B 1G6JA 3KUDB 2FCQA 3QWZB 4ANUA 2JXXA 4A6FA 5LONB 2H7DA 3TW1A 4X57B 5LLIA 2M4NA 1X1MA 2JRIB 1YX6B 3L10B 4ZDVA 2L0TA 2VSZA 2KUPA 1EUVB 3PVWA 2V3SA 4FA6A 3MTNB 1GNUA 2ZNVB 3QX1A 1X05A 5C1ZA 5KCVA 4DDID 2JZ3B 3QHTA 2XK5A 3A4SC 2FJLA 1WX7A 2KX0A 4HK2A 1LFDA 1KI1B 5LXIB 3RT3B 1MIXA 2VRWB 1WGDA 2LGXA 1R4MI 3PP2A 4EEWA 1JRUA 4GDKB 4IWOA 3A1QB 2WDTB 2K6DB 4B6WA 2MX2A 3EC8A 1RFAA 2DLWA 3GZNI 3GYOA 1NI2A 4WJNA 2A4ZA 3CIKA 4DHJB 1XQQA 1XD4A 4TUUA 4A20A 1MG8A 2KGXB 3NZSA 2PEAA 3P2BA 1V5PA 3AU5A 2IO2B 1GUAB 4EJNA 2DAFA 2BKRB 1KZ7A 4Z2NA 1NTYA 1QZEA 4MK0A 4PNKA 3KZ1A 3A8PA 2GOWA 5KHOA 1SHCA 1DROA 2UVMA 3HK0A 1UD7A 2N7DA 2YLMA 3WIMA 2ZVOA 1U5DA 3F5RA 2DZIA 2OJRA 5J3YA 2FCSA 1XODA 2W9NA 4FHKA 1V5MA 3ODOA 1FXTB 3ULCA 1EGXA 1T0YA 4GMXB 2JUOA 2DYBA 4ANWA 2KWUB 2N7EA 4HAYB 2D9VA 3OLMD 3BJIA 2P8VA 3DBLI 2Y8GA 5CLLB 2R2QA 4PYUA 3DBSA 3UQAA 2COCA 1V2YA 3K9PB 5J2RA 4M0WB 1IYFA 4TQ1A 4ANXA 1Y5OA 1WJ6A 1W1DA 2O2VB 2LVPA 1V88A 2DA0A 4F7HA 2W2XC 4GXBA 1MK9B 4GGQA 3ZNGC 3M62B 2MBHA 1C3TA 4G11A 4FADA 4NQKE 2LRUA 3ALBA 2EMSA 4IFSA 1Q0WB 2AWTA 4FJVB 3SU8X 2P0DA 2X18A 5CHFA 4II2B 4WJQA 4FULA 4ZYNA 1OQYA 3B0AA 3TIXA 5C79A 5DI9B 3RCZA 4MGKE 2MQJA 4JL9A 1U4AA 4BVUC 3U30A 2JY6A 3ZTDA 2L00B 1ZC4B 2NPTA 5D6JB 3H1UA 2CHZA 2JRHA 2UZSA 4TQ0A 2KLGA 2N1WA 1LB1A 4BOSC 4IW0A 1D3ZA 2XBBC 2NBWB 2LRWA 4B95A 5LXHA 4JGHB 3M63B 2CODA 3O65B 1XD3B 4HAWB 2JPHA 2M8SA 2Y7BA 3KUCB 2H7EA 3ZIMA 4A6KA 2KJHB 3A33B 3KRWA 2ZJDA 4HWIB 4BBNF 4K81A 3HIZA 3ODXA 4BKGA 2AL3A 3ZW3A 3TL5A 2YVCA 2LYDA 3OJ3A 4DHJD 2C7HA 2BKFA 2MA9B 2RUKB 4EZJA 4YL8A 2YS3A 1RRPB 2LOZA 4FN2A 2LI5A 2NPTB 4HB4B 4KHBB 3IFWB 3NHEB 2GBRA 1UEFA 1LQBA 2KHWB 1WX8A 5DPWA 2HJ8A 3NY5A 4DX90 1FHXA 2L2IA 4EKUA 2Z59B 2KDIA 2IYBA 1E8WA 3EECA 4PS3A 4WWPA 2EJ8A 3QJZA 4JLCA 1DYNA 2C7MB 3V6CB 2C5LC 1XT9B 2L8JA 1TGZB 4EOYA 2AYOB 2KN5A 4L6EA 3DVGX 5DPTA 3ZUNA 2GBNA 3DQVA 5D2MB 4IWPA 3WANA 4NNJB 4DHZE 1P9DU 2LASA 2LULA 3EHVA 4W9KA 2ELBA 3ENEA 1V6EA 1U5FA 2Z0OA 2KDBA 2FNJB 4HAUB 4WJOA 2ELAA 3PV1A 5E6OA 3L08A 5DPSA 2EMTA 3T9LA 4IUMB 1WGRA 5CX3A 1IRSA 4W9DA 1ISNA 1WH3A 4KAXB 3K9OB 2IO0B 4PYZA 2M17A 1DDWA 1NU2A 2D9XA 3PVUA 3ZRCA 1WJUA 3PLVA 2O6VA 4DDGD 3W1SA 2KTRA 3AU4A 2CHXA 2V76A 1LW3A 4KZCA 3VXWA 5DHAB 3APFA 3RYTA 3ML9A 1AWEA 1J19A 3KUZA 3VVWB 2KJ6A 4EUTA 3VHTC 4EZKA 1FAOA 4F7ZA 3A98B 4B6HA 2IO3B 4W9FA 1WZ0A 2GBKA 4W9EA 2E2XA 3VIAA 4FBJB 3ZVRA 1OMWA 5E6NA 3PSCA 4FJZA 5GMVA 1E5WA 2LXCA 1I35A 2D07B 2Z0DB 1DDMA 2K8CA 2O6VB 3ZTCA 1LXDA 2BPSA 1P3RA 3DXDA 3HQCA 3VH3B 3KY9A 4LJPB 3WAMA 2K2UA 4ICVA 3H7PA 4HVBA 5IAAC 3ZNID 1U5EA 1BWNA 4DHZB 2LJ5A 3APCA 2COFA 1TZ1A 2I5CA 2AL6A 1F9JA 2YT0A 1YJ1A 1E8YA 3CF6E 3IHPC 4FLHA 1E7UA 2KWVB 1I42A 1E7VA 1OQNA 3I3TB 4NY0A 1MK7B 4BKSA 3VDZA 4G3XB 2CHWA 2K39A 4GN1A 4PQ0A 3SD5A 3NS8A 3ZNZB 2KQ7A 3R7QA 2KD0A 4MGZE 2MP2A 3VUWA 1OTRB 4WWNA 3TMPB 5C6RA 3ODWA 5D27A 3U8ZA 4A5KA 4MELA 3A9JA 5CHWA 4ZRJA 5D3VA 1WG7A 3QARA 5FI1A 5TR5A 2UYZB 3PVLA 1Y19B 1X86A 2DHJA 3VUYA 2LVOA 3VQIA 1FB8A 4ZRKA 3OAWA 1RLFA 2N0YA 2YSZA 4I6LB 2KKCA 3T8MA 1GJZA 1XR0B 1OGWA 4A3OA 1UPRA 1K5GB 2G4DB 1PQSA 1TJ6A 2FIDA 3M95A 3A9JB 3N30A 2R0DA 2GBJA 4K7SA 3NZUA 4MEMA 4XC2A 5EFXA 2KDFB 3AXCA 2NMBA 1ZC3B 4HB3B 2KC2A 4KV2A 2KANA 3CSTA 2LGDA 3FM8C 4A6FB 1Y8RC 5JHAA 1OEYA 1M7RA 5L95C 1P1AA 1UNPA 5CTRC 2KNBA 2PJHA 1TBEA 3O96A 3IVFA 2O6VD 3WYFB 3X0WA 4LCDE 2GMIC 1WR1A 2XK5B 3HW2B 4BOZB 3QWMA 1WJ4A 1L2NA 1P98A 2AEHA 1OEYJ 3R3MA 2LUEA 2M0XA 3PREA 4E71A 4TV3A 2Q13A 2BCJA 1YD8U 5D7GA 2MWNB 4NJ7A 3ZVVA 2PPHA 3UIPB 4HJKA 1V61A 1XCGA 2MKRA 4EMOA 3PRZA 2A5UA 4OVUA 2WYQA 3UF8A 2RPQA 4ASWC 3ONSA 3AJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PS8 A;  4GZU A;  3L54 A;  4HAX B;  3ML8 A;  1XX0 A;  1WJM A;  2MBO A;  3DCG A;  4NAW A;  3PLU A;  4JIO U;  4TYZ A;  1XKE A;  1TXD A;  3V61 A;  1ZM0 A;  2NZ8 B;  3JSV A;  1GC7 A;  1MPH A;  4DBB A;  2BWF A;  2KZR A;  1KLV A;  4ZRI A;  3B1L X;  2J0K A;  3D32 A;  3R7R A;  2MSE D;  4GOC A;  3M1I B;  2LXA A;  1X1F A;  4KSK C;  2D10 A;  4HDQ A;  1W1G A;  2MBE A;  1V80 A;  2IY1 B;  3C0R B;  2JF5 A;  3LJ3 A;  3UQB A;  4HAZ B;  1J0G A;  2QKL A;  4E74 A;  1P6S A;  5G55 A;  3RZF A;  2MRP A;  3UIN B;  3UZT A;  3H7S A;  5KHQ A;  1BTK A;  2PE6 B;  3WA0 A;  4A6H A;  5HKH A;  2VKI A;  3G9W A;  4CHJ A;  3ZO5 B;  2WX1 A;  2MLB A;  2KO3 A;  4MJS A;  3UGB B;  2BYV E;  4GIV A;  2RGF A;  3ECI A;  5FI0 A;  2ROV A;  2BF8 B;  3L17 A;  4K17 A;  2CY4 A;  3V6E B;  1NBF C;  3SNH A;  4URK A;  3ZRF A;  3PSE B;  3CSF A;  4I6P A;  4GSW A;  2DYQ A;  4H8S A;  3P6A A;  2DAJ A;  4IM2 A;  2D3G A;  4HXD A;  1M94 A;  1KM7 A;  3MDB C;  4YON A;  1V81 A;  1RRB A;  3TO1 A;  4DK5 A;  4MDK E;  3QQ8 B;  2DYO A;  3ZDM C;  5HE0 A;  2MBQ A;  2C7N B;  5AZF A;  2KFK A;  2RLO A;  4RM9 A;  4Z2M B;  4MJS B;  1P3Q U;  2RNR B;  2ZNV C;  3L0W B;  4F8C B;  1Z87 A;  2RD0 A;  2QHO A;  1IP9 A;  3GYP A;  2LOX A;  3DXC A;  2MWS B;  2N9X A;  4K2P A;  4BBN C;  3A4R A;  3M3J A;  1AAR A;  2MW5 A;  1TTN A;  2JZZ A;  3JYU A;  1FHW A;  5EDS A;  5FR6 A;  4AOF A;  5DIF B;  4WSF A;  3A9K A;  3VH4 B;  1YIW A;  1Z5S B;  2G4S A;  1GC6 A;  3JVZ X;  3OAN A;  4HDO A;  2RVB B;  3NSU A;  5JLJ B;  1AQC A;  1MIZ B;  5BO4 B;  4KIK A;  4WQO B;  4IG7 B;  3VAW A;  1BTN A;  2NR2 A;  5DHF B;  4WVF B;  3PRM B;  2V1Y A;  4G50 A;  1KJT A;  1K5D B;  3VTV A;  1B55 A;  2GJY A;  2D11 A;  3EFU A;  4AJW A;  2DYN A;  3APD A;  2FAZ A;  2GS0 A;  1V9J A;  2ROZ B;  3PPA A;  3SDL C;  5IA7 A;  2IZV B;  1ZGU B;  5CLQ B;  2CAY A;  1ZKH A;  1WE6 A;  3Q3F A;  1J0W A;  5KQ4 A;  4MSQ B;  2P0F A;  3PGE A;  2DX5 A;  5LOP B;  2Y5B B;  2ADZ A;  4RMA A;  4IAP A;  2N1V A;  2B3A A;  3HHM A;  2D9Y A;  3NOB A;  3JW0 X;  2J59 M;  1WRD B;  1YX5 B;  3IBE A;  2M1M A;  3VFK A;  3FSS A;  5L83 A;  1EF1 A;  1Q67 A;  2DFK A;  2P0H A;  2BWE S;  2K2J A;  2D4Q A;  2KTR B;  4B9K A;  1MKE A;  1LM8 B;  2OTX A;  3PZD A;  1WMH A;  1WM3 A;  4N9F 4;  3H6N A;  4HLE A;  1IPG A;  2CU1 A;  3PT2 B;  1PFJ A;  2DX5 B;  4ANV A;  3QCA A;  2XQN M;  2KXJ A;  1WJ1 A;  1M7E A;  3ML4 A;  1K8R B;  2DKP A;  2CR5 A;  2Y8F A;  3SV1 A;  1RJ2 A;  2L0F A;  1FHO A;  2MFQ A;  2YF0 A;  4IM0 A;  4EFO A;  3BY4 B;  2DHZ A;  2RR9 A;  3KYD D;  3WAL A;  3AI5 A;  1HE8 A;  1TQZ A;  1L7Y A;  3Q3J A;  4DBG A;  5JHG A;  4KHA A;  2Z0E B;  3DXE A;  3V5W A;  3QC8 B;  4MGI E;  3RUI B;  3SUZ A;  3KYC D;  3H7P B;  4BFR A;  1WMH B;  4HB0 B;  3TVV A;  2DTC A;  1H4R A;  3X23 A;  1SIF A;  1S3S G;  2BYF A;  1V86 A;  4JQW C;  2EKE C;  2K8H A;  4HAV B;  2FUH B;  2L1C A;  5AZG A;  1UEL A;  4DWF A;  2I1K A;  4K1R B;  4CHK A;  5AEK B;  4KSL C;  4NSW A;  1SE9 A;  2G3Q B;  2ZPN A;  3DOW A;  1WXV A;  3R66 C;  2KJR A;  3H9D A;  1E8X A;  3WAP A;  4K2O A;  5JHB A;  2DYM A;  4GDK A;  3A1Q A;  4TKN A;  2FCM A;  2MP2 B;  1A5R A;  2J0M A;  1UPQ A;  4IM3 A;  1BT0 A;  1WF9 A;  4AWJ A;  4KDI C;  2W2W A;  1EVH A;  3QK0 A;  3ZKJ C;  2YS1 A;  2NBV B;  2K00 A;  2IBI B;  1V49 A;  1KZG A;  3CXB B;  3B08 A;  1UGM A;  2J7Q B;  4W9I A;  4NJ6 A;  2JWZ A;  4RM8 A;  3SO6 A;  4LDT B;  5C5B A;  2GCL A;  4W9H A;  4J6I A;  4GPT B;  1J8C A;  2FIF A;  3PG7 A;  3VTW A;  2W2X D;  2DKQ A;  3VOQ A;  4P7I A;  1WI0 A;  3PS6 A;  2JP2 A;  1UBI A;  3A8Q A;  1WGQ A;  2VRR B;  4NPN A;  3RD2 A;  2UZR A;  1I2H A;  3AUL A;  3ZDT A;  1V5O A;  3CMM B;  4Y94 A;  3N32 A;  4HCN B;  4W9L A;  4WWO A;  2HE7 A;  1ZW7 A;  3V60 A;  2KOX A;  2Z0P A;  2YT1 A;  3TCA A;  2LGY A;  4WAA A;  2DZM A;  1U27 A;  3U7D A;  1PLS A;  3F0W A;  2DHK A;  2IO1 B;  4BKT A;  2HTH A;  2CY5 A;  3LJU X;  2EC1 A;  2IYD B;  2KVR A;  2O2V A;  5JH5 C;  1WY8 A;  4GDL A;  2OQB A;  5C5B B;  4II3 B;  3L13 A;  5D94 A;  1E90 A;  3KVF B;  4HHV A;  1Q1O A;  2IY0 B;  3OJ4 B;  2PZ1 A;  2KWC A;  2ZPY A;  1VCB A;  1V89 A;  2V4L A;  4CHM A;  2K1F A;  4C0A A;  3DDC B;  1WM2 A;  2KDE B;  5C23 A;  2COA A;  1W1H A;  2C9W B;  1VD2 A;  2REX A;  1PMS A;  2L7R A;  4HB2 B;  1WR6 E;  1C1Y B;  3BIN A;  1BAK A;  2G35 A;  2N9P C;  2Z0Q A;  2WX0 A;  3LDZ E;  2HTH B;  2KX3 A;  5GOW B;  1WI1 A;  2K6Q A;  1ZSQ A;  1WZ3 A;  5E6P A;  3P7Z A;  3VTU A;  4GDL B;  2DZK A;  4BKS D;  5D3W A;  4HPM B;  1WXS A;  1U2B A;  3W1S C;  1U5G A;  2LZ6 A;  4IWQ A;  1FGZ A;  1FOE A;  1U29 A;  2D2Q A;  3RCP A;  2C60 A;  3DVN U;  4W9C A;  1V5T A;  3HM6 X;  2WWZ A;  2NVU I;  2N4F A;  2D9Z A;  2CKH B;  2I5F A;  3MHS D;  4KZ0 A;  4NAW B;  1WGG A;  2K8B A;  1UNR A;  3MJW A;  3JSV B;  3WAO A;  4BBK A;  2NS5 A;  2KCJ A;  2OOB B;  3DPD A;  2CS4 A;  5AZH A;  1GG3 A;  4LDT D;  4IOY X;  4ICU A;  1I7A A;  4AJY B;  2LKO A;  4AP4 C;  4MY6 A;  2K25 A;  3DVN V;  4DXA B;  4D0N B;  1X11 A;  1YQB A;  2R09 A;  3ZLZ A;  5DH9 B;  1EAZ A;  2YRY A;  1SGH A;  1CMX B;  1WXM A;  2MBB B;  1WJN A;  4GB9 A;  4I6N B;  4M8M A;  1WGU A;  2J0J A;  2GCJ A;  2LWP A;  2MCN B;  3ZNH B;  4KDL B;  4IC7 B;  1N3H A;  4GU2 A;  2BGF A;  4K7W A;  1H10 A;  2KLC A;  3QA8 A;  2I1J A;  1QC6 A;  1E8Z A;  2LVQ A;  5CHV C;  2KQS A;  1OY2 A;  2N23 A;  3N7C A;  4NQL B;  5J18 A;  3TJP A;  2M38 A;  2KMC A;  3DVG Y;  2ASQ A;  2ZZP B;  2IFS A;  3QAQ A;  4LJO B;  1Q5W B;  2HD5 B;  4MGY E;  2YS5 A;  3PTF C;  2LG1 A;  3SHQ A;  1MAI A;  3PHW B;  2L76 A;  3KRX A;  4CO7 A;  4KHO A;  4EZL A;  2QKM A;  2KMA A;  1WGY A;  1WVH A;  2CRF A;  1KOT A;  3RZW C;  3V62 A;  4F7G A;  4A3P A;  2L05 A;  2KFK B;  2DHI A;  4FHJ A;  1UH6 A;  3IG3 A;  3S2A A;  3GOE A;  5DPR A;  3PEG A;  4E3C A;  1RAX A;  3KSY A;  3D8F A;  1WYW B;  3D8E A;  1NDD A;  2LD9 A;  2KTF A;  5JHH A;  3VUX A;  5G2N A;  4PS7 A;  4WJ7 A;  2ZCB A;  2MDX A;  4M8N A;  1V5U A;  2N9E B;  2JVC A;  2ZCC A;  3PRP B;  2JT4 B;  1UZX B;  5HE3 A;  2RSG A;  5DCN A;  3MPX A;  2DZJ A;  3A9K B;  2L3Z A;  5L81 A;  1WFY A;  5HE2 A;  4G0N B;  3L16 A;  1R4N I;  4F7U P;  4KIK B;  5J3T A;  2GBM A;  2KC1 A;  2DN6 A;  3ULB A;  2DEN B;  1UNQ A;  4F1S A;  4MM3 A;  3T06 A;  3W1Y A;  1UBQ A;  2PE9 A;  3DBH I;  5D3Y A;  5JZE B;  2BYE A;  2NCN A;  2RGN B;  1WGH A;  4OVV A;  4W9J A;  1WIA A;  2KFJ A;  1Z2M A;  2M14 A;  1DDV A;  4CYE A;  3TFM A;  1NTV A;  4MT7 A;  5D3X A;  4GMV A;  4HAT B;  5JP4 A;  2KK8 A;  2ZVN A;  4K7U A;  4WJP A;  1P0R A;  3RUL A;  3PHX B;  4HCP B;  4MH0 E;  1QQG A;  4KVG B;  3HM3 A;  1WE7 A;  5KQ1 A;  3DBR I;  1EO6 A;  4HPL B;  5J17 A;  2D9W A;  1X1G A;  3QBV B;  2UWQ A;  4DX8 A;  3N3K B;  3FEH A;  4XWX A;  3QIJ A;  1EF5 A;  4XZ4 A;  2FCN A;  4MSM B;  2R2O A;  4XX5 A;  3KH0 A;  2ZEQ A;  1WXA A;  1H8C A;  1DBH A;  2NBU A;  1FGY A;  5C16 A;  4FJY A;  3TBL D;  5J3Q A;  2XEW A;  3KW5 B;  1ZVR A;  3SYX A;  3UIO B;  4AUQ C;  2RSU A;  5HE1 A;  4W9G A;  1WX9 A;  2DX1 A;  1S1Q B;  3D8D A;  1P5T A;  2G45 B;  1G6J A;  3KUD B;  2FCQ A;  3QWZ B;  4ANU A;  2JXX A;  4A6F A;  5LON B;  2H7D A;  3TW1 A;  4X57 B;  5LLI A;  2M4N A;  1X1M A;  2JRI B;  1YX6 B;  3L10 B;  4ZDV A;  2L0T A;  2VSZ A;  2KUP A;  1EUV B;  3PVW A;  2V3S A;  4FA6 A;  3MTN B;  1GNU A;  2ZNV B;  3QX1 A;  1X05 A;  5C1Z A;  5KCV A;  4DDI D;  2JZ3 B;  3QHT A;  2XK5 A;  3A4S C;  2FJL A;  1WX7 A;  2KX0 A;  4HK2 A;  1LFD A;  1KI1 B;  5LXI B;  3RT3 B;  1MIX A;  2VRW B;  1WGD A;  2LGX A;  1R4M I;  3PP2 A;  4EEW A;  1JRU A;  4GDK B;  4IWO A;  3A1Q B;  2WDT B;  2K6D B;  4B6W A;  2MX2 A;  3EC8 A;  1RFA A;  2DLW A;  3GZN I;  3GYO A;  1NI2 A;  4WJN A;  2A4Z A;  3CIK A;  4DHJ B;  1XQQ A;  1XD4 A;  4TUU A;  4A20 A;  1MG8 A;  2KGX B;  3NZS A;  2PEA A;  3P2B A;  1V5P A;  3AU5 A;  2IO2 B;  1GUA B;  4EJN A;  2DAF A;  2BKR B;  1KZ7 A;  4Z2N A;  1NTY A;  1QZE A;  4MK0 A;  4PNK A;  3KZ1 A;  3A8P A;  2GOW A;  5KHO A;  1SHC A;  1DRO A;  2UVM A;  3HK0 A;  1UD7 A;  2N7D A;  2YLM A;  3WIM A;  2ZVO A;  1U5D A;  3F5R A;  2DZI A;  2OJR A;  5J3Y A;  2FCS A;  1XOD A;  2W9N A;  4FHK A;  1V5M A;  3ODO A;  1FXT B;  3ULC A;  1EGX A;  1T0Y A;  4GMX B;  2JUO A;  2DYB A;  4ANW A;  2KWU B;  2N7E A;  4HAY B;  2D9V A;  3OLM D;  3BJI A;  2P8V A;  3DBL I;  2Y8G A;  5CLL B;  2R2Q A;  4PYU A;  3DBS A;  3UQA A;  2COC A;  1V2Y A;  3K9P B;  5J2R A;  4M0W B;  1IYF A;  4TQ1 A;  4ANX A;  1Y5O A;  1WJ6 A;  1W1D A;  2O2V B;  2LVP A;  1V88 A;  2DA0 A;  4F7H A;  2W2X C;  4GXB A;  1MK9 B;  4GGQ A;  3ZNG C;  3M62 B;  2MBH A;  1C3T A;  4G11 A;  4FAD A;  4NQK E;  2LRU A;  3ALB A;  2EMS A;  4IFS A;  1Q0W B;  2AWT A;  4FJV B;  3SU8 X;  2P0D A;  2X18 A;  5CHF A;  4II2 B;  4WJQ A;  4FUL A;  4ZYN A;  1OQY A;  3B0A A;  3TIX A;  5C79 A;  5DI9 B;  3RCZ A;  4MGK E;  2MQJ A;  4JL9 A;  1U4A A;  4BVU C;  3U30 A;  2JY6 A;  3ZTD A;  2L00 B;  1ZC4 B;  2NPT A;  5D6J B;  3H1U A;  2CHZ A;  2JRH A;  2UZS A;  4TQ0 A;  2KLG A;  2N1W A;  1LB1 A;  4BOS C;  4IW0 A;  1D3Z A;  2XBB C;  2NBW B;  2LRW A;  4B95 A;  5LXH A;  4JGH B;  3M63 B;  2COD A;  3O65 B;  1XD3 B;  4HAW B;  2JPH A;  2M8S A;  2Y7B A;  3KUC B;  2H7E A;  3ZIM A;  4A6K A;  2KJH B;  3A33 B;  3KRW A;  2ZJD A;  4HWI B;  4BBN F;  4K81 A;  3HIZ A;  3ODX A;  4BKG A;  2AL3 A;  3ZW3 A;  3TL5 A;  2YVC A;  2LYD A;  3OJ3 A;  4DHJ D;  2C7H A;  2BKF A;  2MA9 B;  2RUK B;  4EZJ A;  4YL8 A;  2YS3 A;  1RRP B;  2LOZ A;  4FN2 A;  2LI5 A;  2NPT B;  4HB4 B;  4KHB B;  3IFW B;  3NHE B;  2GBR A;  1UEF A;  1LQB A;  2KHW B;  1WX8 A;  5DPW A;  2HJ8 A;  3NY5 A;  4DX9 0;  1FHX A;  2L2I A;  4EKU A;  2Z59 B;  2KDI A;  2IYB A;  1E8W A;  3EEC A;  4PS3 A;  4WWP A;  2EJ8 A;  3QJZ A;  4JLC A;  1DYN A;  2C7M B;  3V6C B;  2C5L C;  1XT9 B;  2L8J A;  1TGZ B;  4EOY A;  2AYO B;  2KN5 A;  4L6E A;  3DVG X;  5DPT A;  3ZUN A;  2GBN A;  3DQV A;  5D2M B;  4IWP A;  3WAN A;  4NNJ B;  4DHZ E;  1P9D U;  2LAS A;  2LUL A;  3EHV A;  4W9K A;  2ELB A;  3ENE A;  1V6E A;  1U5F A;  2Z0O A;  2KDB A;  2FNJ B;  4HAU B;  4WJO A;  2ELA A;  3PV1 A;  5E6O A;  3L08 A;  5DPS A;  2EMT A;  3T9L A;  4IUM B;  1WGR A;  5CX3 A;  1IRS A;  4W9D A;  1ISN A;  1WH3 A;  4KAX B;  3K9O B;  2IO0 B;  4PYZ A;  2M17 A;  1DDW A;  1NU2 A;  2D9X A;  3PVU A;  3ZRC A;  1WJU A;  3PLV A;  2O6V A;  4DDG D;  3W1S A;  2KTR A;  3AU4 A;  2CHX A;  2V76 A;  1LW3 A;  4KZC A;  3VXW A;  5DHA B;  3APF A;  3RYT A;  3ML9 A;  1AWE A;  1J19 A;  3KUZ A;  3VVW B;  2KJ6 A;  4EUT A;  3VHT C;  4EZK A;  1FAO A;  4F7Z A;  3A98 B;  4B6H A;  2IO3 B;  4W9F A;  1WZ0 A;  2GBK A;  4W9E A;  2E2X A;  3VIA A;  4FBJ B;  3ZVR A;  1OMW A;  5E6N A;  3PSC A;  4FJZ A;  5GMV A;  1E5W A;  2LXC A;  1I35 A;  2D07 B;  2Z0D B;  1DDM A;  2K8C A;  2O6V B;  3ZTC A;  1LXD A;  2BPS A;  1P3R A;  3DXD A;  3HQC A;  3VH3 B;  3KY9 A;  4LJP B;  3WAM A;  2K2U A;  4ICV A;  3H7P A;  4HVB A;  5IAA C;  3ZNI D;  1U5E A;  1BWN A;  4DHZ B;  2LJ5 A;  3APC A;  2COF A;  1TZ1 A;  2I5C A;  2AL6 A;  1F9J A;  2YT0 A;  1YJ1 A;  1E8Y A;  3CF6 E;  3IHP C;  4FLH A;  1E7U A;  2KWV B;  1I42 A;  1E7V A;  1OQN A;  3I3T B;  4NY0 A;  1MK7 B;  4BKS A;  3VDZ A;  4G3X B;  2CHW A;  2K39 A;  4GN1 A;  4PQ0 A;  3SD5 A;  3NS8 A;  3ZNZ B;  2KQ7 A;  3R7Q A;  2KD0 A;  4MGZ E;  2MP2 A;  3VUW A;  1OTR B;  4WWN A;  3TMP B;  5C6R A;  3ODW A;  5D27 A;  3U8Z A;  4A5K A;  4MEL A;  3A9J A;  5CHW A;  4ZRJ A;  5D3V A;  1WG7 A;  3QAR A;  5FI1 A;  5TR5 A;  2UYZ B;  3PVL A;  1Y19 B;  1X86 A;  2DHJ A;  3VUY A;  2LVO A;  3VQI A;  1FB8 A;  4ZRK A;  3OAW A;  1RLF A;  2N0Y A;  2YSZ A;  4I6L B;  2KKC A;  3T8M A;  1GJZ A;  1XR0 B;  1OGW A;  4A3O A;  1UPR A;  1K5G B;  2G4D B;  1PQS A;  1TJ6 A;  2FID A;  3M95 A;  3A9J B;  3N30 A;  2R0D A;  2GBJ A;  4K7S A;  3NZU A;  4MEM A;  4XC2 A;  5EFX A;  2KDF B;  3AXC A;  2NMB A;  1ZC3 B;  4HB3 B;  2KC2 A;  4KV2 A;  2KAN A;  3CST A;  2LGD A;  3FM8 C;  4A6F B;  1Y8R C;  5JHA A;  1OEY A;  1M7R A;  5L95 C;  1P1A A;  1UNP A;  5CTR C;  2KNB A;  2PJH A;  1TBE A;  3O96 A;  3IVF A;  2O6V D;  3WYF B;  3X0W A;  4LCD E;  2GMI C;  1WR1 A;  2XK5 B;  3HW2 B;  4BOZ B;  3QWM A;  1WJ4 A;  1L2N A;  1P98 A;  2AEH A;  1OEY J;  3R3M A;  2LUE A;  2M0X A;  3PRE A;  4E71 A;  4TV3 A;  2Q13 A;  2BCJ A;  1YD8 U;  5D7G A;  2MWN B;  4NJ7 A;  3ZVV A;  2PPH A;  3UIP B;  4HJK A;  1V61 A;  1XCG A;  2MKR A;  4EMO A;  3PRZ A;  2A5U A;  4OVU A;  2WYQ A;  3UF8 A;  2RPQ A;  4ASW C;  3ONS A;  3AJ4 A; 
#chains in the Genus database with same CATH topology
 4PS8 A;  4GZU A;  3L54 A;  4HAX B;  3ML8 A;  1XX0 A;  4IOI E;  1WJM A;  4KGT A;  2MBO A;  3DCG A;  4NAW A;  1MI0 A;  3PLU A;  4WH4 A;  1LGR A;  4JIO U;  4TYZ A;  1XKE A;  1TXD A;  4FXC A;  3V61 A;  1ZM0 A;  2NZ8 B;  3JSV A;  1GC7 A;  2W3R A;  3MFG A;  1MPH A;  4C00 A;  4DBB A;  3T3O A;  5HI1 A;  2BWF A;  4L2Y A;  2KZR A;  4XWT A;  1KLV A;  4ZRI A;  3B1L X;  2J0K A;  3D32 A;  2DLB A;  4WIP A;  2K0P A;  4PT5 A;  1V1O A;  4LNF A;  3R7R A;  2MSE D;  4GOC A;  1SSN A;  5HFY A;  3M1I B;  1UWX A;  2LXA A;  2KT7 A;  1X1F A;  4KSK C;  2D10 A;  4HDQ A;  1W1G A;  1JML A;  5FK9 C;  2MBE A;  1V80 A;  2IY1 B;  3C0R B;  3ZGZ A;  3DHH C;  2JF5 A;  3AE1 B;  3LJ3 A;  3MC8 A;  1N62 A;  2ZW0 A;  3I5J C;  3UQB A;  4HAZ B;  1J0G A;  2QKL A;  4E74 A;  1C9F A;  1P6S A;  2CU3 A;  5G55 A;  3N1X C;  4WQM A;  3RZF A;  2LHD A;  2MRP A;  3DWG C;  3NW8 A;  3NWF A;  3UIN B;  3UZT A;  3H7S A;  5KHQ A;  2JX5 A;  2X8X X;  2PIA A;  1BTK A;  4ZRQ A;  3N1Y C;  2NTS A;  2PE6 B;  3WA0 A;  4A6H A;  3BVZ A;  1DOX A;  5HKH A;  1VZ8 A;  3HSA A;  3Q69 A;  2VKI A;  3G9W A;  4CHJ A;  3ZO5 B;  2WX1 A;  4KGR A;  2MLB A;  2KO3 A;  2WU2 B;  4MJS A;  3UGB B;  2WXP A;  2BYV E;  4GIV A;  2RGF A;  4NAM A;  1F0Z A;  3ECI A;  5FI0 A;  2ROV A;  2OED A;  1EWC A;  2BF8 B;  1J7B A;  1KLG D;  3L17 A;  4XGA B;  2W82 A;  4QXA B;  4K17 A;  2BQQ A;  2I2Y A;  2CY4 A;  4YWG G;  2MH7 A;  3V6E B;  1NBF C;  3KWV A;  3SNH A;  1RFK A;  4URK A;  3ZRF A;  3PSE B;  3CSF A;  4I6P A;  4GSW A;  2DYQ A;  1ET9 A;  4H8S A;  3P6A A;  2DAJ A;  2JZP A;  4IM2 A;  2D3G A;  2YEP B;  4HXD A;  1M94 A;  1KM7 A;  3MDB C;  4YON A;  1V81 A;  3Q3N C;  1SF0 A;  1RRB A;  3TO1 A;  3HVD A;  4DK5 A;  4LNN A;  4MDK E;  3QQ8 B;  3NVV A;  2DYO A;  3ZDM C;  2KWD A;  5HE0 A;  2MBQ A;  1C78 A;  3SFE B;  2C7N B;  3HVZ A;  3HIE A;  2WXR A;  5AZF A;  2KYW A;  2XN9 C;  2INP E;  2KFK A;  2Q5W D;  4IDI A;  2RLO A;  1C4A A;  4RM9 A;  4Z2M B;  4MJS B;  2QSD A;  3SR6 A;  1P3Q U;  2RNR B;  2ZNV C;  3L0W B;  2GLS A;  4OZA A;  4F8C B;  1Z87 A;  2RD0 A;  2QHO A;  1IP9 A;  3GYP A;  1AN8 A;  2LOX A;  3DXC A;  1K51 A;  2MWS B;  4OZB A;  2N9X A;  3LYY A;  2M56 B;  4K2P A;  2PLP A;  4BBN C;  2IJ0 A;  4HJG E;  1LO5 D;  3A4R A;  3M3J A;  1AAR A;  2MW5 A;  1TTN A;  2JZZ A;  1ZDV A;  3JYU A;  1YJI A;  1FHW A;  5EDS A;  5FR6 A;  4AOF A;  5DIF B;  4WSF A;  3A9K A;  1E9M A;  2JXT A;  3VH4 B;  4ARI A;  1YIW A;  1Z5S B;  1MPE A;  2G4S A;  1GC6 A;  1F52 A;  1CZP A;  3JVZ X;  4OW0 A;  3OAN A;  4HDO A;  3AN1 A;  2RVB B;  3NSU A;  5JLJ B;  1AQC A;  1MIZ B;  5BO4 B;  4KIK A;  4WQO B;  4HEA 1;  4IG7 B;  3VAW A;  1BTN A;  2NR2 A;  5DHF B;  4WVF B;  3PRM B;  4D6W A;  1XLP A;  2V1Y A;  4G50 A;  1KJT A;  1K5D B;  3VTV A;  1B55 A;  2GJY A;  2D11 A;  1VLB A;  3EFU A;  1D5X C;  4XDC A;  4AJW A;  2DYN A;  3APD A;  2FAZ A;  2GS0 A;  1V9J A;  2ROZ B;  2G9H D;  3Q8E A;  3PPA A;  4LNK A;  3SDL C;  5IA7 A;  2IZV B;  2Z4D A;  3E56 A;  4GLS C;  1ZGU B;  3SFD B;  5CLQ B;  1I4P A;  2B76 B;  2CAY A;  1ZKH A;  1WE6 A;  3Q3F A;  1J0W A;  4RNA A;  2Z14 A;  5KQ4 A;  1EU4 A;  2JWU A;  1TKY A;  4MSQ B;  3I57 A;  2P0F A;  3PGE A;  5G5G A;  4P1C C;  2DX5 A;  1N5X A;  5LOP B;  3CIR B;  2Y5B B;  4ZHP A;  4P6V F;  4IKG A;  2ADZ A;  4CQN A;  1I4R A;  4RMA A;  1PFD A;  4IAP A;  2N1V A;  2B3A A;  3HHM A;  2D9Y A;  3P4R B;  2IGD A;  3NOB A;  3JW0 X;  4OT1 A;  2J59 M;  1WRD B;  1YX5 B;  3IBE A;  2M1M A;  1P7E A;  3VFK A;  3FSS A;  1L4Z B;  3BYY B;  1VZ7 A;  2QIL A;  5L83 A;  1EF1 A;  1Q67 A;  2DFK A;  2P0H A;  2BWE S;  2K2J A;  2JQR B;  3RNF C;  2D4Q A;  1D5M C;  2KTR B;  4XE0 A;  2AX5 A;  3MP9 A;  4B9K A;  3U12 A;  1MKE A;  3AE9 B;  3BWU D;  1LM8 B;  5IKC M;  4S17 A;  3IT4 B;  2OTX A;  3PZD A;  1WMH A;  1WM3 A;  4N9F 4;  3H6N A;  3ZQ4 A;  1IPG A;  3ETR A;  2CU1 A;  4HLE A;  1D6E C;  4RH6 A;  3PT2 B;  1KTK A;  3BK1 A;  1PFJ A;  4HSI A;  2DX5 B;  4ANV A;  3QCA A;  2XQN M;  2KXJ A;  1WJ1 A;  2ZW1 A;  1M7E A;  5BYR A;  3ML4 A;  5HHD G;  1K8R B;  2DKP A;  2CR5 A;  1MHX A;  2Y8F A;  3SV1 A;  1RJ2 A;  2MJE A;  2L0F A;  4MAC A;  5IO9 A;  1FHO A;  2MFQ A;  2YF0 A;  4IM0 A;  4EFO A;  3BY4 B;  2DHZ A;  2RR9 A;  3KYD D;  3WAL A;  4C80 A;  4ZOH C;  3AI5 A;  1HE8 A;  3AE2 B;  4O1N A;  4YXD B;  1V8C A;  1TQZ A;  1L7Y A;  3Q3J A;  4DBG A;  5JHG A;  1XXG A;  4KHA A;  2Z0E B;  1DYQ A;  1PYW D;  3DXE A;  3V5W A;  3FKY A;  2WXJ A;  3QC8 B;  4MGI E;  3RUI B;  4BAX A;  3SUZ A;  3Q3M C;  3KYC D;  3H7P B;  2TSS A;  4BFR A;  1WMH B;  4HB0 B;  1VDV A;  3TVV A;  1C76 A;  2DTC A;  1WYG A;  1H4R A;  3X23 A;  1SIF A;  1S3S G;  2BYF A;  1V86 A;  4JQW C;  3VR8 B;  1ZDX A;  2V3N A;  4YSY B;  2EKE C;  3OG5 A;  2Z13 A;  1FMA D;  2K8H A;  4HAV B;  4A55 A;  2FUH B;  2VH1 A;  2LMC A;  2L1C A;  3NJT A;  5AZG A;  1UEL A;  1JWB D;  4DWF A;  2I1K A;  4K1R B;  3AEB B;  4CHK A;  1PGA A;  3Q8B A;  5AEK B;  4KSL C;  1FXI A;  4NSW A;  1SE9 A;  1IGC A;  2G3Q B;  2ZPN A;  3DOW A;  1WXV A;  1E10 A;  3R66 C;  1SE4 A;  2KJR A;  3H9D A;  4GNK B;  1VRA B;  1E8X A;  3I63 C;  3WAP A;  2WU5 B;  4K2O A;  5JHB A;  2DYM A;  4GDK A;  1JWU D;  3A1Q A;  3AEC B;  4TKN A;  4XYC A;  3HUI A;  2FCM A;  2MP2 B;  3RN9 C;  1A5R A;  3R2T A;  1D4B A;  5E6J A;  4KKJ A;  1WSP A;  3GB1 A;  1CJE A;  2J0M A;  1QKZ A;  3Q8F A;  1UPQ A;  1XF5 L;  3BYT B;  4IM3 A;  1IBX A;  5H8Y E;  1BT0 A;  1WF9 A;  2QDF A;  4KDI C;  4AWJ A;  1NEK B;  2W2W A;  1EVH A;  3QK0 A;  3ZKJ C;  1YNT E;  5M4Y B;  2WDQ B;  4ZYS A;  2YS1 A;  2WXH A;  2NBV B;  2K00 A;  2IBI B;  1V49 A;  1RWS A;  1KZG A;  3CXB B;  2WXQ A;  3B08 A;  2N0S B;  3ZJT A;  1UGM A;  1SXT A;  2J7Q B;  4W9I A;  4NJ6 A;  2JWZ A;  4RM8 A;  3SO6 A;  1MG4 A;  5BYQ A;  4LDT B;  5C5B A;  2GCL A;  4W9H A;  4J6I A;  4GPT B;  1J8C A;  2FIF A;  3PG7 A;  2PVO D;  4OHJ A;  3OWE B;  2H89 B;  3VTW A;  2W2X D;  2DKQ A;  1XLO A;  3VOQ A;  4P7I A;  1WI0 A;  3PS6 A;  2JP2 A;  5I2S A;  3T3N A;  1UBI A;  3A8Q A;  1WGQ A;  2VRR B;  4NPN A;  5TSS A;  1QT9 A;  3RD2 A;  2UZR A;  1I2H A;  3AUL A;  3ZDT A;  4ITK A;  1V5O A;  3CMM B;  2FE8 A;  4Y94 A;  4KX6 B;  3N32 A;  1ROE A;  4HCN B;  4W9L A;  3ZYY X;  2E6X A;  2E3T A;  4WWO A;  2HE7 A;  1EWY C;  1TS5 A;  1ZW7 A;  1IBX B;  3V60 A;  2KOX A;  2Z0P A;  2YT1 A;  3TCA A;  2LGY A;  4YSX B;  2FJU B;  4WAA A;  2DZM A;  1U27 A;  3U7D A;  1PLS A;  3F0W A;  2DHK A;  1ET6 A;  2IO1 B;  4LTU A;  5C2T B;  4C56 C;  4BKT A;  4M0W A;  3GE3 C;  4H2A A;  2HTH A;  2CY5 A;  3LJU X;  5FKA C;  2EC1 A;  2IYD B;  2KVR A;  4RGO S;  2O2V A;  5JH5 C;  1SIJ A;  1WY8 A;  3Q8C A;  2GRI A;  4GDL A;  2IGG A;  2OQB A;  3P4Q B;  2L52 A;  5C5B B;  1TS3 A;  2WS3 B;  3N1Z C;  1HTQ A;  3IAM 1;  4II3 B;  3L13 A;  4LK0 M;  2J53 A;  5D94 A;  1E90 A;  3KVF B;  4HHV A;  3U4E G;  4AS1 A;  1Q1O A;  2IY0 B;  2Y5C A;  3OJ4 B;  1HXY D;  2PZ1 A;  2KWC A;  2ZPY A;  1VCB A;  3L4P A;  1V89 A;  2V4L A;  1F2R C;  5G5H A;  1I4Q A;  4CHM A;  2K1F A;  4C0A A;  3DDC B;  2X38 A;  1WM2 A;  2KDE B;  1FCL A;  4D2K A;  3I9V 1;  5C23 A;  2COA A;  2ICI A;  5EE3 A;  1W1H A;  2C9W B;  2KUQ A;  1VD2 A;  4JE3 B;  1FPY A;  4XWW A;  1MJD A;  2REX A;  4LLG M;  1PMS A;  2L7R A;  2WXG A;  4HB2 B;  1WR6 E;  3EUB 2;  2BS4 B;  3ZJV A;  1C1Y B;  3BIN A;  1BAK A;  3C19 A;  2G35 A;  2N9P C;  1TKE A;  3WCQ A;  2Z0Q A;  5EE1 A;  1L6U A;  2WX0 A;  3VR9 B;  3LDZ E;  2HTH B;  4A8X C;  4C4V B;  2N9L A;  4HKQ A;  2KX3 A;  4P16 A;  5GOW B;  2BS2 B;  1WI1 A;  1IGD A;  1ZSQ A;  2K6Q A;  1XCQ L;  3EFC A;  1WZ3 A;  5E6P A;  3P7Z A;  3VTU A;  3W9C B;  4GDL B;  2DZK A;  4BKS D;  5D3W A;  4HPM B;  1WXS A;  1U2B A;  3W1S C;  1U5G A;  2JSV X;  4QJ4 B;  1T0R C;  2DBY A;  1P7F A;  2LZ6 A;  4IWQ A;  1FGZ A;  1BML C;  1FOE A;  1U29 A;  2PKO A;  2D2Q A;  3RCP A;  2C60 A;  3DVN U;  4W9C A;  2ACZ B;  2QEJ C;  1V5T A;  1FNW A;  3HM6 X;  2WWZ A;  2NVU I;  2WNM A;  2N4F A;  2D9Z A;  2EEL A;  5C3J B;  5LG4 B;  3BII D;  2CKH B;  2I5F A;  3MHS D;  4KZ0 A;  4NAW B;  1FFV A;  1WGG A;  2K8B A;  1UNR A;  1K52 A;  1OQQ A;  2G1E A;  2K22 A;  3MJW A;  3JSV B;  5AUI A;  4KHB A;  3WAO A;  1FXA A;  4BBK A;  2NS5 A;  1HEZ E;  2KCJ A;  2ONQ A;  1STE A;  2OOB B;  3DPD A;  2CS4 A;  2KAJ A;  5AZH A;  1SE3 A;  1GG3 A;  2M19 A;  4LDT D;  5EE9 A;  4IOY X;  2Z59 A;  2K3U A;  4ICU A;  1I7A A;  4AJY B;  3J9C A;  3VRB B;  2LKO A;  4AP4 C;  1FD6 A;  1T5X D;  3KLS X;  4MY6 A;  2IGH A;  2RPV A;  1BUI C;  2K25 A;  3DVN V;  4ARC A;  3A58 A;  4DXA B;  1HQR D;  4D0N B;  2LUM A;  1X11 A;  3MC0 B;  4RGM A;  1YQB A;  1TYG B;  2R09 A;  3ZLZ A;  1JWA D;  5DH9 B;  1EAZ A;  2YRY A;  4DQO C;  3AE4 B;  1SGH A;  3BVG A;  1DOI A;  1CMX B;  1WXM A;  3IAS 1;  5AUK A;  1M4V A;  2MBB B;  1WJN A;  4C7Y A;  4GB9 A;  4I6N B;  2V3P A;  2WDV B;  4M8M A;  1WGU A;  2J0J A;  2GCJ A;  2LWP A;  3NVZ A;  2MCN B;  3ZNH B;  3BZD B;  4KDL B;  1YMH E;  3FC4 A;  4IC7 B;  1N3H A;  2BB6 A;  3KWL A;  3PO0 A;  2IPK D;  2BGF A;  4GU2 A;  4K7W A;  1H10 A;  2KLC A;  3QA8 A;  4N59 A;  1ZOY B;  3W2D A;  2I1J A;  4TMA B;  1QC6 A;  1E8Z A;  2LVQ A;  1WGK A;  1UNS A;  1R4N B;  5CHV C;  2KQS A;  2K49 A;  3U52 E;  1OY2 A;  2N23 A;  2M0A A;  3N7C A;  4NQL B;  4QJ3 B;  5J18 A;  3TJP A;  2M38 A;  2KMC A;  3DVG Y;  2ASQ A;  1TS2 A;  2ZZP B;  2IFS A;  1PDX A;  3QAQ A;  4LJO B;  4LNI A;  1Q5W B;  2HD5 B;  4GOU A;  3AE6 B;  4MGY E;  2YS5 A;  3DBH B;  1L6V A;  3PTF C;  2WP9 B;  1ZXI A;  2LG1 A;  1QOB A;  2PW9 A;  3SHQ A;  1MAI A;  3PHW B;  2QCZ A;  2L76 A;  3KRX A;  4CO7 A;  4KHO A;  1NVI D;  4EZL A;  2QKM A;  2KMA A;  2WQY B;  1WGY A;  4L1B A;  1WVH A;  2CRF A;  1KOT A;  3RZW C;  3V62 A;  4F7G A;  2KDM A;  4A3P A;  2L05 A;  1UGJ A;  1ZXH A;  2KFK B;  2DHI A;  4FHJ A;  3Q6B A;  1F77 A;  1UH6 A;  3IG3 A;  3S2A A;  1GPX A;  1MI1 A;  3GOE A;  5DPR A;  3PEG A;  4E3C A;  1RAX A;  3KSY A;  2JU6 X;  3D8F A;  1WYW B;  3D8E A;  4MH8 A;  1NDD A;  2LD9 A;  2KTF A;  3AEE B;  5JHH A;  3VUX A;  5G2N A;  4WJ7 A;  4PS7 A;  2ZCB A;  2MDX A;  4M8N A;  4DIX A;  1V5U A;  1C4P A;  2N9E B;  2JVC A;  2ZCC A;  1AW7 A;  3MHZ A;  1PGX A;  3PRP B;  2JT4 B;  1UZX B;  3NWD A;  5HE3 A;  2RSG A;  3AE8 B;  5DCN A;  3MPX A;  1YN5 A;  3ZJU A;  2DZJ A;  3A9K B;  2L3Z A;  3W5V B;  4US8 A;  4OZC A;  5L81 A;  1WFY A;  5HE2 A;  3AEG B;  4ZRP A;  4G0N B;  3L16 A;  2BW2 A;  1R4N I;  2OJW A;  1ACC A;  4F7U P;  3NG0 A;  4KIK B;  5J3T A;  3HRD D;  1NYQ A;  2GBM A;  2KC1 A;  2DN6 A;  3ULB A;  3P63 A;  3FVC A;  1UNQ A;  2DEN B;  4F1S A;  3RPF C;  4MM3 A;  3T06 A;  3RNG C;  2KIE A;  1ZP0 B;  3W1Y A;  1UBQ A;  2PE9 A;  3DBH I;  4RFB A;  1E6E B;  1TJE A;  2J42 A;  5D3Y A;  5JZE B;  1C4C A;  2BYE A;  1L4D B;  2NCN A;  2RGN B;  1WGH A;  4OVV A;  4W9J A;  5EE0 A;  1WIA A;  2KFJ A;  4KGS A;  1Z2M A;  2I38 A;  2M14 A;  3AE5 B;  4C7Z A;  1DDV A;  3NWA A;  4CYE A;  3TFM A;  3NUH B;  1NTV A;  4MT7 A;  1E7P B;  5D3X A;  4GMV A;  2N9K A;  1K50 A;  1YOV B;  1FEH A;  4HAT B;  5JP4 A;  2KK8 A;  2ZVN A;  4K7U A;  4WJP A;  3U7Z A;  4DXF A;  1P0R A;  3RUL A;  4HRS A;  3FAH A;  1L0X B;  3PHX B;  3VRA B;  4HCP B;  4MH0 E;  1QQG A;  3ABV B;  4KVG B;  1WE7 A;  5KQ1 A;  3HM3 A;  3DBR I;  1AYF A;  2D3B A;  1EO6 A;  4HPL B;  5J17 A;  1WXQ A;  5HG2 A;  2D9W A;  1X1G A;  1CK1 A;  3SEB A;  3QBV B;  2UWQ A;  2W55 A;  4WAF A;  4DX8 A;  3N3K B;  2V0G A;  4M01 A;  3FEH A;  1GB1 A;  4XWX A;  3QIJ A;  5BMH A;  1EF5 A;  2EKI A;  4XZ4 A;  2FCN A;  4MSM B;  2R2O A;  2BS3 B;  3KH0 A;  4XX5 A;  1JAL A;  2ZEQ A;  2D5G A;  1WXA A;  1H8C A;  2WXK A;  1DBH A;  2NBU A;  1FGY A;  5C16 A;  3V05 A;  4FJY A;  4B0E A;  2QJL A;  5JXV A;  3TBL D;  4AQ7 A;  5J3Q A;  2XEW A;  3N20 C;  3B9J A;  2KN4 A;  3KW5 B;  2FBW B;  1ZVR A;  4BZA A;  3GZN B;  5FR3 A;  3SYX A;  3UIO B;  4AUQ C;  2ZKM X;  3BK2 A;  3AM9 A;  2RSU A;  5HE1 A;  4W9G A;  1WX9 A;  3LXF A;  3Q14 C;  2DX1 A;  1S1Q B;  3D8D A;  1P5T A;  2G45 B;  1G6J A;  3AED B;  3GS2 A;  4HPP A;  3KUD B;  2FCQ A;  3QWZ B;  4ANU A;  2JXX A;  4A6F A;  5LON B;  2H7D A;  3TW1 A;  4X57 B;  5LLI A;  2M4N A;  1X1M A;  2JRI B;  2WHI A;  1V1P A;  1I4H A;  1YX6 B;  1HA5 A;  3L10 B;  4ZDV A;  5H92 C;  2L0T A;  2VSZ A;  2KVZ A;  2KUP A;  1EUV B;  2GB1 A;  3PVW A;  2V3S A;  1VZ6 A;  4FA6 A;  3MTN B;  1N6Z A;  1GNU A;  2ZNV B;  3QX1 A;  1X05 A;  3AE7 B;  5C1Z A;  5KCV A;  4DDI D;  2JZ3 B;  1KLU D;  1UWM A;  3QHT A;  2XK5 A;  1N60 A;  1ZUD 2;  3A4S C;  2FJL A;  2RDH A;  1TY2 A;  1WX7 A;  2KX0 A;  4HK2 A;  1LFD A;  1KI1 B;  5LXI B;  1DGJ A;  1JRP A;  3RT3 B;  1MIX A;  2VRW B;  1KH0 A;  3RNC C;  2W3S A;  2R61 A;  3DBL B;  1WGD A;  1RYJ A;  4WWM A;  2AQ2 B;  2LGX A;  1R4M I;  3PP2 A;  4EEW A;  1JRU A;  3GE8 C;  1L5P A;  4GDK B;  4IWO A;  3R8B A;  1QOF A;  2WDR B;  3A1Q B;  2WDT B;  2K6D B;  2SAK A;  2MX2 A;  3EC8 A;  4NJC A;  4B6W A;  1RFA A;  4REZ A;  2DLW A;  2QIE B;  3GZN I;  3AEA B;  3GYO A;  1NI2 A;  4WJN A;  1T77 A;  2A4Z A;  3CIK A;  4DHJ B;  1V1P B;  4OSN A;  1XQQ A;  1XD4 A;  4TUU A;  4A20 A;  2K8E A;  1MG8 A;  2KGX B;  2OHF A;  3NZS A;  2PEA A;  2NMQ A;  3P2B A;  1V5P A;  3AU5 A;  1JRO A;  5D3D A;  2IO2 B;  1SBB B;  1GUA B;  4EJN A;  2DAF A;  2BKR B;  3N9Y C;  1KZ7 A;  2HTM E;  2WXM A;  4OVZ A;  4A90 A;  4Z2N A;  1YQ3 B;  1NTY A;  2INN E;  1QZE A;  4MK0 A;  3TEY A;  4PNK A;  4YSZ B;  2HJ1 A;  3KZ1 A;  3A8P A;  2GOW A;  2XNA C;  5KHO A;  1SHC A;  1DRO A;  2UVM A;  3HK0 A;  1UD7 A;  3TEW A;  4JWU C;  2N7D A;  2YLM A;  3WIM A;  2ZVO A;  1IUE A;  1U5D A;  2PVG C;  3F5R A;  4ACF A;  2DZI A;  1JWM D;  1KFY B;  4HKZ E;  2OJR A;  5J3Y A;  2FCS A;  1XOD A;  2H88 B;  2W9N A;  1E0Z A;  2K9X A;  1N61 A;  4FHK A;  1V5M A;  3ODO A;  1FXT B;  3ULC A;  1EGX A;  5GXG B;  1T0Y A;  1C79 A;  4RGT A;  4GMX B;  2JUO A;  2DYB A;  4ANW A;  2KWU B;  1MFW A;  2JYT A;  2N7E A;  4HAY B;  1MHH E;  2D9V A;  2Z8L A;  3OLM D;  3BJI A;  3OHM B;  2P8V A;  3DBL I;  3EA6 A;  2DWQ A;  2Y8G A;  5CLL B;  4TSS A;  1SE2 A;  2R2Q A;  4PYU A;  3DBS A;  2L83 A;  3UQA A;  2COC A;  1V2Y A;  3DHG C;  3K9P B;  5J2R A;  4HRO A;  3Q8A A;  4M0W B;  1IYF A;  1XLQ A;  4N58 A;  4TQ1 A;  4ANX A;  3PZ7 A;  1Y5O A;  1WJ6 A;  1ZYI A;  1W1D A;  2BT6 A;  2O2V B;  2LVP A;  1V88 A;  2DA0 A;  3P1M A;  1T0S C;  4F7H A;  2J52 A;  1VR9 A;  1OFF A;  2W2X C;  4GXB A;  1MK9 B;  4GGQ A;  1SEB D;  1V97 A;  2L1A A;  2MBH A;  3M62 B;  3ZNG C;  1B1Z A;  4G11 A;  4FAD A;  1C3T A;  4NQK E;  5I2M A;  2LRU A;  3ALB A;  2EMS A;  4IFS A;  1Q0W B;  2AWT A;  4FJV B;  2YT2 A;  2BYT A;  3SU8 X;  2P0D A;  2X18 A;  5CHF A;  1J7A A;  1FIQ A;  4II2 B;  2VZK B;  1Y56 A;  3RFZ B;  4WJQ A;  4FUL A;  4NZL B;  2LEK A;  4ZYN A;  1OQY A;  3B0A A;  3TIX A;  1F1H A;  5C79 A;  2UU7 A;  5DI9 B;  1QLB B;  3RCZ A;  4MGK E;  1T0Q C;  2MQJ A;  1XO3 A;  1KRH A;  1RM6 C;  2NTT A;  4JL9 A;  1U4A A;  3B2G A;  4BVU C;  3U30 A;  5T8I A;  2JY6 A;  2IND C;  3ZTD A;  2L00 B;  1ZC4 B;  2NPT A;  5D6J B;  3H1U A;  2CHZ A;  2JRH A;  4M02 A;  2UZS A;  2RMM A;  4TQ0 A;  2KLG A;  2N1W A;  4R3D A;  1LB1 A;  4BOS C;  4IW0 A;  1D3Z A;  2XBB C;  2NBW B;  2LRW A;  4B95 A;  2LJI A;  5LXH A;  4LNO A;  1WRI A;  4JGH B;  3M63 B;  1J7C A;  2COD A;  3O65 B;  1XD3 B;  4HAW B;  2JPH A;  2M8S A;  2Y7B A;  3KUC B;  4S0R A;  2H7E A;  3ZIM A;  4A6K A;  1TT5 B;  2KJH B;  3A33 B;  3KRW A;  2ZJD A;  4HWI B;  4BBN F;  4K81 A;  3HIZ A;  1FNU A;  4KKI A;  3ODX A;  4BKG A;  2AL3 A;  3ZW3 A;  5BMI A;  3TL5 A;  1HZ6 A;  2YVC A;  2LYD A;  3OJ3 A;  4DHJ D;  2C7H A;  2BKF A;  2MA9 B;  2RUK B;  4USA A;  4EZJ A;  4YL8 A;  2YS3 A;  3DHI C;  1RRP B;  1XCT L;  2LOZ A;  4FN2 A;  2LI5 A;  1EM7 A;  1C77 A;  2NPT B;  1QIL A;  1FRR A;  4HB4 B;  4KHB B;  1UUP A;  3IFW B;  3NHE B;  2GBR A;  1UEF A;  3EGR A;  1LQB A;  2KHW B;  2Y3A A;  5IN7 A;  1WX8 A;  2V4I B;  5DPW A;  2HJ8 A;  4WUR A;  3NY5 A;  1TIF A;  2AQ1 B;  3RNE C;  2WGS A;  4DX9 0;  2W54 A;  1FHX A;  3P4S B;  2L2I A;  4EKU A;  2Z59 B;  2KDI A;  4UDU C;  2IYB A;  2PMV A;  1E8W A;  1DOY A;  3Q2A C;  1PGB A;  3EEC A;  3NRZ A;  4PS3 A;  4WWP A;  2EJ8 A;  3QJZ A;  4JLC A;  1DYN A;  2C7M B;  3V6C B;  2C5L C;  3URY A;  1XT9 B;  1TY0 A;  3AV8 A;  2L8J A;  1TGZ B;  4EOY A;  2AYO B;  3ZXR A;  2KN5 A;  3GP7 A;  4L6E A;  4K3C A;  4EE2 A;  2AQ3 B;  3DVG X;  5DPT A;  3ZUN A;  2GBN A;  1JW9 D;  3DQV A;  5D2M B;  2LFI A;  2MJ3 A;  4IWP A;  3WAN A;  4NNJ B;  4DHZ E;  1P9D U;  2LAS A;  2VH2 A;  3UI3 A;  2K5P A;  2LUL A;  3EHV A;  4W9K A;  2ELB A;  3H8H A;  3ENE A;  1V6E A;  4QAY A;  1U5F A;  2Z0O A;  1SB3 C;  2KDB A;  2FNJ B;  4HAU B;  4WJO A;  3Q3O C;  2ELA A;  3PV1 A;  5D3I B;  5E6O A;  3L08 A;  5DPS A;  2EMT A;  1I7H A;  3NS1 A;  2FUG 1;  3T9L A;  1XLN A;  4IUM B;  1GOZ A;  1GAQ B;  1WGR A;  1NEN B;  5CX3 A;  2BB5 A;  4A9A A;  1IRS A;  1T3Q A;  4W9D A;  1ISN A;  2PTL A;  3NVW A;  1WH3 A;  4KAX B;  3K9O B;  2IO0 B;  4PYZ A;  2M17 A;  1DDW A;  1NU2 A;  2D9X A;  2VZK D;  1I4G A;  3PVU A;  3ZRC A;  3C8Y A;  4J3O D;  1WJU A;  3PLV A;  1N63 A;  2J4X A;  3DBR B;  2O6V A;  4DDG D;  3W1S A;  2KTR A;  3AU4 A;  1K53 A;  1OQR A;  2CHX A;  3KQ4 A;  2V76 A;  1LW3 A;  4KZC A;  3B2F A;  5DHA B;  3VXW A;  3APF A;  2MJD A;  3RYT A;  1YN4 A;  3IT6 B;  3ML9 A;  1AWE A;  1J19 A;  3KUZ A;  3V3X A;  3VVW B;  2BVC A;  2KJ6 A;  5MPO A;  2LHE A;  4EUT A;  3VHT C;  4EZK A;  1FAO A;  4F7Z A;  3A98 B;  1QOG A;  4QJ5 B;  3AEF B;  2R2Y A;  1QF6 A;  4B6H A;  2IO3 B;  4A6Q A;  4L1R A;  4W9F A;  2KQ4 X;  1WZ0 A;  1ENF A;  2GBK A;  4W9E A;  2E2X A;  3VIA A;  4FBJ B;  3ZVR A;  2LGI A;  1OMW A;  4YTP B;  1CQV A;  5E6N A;  3PSC A;  1FCC C;  4FJZ A;  4N6E B;  1E5W A;  4RGN A;  5GMV A;  1JQ4 A;  2LXC A;  1I35 A;  2D07 B;  2Z0D B;  1DDM A;  1QOA A;  2K8C A;  1FFU A;  2O6V B;  3FIL A;  3ZTC A;  1LXD A;  1I4X A;  2BPS A;  3TSS A;  1P3R A;  1TKG A;  3DXD A;  3HQC A;  2L32 A;  1Q10 A;  3VH3 B;  2IDY A;  3KY9 A;  4LJP B;  3WAM A;  4JPS A;  2K2U A;  1TZO A;  3H7P A;  4ICV A;  4JWS C;  4HVB A;  1KF6 B;  5IAA C;  1WWT A;  3ZNI D;  1U5E A;  1BWN A;  4DHZ B;  4YT0 B;  1QQR A;  3BVM A;  1JCK B;  2LJ5 A;  3APC A;  1YQ4 B;  2COF A;  1TZ1 A;  2I5C A;  2WXN A;  2AL6 A;  3RNB C;  1F9J A;  2YT0 A;  1YJ1 A;  1E8Y A;  4MM3 B;  3CF6 E;  3IHP C;  4FLH A;  1NYR A;  4RF0 A;  1E7U A;  1VJK A;  2KWV B;  1I42 A;  2KR0 A;  1E7V A;  5IRS A;  4DXG A;  1OQN A;  3I3T B;  4NY0 A;  2N7J A;  1MK7 B;  1FNV A;  2YEP F;  4BKS A;  1F2R I;  4Q2J A;  3VDZ A;  2MHJ A;  4G3X B;  1EU3 A;  2V9H A;  2CJO A;  2CHW A;  2K39 A;  3B77 A;  4GN1 A;  4PQ0 A;  3SD5 A;  3NS8 A;  1R4M B;  3FIL B;  3ZNZ B;  2KQ7 A;  3R2I A;  2KD0 A;  3R7Q A;  2ON8 A;  4MGZ E;  2MP2 A;  3VUW A;  1XEE A;  1OTR B;  1UF0 A;  4WWN A;  3TMP B;  5C6R A;  5I4D A;  3ODW A;  5D27 A;  2KMM A;  3U8Z A;  4A5K A;  4MEL A;  4CSQ A;  3A9J A;  4K3B A;  3TEX A;  3P42 A;  5CHW A;  2WXL A;  4ZRJ A;  5D3V A;  2KIG A;  1WG7 A;  3IXS A;  2Y5P A;  3QAR A;  5FI1 A;  5TR5 A;  1PUT A;  3P4P B;  2CJN A;  2UYZ B;  2NBV A;  4JX1 C;  3PVL A;  1Y19 B;  5BMG A;  1X86 A;  4XDD A;  2DHJ A;  3VUY A;  3O13 A;  2LVO A;  1FM0 D;  3RNA C;  4ZHO A;  3VQI A;  1FB8 A;  4ZRK A;  3OAW A;  1R7S A;  3AH7 A;  2WLB A;  1RLF A;  2N0Y A;  2YSZ A;  4M00 A;  4P1B C;  1YN3 A;  2INC C;  4US9 A;  4I6L B;  2QC8 A;  2KKC A;  3T8M A;  3ZXV A;  4B0M A;  2KAC A;  1GJZ A;  1XR0 B;  1OGW A;  4A3O A;  1UPR A;  2GI9 A;  3PZ8 A;  1K5G B;  2RDG A;  2G4D B;  3MJ5 A;  1PQS A;  1HTO A;  1B9R A;  1BXT A;  1TJ6 A;  3NZ3 A;  2FID A;  3M95 A;  3AE3 B;  3A9J B;  4YTN B;  1L0Y B;  1FRD A;  3MC9 A;  3N30 A;  2R0D A;  2GBJ A;  1FO4 A;  1A70 A;  4K7S A;  4MT5 A;  3NZU A;  4MEM A;  2DNF A;  4XC2 A;  5EFX A;  1NI3 A;  2KDF B;  3AXC A;  1SJH D;  2NMB A;  3RI7 C;  1ZC3 B;  4HB3 B;  2KC2 A;  4KV2 A;  2KAN A;  3CST A;  1JWS D;  2LGD A;  3FM8 C;  4A6F B;  1Y8R C;  5JHA A;  3DWM A;  1OEY A;  3U2S C;  1M7R A;  2HDE A;  3CWI A;  1ZE3 D;  1ZPS A;  2MEK A;  5L95 C;  5LNK 1;  1P1A A;  1UNP A;  3AB5 A;  5CTR C;  2KNB A;  2PJH A;  1TBE A;  2D3A A;  3O96 A;  1T6B X;  3IVF A;  2O6V D;  3WYF B;  3TUO A;  3X0W A;  5BYS A;  3AMZ A;  4LCD E;  3LB8 C;  4RCO A;  2GMI C;  1YJJ A;  1WR1 A;  2XK5 B;  4YTM B;  3HW2 B;  4BOZ B;  3QWM A;  5IOI A;  1WJ4 A;  1MVK A;  2LGS A;  1L2N A;  3DCX A;  1P98 A;  2AEH A;  1OEY J;  1D5Z C;  2LUE A;  1ESF A;  2M0X A;  3R3M A;  2SEB D;  3PRE A;  2WXF A;  2WXI A;  4E71 A;  1L0V B;  3W5U B;  4TV3 A;  2Q13 A;  2BCJ A;  3E9S A;  2GUM A;  1YD8 U;  2BBC A;  5D7G A;  1N5W A;  2QMT A;  4RF1 A;  4C4V A;  2MWN B;  2D3C A;  1HZ5 A;  4NJ7 A;  3ZVV A;  4PK1 A;  2RRF A;  2BTE A;  2PPH A;  2WXO A;  1SJE D;  3UIP B;  4HJK A;  1V61 A;  1XCG A;  2MKR A;  5IP4 D;  4EMO A;  3PRZ A;  4L23 A;  3TEZ A;  1TS4 A;  3RMK C;  2A5U A;  4OVU A;  2RDB C;  2WYQ A;  1AWD A;  2JYE A;  3UF8 A;  3NVY A;  2RPQ A;  4ASW C;  3ONS A;  3AJ4 A;  1GB4 A; 
#chains in the Genus database with same CATH homology
 4PS8 A;  4GZU A;  3L54 A;  4HAX B;  3ML8 A;  1XX0 A;  1WJM A;  2MBO A;  3DCG A;  4NAW A;  3PLU A;  4JIO U;  4TYZ A;  1XKE A;  1TXD A;  3V61 A;  1ZM0 A;  2NZ8 B;  3JSV A;  1GC7 A;  1MPH A;  4DBB A;  2BWF A;  2KZR A;  1KLV A;  4ZRI A;  3B1L X;  2J0K A;  3D32 A;  3R7R A;  2MSE D;  4GOC A;  3M1I B;  2LXA A;  1X1F A;  4KSK C;  2D10 A;  4HDQ A;  1W1G A;  2MBE A;  1V80 A;  2IY1 B;  3C0R B;  2JF5 A;  3LJ3 A;  3UQB A;  4HAZ B;  1J0G A;  2QKL A;  4E74 A;  1P6S A;  5G55 A;  3RZF A;  2MRP A;  3UIN B;  3UZT A;  3H7S A;  5KHQ A;  1BTK A;  2PE6 B;  3WA0 A;  4A6H A;  5HKH A;  2VKI A;  3G9W A;  4CHJ A;  3ZO5 B;  2WX1 A;  2MLB A;  2KO3 A;  4MJS A;  3UGB B;  2BYV E;  4GIV A;  2RGF A;  3ECI A;  5FI0 A;  2ROV A;  2BF8 B;  3L17 A;  4K17 A;  2CY4 A;  3V6E B;  1NBF C;  3SNH A;  4URK A;  3ZRF A;  3PSE B;  3CSF A;  4I6P A;  4GSW A;  2DYQ A;  4H8S A;  3P6A A;  2DAJ A;  4IM2 A;  2D3G A;  4HXD A;  1M94 A;  1KM7 A;  3MDB C;  4YON A;  1V81 A;  1RRB A;  3TO1 A;  4DK5 A;  4MDK E;  3QQ8 B;  2DYO A;  3ZDM C;  5HE0 A;  2MBQ A;  2C7N B;  5AZF A;  2KFK A;  2RLO A;  4RM9 A;  4Z2M B;  4MJS B;  1P3Q U;  2RNR B;  2ZNV C;  3L0W B;  4F8C B;  1Z87 A;  2RD0 A;  2QHO A;  1IP9 A;  3GYP A;  2LOX A;  3DXC A;  2MWS B;  2N9X A;  4K2P A;  4BBN C;  3A4R A;  3M3J A;  1AAR A;  2MW5 A;  1TTN A;  2JZZ A;  3JYU A;  1FHW A;  5EDS A;  5FR6 A;  4AOF A;  5DIF B;  4WSF A;  3A9K A;  3VH4 B;  1YIW A;  1Z5S B;  2G4S A;  1GC6 A;  3JVZ X;  3OAN A;  4HDO A;  2RVB B;  3NSU A;  5JLJ B;  1AQC A;  1MIZ B;  5BO4 B;  4KIK A;  4WQO B;  4IG7 B;  3VAW A;  1BTN A;  2NR2 A;  5DHF B;  4WVF B;  3PRM B;  2V1Y A;  4G50 A;  1KJT A;  1K5D B;  3VTV A;  1B55 A;  2GJY A;  2D11 A;  3EFU A;  4AJW A;  2DYN A;  3APD A;  2FAZ A;  2GS0 A;  1V9J A;  2ROZ B;  3PPA A;  3SDL C;  5IA7 A;  2IZV B;  1ZGU B;  5CLQ B;  2CAY A;  1ZKH A;  1WE6 A;  3Q3F A;  1J0W A;  5KQ4 A;  4MSQ B;  2P0F A;  3PGE A;  2DX5 A;  5LOP B;  2Y5B B;  2ADZ A;  4RMA A;  4IAP A;  2N1V A;  2B3A A;  3HHM A;  2D9Y A;  3NOB A;  3JW0 X;  2J59 M;  1WRD B;  1YX5 B;  3IBE A;  2M1M A;  3VFK A;  3FSS A;  5L83 A;  1EF1 A;  1Q67 A;  2DFK A;  2P0H A;  2BWE S;  2K2J A;  2D4Q A;  2KTR B;  4B9K A;  1MKE A;  1LM8 B;  2OTX A;  3PZD A;  1WMH A;  1WM3 A;  4N9F 4;  3H6N A;  4HLE A;  1IPG A;  2CU1 A;  3PT2 B;  1PFJ A;  2DX5 B;  4ANV A;  3QCA A;  2XQN M;  2KXJ A;  1WJ1 A;  1M7E A;  3ML4 A;  1K8R B;  2DKP A;  2CR5 A;  2Y8F A;  3SV1 A;  1RJ2 A;  2L0F A;  1FHO A;  2MFQ A;  2YF0 A;  4IM0 A;  4EFO A;  3BY4 B;  2DHZ A;  2RR9 A;  3KYD D;  3WAL A;  3AI5 A;  1HE8 A;  1TQZ A;  1L7Y A;  3Q3J A;  4DBG A;  5JHG A;  4KHA A;  2Z0E B;  3DXE A;  3V5W A;  3QC8 B;  4MGI E;  3RUI B;  3SUZ A;  3KYC D;  3H7P B;  4BFR A;  1WMH B;  4HB0 B;  3TVV A;  2DTC A;  1H4R A;  3X23 A;  1SIF A;  1S3S G;  2BYF A;  1V86 A;  4JQW C;  2EKE C;  2K8H A;  4HAV B;  2FUH B;  2L1C A;  5AZG A;  1UEL A;  4DWF A;  2I1K A;  4K1R B;  4CHK A;  5AEK B;  4KSL C;  4NSW A;  1SE9 A;  2G3Q B;  2ZPN A;  3DOW A;  1WXV A;  3R66 C;  2KJR A;  3H9D A;  1E8X A;  3WAP A;  4K2O A;  5JHB A;  2DYM A;  4GDK A;  3A1Q A;  4TKN A;  2FCM A;  2MP2 B;  1A5R A;  2J0M A;  1UPQ A;  4IM3 A;  1BT0 A;  1WF9 A;  4AWJ A;  4KDI C;  2W2W A;  1EVH A;  3QK0 A;  3ZKJ C;  2YS1 A;  2NBV B;  2K00 A;  2IBI B;  1V49 A;  1KZG A;  3CXB B;  3B08 A;  1UGM A;  2J7Q B;  4W9I A;  4NJ6 A;  2JWZ A;  4RM8 A;  3SO6 A;  4LDT B;  5C5B A;  2GCL A;  4W9H A;  4J6I A;  4GPT B;  1J8C A;  2FIF A;  3PG7 A;  3VTW A;  2W2X D;  2DKQ A;  3VOQ A;  4P7I A;  1WI0 A;  3PS6 A;  2JP2 A;  1UBI A;  3A8Q A;  1WGQ A;  2VRR B;  4NPN A;  3RD2 A;  2UZR A;  1I2H A;  3AUL A;  3ZDT A;  1V5O A;  3CMM B;  4Y94 A;  3N32 A;  4HCN B;  4W9L A;  4WWO A;  2HE7 A;  1ZW7 A;  3V60 A;  2KOX A;  2Z0P A;  2YT1 A;  3TCA A;  2LGY A;  4WAA A;  2DZM A;  1U27 A;  3U7D A;  1PLS A;  3F0W A;  2DHK A;  2IO1 B;  4BKT A;  2HTH A;  2CY5 A;  3LJU X;  2EC1 A;  2IYD B;  2KVR A;  2O2V A;  5JH5 C;  1WY8 A;  4GDL A;  2OQB A;  5C5B B;  4II3 B;  3L13 A;  5D94 A;  1E90 A;  3KVF B;  4HHV A;  1Q1O A;  2IY0 B;  3OJ4 B;  2PZ1 A;  2KWC A;  2ZPY A;  1VCB A;  1V89 A;  2V4L A;  4CHM A;  2K1F A;  4C0A A;  3DDC B;  1WM2 A;  2KDE B;  5C23 A;  2COA A;  1W1H A;  2C9W B;  1VD2 A;  2REX A;  1PMS A;  2L7R A;  4HB2 B;  1WR6 E;  1C1Y B;  3BIN A;  1BAK A;  2G35 A;  2N9P C;  2Z0Q A;  2WX0 A;  3LDZ E;  2HTH B;  2KX3 A;  5GOW B;  1WI1 A;  2K6Q A;  1ZSQ A;  1WZ3 A;  5E6P A;  3P7Z A;  3VTU A;  4GDL B;  2DZK A;  4BKS D;  5D3W A;  4HPM B;  1WXS A;  1U2B A;  3W1S C;  1U5G A;  2LZ6 A;  4IWQ A;  1FGZ A;  1FOE A;  1U29 A;  2D2Q A;  3RCP A;  2C60 A;  3DVN U;  4W9C A;  1V5T A;  3HM6 X;  2WWZ A;  2NVU I;  2N4F A;  2D9Z A;  2CKH B;  2I5F A;  3MHS D;  4KZ0 A;  4NAW B;  1WGG A;  2K8B A;  1UNR A;  3MJW A;  3JSV B;  3WAO A;  4BBK A;  2NS5 A;  2KCJ A;  2OOB B;  3DPD A;  2CS4 A;  5AZH A;  1GG3 A;  4LDT D;  4IOY X;  4ICU A;  1I7A A;  4AJY B;  2LKO A;  4AP4 C;  4MY6 A;  2K25 A;  3DVN V;  4DXA B;  4D0N B;  1X11 A;  1YQB A;  2R09 A;  3ZLZ A;  5DH9 B;  1EAZ A;  2YRY A;  1SGH A;  1CMX B;  1WXM A;  2MBB B;  1WJN A;  4GB9 A;  4I6N B;  4M8M A;  1WGU A;  2J0J A;  2GCJ A;  2LWP A;  2MCN B;  3ZNH B;  4KDL B;  4IC7 B;  1N3H A;  4GU2 A;  2BGF A;  4K7W A;  1H10 A;  2KLC A;  3QA8 A;  2I1J A;  1QC6 A;  1E8Z A;  2LVQ A;  5CHV C;  2KQS A;  1OY2 A;  2N23 A;  3N7C A;  4NQL B;  5J18 A;  3TJP A;  2M38 A;  2KMC A;  3DVG Y;  2ASQ A;  2ZZP B;  2IFS A;  3QAQ A;  4LJO B;  1Q5W B;  2HD5 B;  4MGY E;  2YS5 A;  3PTF C;  2LG1 A;  3SHQ A;  1MAI A;  3PHW B;  2L76 A;  3KRX A;  4CO7 A;  4KHO A;  4EZL A;  2QKM A;  2KMA A;  1WGY A;  1WVH A;  2CRF A;  1KOT A;  3RZW C;  3V62 A;  4F7G A;  4A3P A;  2L05 A;  2KFK B;  2DHI A;  4FHJ A;  1UH6 A;  3IG3 A;  3S2A A;  3GOE A;  5DPR A;  3PEG A;  4E3C A;  1RAX A;  3KSY A;  3D8F A;  1WYW B;  3D8E A;  1NDD A;  2LD9 A;  2KTF A;  5JHH A;  3VUX A;  5G2N A;  4PS7 A;  4WJ7 A;  2ZCB A;  2MDX A;  4M8N A;  1V5U A;  2N9E B;  2JVC A;  2ZCC A;  3PRP B;  2JT4 B;  1UZX B;  5HE3 A;  2RSG A;  5DCN A;  3MPX A;  2DZJ A;  3A9K B;  2L3Z A;  5L81 A;  1WFY A;  5HE2 A;  4G0N B;  3L16 A;  1R4N I;  4F7U P;  4KIK B;  5J3T A;  2GBM A;  2KC1 A;  2DN6 A;  3ULB A;  2DEN B;  1UNQ A;  4F1S A;  4MM3 A;  3T06 A;  3W1Y A;  1UBQ A;  2PE9 A;  3DBH I;  5D3Y A;  5JZE B;  2BYE A;  2NCN A;  2RGN B;  1WGH A;  4OVV A;  4W9J A;  1WIA A;  2KFJ A;  1Z2M A;  2M14 A;  1DDV A;  4CYE A;  3TFM A;  1NTV A;  4MT7 A;  5D3X A;  4GMV A;  4HAT B;  5JP4 A;  2KK8 A;  2ZVN A;  4K7U A;  4WJP A;  1P0R A;  3RUL A;  3PHX B;  4HCP B;  4MH0 E;  1QQG A;  4KVG B;  3HM3 A;  1WE7 A;  5KQ1 A;  3DBR I;  1EO6 A;  4HPL B;  5J17 A;  2D9W A;  1X1G A;  3QBV B;  2UWQ A;  4DX8 A;  3N3K B;  3FEH A;  4XWX A;  3QIJ A;  1EF5 A;  4XZ4 A;  2FCN A;  4MSM B;  2R2O A;  4XX5 A;  3KH0 A;  2ZEQ A;  1WXA A;  1H8C A;  1DBH A;  2NBU A;  1FGY A;  5C16 A;  4FJY A;  3TBL D;  5J3Q A;  2XEW A;  3KW5 B;  1ZVR A;  3SYX A;  3UIO B;  4AUQ C;  2RSU A;  5HE1 A;  4W9G A;  1WX9 A;  2DX1 A;  1S1Q B;  3D8D A;  1P5T A;  2G45 B;  1G6J A;  3KUD B;  2FCQ A;  3QWZ B;  4ANU A;  2JXX A;  4A6F A;  5LON B;  2H7D A;  3TW1 A;  4X57 B;  5LLI A;  2M4N A;  1X1M A;  2JRI B;  1YX6 B;  3L10 B;  4ZDV A;  2L0T A;  2VSZ A;  2KUP A;  1EUV B;  3PVW A;  2V3S A;  4FA6 A;  3MTN B;  1GNU A;  2ZNV B;  3QX1 A;  1X05 A;  5C1Z A;  5KCV A;  4DDI D;  2JZ3 B;  3QHT A;  2XK5 A;  3A4S C;  2FJL A;  1WX7 A;  2KX0 A;  4HK2 A;  1LFD A;  1KI1 B;  5LXI B;  3RT3 B;  1MIX A;  2VRW B;  1WGD A;  2LGX A;  1R4M I;  3PP2 A;  4EEW A;  1JRU A;  4GDK B;  4IWO A;  3A1Q B;  2WDT B;  2K6D B;  4B6W A;  2MX2 A;  3EC8 A;  1RFA A;  2DLW A;  3GZN I;  3GYO A;  1NI2 A;  4WJN A;  2A4Z A;  3CIK A;  4DHJ B;  1XQQ A;  1XD4 A;  4TUU A;  4A20 A;  1MG8 A;  2KGX B;  3NZS A;  2PEA A;  3P2B A;  1V5P A;  3AU5 A;  2IO2 B;  1GUA B;  4EJN A;  2DAF A;  2BKR B;  1KZ7 A;  4Z2N A;  1NTY A;  1QZE A;  4MK0 A;  4PNK A;  3KZ1 A;  3A8P A;  2GOW A;  5KHO A;  1SHC A;  1DRO A;  2UVM A;  3HK0 A;  1UD7 A;  2N7D A;  2YLM A;  3WIM A;  2ZVO A;  1U5D A;  3F5R A;  2DZI A;  2OJR A;  5J3Y A;  2FCS A;  1XOD A;  2W9N A;  4FHK A;  1V5M A;  3ODO A;  1FXT B;  3ULC A;  1EGX A;  1T0Y A;  4GMX B;  2JUO A;  2DYB A;  4ANW A;  2KWU B;  2N7E A;  4HAY B;  2D9V A;  3OLM D;  3BJI A;  2P8V A;  3DBL I;  2Y8G A;  5CLL B;  2R2Q A;  4PYU A;  3DBS A;  3UQA A;  2COC A;  1V2Y A;  3K9P B;  5J2R A;  4M0W B;  1IYF A;  4TQ1 A;  4ANX A;  1Y5O A;  1WJ6 A;  1W1D A;  2O2V B;  2LVP A;  1V88 A;  2DA0 A;  4F7H A;  2W2X C;  4GXB A;  1MK9 B;  4GGQ A;  3ZNG C;  3M62 B;  2MBH A;  1C3T A;  4G11 A;  4FAD A;  4NQK E;  2LRU A;  3ALB A;  2EMS A;  4IFS A;  1Q0W B;  2AWT A;  4FJV B;  3SU8 X;  2P0D A;  2X18 A;  5CHF A;  4II2 B;  4WJQ A;  4FUL A;  4ZYN A;  1OQY A;  3B0A A;  3TIX A;  5C79 A;  5DI9 B;  3RCZ A;  4MGK E;  2MQJ A;  4JL9 A;  1U4A A;  4BVU C;  3U30 A;  2JY6 A;  3ZTD A;  2L00 B;  1ZC4 B;  2NPT A;  5D6J B;  3H1U A;  2CHZ A;  2JRH A;  2UZS A;  4TQ0 A;  2KLG A;  2N1W A;  1LB1 A;  4BOS C;  4IW0 A;  1D3Z A;  2XBB C;  2NBW B;  2LRW A;  4B95 A;  5LXH A;  4JGH B;  3M63 B;  2COD A;  3O65 B;  1XD3 B;  4HAW B;  2JPH A;  2M8S A;  2Y7B A;  3KUC B;  2H7E A;  3ZIM A;  4A6K A;  2KJH B;  3A33 B;  3KRW A;  2ZJD A;  4HWI B;  4BBN F;  4K81 A;  3HIZ A;  3ODX A;  4BKG A;  2AL3 A;  3ZW3 A;  3TL5 A;  2YVC A;  2LYD A;  3OJ3 A;  4DHJ D;  2C7H A;  2BKF A;  2MA9 B;  2RUK B;  4EZJ A;  4YL8 A;  2YS3 A;  1RRP B;  2LOZ A;  4FN2 A;  2LI5 A;  2NPT B;  4HB4 B;  4KHB B;  3IFW B;  3NHE B;  2GBR A;  1UEF A;  1LQB A;  2KHW B;  1WX8 A;  5DPW A;  2HJ8 A;  3NY5 A;  4DX9 0;  1FHX A;  2L2I A;  4EKU A;  2Z59 B;  2KDI A;  2IYB A;  1E8W A;  3EEC A;  4PS3 A;  4WWP A;  2EJ8 A;  3QJZ A;  4JLC A;  1DYN A;  2C7M B;  3V6C B;  2C5L C;  1XT9 B;  2L8J A;  1TGZ B;  4EOY A;  2AYO B;  2KN5 A;  4L6E A;  3DVG X;  5DPT A;  3ZUN A;  2GBN A;  3DQV A;  5D2M B;  4IWP A;  3WAN A;  4NNJ B;  4DHZ E;  1P9D U;  2LAS A;  2LUL A;  3EHV A;  4W9K A;  2ELB A;  3ENE A;  1V6E A;  1U5F A;  2Z0O A;  2KDB A;  2FNJ B;  4HAU B;  4WJO A;  2ELA A;  3PV1 A;  5E6O A;  3L08 A;  5DPS A;  2EMT A;  3T9L A;  4IUM B;  1WGR A;  5CX3 A;  1IRS A;  4W9D A;  1ISN A;  1WH3 A;  4KAX B;  3K9O B;  2IO0 B;  4PYZ A;  2M17 A;  1DDW A;  1NU2 A;  2D9X A;  3PVU A;  3ZRC A;  1WJU A;  3PLV A;  2O6V A;  4DDG D;  3W1S A;  2KTR A;  3AU4 A;  2CHX A;  2V76 A;  1LW3 A;  4KZC A;  3VXW A;  5DHA B;  3APF A;  3RYT A;  3ML9 A;  1AWE A;  1J19 A;  3KUZ A;  3VVW B;  2KJ6 A;  4EUT A;  3VHT C;  4EZK A;  1FAO A;  4F7Z A;  3A98 B;  4B6H A;  2IO3 B;  4W9F A;  1WZ0 A;  2GBK A;  4W9E A;  2E2X A;  3VIA A;  4FBJ B;  3ZVR A;  1OMW A;  5E6N A;  3PSC A;  4FJZ A;  5GMV A;  1E5W A;  2LXC A;  1I35 A;  2D07 B;  2Z0D B;  1DDM A;  2K8C A;  2O6V B;  3ZTC A;  1LXD A;  2BPS A;  1P3R A;  3DXD A;  3HQC A;  3VH3 B;  3KY9 A;  4LJP B;  3WAM A;  2K2U A;  4ICV A;  3H7P A;  4HVB A;  5IAA C;  3ZNI D;  1U5E A;  1BWN A;  4DHZ B;  2LJ5 A;  3APC A;  2COF A;  1TZ1 A;  2I5C A;  2AL6 A;  1F9J A;  2YT0 A;  1YJ1 A;  1E8Y A;  3CF6 E;  3IHP C;  4FLH A;  1E7U A;  2KWV B;  1I42 A;  1E7V A;  1OQN A;  3I3T B;  4NY0 A;  1MK7 B;  4BKS A;  3VDZ A;  4G3X B;  2CHW A;  2K39 A;  4GN1 A;  4PQ0 A;  3SD5 A;  3NS8 A;  3ZNZ B;  2KQ7 A;  3R7Q A;  2KD0 A;  4MGZ E;  2MP2 A;  3VUW A;  1OTR B;  4WWN A;  3TMP B;  5C6R A;  3ODW A;  5D27 A;  3U8Z A;  4A5K A;  4MEL A;  3A9J A;  5CHW A;  4ZRJ A;  5D3V A;  1WG7 A;  3QAR A;  5FI1 A;  5TR5 A;  2UYZ B;  3PVL A;  1Y19 B;  1X86 A;  2DHJ A;  3VUY A;  2LVO A;  3VQI A;  1FB8 A;  4ZRK A;  3OAW A;  1RLF A;  2N0Y A;  2YSZ A;  4I6L B;  2KKC A;  3T8M A;  1GJZ A;  1XR0 B;  1OGW A;  4A3O A;  1UPR A;  1K5G B;  2G4D B;  1PQS A;  1TJ6 A;  2FID A;  3M95 A;  3A9J B;  3N30 A;  2R0D A;  2GBJ A;  4K7S A;  3NZU A;  4MEM A;  4XC2 A;  5EFX A;  2KDF B;  3AXC A;  2NMB A;  1ZC3 B;  4HB3 B;  2KC2 A;  4KV2 A;  2KAN A;  3CST A;  2LGD A;  3FM8 C;  4A6F B;  1Y8R C;  5JHA A;  1OEY A;  1M7R A;  5L95 C;  1P1A A;  1UNP A;  5CTR C;  2KNB A;  2PJH A;  1TBE A;  3O96 A;  3IVF A;  2O6V D;  3WYF B;  3X0W A;  4LCD E;  2GMI C;  1WR1 A;  2XK5 B;  3HW2 B;  4BOZ B;  3QWM A;  1WJ4 A;  1L2N A;  1P98 A;  2AEH A;  1OEY J;  3R3M A;  2LUE A;  2M0X A;  3PRE A;  4E71 A;  4TV3 A;  2Q13 A;  2BCJ A;  1YD8 U;  5D7G A;  2MWN B;  4NJ7 A;  3ZVV A;  2PPH A;  3UIP B;  4HJK A;  1V61 A;  1XCG A;  2MKR A;  4EMO A;  3PRZ A;  2A5U A;  4OVU A;  2WYQ A;  3UF8 A;  2RPQ A;  4ASW C;  3ONS A;  3AJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...