4GMVA

Crystal structure of the coiled-coil, ra and ph domains of lamellipodin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
269
structure length
260
Chain Sequence
KAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Ras-associated and pleckstrin homology domains-containing pr
total genus 77
structure length 260
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gmvA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gmvA01
3N7CA 1JRUA 3M1IB 2K6QA 3R3MA 2I1JA 3A9KA 4ZDVA 1W1GA 4KHOA 4BKSA 1UNPA 1KZ7A 2I1KA 2K2JA 2V1YA 4HAZB 1HE8A 1XCGA 2WX1A 4WWPA 3HQCA 1U5DA 2NZ8B 3TJPA 2N0YA 2IO3B 2G45B 3HIZA 2Y8FA 5J3QA 4ZYNA 3U8ZA 2JRIB 2DAFA 2BPSA 3VVWB 2KX0A 4OVVA 1GC7A 2CY5A 3D8EA 1NDDA 4MSMB 4GMVA 4HAUB 5KHOA 5L83A 2KUPA 2WYQA 2NS5A 1E8YA 3PG7A 5GOWB 3CF6E 5DPSA 1P9DU 3L17A 5EFXA 1TGZB 3H7PA 1BTNA 3PHXB 1OGWA 4KZ0A 4HB4B 2D3GA 2O6VD 4EKUA 1Z5SB 1J8CA 4TQ0A 1A5RA 1MIXA 2PZ1A 5HE3A 2Z0OA 1E8ZA 1WGYA 2Z59B 2MLBA 2M4NA 4KZCA 2CODA 1WH3A 2MFQA 3CSFA 3PVUA 4HB2B 2J7QB 3M63B 4G11A 2MDXA 5KQ1A 2KDEB 2NPTB 2BYEA 4HB0B 2N23A 4HHVA 2CRFA 2R09A 3P2BA 2ZCCA 3OANA 2RNRB 4ZRKA 2JPHA 1R4NI 2MBBB 4G50A 2DYMA 1V6EA 4N9F4 4TQ1A 1YJ1A 2M38A 1OEYA 4EEWA 5JLJB 3ML9A 2QKMA 3PTFC 2UZRA 2HTHB 3H1UA 3VXWA 2BKRB 1PMSA 2IFSA 4URKA 4ZRJA 5C16A 5J3YA 1SIFA 3B08A 2R0DA 3O65B 5D94A 1RAXA 1WZ0A 2C7NB 1QC6A 2FCSA 3X23A 2KMAA 3A1QA 1XQQA 2QKLA 1ZC4B 3NOBA 4FJVB 1W1DA 1AWEA 4AWJA 4BOSC 1IYFA 3H7SA 1WXSA 4W9JA 3SHQA 4DDID 1P0RA 2DENB 2G3QB 3Q3JA 4DHZE 2WDTB 1H4RA 3KSYA 4YONA 2Z0DB 1WIAA 1EF1A 1R4MI 3ZNZB 5JHBA 3VH3B 4J6IA 2LVQA 4TV3A 5L95C 2KXJA 1U29A 2DHZA 2FIDA 3HM6X 4MK0A 4NAWA 5JZEB 1GG3A 4PS3A 3V6EB 4Z2NA 2PE9A 2C60A 2MSED 1WMHA 4DX8A 1C1YB 5D6JB 4EOYA 3EC8A 4F1SA 2DYOA 2PE6B 2BWES 2MBHA 4W9CA 2D9XA 1XKEA 2Y7BA 3IFWB 4RM8A 5DCNA 2KVRA 2DKQA 5LXHA 3QARA 3RUIB 5JHHA 3A33B 1MAIA 3Q3FA 4GXBA 2LRWA 2D2QA 4DBBA 1WJ6A 1FGZA 2L8JA 3PHWB 3VH4B 2P8VA 2KJHB 4E3CA 2JY6A 4IOYX 3SO6A 3N30A 2L1CA 2XQNM 1WI1A 5D27A 4NQKE 2RGFA 3VDZA 2V76A 4CYEA 2KC2A 2RGNB 2UZSA 1NTYA 2COCA 4IFSA 2M8SA 3NY5A 3WIMA 1U5GA 2IY0B 2FIFA 2GBKA 2ZPNA 2KDIA 2KJ6A 1V5MA 3HM3A 3ZRFA 2JZ3B 1OY2A 1FOEA 3SUZA 1ZGUB 4PQ0A 2DN6A 1E8WA 1UPRA 5C79A 2KTRB 2O6VB 3NZSA 2FCMA 2D9WA 4NJ6A 2ZNVB 1RRPB 4AUQC 1FHOA 4P7IA 2YRYA 3QWMA 2KWUB 4K17A 4MH0E 1SGHA 1EF5A 2COFA 4EZLA 2VKIA 2DZKA 3QCAA 1NI2A 4GU2A 1GNUA 1Z87A 3MDBC 1NTVA 5DHAB 1UGMA 2AL3A 2R2OA 3QC8B 3MJWA 4KHAA 2ROVA 4KIKB 3PT2B 4DDGD 2BYFA 1WJ4A 4A3OA 2RUKB 2KLCA 2RR9A 2KD0A 5CHVC 4XWXA 3QWZB 3SV1A 3TCAA 2DX5B 3JW0X 5JH5C 4WVFB 2JF5A 3T06A 1ZSQA 3IHPC 3A9JB 4MGZE 4AP4C 1WGRA 2YVCA 1TJ6A 1J0GA 2NPTA 2L05A 1E90A 3R7QA 2J0JA 4KVGB 2DAJA 4IAPA 2FAZA 3RD2A 4EZKA 1V2YA 5D7GA 1U5EA 2ZEQA 4PS7A 1BWNA 4ANUA 1WRDB 4WWNA 4K81A 3S2AA 2DHIA 2JWZA 4HWIB 3TVVA 3PZDA 1P6SA 2ZPYA 2MBEA 3AU4A 1BT0A 3DVGY 2IYDB 3UZTA 4W9GA 2D11A 4D0NB 4W9DA 4GDLB 3VUYA 3A1QB 2BCJA 1N3HA 2A5UA 2KZRA 2NMBA 3N32A 2RD0A 3SDLC 2G4SA 4NY0A 3NSUA 2LULA 1TTNA 1ZW7A 2LRUA 3LJUX 3IG3A 4K1RB 3VAWA 2K39A 1QQGA 4IW0A 3PRZA 4GIVA 1H10A 3PEGA 4Z2MB 2MW5A 3UF8A 4EMOA 3QQ8B 3SD5A 1H8CA 1IPGA 1V9JA 3L16A 3QJZA 2CU1A 2GBRA 4I6PA 2LGYA 4IC7B 1V80A 4NQLB 4BFRA 4KIKA 4EUTA 3OLMD 1DYNA 2KGXB 3KRWA 3JYUA 3ZLZA 2D4QA 5J18A 2COAA 2K2UA 2LOXA 1QZEA 2Z0EB 5CHWA 4ANWA 3HW2B 4ANXA 4F7ZA 2DYQA 5D3VA 1RRBA 3QAQA 2NBVB 2N7DA 1LFDA 1WXAA 5E6NA 2MBQA 3RCZA 4NNJB 3B0AA 3PVWA 4RM9A 4WJ7A 1OQNA 4HATB 2K6DB 2KTRA 4IWOA 2ZJDA 2V4LA 2GJYA 4W9FA 2DFKA 3O96A 2IYBA 2N9PC 5E6PA 4A6FB 4PNKA 4BKTA 4DHZB 2N9XA 2N1VA 5AZHA 4B6WA 3NHEB 5CTRC 1Q0WB 5D3XA 3T8MA 2MWNB 4WWOA 4MELA 2UVMA 1UNQA 2AEHA 2DLWA 4X57B 1I42A 1V86A 2D9YA 3DBLI 5TR5A 5HE2A 2WWZA 2ADZA 2KC1A 1P98A 2MP2B 4AOFA 4HAYB 2L3ZA 3A98B 2DTCA 3K9OB 3PRPB 4LJOB 4EFOA 5E6OA 3MHSD 3UGBB 1WGGA 3NS8A 2P0DA 2G4DB 3KVFB 3WA0A 2HJ8A 2LXCA 1G6JA 2MQJA 4I6NB 2D9ZA 4GGQA 4MSQB 4JIOU 2DZIA 4LJPB 2KMCA 3H6NA 2MKRA 2ROZB 3L08A 3V60A 1P3RA 1D3ZA 3CXBB 3ODWA 3FM8C 3ZW3A 3EECA 1Y5OA 4MT7A 1RFAA 3EHVA 2BGFA 4DK5A 1YIWA 3QHTA 2FNJB 1TBEA 3VOQA 2KWCA 4EJNA 3CSTA 3DVNU 3W1SA 3GZNI 2GBJA 2JT4B 2BYVE 4BKGA 3P7ZA 3B1LX 2EJ8A 1X1MA 3ODOA 3ML4A 3KYCD 3LJ3A 1U4AA 5J3TA 3ZNID 1LB1A 4B95A 2RSGA 4WJQA 1XD4A 4DHJB 2JZZA 2B3AA 2QHOA 1I2HA 3ULCA 1X11A 1KOTA 2DZJA 2I5FA 2M0XA 3KY9A 2UYZB 2KQ7A 2MRPA 1F9JA 2MWSB 3AXCA 4I6LB 4IUMB 4NSWA 1BTKA 4XZ4A 2KX3A 4WJNA 3RT3B 1V81A 1ISNA 1WJNA 1WYWB 1XT9B 2GBMA 2NCNA 3QX1A 1T0YA 2CR5A 1RJ2A 2AL6A 4YL8A 5LOPB 1Q1OA 2N9EB 4TUUA 4DWFA 1J0WA 2W2XC 2IO2B 2IBIB 2JRHA 3L10B 4FJZA 1UZXB 5C6RA 5C5BA 4CHMA 2CS4A 3OJ3A 1EAZA 5FR6A 3V62A 3G9WA 2BF8B 2C7HA 2EKEC 3PPAA 3VTWA 1X1FA 1LQBA 2KFJA 4JGHB 3VQIA 1Y19B 2G35A 1M7RA 2KJRA 2CAYA 1AQCA 3ULBA 2KWVB 3RZFA 2Z0QA 4FA6A 3QIJA 1DDVA 2O6VA 2VSZA 2KFKB 2PJHA 1WXMA 3WAOA 3EFUA 3KUCB 1V5PA 5JP4A 2LYDA 5AZFA 3SNHA 3GYPA 2KANA 2XBBC 2DX5A 3T9LA 1FAOA 4MY6A 3DXEA 4E71A 2DKPA 1FHWA 3APCA 1TXDA 2YSZA 3IVFA 1B55A 3LDZE 4DX90 3VUXA 4A6KA 4LCDE 1WR6E 3SYXA 5FI0A 2GBNA 1KI1B 3ODXA 2IO1B 2MA9B 4FJYA 3TBLD 4TKNA 3ZRCA 4CO7A 4JQWC 5CX3A 1V5TA 3A4RA 3ML8A 5DH9B 1PFJA 2WX0A 3PREA 1XX0A 4HJKA 4A20A 3ZIMA 2ELAA 1WM3A 1IRSA 2XK5B 2KQSA 2FUHB 1WJ1A 3ENEA 4IM3A 3RULA 3QK0A 4NAWB 1V5OA 4F7GA 2X18A 1PLSA 5FI1A 1EGXA 1EO6A 1PQSA 2IO0B 2XEWA 4ICUA 4BBKA 2ASQA 3H7PB 1OTRB 2Q13A 3PLUA 3PV1A 1UPQA 1XR0B 5DPWA 1OQYA 2K8BA 2K1FA 3DOWA 1YD8U 2LVOA 2LOZA 5AEKB 3F5RA 3KYDD 4B9KA 3GYOA 2ZVOA 2L2IA 3VUWA 2MX2A 2M1MA 3I3TB 2OTXA 1M94A 3L13A 3ZDTA 4KDIC 2YT1A 1ZC3B 4CHJA 2L0TA 2O2VA 1EUVB 1E8XA 4F8CB 1WF9A 2LKOA 5DIFB 1S1QB 2HTHA 2MBOA 2LI5A 4JL9A 1ZVRA 1MG8A 2EC1A 2LG1A 3TFMA 1DROA 1KLVA 3V6CB 4HPLB 3L54A 3UQBA 2EMTA 4WJOA 2HD5B 3A8PA 1FGYA 1EVHA 4GPTB 1P1AA 4K7SA 4A6FA 1YQBA 3BY4B 4HCNB 2N1WA 4FHKA 3VTUA 1UEFA 1K5DB 1S3SG 2W9NA 2AWTA 2KDFB 5G2NA 1WE7A 3ZTCA 2REXA 3APDA 3GOEA 1WX8A 3ZVVA 4MGIE 2KHWB 3PSCA 5DI9B 2DX1A 1WM2A 2V3SA 1AARA 4KDLB 1V61A 2JXXA 2KKCA 3M62B 4MJSA 4GN1A 4LDTD 3UIOB 4GSWA 1UD7A 4KSLC 5CLQB 3R66C 5DPRA 3VHTC 5HKHA 3M3JA 3HK0A 4FADA 4AJYB 4BBNF 4HAWB 2PPHA 2C7MB 3WYFB 5IA7A 2VRRB 3DDCB 4W9EA 5BO4B 3ZTDA 4EZJA 4HLEA 4F7HA 3DBHI 2KTFA 1GUAB 2J59M 4MEMA 4KHBB 3DPDA 4HXDA 1WZ3A 3CMMB 2GS0A 4IM0A 4RMAA 2ZNVC 2O2VB 4A5KA 1XD3B 4DHJD 2M17A 4E74A 3IBEA 4MGYE 5JHAA 2KCJA 4M8MA 2W2XD 1J19A 1WGQA 3DVGX 2BWFA 3M95A 2YS1A 4A6HA 4MM3A 3UIPB 3PP2A 4ANVA 3DXDA 3AULA 2KK8A 2KLGA 4FLHA 2ZCBA 3RZWC 1KZGA 2EMSA 2CKHB 2IZVB 4KAXB 4GDKB 4MJSB 4OVUA 2P0FA 1I35A 1DBHA 3BINA 1X86A 1RLFA 4HK2A 2YS3A 5HE1A 4H8SA 3U30A 2J0KA 1E7UA 1FHXA 2Z0PA 3KZ1A 1LXDA 1IP9A 5KCVA 1UBIA 3ONSA 2I5CA 2LGDA 3KH0A 2N7EA 4HAXB 3TW1A 5C23A 3A9JA 4C0AA 3UINB 2PEAA 1X1GA 5GMVA 1WE6A 4AJWA 4KSKC 4XC2A 3SU8X 3L0WB 1V49A 4A3PA 3KRXA 2YLMA 4KV2A 1DDMA 1VD2A 2OOBB 4IM2A 1WY8A 3FEHA 1UELA 1MKEA 3ECIA 4IWQA 5HE0A 1C3TA 1UBQA 1E5WA 1K5GB 4DXAB 2LGXA 2LJ5A 1ZM0A 3ALBA 4HCPB 3A8QA 2RSUA 4BOZB 4HVBA 5KHQA 1KJTA 3OJ4B 2NR2A 1MIZB 3CIKA 1VCBA 3PRMB 2LASA 2MP2A 2Y5BB 1P3QU 3ZUNA 3APFA 1WMHB 5IAAC 3F0WA 2NVUI 5C1ZA 3ZDMC 3VTVA 2KNBA 3V61A 4ZRIA 3VIAA 1OMWA 2P0HA 1WXVA 2CHZA 5KQ4A 1ZKHA 2K8CA 3JVZX 4G3XB 3JSVB 1NBFC 3ZNHB 2HE7A 2KN5A 4PYZA 2AYOB 2XK5A 4PYUA 2Y8GA 3KUDB 2KFKA 2YT0A 4HB3B 4XX5A 5LONB 2L7RA 1XODA 3OAWA 3U7DA 1SHCA 4GDKA 5D2MB 4ASWC 1FXTB 4L6EA 2DYNA 2LUEA 4GZUA 3QA8A 4W9HA 2RLOA 2LD9A 3H9DA 2FCQA 4W9IA 1U2BA 4CHKA 3AU5A 1TQZA 2L0FA 1WGUA 2LZ6A 3A4SC 3DBSA 1MK9B 1WVHA 3R7RA 4K2PA 1WG7A 2CY4A 4BVUC 5LXIB 1UNRA 3WALA 2J0MA 1L2NA 3PVLA 1LM8B 1Y8RC 4B6HA 2ZZPB 3K9PB 3NZUA 4W9LA 3ZNGC 3ZO5B 3KW5B 4GMXB 1CMXB 5DHFB 1K8RB 1V5UA 1I7AA 2GCLA 2NBWB 2DHKA 4GB9A 2D9VA 1P5TA 4BKSD 3W1YA 2OQBA 1SE9A 3PSEB 2RVBB 4HAVB 2C5LC 5L81A 1Q67A 2YS5A 4WAAA 4FN2A 1WX9A 2R2QA 4WJPA 4IWPA 3D8DA 3MTNB 1M7EA 3N3KB 4MDKE 2MCNB 2IY1B 4LDTB 1BAKA 3DQVA 3D8FA 4GDLA 4PS8A 3DXCA 3TO1A 3PS6A 2ELBA 3DBRI 3WANA 4FULA 1OEYJ 1YX5B 3C0RB 4DBGA 2DZMA 2A4ZA 1NU2A 1V88A 5C5BB 4HDQA 2DHJA 2LVPA 2W2WA 4M0WB 2GOWA 4WSFA 1MK7B 5G55A 4BBNC 2KO3A 2D07B 5EDSA 3TMPB 1LW3A 2E2XA 2H7DA 3FSSA 3P6AA 1WGDA 5D3WA 1TZ1A 2CHWA 4II2B 2DYBA 4ICVA 3VFKA 3UQAA 5CLLB 2L76A 2KOXA 1W1HA 2OJRA 4K7WA 2ZVNA 1KM7A 4W9KA 1WR1A 1Q5WB 4G0NB 2YF0A 2N4FA 2RPQA 2L00B 5CHFA 5J17A 4HPMB 4HDOA 3QBVB 1U5FA 3HHMA 3W1SC 1DDWA 1U27A 4Y94A 1E7VA 1WX7A 2LWPA 1WJUA 2M14A 2FCNA 1Z2MA 4WQOB 3TIXA 1YX6B 1UH6A 2KDBA 1MPHA 3AI5A 4II3B 3MPXA 4K2OA 5D3YA 3V5WA 4MGKE 3TL5A 4F7UP 5AZGA 1GC6A 4NPNA 1WGHA 2UWQA 3WAMA 2K8HA 3DVNV 3PGEA 5JHGA 4NJ7A 5DPTA 3X0WA 2JP2A 3PLVA 2VRWB 1X05A 4GOCA 3D32A 2NBUA 1GJZA 1V89A 3DCGA 4M8NA 3JSVA 2K00A 3KUZA 2C9WB 4JLCA 2DA0A 2D10A 3BJIA 5J2RA 1WI0A 2H7EA 2CHXA 2JUOA 2GMIC 2LXAA 2K25A 2BKFA 2FJLA 3WAPA 3AJ4A 1WJMA 3RCPA 1WFYA 3ZKJC 1L7YA 1FB8A 2GCJA 4FBJB 3ZVRA 4IG7B 5LLIA 4TYZA 4K7UA 2JVCA 4FHJA 3RYTA 3A9KB
chains in the Genus database with same CATH superfamily
2MJEA 1VLBA 4ZDVA 1W1GA 2WXHA 1VRAB 1HTQA 3HIZA 4IKGA 3U8ZA 2DAFA 1GC7A 2CY5A 3D8EA 2BS2B 1GB1A 1N5XA 4C7YA 2BT6A 3PG7A 2B76B 3PHXB 4OVZA 3H7PA 1TGZB 2OJWA 1J8CA 4KZ0A 2O6VD 4EKUA 2PZ1A 2Z0OA 2Z59B 4N6EB 4B95A 2MDXA 4HHVA 3ZQ4A 2ZCCA 3OANA 4ZRKA 4TQ1A 4XDDA 4EEWA 2DYMA 1V6EA 1OEYA 2UZRA 4OW0A 4RCOA 1JWUD 1T0QC 1PMSA 4MT5A 1SIFA 3B08A 3O65B 1HZ5A 2C7NB 2KMAA 3A1QA 2X8XX 3P4SB 1XQQA 1ZC4B 4AWJA 1IYFA 4M02A 4DDID 2DENB 2G3QB 2Z59A 4YONA 1EF1A 1P7EA 2N9LA 4J6IA 4TV3A 2KXJA 5JZEB 4KKIA 1TY0A 4W9CA 1B1ZA 3RUIB 1FNVA 1XCTL 1TJEA 2LRWA 3DBRB 4DBBA 2P8VA 2JY6A 3SO6A 3C8YA 2L1CA 2BTEA 2KC2A 2UZSA 2GBKA 4UDUC 2KTRB 1E8WA 2DN6A 3Q8FA 1UPRA 2D9WA 3QWMA 4K17A 1SGHA 1EF5A 4EZLA 1L0VB 2DZKA 5E6PA 1NI2A 1UGMA 3QC8B 4MM3B 4RGTA 4KHAA 2ROVA 3PT2B 4US9A 4A3OA 2KLCA 2DWQA 3JW0X 4WVFB 3IHPC 5FK9C 3R7QA 4KVGB 3GP7A 4IAPA 1EM7A 4EZKA 4OSNA 1BWNA 2JWZA 4HWIB 5G5GA 2IPKD 3DVGY 2LEKA 3UZTA 4W9GA 4C7ZA 1SB3C 4YWGG 2KZRA 1N3HA 3SDLC 1NENB 2G4SA 2LRUA 3VAWA 4L1BA 3CWIA 4JX1C 3SD5A 1V9JA 2GBRA 1V80A 4EUTA 2WXMA 3PO0A 5LG4B 2KQ4X 1KH0A 2NBVB 2N7DA 2MBQA 3B0AA 3PVWA 4WJ7A 1OQNA 2K6DB 2KTRA 4W9FA 4BKTA 2DFKA 3TEZA 4PNKA 4DHZB 2N1VA 4MH8A 5CTRC 3IT6B 4MACA 4MELA 1MFWA 2AEHA 1I42A 2D9YA 1L4DB 1TKGA 1VZ7A 4YSXB 2WWZA 4C4VB 2KC1A 1XLNA 3K9OB 2DTCA 1PGBA 4EFOA 1R4MB 2P0DA 1YN3A 1C78A 2D9ZA 3AH7A 3U4EG 3Q69A 2KMCA 4LJPB 1P3RA 3ODWA 3SEBA 5JXVA 3FM8C 1Y5OA 1C4PA 2KWCA 3DVNU 3GZNI 3P7ZA 3LJ3A 4GNKB 1U4AA 2SAKA 3ULCA 1KOTA 2DZJA 2I5FA 1XCQL 2KQ7A 2MRPA 2MWSB 3AXCA 4IUMB 4XZ4A 4S17A 1ISNA 3AEBB 3Q14C 1WYWB 1XT9B 2GBMA 1NYQA 2N9EB 4DWFA 1J0WA 4LNOA 2IO2B 5C5BA 3OJ3A 4M0WA 3PPAA 2JYTA 2G35A 2KJRA 1AQCA 1YMHE 3QIJA 1RWSA 2VSZA 2IGDA 1WXMA 3EFUA 1SIJA 1YNTE 4ZHPA 2M56B 3GYPA 2XBBC 3T9LA 2DX5A 4A9AA 1L6VA 4A6KA 1I4XA 2NMQA 4FJYA 3RMKC 1FNWA 4JQWC 2L52A 2ELAA 4D6WA 1FMAD 3ENEA 4EE2A 4NAMA 2X18A 1PLSA 3OHMB 1EGXA 2MJDA 2WXNA 2ASQA 2JYEA 1D5MC 1ZDVA 1UPQA 2LOZA 5BYQA 1SXTA 2M1MA 3RNEC 1ZC3B 4F8CB 1WF9A 4JL9A 3TFMA 2HTME 2EMTA 1EVHA 4RGNA 1P1AA 3BY4B 4N59A 1F77A 4FHKA 1V1PB 1UEFA 5G2NA 5BMIA 1I7HA 2REXA 5HFYA 1WX8A 3ZVVA 1WM2A 2QILA 3RNGC 4ZOHC 1AARA 2JXXA 4MJSA 4GN1A 1PGXA 3UIOB 5HKHA 1UD7A 3R66C 2INCC 2BYTA 3HK0A 4HAWB 5BO4B 4HLEA 1YQ4B 4KHBB 3P4RB 3CMMB 4IM0A 2HDEA 4DHJD 2M17A 1TYGB 2RPVA 4KGSA 1L0YB 3AULA 3AN1A 3AE1B 4MJSB 4OVUA 1FCLA 1DBHA 1X86A 2YS3A 5HE1A 4H8SA 2MHJA 2J0KA 4M00A 1SJHD 1XLOA 1IP9A 4M01A 1UBIA 1ZXIA 5GMVA 3E56A 2DLBA 1TT5B 3FEHA 1UELA 4RGMA 1C3TA 4HCPB 3ALBA 2RSUA 3DWMA 5KHQA 2JZPA 3PRMB 2LASA 4YTPB 4RH6A 5H8YE 4ZRIA 1QOFA 3NVZA 1JWBD 2Q5WD 1NBFC 2HE7A 2VZKD 3KUDB 2KFKA 2YT0A 5LONB 1XODA 3OAWA 1P7FA 2RLOA 2LD9A 4W9IA 1U2BA 3R7RA 1TQZA 4K2PA 1UNRA 2KIEA 3PVLA 1Y8RC 3K9PB 5E6JA 2ZZPB 3MFGA 5DHFB 1K8RB 1I7AA 2GCLA 3HSAA 1T0SC 4GB9A 2K3UA 3PSEB 3ZJVA 2C5LC 5L81A 2YS5A 4WAAA 4FN2A 2R2QA 1QT9A 4MDKE 4A8XC 3DQVA 4GDLA 1SE4A 2QSDA 2WXJA 1YX5B 3C0RB 1KLGD 5G55A 2W2WA 1YJJA 4WSFA 2GOWA 3TMPB 2H7DA 1FXIA 2L76A 3P42A 1HEZE 1W1HA 2OJRA 4A90A 2ZVNA 4W9KA 4G0NB 5CHFA 2EELA 2L00B 5HI1A 1Z2MA 4DXFA 1YX6B 1UH6A 3MPXA 5D3YA 1ZOYB 4MGKE 3BVMA 4F7UP 1GC6A 5IO9A 1WGHA 2UWQA 3WAMA 3PGEA 3VR9B 3NVYA 4KKJA 5HG2A 4M8NA 2C9WB 5J2RA 2W54A 2GMIC 1T3QA 5TSSA 4D2KA 3RPFC 3MC0B 3RCPA 3ZKJC 1I4QA 4IG7B 3T3NA 3DHHC 3RYTA 1JCKB 4RF0A 1EWCA 1ET9A 4L1RA 3A9KA 4TSSA 4KHOA 2I1KA 1KZ7A 3HVZA 2FUG1 2G1EA 3I5JC 1HE8A 2WX1A 2YEPF 2WXKA 2KN4A 4K3BA 2K8EA 5J3QA 1ENFA 2BPSA 5GXGB 3UI3A 2JSVX 2KACA 5KHOA 2WYQA 3BIID 1ZP0B 2ON8A 5TR5A 1P9DU 5EFXA 1Z5SB 4TQ0A 1MIXA 3RNAC 2MLBA 2M4NA 4KZCA 2WGSA 1WH3A 2MFQA 3CSFA 3PVUA 2J7QB 3IAS1 1HTOA 2KDEB 5KQ1A 3FILB 4HB0B 2CRFA 2RNRB 3I63C 2HTHB 3H1UA 2BKRB 2LMCA 4URKA 1CJEA 2INNE 2PVGC 1QC6A 3X23A 3NOBA 3L4PA 2FBWB 2Z13A 1WXSA 4W9JA 1NYRA 3Q3JA 2H89B 3LYYA 4DHZE 2OEDA 2WDTB 2MEKA 2VH2A 4ITKA 5L95C 2DHZA 3ZXRA 3HM6X 4MK0A 4KGRA 4NAWA 4PS3A 3V6EB 1UNSA 4Z2NA 2PE9A 2C60A 1WMHA 4F1SA 1C1YB 3EC8A 2V4IB 2PE6B 4RM8A 2DKQA 3QARA 3O13A 5JHHA 3A33B 2IJ0A 1MAIA 1C79A 4GXBA 2JQRB 2D2QA 1YN5A 1WJ6A 1FGZA 3VH4B 2KJHB 1GAQB 3N30A 4CYEA 3U12A 5D3DA 2M8SA 3WIMA 2ZPNA 2WDRB 1V5MA 2JZ3B 4JIOU 5C79A 1FNUA 4P7IA 3B9JA 1KFYB 2K0PA 1GNUA 1Z87A 2AL3A 3AE7B 3MJWA 1JWMD 2IGGA 2RUKB 4YT0B 2J52A 1Y56A 5CHVC 4XWXA 4ARIA 3SV1A 3TCAA 2DX5B 5JH5C 4S0RA 3A9JB 4AP4C 5EE0A 2NPTA 1E90A 2Y3AA 2J0JA 3RD2A 1K51A 2FAZA 4OT1A 2QEJC 1V2YA 5D7GA 4PS7A 2L32A 1WRDB 4WWNA 3S2AA 3TVVA 3PZDA 1P6SA 1JMLA 2WDQB 2GI9A 4D0NB 4W9DA 4JPSA 1EU3A 4QAYA 2BCJA 3N32A 2RD0A 1PYWD 1TTNA 3LJUX 4IW0A 4GIVA 1H10A 3PEGA 4EMOA 1TS5A 3W5VB 3QJZA 4R3DA 4I6PA 4NJCA 3OLMD 1N5WA 3KRWA 2KGXB 1L4ZB 3ZLZA 2D4QA 2WXIA 2COAA 2LOXA 1QZEA 4ANWA 4CQNA 4F7ZA 1T6BX 5BYRA 5E6NA 4RM9A 5DPRA 1JWAD 2ZJDA 3O96A 2IYBA 4A6FB 5AZHA 3ZYYX 3SFDB 1HXYD 3T8MA 2MWNB 4WWOA 2UVMA 1V86A 1XXGA 4AOFA 3PRPB 3RNBC 3UGBB 2HJ8A 4J3OD 4L23A 1L6UA 4BAXA 1QKZA 2DZIA 3L08A 1D3ZA 4MT7A 2BGFA 1YIWA 3QHTA 4REZA 1WXQA 2PLPA 3I9V1 2WXPA 1KF6B 1L0XB 2JT4B 2K22A 3B1LX 1BUIC 2J4XA 2B3AA 1X11A 1YJIA 3NW8A 2M0XA 3KY9A 2QMTA 2ACZB 4I6LB 4NSWA 3NG0A 3ABVB 4HJGE 2J53A 1MPEA 2AL6A 4YL8A 5LOPB 1Q1OA 3N1ZC 2QDFA 4AJWA 2KWDA 2EKEC 1X1FA 3VQIA 2KFJA 1M7RA 2CAYA 3I57A 1I4PA 2Z0QA 3GE3C 1DDVA 2KFKB 5HHDG 1V5PA 5JP4A 4JE3B 3MHZA 1D6EC 2XN9C 2DKPA 1FHWA 1UWXA 1RFKA 4LCDE 4P6VF 1KI1B 2MA9B 4CO7A 3ZRCA 1V5TA 3PREA 4HJKA 1PFJA 2WX0A 1XX0A 4QXAB 3ZIMA 1IRSA 2QCZA 1WJ1A 3QK0A 4NAWB 2IO0B 5FI1A 5IA7A 2KT7A 2NTTA 1LGRA 1N60A 1XR0B 1AN8A 3DOWA 2K1FA 2KAJA 3P4PB 2LVOA 2IDYA 2MH7A 1IBXA 2ZVOA 1ZYIA 4WQMA 2OTXA 4KDIC 5I2SA 2O2VA 2L0TA 2HTHA 2LKOA 2FJUB 2MBOA 2EC1A 1KLVA 3RN9C 2JWUA 4HPLB 3L54A 5IP4D 2E6XA 2HD5B 1FGYA 4GPTB 4A6FA 4HCNB 3VTUA 4QJ3B 2AWTA 3APDA 4MGIE 2KHWB 3PSCA 5DI9B 3Q3OC 4KDLB 1V61A 2KKCA 2QC8A 3OG5A 1NEKB 2KR0A 4GSWA 3VHTC 5CLQB 4Q2JA 4LNNA 1V1PA 2PPHA 2C7MB 3WYFB 3DBHI 1GUAB 1WZ3A 3NWDA 2XNAC 2ZNVC 2O2VB 4A5KA 1FRRA 3IBEA 2W2XD 1J19A 1WGQA 1D5XC 1TS4A 4A6HA 4ANVA 3DXDA 4FLHA 2KK8A 2SEBD 5M4YB 1KZGA 2CKHB 2IZVB 3DBHB 1E7UA 3HVDA 2Z0PA 3KZ1A 1DYQA 1FCCC 2LGDA 3KH0A 3A9JA 1A70A 3UINB 4KSKC 3SU8X 1V49A 4WAFA 1B9RA 1PFDA 2OOBB 5HE0A 2LGXA 3A8QA 4HVBA 4LK0M 3OJ4B 1MIZB 2MP2A 2Y5BB 1P3QU 2ZKMX 3AEGB 3F0WA 1TS2A 2W3SA 1C76A 3VTVA 3VIAA 1WXVA 2PMVA 4XGAB 1K52A 3JSVB 3ZNHB 1DOXA 2KN5A 4PYZA 3W5UB 4C56C 3EA6A 4HB3B 5LNK1 1UWMA 3U7DA 1SHCA 4ASWC 1FXTB 3R2IA 2DYNA 2LUEA 3NVWA 2LZ6A 4XYCA 1WVHA 1WG7A 3AV8A 2CY4A 5LXIB 1L2NA 3TEXA 2W3RA 1SJED 4TMAB 4YTMB 4GMXB 1CMXB 3HRDD 2DHKA 1P5TA 4KGTA 1SE9A 1C9FA 3B2GA 1M7EA 2MCNB 3BWUD 4LDTB 2J42A 3PS6A 2ELBA 3WANA 5I2MA 4FULA 3NRZA 5C2TB 4M0WB 2MJ3A 3VUXA 5C5BB 4HDQA 3IT4B 1MK7B 4BBNC 2KO3A 3HIEA 2D07B 2UU7A 2CHWA 1LW3A 2E2XA 4ICVA 3VFKA 1ESFA 1N6ZA 3PZ8A 4K7WA 3SFEB 4QJ5B 2YF0A 2G9HD 1JALA 2N4FA 3BYTB 5J17A 4HDOA 3QBVB 3HHMA 3W1SC 1DDWA 1U27A 1E7VA 1WJUA 4WQOB 3TIXA 1C4AA 1MPHA 4II3B 4K2OA 3V5WA 3E9SA 1FM0D 1QOGA 4NPNA 1MJDA 5JHGA 5AUKA 3KLSX 2NBUA 4H2AA 3DCGA 3J9CA 3R8BA 2K00A 4JLCA 3BJIA 1WI0A 2H7EA 2JUOA 3Q8EA 1R7SA 3WCQA 4PT5A 1AYFA 1TY2A 1WFYA 1DOIA 4RF1A 2GCJA 1XLPA 3NZ3A 4TYZA 2NBVA 2JVCA 3DHIC 4FHJA 3U52E 3A9KB 3JVZX 2K6QA 3M1IB 2I1JA 4N58A 1UNPA 3AEEB 1XCGA 3HQCA 3BZDB 3IXSA 3GS2A 4LTUA 2G45B 2Y8FA 3VVWB 1XO3A 2V3PA 1NDDA 4MSMB 5L83A 2KUPA 2NS5A 1E8YA 5DPSA 3CF6E 1BTNA 1OGWA 2D3GA 1NI3A 1XF5L 5HE3A 1WGYA 2VZKB 4ZYSA 1I4GA 3M63B 4G11A 4HB2B 3MC8A 3V05A 2NPTB 2BYEA 2N23A 3P2BA 2MBBB 4N9F4 1YJ1A 2M0AA 5JLJB 1T0RC 4KX6B 3ML9A 2QKMA 4ZHOA 1YQ3B 1TKYA 3VXWA 2IFSA 4DXGA 3AEDB 4ZRJA 1XEEA 4YXDB 2R0DA 1RAXA 2FCSA 2JXTA 2QKLA 1AWEA 3H7SA 4JWUC 1H4RA 1WIAA 2M19A 1F2RI 5JHBA 2LVQA 4CSQA 2FIDA 3Q8AA 2MSED 3BVZA 2BWES 2MBHA 1XKEA 3IFWB 4PK1A 2KVRA 3B2FA 4ARCA 5BMGA 2EKIA 3Q3FA 3BVGA 1JROA 2L8JA 3PHWB 3AM9A 5BMHA 4E3CA 1WGKA 4IOYX 3N1YC 2XQNM 1WI1A 5D27A 3FKYA 2V76A 4IFSA 2KVZA 1U5GA 2FIFA 2KJ6A 3HM3A 5T8IA 3ZRFA 1ZGUB 1FOEA 3NZSA 3KWLA 4OZBA 1RRPB 1FHOA 3U2SC 4US8A 2KWUB 1GPXA 3QCAA 3MDBC 1NTVA 3CIRB 1D4BA 4KIKB 2BYFA 2ZW1A 2RR9A 1QLBB 2HJ1A 2CJOA 1MI1A 2YT2A 4MGZE 1WGRA 2YVCA 1TJ6A 1BMLC 1J0GA 2L05A 2GUMA 1TS3A 2LUMA 2BQQA 3N20C 4K81A 2DHIA 2WXRA 1KLUD 1OQRA 2ZPYA 2MBEA 3AU4A 2D11A 1KRHA 3A1QB 2H88B 2NTSA 4NY0A 3NSUA 2LULA 1ZW7A 3IG3A 3AEFB 3PRZA 3Q3MC 2MW5A 5MPOA 1IPGA 1QF6A 3L16A 2BS3B 1JRPA 4BFRA 4KIKA 1N62A 4C80A 4YSZB 1SE2A 2RDBC 5J18A 4DQOC 2DYQA 5D3VA 4B0EA 2N9KA 2ICIA 3RCZA 4NNJB 4HPPA 4HATB 4AUQC 2V4LA 2GJYA 2N9PC 2N9XA 3NHEB 1Q0WB 4X57B 3DBLI 2ADZA 1P98A 2MP2B 4HAYB 2L3ZA 3A98B 4LJOB 3MHSD 1G6JA 3NS8A 3WA0A 2LXCA 4I6NB 4GGQA 3NS1A 3H6NA 2MKRA 2ROZB 3V60A 1AWDA 3EECA 1M4VA 1RFAA 3EHVA 2BB6A 3EGRA 2FNJB 1TBEA 3VOQA 1ZPSA 1E0ZA 2BYVE 2EJ8A 1K53A 3ZNID 2RRFA 4WJQA 1XD4A 2QHOA 2LGIA 1F9JA 1BTKA 1FFUA 4WJNA 3RT3B 1V81A 3AE4B 4OZAA 4IDIA 4XWTA 3QX1A 2L1AA 1T0YA 4AS1A 1RJ2A 2W2XC 4FJZA 5C6RA 3V62A 1EAZA 5FR6A 2BB5A 2BF8B 3VTWA 2WQYB 1Y19B 4FA6A 3ULBA 4HROA 5H92C 1FIQA 3C19A 2PVOD 5I4DA 1XLQA 2PKOA 5C3JB 2OHFA 5AZFA 4HSIA 3DWGC 4XDCA 4RGOS 3DXEA 1R4NB 3APCA 3IVFA 1FPYA 3SYXA 5FI0A 2GBNA 3ODXA 2IO1B 3TBLD 1C4CA 5CX3A 3A4RA 4A20A 1WM3A 1F0ZA 1FRDA 2XK5B 4F7GA 1PQSA 5DPWA 1EO6A 2XEWA 4ICUA 3H7PB 1NVID 1OTRB 4OZCA 4HRSA 2Q13A 1FXAA 2QJLA 5AEKB 3AE6B 3AE3B 3F5RA 3KYDD 1TZOA 3GYOA 4LLGM 3VUWA 3L13A 3I3TB 1FO4A 3EFCA 3ZDTA 2YT1A 4YTNB 5DIFB 1S1QB 2LI5A 1ZVRA 2D5GA 3DHGC 2WU2B 1ET6A 4K7SA 3DBLB 1WE7A 3ZTCA 3GOEA 2DX1A 3RNFC 1QOAA 3M62B 3ETRA 2BBCA 4KSLC 4FADA 4AJYB 4BBNF 3DDCB 3HUIA 4W9EA 3ZTDA 4EZJA 4F7HA 2D3CA 4MEMA 3DPDA 4RFBA 3OWEB 1C77A 4RMAA 3Q6BA 1XD3B 2K5PA 4MGYE 1YN4A 5JHAA 2KCJA 4M8MA 1JQ4A 1ROEA 3DVGX 4MM3A 4ZRPA 2E3TA 2KLGA 2ZCBA 2EMSA 1VZ6A 5G5HA 2P0FA 1CK1A 1RLFA 3BINA 4HK2A 3U30A 1LXDA 2I5CA 4DIXA 2PW9A 5C23A 4C0AA 1X1GA 1WE6A 4LNFA 4XC2A 3L0WB 3KRXA 1DDMA 1EWYC 1WY8A 3ECIA 4IWQA 1ZM0A 1FD6A 1WMHB 1QQRA 5IAAC 2NVUI 5C1ZA 3IAM1 3ZDMC 3V61A 2JX5A 2K8CA 1V97A 3TEWA 4PYUA 1T77A 5D2MB 4GZUA 1L5PA 3AU5A 2L0FA 1WGUA 3A4SC 1MK9B 3MC9A 3Q3NC 1KTKA 1VDVA 4BVUC 2Y5CA 3AECB 3WALA 2J0MA 1LM8B 3ZO5B 2INPE 1V5UA 2D9VA 2WXLA 2LFIA 3W1YA 2I38A 1DOYA 4HAVB 3ZJUA 1Q67A 1MVKA 2KIGA 4WJPA 1I4RA 1WX9A 4IWPA 3N3KB 1BAKA 4PS8A 3VRBB 2WP9B 1OEYJ 2KDMA 3T3OA 1AW7A 4A6QA 2WXQA 5EDSA 1WGDA 3FSSA 3P6AA 1F1HA 5D3WA 2DYBA 4WIPA 1KM7A 2RPQA 1U5FA 1WX7A 2LWPA 3N1XC 3PZ7A 2M14A 1ZUD2 2DBYA 2KDBA 1K50A 3TL5A 2V3NA 4C4VA 3EUB2 5AZGA 3AE8B 1IBXB 4L2YA 5DPTA 3X0WA 2JP2A 3P1MA 3PLVA 1X05A 5FKAC 1GJZA 1V89A 4OHJA 2Z14A 3KUZA 3A58A 1E9MA 5BYSA 4P16A 2CHXA 2ZW0A 2BKFA 3WAPA 1WJMA 1L7YA 1FB8A 4FBJB 4K7UA 3N7CA 1JRUA 2BS4B 3R3MA 1VZ8A 4BKSA 1ZE3D 2K2JA 1E7PB 3AB5A 2V1YA 4XE0A 4HAZB 2WNMA 3GB1A 4WWPA 1U5DA 2NZ8B 3TJPA 2N0YA 2IO3B 2AQ1B 2CJNA 2K9XA 3DCXA 4ZYNA 1MI0A 2JRIB 2KX0A 4OVVA 4GMVA 4HAUB 3NUHB 5GOWB 1H8CA 3L17A 4YSYB 4HB4B 3LXFA 1A5RA 1E8ZA 1V1OA 2CODA 4JWSC 4A55A 2R09A 3BK2A 3URYA 2JPHA 4G50A 1R4NI 2LGSA 2M38A 2KYWA 5FR3A 4RNAA 3PTFC 1STEA 5C16A 1UUPA 5J3YA 5D94A 1WZ0A 1I4HA 4FJVB 1W1DA 4BOSC 1CZPA 3SHQA 3VRAB 1P0RA 3KSYA 2Z0DB 3ZNZB 1R4MI 3VH3B 3MJ5A 1U29A 1GG3A 2AQ3B 4DX8A 5D6JB 1ZDXA 4EOYA 2DYOA 2D9XA 2Y7BA 1J7CA 5DCNA 5LXHA 1YOVB 3RFZB 1BXTA 4LNIA 4NQKE 2RGFA 3VDZA 2INDC 2RGNB 1NTYA 2COCA 2RDGA 3NY5A 2IY0B 2KDIA 5IRSA 2D3BA 1OY2A 3SUZA 4PQ0A 2GRIA 2O6VB 2FCMA 4NJ6A 2ZNVB 5IN7A 2YRYA 2X38A 4MH0E 2COFA 1SBBB 2VKIA 4GU2A 2GB1A 5DHAB 2R2OA 4DDGD 1WJ4A 3AE2B 2RDHA 3AE9B 2KD0A 3QWZB 2BW2A 4LNKA 1SF0A 2RMMA 3MP9A 2JF5A 3T06A 1ZSQA 2FE8A 1E10A 2DAJA 2PTLA 1U5EA 2ZEQA 4ANUA 5EE1A 1EU4A 1BT0A 3FC4A 2IYDB 1TKEA 4GDLB 3AMZA 2A5UA 2NMBA 1WSPA 4HEA1 1T5XD 4K1RB 2K39A 1QQGA 3UF8A 3Q2AC 4Z2MB 3RNCC 3QQ8B 3KQ4A 2CU1A 1D5ZC 2LGYA 4IC7B 2KUQA 1QOBA 4NQLB 1DYNA 3JYUA 2K2UA 2Z0EB 5CHWA 4ANXA 1VR9A 3HW2B 1RRBA 3QAQA 1LFDA 1WXAA 1F2RC 3LB8C 5IKCM 4WURA 4IWOA 2JU6X 3NWAA 1OFFA 4B6WA 5D3XA 1UNQA 2DLWA 1PDXA 5HE2A 5E6OA 2K49A 1WGGA 2G4DB 3KVFB 1SSNA 2MQJA 1QILA 4MSQB 2WLBA 3CXBB 3ZW3A 4DK5A 4EJNA 1LO5D 1IGCA 3CSTA 3W1SA 2GBJA 4BKGA 1N63A 3ODOA 3ML4A 1X1MA 4GOUA 3KYCD 5J3TA 1LB1A 2RSGA 4DHJB 2I2YA 2JZZA 3KWVA 4NZLB 2DNFA 1I2HA 3R2TA 2AX5A 2UYZB 2WDVB 2KX3A 1CQVA 1WWTA 1HA5A 1WJNA 2NCNA 3GZNB 2D3AA 2CR5A 1MG4A 4TUUA 4C00A 2IBIB 2JRHA 3BK1A 3L10B 1UZXB 4WH4A 4CHMA 2CS4A 3G9WA 1UGJA 2C7HA 1LQBA 4JGHB 3ZGZA 2KWVB 3RZFA 4HKQA 2VH1A 2O6VA 2WU5B 2PJHA 3WAOA 1Q10A 3KUCB 2LYDA 3SNHA 2KMMA 3H8HA 2KANA 1FAOA 4MY6A 4E71A 1TXDA 2YSZA 1B55A 3LDZE 4DX90 3P4QB 1WR6E 3NWFA 4TKNA 3ML8A 5DH9B 3TSSA 1J7BA 3NVVA 1JWSD 2KQSA 2FUHB 2WS3B 4IM3A 4ZRQA 3RULA 3TEYA 1V5OA 1FFVA 4BBKA 3PLUA 3ZXVA 3PV1A 1IUEA 1OQYA 2K8BA 1VJKA 1YD8U 2LHDA 1UF0A 2L2IA 2MX2A 1M94A 4CHJA 1EUVB 3AE5B 1E8XA 1MG8A 2LG1A 1DROA 3V6CB 3ZJTA 2N0SB 3UQBA 2LJIA 4WJOA 3A8PA 3Q8CA 2R2YA 1YQBA 3VR8B 2N1WA 3NJTA 1K5DB 1S3SG 2W9NA 2KDFB 2ONQA 5EE9A 1HZ6A 2V3SA 4P1CC 1HQRD 4LDTD 3M3JA 2VRRB 2Y5PA 1RYJA 2KTFA 2AQ2B 2J59M 4HXDA 2Z8LA 2GS0A 3N9YC 4E74A 1WYGA 3P63A 4FXCA 2WXOA 1FEHA 1PUTA 2BWFA 2V9HA 3FILA 3M95A 3W9CB 2YS1A 2QIEB 3BYYB 4USAA 3UIPB 3PP2A 3RZWC 1ACCA 2IGHA 4KAXB 4GDKB 4HKZE 4QJ4B 1I35A 2WXGA 1V8CA 5IOIA 1FHXA 5KCVA 3ONSA 2Z4DA 2N7EA 4HAXB 3TW1A 2YEPB 2PEAA 4K3CA 4A3PA 2YLMA 1F52A 4KV2A 1VD2A 4IM2A 2WXFA 2N7JA 1DGJA 1MKEA 4O1NA 1JW9D 1UBQA 1E5WA 1K5GB 4DXAB 2LJ5A 4BOZB 2LHEA 1KJTA 1IGDA 2NR2A 3CIKA 1VCBA 3ZUNA 3APFA 4WWMA 1MHXA 2KNBA 2CHZA 1OMWA 2P0HA 1RM6C 3RI7C 5KQ4A 1ZKHA 2V0GA 4G3XB 2PIAA 2AYOB 2XK5A 2Y8GA 4B0MA 4XX5A 2L7RA 5AUIA 5EE3A 4AQ7A 4GDKA 3U7ZA 4L6EA 3QA8A 4W9HA 3H9DA 2FCQA 3FVCA 4CHKA 3DBSA 1MHHE 3V3XA 2WHIA 3W2DA 4KHBA 4W9LA 4B6HA 3ZNGC 3NZUA 3KW5B 1N61A 2R61A 3SR6A 2NBWB 3TUOA 4BKSD 4ACFA 4BZAA 1SE3A 2OQBA 1OQQA 2RVBB 2W82A 1WRIA 3D8DA 3MTNB 2W55A 2CU3A 2IY1B 3B77A 3D8FA 4GLSC 2L83A 3DXCA 3TO1A 3DBRI 1E6EB 4DBGA 2DZMA 2A4ZA 1NU2A 1V88A 2DHJA 2LVPA 2BVCA 5D3IB 1TIFA 1TZ1A 4II2B 3UQAA 5CLLB 2KOXA 3FAHA 1WR1A 1Q5WB 1ZXHA 4HPMB 4Y94A 1SEBD 3VUYA 1PGAA 2FCNA 3AI5A 1GOZA 3AEAB 2K8HA 3DVNV 4NJ7A 4XWWA 4P1BC 2VRWB 4GOCA 3D32A 3GE8C 3JSVA 2DA0A 2D10A 4IOIE 1GB4A 2LXAA 2K25A 3Q8BA 1J7AA 2FJLA 3AJ4A 2GLSA 3ZVRA 2TSSA 5LLIA 4B9KA
chains in the Genus database with same CATH topology
3N7CA 1JRUA 3M1IB 2K6QA 3R3MA 2I1JA 3A9KA 4ZDVA 1W1GA 4KHOA 4BKSA 1UNPA 1KZ7A 2I1KA 2K2JA 2V1YA 4HAZB 1HE8A 1XCGA 2WX1A 4WWPA 3HQCA 1U5DA 2NZ8B 3TJPA 2N0YA 2IO3B 2G45B 3HIZA 2Y8FA 5J3QA 4ZYNA 3U8ZA 2JRIB 2DAFA 2BPSA 3VVWB 2KX0A 4OVVA 1GC7A 2CY5A 3D8EA 1NDDA 4MSMB 4GMVA 4HAUB 5KHOA 5L83A 2KUPA 2WYQA 2NS5A 1E8YA 3PG7A 5GOWB 3CF6E 5DPSA 1P9DU 3L17A 5EFXA 1TGZB 3H7PA 1BTNA 3PHXB 1OGWA 4KZ0A 4HB4B 2D3GA 2O6VD 4EKUA 1Z5SB 1J8CA 4TQ0A 1A5RA 1MIXA 2PZ1A 5HE3A 2Z0OA 1E8ZA 1WGYA 2Z59B 2MLBA 2M4NA 4KZCA 2CODA 1WH3A 2MFQA 3CSFA 3PVUA 4HB2B 2J7QB 3M63B 4G11A 2MDXA 5KQ1A 2KDEB 2NPTB 2BYEA 4HB0B 2N23A 4HHVA 2CRFA 2R09A 3P2BA 2ZCCA 3OANA 2RNRB 4ZRKA 2JPHA 1R4NI 2MBBB 4G50A 2DYMA 1V6EA 4N9F4 4TQ1A 1YJ1A 2M38A 1OEYA 4EEWA 5JLJB 3ML9A 2QKMA 3PTFC 2UZRA 2HTHB 3H1UA 3VXWA 2BKRB 1PMSA 2IFSA 4URKA 4ZRJA 5C16A 5J3YA 1SIFA 3B08A 2R0DA 3O65B 5D94A 1RAXA 1WZ0A 2C7NB 1QC6A 2FCSA 3X23A 2KMAA 3A1QA 1XQQA 2QKLA 1ZC4B 3NOBA 4FJVB 1W1DA 1AWEA 4AWJA 4BOSC 1IYFA 3H7SA 1WXSA 4W9JA 3SHQA 4DDID 1P0RA 2DENB 2G3QB 3Q3JA 4DHZE 2WDTB 1H4RA 3KSYA 4YONA 2Z0DB 1WIAA 1EF1A 1R4MI 3ZNZB 5JHBA 3VH3B 4J6IA 2LVQA 4TV3A 5L95C 2KXJA 1U29A 2DHZA 2FIDA 3HM6X 4MK0A 4NAWA 5JZEB 1GG3A 4PS3A 3V6EB 4Z2NA 2PE9A 2C60A 2MSED 1WMHA 4DX8A 1C1YB 5D6JB 4EOYA 3EC8A 4F1SA 2DYOA 2PE6B 2BWES 2MBHA 4W9CA 2D9XA 1XKEA 2Y7BA 3IFWB 4RM8A 5DCNA 2KVRA 2DKQA 5LXHA 3QARA 3RUIB 5JHHA 3A33B 1MAIA 3Q3FA 4GXBA 2LRWA 2D2QA 4DBBA 1WJ6A 1FGZA 2L8JA 3PHWB 3VH4B 2P8VA 2KJHB 4E3CA 2JY6A 4IOYX 3SO6A 3N30A 2L1CA 2XQNM 1WI1A 5D27A 4NQKE 2RGFA 3VDZA 2V76A 4CYEA 2KC2A 2RGNB 2UZSA 1NTYA 2COCA 4IFSA 2M8SA 3NY5A 3WIMA 1U5GA 2IY0B 2FIFA 2GBKA 2ZPNA 2KDIA 2KJ6A 1V5MA 3HM3A 3ZRFA 2JZ3B 1OY2A 1FOEA 3SUZA 1ZGUB 4PQ0A 2DN6A 1E8WA 1UPRA 5C79A 2KTRB 2O6VB 3NZSA 2FCMA 2D9WA 4NJ6A 2ZNVB 1RRPB 4AUQC 1FHOA 4P7IA 2YRYA 3QWMA 2KWUB 4K17A 4MH0E 1SGHA 1EF5A 2COFA 4EZLA 2VKIA 2DZKA 3QCAA 1NI2A 4GU2A 1GNUA 1Z87A 3MDBC 1NTVA 5DHAB 1UGMA 2AL3A 2R2OA 3QC8B 3MJWA 4KHAA 2ROVA 4KIKB 3PT2B 4DDGD 2BYFA 1WJ4A 4A3OA 2RUKB 2KLCA 2RR9A 2KD0A 5CHVC 4XWXA 3QWZB 3SV1A 3TCAA 2DX5B 3JW0X 5JH5C 4WVFB 2JF5A 3T06A 1ZSQA 3IHPC 3A9JB 4MGZE 4AP4C 1WGRA 2YVCA 1TJ6A 1J0GA 2NPTA 2L05A 1E90A 3R7QA 2J0JA 4KVGB 2DAJA 4IAPA 2FAZA 3RD2A 4EZKA 1V2YA 5D7GA 1U5EA 2ZEQA 4PS7A 1BWNA 4ANUA 1WRDB 4WWNA 4K81A 3S2AA 2DHIA 2JWZA 4HWIB 3TVVA 3PZDA 1P6SA 2ZPYA 2MBEA 3AU4A 1BT0A 3DVGY 2IYDB 3UZTA 4W9GA 2D11A 4D0NB 4W9DA 4GDLB 3VUYA 3A1QB 2BCJA 1N3HA 2A5UA 2KZRA 2NMBA 3N32A 2RD0A 3SDLC 2G4SA 4NY0A 3NSUA 2LULA 1TTNA 1ZW7A 2LRUA 3LJUX 3IG3A 4K1RB 3VAWA 2K39A 1QQGA 4IW0A 3PRZA 4GIVA 1H10A 3PEGA 4Z2MB 2MW5A 3UF8A 4EMOA 3QQ8B 3SD5A 1H8CA 1IPGA 1V9JA 3L16A 3QJZA 2CU1A 2GBRA 4I6PA 2LGYA 4IC7B 1V80A 4NQLB 4BFRA 4KIKA 4EUTA 3OLMD 1DYNA 2KGXB 3KRWA 3JYUA 3ZLZA 2D4QA 5J18A 2COAA 2K2UA 2LOXA 1QZEA 2Z0EB 5CHWA 4ANWA 3HW2B 4ANXA 4F7ZA 2DYQA 5D3VA 1RRBA 3QAQA 2NBVB 2N7DA 1LFDA 1WXAA 5E6NA 2MBQA 3RCZA 4NNJB 3B0AA 3PVWA 4RM9A 4WJ7A 1OQNA 4HATB 2K6DB 2KTRA 4IWOA 2ZJDA 2V4LA 2GJYA 4W9FA 2DFKA 3O96A 2IYBA 2N9PC 5E6PA 4A6FB 4PNKA 4BKTA 4DHZB 2N9XA 2N1VA 5AZHA 4B6WA 3NHEB 5CTRC 1Q0WB 5D3XA 3T8MA 2MWNB 4WWOA 4MELA 2UVMA 1UNQA 2AEHA 2DLWA 4X57B 1I42A 1V86A 2D9YA 3DBLI 5TR5A 5HE2A 2WWZA 2ADZA 2KC1A 1P98A 2MP2B 4AOFA 4HAYB 2L3ZA 3A98B 2DTCA 3K9OB 3PRPB 4LJOB 4EFOA 5E6OA 3MHSD 3UGBB 1WGGA 3NS8A 2P0DA 2G4DB 3KVFB 3WA0A 2HJ8A 2LXCA 1G6JA 2MQJA 4I6NB 2D9ZA 4GGQA 4MSQB 4JIOU 2DZIA 4LJPB 2KMCA 3H6NA 2MKRA 2ROZB 3L08A 3V60A 1P3RA 1D3ZA 3CXBB 3ODWA 3FM8C 3ZW3A 3EECA 1Y5OA 4MT7A 1RFAA 3EHVA 2BGFA 4DK5A 1YIWA 3QHTA 2FNJB 1TBEA 3VOQA 2KWCA 4EJNA 3CSTA 3DVNU 3W1SA 3GZNI 2GBJA 2JT4B 2BYVE 4BKGA 3P7ZA 3B1LX 2EJ8A 1X1MA 3ODOA 3ML4A 3KYCD 3LJ3A 1U4AA 5J3TA 3ZNID 1LB1A 4B95A 2RSGA 4WJQA 1XD4A 4DHJB 2JZZA 2B3AA 2QHOA 1I2HA 3ULCA 1X11A 1KOTA 2DZJA 2I5FA 2M0XA 3KY9A 2UYZB 2KQ7A 2MRPA 1F9JA 2MWSB 3AXCA 4I6LB 4IUMB 4NSWA 1BTKA 4XZ4A 2KX3A 4WJNA 3RT3B 1V81A 1ISNA 1WJNA 1WYWB 1XT9B 2GBMA 2NCNA 3QX1A 1T0YA 2CR5A 1RJ2A 2AL6A 4YL8A 5LOPB 1Q1OA 2N9EB 4TUUA 4DWFA 1J0WA 2W2XC 2IO2B 2IBIB 2JRHA 3L10B 4FJZA 1UZXB 5C6RA 5C5BA 4CHMA 2CS4A 3OJ3A 1EAZA 5FR6A 3V62A 3G9WA 2BF8B 2C7HA 2EKEC 3PPAA 3VTWA 1X1FA 1LQBA 2KFJA 4JGHB 3VQIA 1Y19B 2G35A 1M7RA 2KJRA 2CAYA 1AQCA 3ULBA 2KWVB 3RZFA 2Z0QA 4FA6A 3QIJA 1DDVA 2O6VA 2VSZA 2KFKB 2PJHA 1WXMA 3WAOA 3EFUA 3KUCB 1V5PA 5JP4A 2LYDA 5AZFA 3SNHA 3GYPA 2KANA 2XBBC 2DX5A 3T9LA 1FAOA 4MY6A 3DXEA 4E71A 2DKPA 1FHWA 3APCA 1TXDA 2YSZA 3IVFA 1B55A 3LDZE 4DX90 3VUXA 4A6KA 4LCDE 1WR6E 3SYXA 5FI0A 2GBNA 1KI1B 3ODXA 2IO1B 2MA9B 4FJYA 3TBLD 4TKNA 3ZRCA 4CO7A 4JQWC 5CX3A 1V5TA 3A4RA 3ML8A 5DH9B 1PFJA 2WX0A 3PREA 1XX0A 4HJKA 4A20A 3ZIMA 2ELAA 1WM3A 1IRSA 2XK5B 2KQSA 2FUHB 1WJ1A 3ENEA 4IM3A 3RULA 3QK0A 4NAWB 1V5OA 4F7GA 2X18A 1PLSA 5FI1A 1EGXA 1EO6A 1PQSA 2IO0B 2XEWA 4ICUA 4BBKA 2ASQA 3H7PB 1OTRB 2Q13A 3PLUA 3PV1A 1UPQA 1XR0B 5DPWA 1OQYA 2K8BA 2K1FA 3DOWA 1YD8U 2LVOA 2LOZA 5AEKB 3F5RA 3KYDD 4B9KA 3GYOA 2ZVOA 2L2IA 3VUWA 2MX2A 2M1MA 3I3TB 2OTXA 1M94A 3L13A 3ZDTA 4KDIC 2YT1A 1ZC3B 4CHJA 2L0TA 2O2VA 1EUVB 1E8XA 4F8CB 1WF9A 2LKOA 5DIFB 1S1QB 2HTHA 2MBOA 2LI5A 4JL9A 1ZVRA 1MG8A 2EC1A 2LG1A 3TFMA 1DROA 1KLVA 3V6CB 4HPLB 3L54A 3UQBA 2EMTA 4WJOA 2HD5B 3A8PA 1FGYA 1EVHA 4GPTB 1P1AA 4K7SA 4A6FA 1YQBA 3BY4B 4HCNB 2N1WA 4FHKA 3VTUA 1UEFA 1K5DB 1S3SG 2W9NA 2AWTA 2KDFB 5G2NA 1WE7A 3ZTCA 2REXA 3APDA 3GOEA 1WX8A 3ZVVA 4MGIE 2KHWB 3PSCA 5DI9B 2DX1A 1WM2A 2V3SA 1AARA 4KDLB 1V61A 2JXXA 2KKCA 3M62B 4MJSA 4GN1A 4LDTD 3UIOB 4GSWA 1UD7A 4KSLC 5CLQB 3R66C 5DPRA 3VHTC 5HKHA 3M3JA 3HK0A 4FADA 4AJYB 4BBNF 4HAWB 2PPHA 2C7MB 3WYFB 5IA7A 2VRRB 3DDCB 4W9EA 5BO4B 3ZTDA 4EZJA 4HLEA 4F7HA 3DBHI 2KTFA 1GUAB 2J59M 4MEMA 4KHBB 3DPDA 4HXDA 1WZ3A 3CMMB 2GS0A 4IM0A 4RMAA 2ZNVC 2O2VB 4A5KA 1XD3B 4DHJD 2M17A 4E74A 3IBEA 4MGYE 5JHAA 2KCJA 4M8MA 2W2XD 1J19A 1WGQA 3DVGX 2BWFA 3M95A 2YS1A 4A6HA 4MM3A 3UIPB 3PP2A 4ANVA 3DXDA 3AULA 2KK8A 2KLGA 4FLHA 2ZCBA 3RZWC 1KZGA 2EMSA 2CKHB 2IZVB 4KAXB 4GDKB 4MJSB 4OVUA 2P0FA 1I35A 1DBHA 3BINA 1X86A 1RLFA 4HK2A 2YS3A 5HE1A 4H8SA 3U30A 2J0KA 1E7UA 1FHXA 2Z0PA 3KZ1A 1LXDA 1IP9A 5KCVA 1UBIA 3ONSA 2I5CA 2LGDA 3KH0A 2N7EA 4HAXB 3TW1A 5C23A 3A9JA 4C0AA 3UINB 2PEAA 1X1GA 5GMVA 1WE6A 4AJWA 4KSKC 4XC2A 3SU8X 3L0WB 1V49A 4A3PA 3KRXA 2YLMA 4KV2A 1DDMA 1VD2A 2OOBB 4IM2A 1WY8A 3FEHA 1UELA 1MKEA 3ECIA 4IWQA 5HE0A 1C3TA 1UBQA 1E5WA 1K5GB 4DXAB 2LGXA 2LJ5A 1ZM0A 3ALBA 4HCPB 3A8QA 2RSUA 4BOZB 4HVBA 5KHQA 1KJTA 3OJ4B 2NR2A 1MIZB 3CIKA 1VCBA 3PRMB 2LASA 2MP2A 2Y5BB 1P3QU 3ZUNA 3APFA 1WMHB 5IAAC 3F0WA 2NVUI 5C1ZA 3ZDMC 3VTVA 2KNBA 3V61A 4ZRIA 3VIAA 1OMWA 2P0HA 1WXVA 2CHZA 5KQ4A 1ZKHA 2K8CA 3JVZX 4G3XB 3JSVB 1NBFC 3ZNHB 2HE7A 2KN5A 4PYZA 2AYOB 2XK5A 4PYUA 2Y8GA 3KUDB 2KFKA 2YT0A 4HB3B 4XX5A 5LONB 2L7RA 1XODA 3OAWA 3U7DA 1SHCA 4GDKA 5D2MB 4ASWC 1FXTB 4L6EA 2DYNA 2LUEA 4GZUA 3QA8A 4W9HA 2RLOA 2LD9A 3H9DA 2FCQA 4W9IA 1U2BA 4CHKA 3AU5A 1TQZA 2L0FA 1WGUA 2LZ6A 3A4SC 3DBSA 1MK9B 1WVHA 3R7RA 4K2PA 1WG7A 2CY4A 4BVUC 5LXIB 1UNRA 3WALA 2J0MA 1L2NA 3PVLA 1LM8B 1Y8RC 4B6HA 2ZZPB 3K9PB 3NZUA 4W9LA 3ZNGC 3ZO5B 3KW5B 4GMXB 1CMXB 5DHFB 1K8RB 1V5UA 1I7AA 2GCLA 2NBWB 2DHKA 4GB9A 2D9VA 1P5TA 4BKSD 3W1YA 2OQBA 1SE9A 3PSEB 2RVBB 4HAVB 2C5LC 5L81A 1Q67A 2YS5A 4WAAA 4FN2A 1WX9A 2R2QA 4WJPA 4IWPA 3D8DA 3MTNB 1M7EA 3N3KB 4MDKE 2MCNB 2IY1B 4LDTB 1BAKA 3DQVA 3D8FA 4GDLA 4PS8A 3DXCA 3TO1A 3PS6A 2ELBA 3DBRI 3WANA 4FULA 1OEYJ 1YX5B 3C0RB 4DBGA 2DZMA 2A4ZA 1NU2A 1V88A 5C5BB 4HDQA 2DHJA 2LVPA 2W2WA 4M0WB 2GOWA 4WSFA 1MK7B 5G55A 4BBNC 2KO3A 2D07B 5EDSA 3TMPB 1LW3A 2E2XA 2H7DA 3FSSA 3P6AA 1WGDA 5D3WA 1TZ1A 2CHWA 4II2B 2DYBA 4ICVA 3VFKA 3UQAA 5CLLB 2L76A 2KOXA 1W1HA 2OJRA 4K7WA 2ZVNA 1KM7A 4W9KA 1WR1A 1Q5WB 4G0NB 2YF0A 2N4FA 2RPQA 2L00B 5CHFA 5J17A 4HPMB 4HDOA 3QBVB 1U5FA 3HHMA 3W1SC 1DDWA 1U27A 4Y94A 1E7VA 1WX7A 2LWPA 1WJUA 2M14A 2FCNA 1Z2MA 4WQOB 3TIXA 1YX6B 1UH6A 2KDBA 1MPHA 3AI5A 4II3B 3MPXA 4K2OA 5D3YA 3V5WA 4MGKE 3TL5A 4F7UP 5AZGA 1GC6A 4NPNA 1WGHA 2UWQA 3WAMA 2K8HA 3DVNV 3PGEA 5JHGA 4NJ7A 5DPTA 3X0WA 2JP2A 3PLVA 2VRWB 1X05A 4GOCA 3D32A 2NBUA 1GJZA 1V89A 3DCGA 4M8NA 3JSVA 2K00A 3KUZA 2C9WB 4JLCA 2DA0A 2D10A 3BJIA 5J2RA 1WI0A 2H7EA 2CHXA 2JUOA 2GMIC 2LXAA 2K25A 2BKFA 2FJLA 3WAPA 3AJ4A 1WJMA 3RCPA 1WFYA 3ZKJC 1L7YA 1FB8A 2GCJA 4FBJB 3ZVRA 4IG7B 5LLIA 4TYZA 4K7UA 2JVCA 4FHJA 3RYTA 3A9KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7C A;  1JRU A;  3M1I B;  2K6Q A;  3R3M A;  2I1J A;  3A9K A;  4ZDV A;  1W1G A;  4KHO A;  4BKS A;  1UNP A;  1KZ7 A;  2I1K A;  2K2J A;  2V1Y A;  4HAZ B;  1HE8 A;  1XCG A;  2WX1 A;  4WWP A;  3HQC A;  1U5D A;  2NZ8 B;  3TJP A;  2N0Y A;  2IO3 B;  2G45 B;  3HIZ A;  2Y8F A;  5J3Q A;  4ZYN A;  3U8Z A;  2JRI B;  2DAF A;  2BPS A;  3VVW B;  2KX0 A;  4OVV A;  1GC7 A;  2CY5 A;  3D8E A;  1NDD A;  4MSM B;  4GMV A;  4HAU B;  5KHO A;  5L83 A;  2KUP A;  2WYQ A;  2NS5 A;  1E8Y A;  3PG7 A;  5GOW B;  3CF6 E;  5DPS A;  1P9D U;  3L17 A;  5EFX A;  1TGZ B;  3H7P A;  1BTN A;  3PHX B;  1OGW A;  4KZ0 A;  4HB4 B;  2D3G A;  2O6V D;  4EKU A;  1Z5S B;  1J8C A;  4TQ0 A;  1A5R A;  1MIX A;  2PZ1 A;  5HE3 A;  2Z0O A;  1E8Z A;  1WGY A;  2Z59 B;  2MLB A;  2M4N A;  4KZC A;  2COD A;  1WH3 A;  2MFQ A;  3CSF A;  3PVU A;  4HB2 B;  2J7Q B;  3M63 B;  4G11 A;  2MDX A;  5KQ1 A;  2KDE B;  2NPT B;  2BYE A;  4HB0 B;  2N23 A;  4HHV A;  2CRF A;  2R09 A;  3P2B A;  2ZCC A;  3OAN A;  2RNR B;  4ZRK A;  2JPH A;  1R4N I;  2MBB B;  4G50 A;  2DYM A;  1V6E A;  4N9F 4;  4TQ1 A;  1YJ1 A;  2M38 A;  1OEY A;  4EEW A;  5JLJ B;  3ML9 A;  2QKM A;  3PTF C;  2UZR A;  2HTH B;  3H1U A;  3VXW A;  2BKR B;  1PMS A;  2IFS A;  4URK A;  4ZRJ A;  5C16 A;  5J3Y A;  1SIF A;  3B08 A;  2R0D A;  3O65 B;  5D94 A;  1RAX A;  1WZ0 A;  2C7N B;  1QC6 A;  2FCS A;  3X23 A;  2KMA A;  3A1Q A;  1XQQ A;  2QKL A;  1ZC4 B;  3NOB A;  4FJV B;  1W1D A;  1AWE A;  4AWJ A;  4BOS C;  1IYF A;  3H7S A;  1WXS A;  4W9J A;  3SHQ A;  4DDI D;  1P0R A;  2DEN B;  2G3Q B;  3Q3J A;  4DHZ E;  2WDT B;  1H4R A;  3KSY A;  4YON A;  2Z0D B;  1WIA A;  1EF1 A;  1R4M I;  3ZNZ B;  5JHB A;  3VH3 B;  4J6I A;  2LVQ A;  4TV3 A;  5L95 C;  2KXJ A;  1U29 A;  2DHZ A;  2FID A;  3HM6 X;  4MK0 A;  4NAW A;  5JZE B;  1GG3 A;  4PS3 A;  3V6E B;  4Z2N A;  2PE9 A;  2C60 A;  2MSE D;  1WMH A;  4DX8 A;  1C1Y B;  5D6J B;  4EOY A;  3EC8 A;  4F1S A;  2DYO A;  2PE6 B;  2BWE S;  2MBH A;  4W9C A;  2D9X A;  1XKE A;  2Y7B A;  3IFW B;  4RM8 A;  5DCN A;  2KVR A;  2DKQ A;  5LXH A;  3QAR A;  3RUI B;  5JHH A;  3A33 B;  1MAI A;  3Q3F A;  4GXB A;  2LRW A;  2D2Q A;  4DBB A;  1WJ6 A;  1FGZ A;  2L8J A;  3PHW B;  3VH4 B;  2P8V A;  2KJH B;  4E3C A;  2JY6 A;  4IOY X;  3SO6 A;  3N30 A;  2L1C A;  2XQN M;  1WI1 A;  5D27 A;  4NQK E;  2RGF A;  3VDZ A;  2V76 A;  4CYE A;  2KC2 A;  2RGN B;  2UZS A;  1NTY A;  2COC A;  4IFS A;  2M8S A;  3NY5 A;  3WIM A;  1U5G A;  2IY0 B;  2FIF A;  2GBK A;  2ZPN A;  2KDI A;  2KJ6 A;  1V5M A;  3HM3 A;  3ZRF A;  2JZ3 B;  1OY2 A;  1FOE A;  3SUZ A;  1ZGU B;  4PQ0 A;  2DN6 A;  1E8W A;  1UPR A;  5C79 A;  2KTR B;  2O6V B;  3NZS A;  2FCM A;  2D9W A;  4NJ6 A;  2ZNV B;  1RRP B;  4AUQ C;  1FHO A;  4P7I A;  2YRY A;  3QWM A;  2KWU B;  4K17 A;  4MH0 E;  1SGH A;  1EF5 A;  2COF A;  4EZL A;  2VKI A;  2DZK A;  3QCA A;  1NI2 A;  4GU2 A;  1GNU A;  1Z87 A;  3MDB C;  1NTV A;  5DHA B;  1UGM A;  2AL3 A;  2R2O A;  3QC8 B;  3MJW A;  4KHA A;  2ROV A;  4KIK B;  3PT2 B;  4DDG D;  2BYF A;  1WJ4 A;  4A3O A;  2RUK B;  2KLC A;  2RR9 A;  2KD0 A;  5CHV C;  4XWX A;  3QWZ B;  3SV1 A;  3TCA A;  2DX5 B;  3JW0 X;  5JH5 C;  4WVF B;  2JF5 A;  3T06 A;  1ZSQ A;  3IHP C;  3A9J B;  4MGZ E;  4AP4 C;  1WGR A;  2YVC A;  1TJ6 A;  1J0G A;  2NPT A;  2L05 A;  1E90 A;  3R7Q A;  2J0J A;  4KVG B;  2DAJ A;  4IAP A;  2FAZ A;  3RD2 A;  4EZK A;  1V2Y A;  5D7G A;  1U5E A;  2ZEQ A;  4PS7 A;  1BWN A;  4ANU A;  1WRD B;  4WWN A;  4K81 A;  3S2A A;  2DHI A;  2JWZ A;  4HWI B;  3TVV A;  3PZD A;  1P6S A;  2ZPY A;  2MBE A;  3AU4 A;  1BT0 A;  3DVG Y;  2IYD B;  3UZT A;  4W9G A;  2D11 A;  4D0N B;  4W9D A;  4GDL B;  3VUY A;  3A1Q B;  2BCJ A;  1N3H A;  2A5U A;  2KZR A;  2NMB A;  3N32 A;  2RD0 A;  3SDL C;  2G4S A;  4NY0 A;  3NSU A;  2LUL A;  1TTN A;  1ZW7 A;  2LRU A;  3LJU X;  3IG3 A;  4K1R B;  3VAW A;  2K39 A;  1QQG A;  4IW0 A;  3PRZ A;  4GIV A;  1H10 A;  3PEG A;  4Z2M B;  2MW5 A;  3UF8 A;  4EMO A;  3QQ8 B;  3SD5 A;  1H8C A;  1IPG A;  1V9J A;  3L16 A;  3QJZ A;  2CU1 A;  2GBR A;  4I6P A;  2LGY A;  4IC7 B;  1V80 A;  4NQL B;  4BFR A;  4KIK A;  4EUT A;  3OLM D;  1DYN A;  2KGX B;  3KRW A;  3JYU A;  3ZLZ A;  2D4Q A;  5J18 A;  2COA A;  2K2U A;  2LOX A;  1QZE A;  2Z0E B;  5CHW A;  4ANW A;  3HW2 B;  4ANX A;  4F7Z A;  2DYQ A;  5D3V A;  1RRB A;  3QAQ A;  2NBV B;  2N7D A;  1LFD A;  1WXA A;  5E6N A;  2MBQ A;  3RCZ A;  4NNJ B;  3B0A A;  3PVW A;  4RM9 A;  4WJ7 A;  1OQN A;  4HAT B;  2K6D B;  2KTR A;  4IWO A;  2ZJD A;  2V4L A;  2GJY A;  4W9F A;  2DFK A;  3O96 A;  2IYB A;  2N9P C;  5E6P A;  4A6F B;  4PNK A;  4BKT A;  4DHZ B;  2N9X A;  2N1V A;  5AZH A;  4B6W A;  3NHE B;  5CTR C;  1Q0W B;  5D3X A;  3T8M A;  2MWN B;  4WWO A;  4MEL A;  2UVM A;  1UNQ A;  2AEH A;  2DLW A;  4X57 B;  1I42 A;  1V86 A;  2D9Y A;  3DBL I;  5TR5 A;  5HE2 A;  2WWZ A;  2ADZ A;  2KC1 A;  1P98 A;  2MP2 B;  4AOF A;  4HAY B;  2L3Z A;  3A98 B;  2DTC A;  3K9O B;  3PRP B;  4LJO B;  4EFO A;  5E6O A;  3MHS D;  3UGB B;  1WGG A;  3NS8 A;  2P0D A;  2G4D B;  3KVF B;  3WA0 A;  2HJ8 A;  2LXC A;  1G6J A;  2MQJ A;  4I6N B;  2D9Z A;  4GGQ A;  4MSQ B;  4JIO U;  2DZI A;  4LJP B;  2KMC A;  3H6N A;  2MKR A;  2ROZ B;  3L08 A;  3V60 A;  1P3R A;  1D3Z A;  3CXB B;  3ODW A;  3FM8 C;  3ZW3 A;  3EEC A;  1Y5O A;  4MT7 A;  1RFA A;  3EHV A;  2BGF A;  4DK5 A;  1YIW A;  3QHT A;  2FNJ B;  1TBE A;  3VOQ A;  2KWC A;  4EJN A;  3CST A;  3DVN U;  3W1S A;  3GZN I;  2GBJ A;  2JT4 B;  2BYV E;  4BKG A;  3P7Z A;  3B1L X;  2EJ8 A;  1X1M A;  3ODO A;  3ML4 A;  3KYC D;  3LJ3 A;  1U4A A;  5J3T A;  3ZNI D;  1LB1 A;  4B95 A;  2RSG A;  4WJQ A;  1XD4 A;  4DHJ B;  2JZZ A;  2B3A A;  2QHO A;  1I2H A;  3ULC A;  1X11 A;  1KOT A;  2DZJ A;  2I5F A;  2M0X A;  3KY9 A;  2UYZ B;  2KQ7 A;  2MRP A;  1F9J A;  2MWS B;  3AXC A;  4I6L B;  4IUM B;  4NSW A;  1BTK A;  4XZ4 A;  2KX3 A;  4WJN A;  3RT3 B;  1V81 A;  1ISN A;  1WJN A;  1WYW B;  1XT9 B;  2GBM A;  2NCN A;  3QX1 A;  1T0Y A;  2CR5 A;  1RJ2 A;  2AL6 A;  4YL8 A;  5LOP B;  1Q1O A;  2N9E B;  4TUU A;  4DWF A;  1J0W A;  2W2X C;  2IO2 B;  2IBI B;  2JRH A;  3L10 B;  4FJZ A;  1UZX B;  5C6R A;  5C5B A;  4CHM A;  2CS4 A;  3OJ3 A;  1EAZ A;  5FR6 A;  3V62 A;  3G9W A;  2BF8 B;  2C7H A;  2EKE C;  3PPA A;  3VTW A;  1X1F A;  1LQB A;  2KFJ A;  4JGH B;  3VQI A;  1Y19 B;  2G35 A;  1M7R A;  2KJR A;  2CAY A;  1AQC A;  3ULB A;  2KWV B;  3RZF A;  2Z0Q A;  4FA6 A;  3QIJ A;  1DDV A;  2O6V A;  2VSZ A;  2KFK B;  2PJH A;  1WXM A;  3WAO A;  3EFU A;  3KUC B;  1V5P A;  5JP4 A;  2LYD A;  5AZF A;  3SNH A;  3GYP A;  2KAN A;  2XBB C;  2DX5 A;  3T9L A;  1FAO A;  4MY6 A;  3DXE A;  4E71 A;  2DKP A;  1FHW A;  3APC A;  1TXD A;  2YSZ A;  3IVF A;  1B55 A;  3LDZ E;  4DX9 0;  3VUX A;  4A6K A;  4LCD E;  1WR6 E;  3SYX A;  5FI0 A;  2GBN A;  1KI1 B;  3ODX A;  2IO1 B;  2MA9 B;  4FJY A;  3TBL D;  4TKN A;  3ZRC A;  4CO7 A;  4JQW C;  5CX3 A;  1V5T A;  3A4R A;  3ML8 A;  5DH9 B;  1PFJ A;  2WX0 A;  3PRE A;  1XX0 A;  4HJK A;  4A20 A;  3ZIM A;  2ELA A;  1WM3 A;  1IRS A;  2XK5 B;  2KQS A;  2FUH B;  1WJ1 A;  3ENE A;  4IM3 A;  3RUL A;  3QK0 A;  4NAW B;  1V5O A;  4F7G A;  2X18 A;  1PLS A;  5FI1 A;  1EGX A;  1EO6 A;  1PQS A;  2IO0 B;  2XEW A;  4ICU A;  4BBK A;  2ASQ A;  3H7P B;  1OTR B;  2Q13 A;  3PLU A;  3PV1 A;  1UPQ A;  1XR0 B;  5DPW A;  1OQY A;  2K8B A;  2K1F A;  3DOW A;  1YD8 U;  2LVO A;  2LOZ A;  5AEK B;  3F5R A;  3KYD D;  4B9K A;  3GYO A;  2ZVO A;  2L2I A;  3VUW A;  2MX2 A;  2M1M A;  3I3T B;  2OTX A;  1M94 A;  3L13 A;  3ZDT A;  4KDI C;  2YT1 A;  1ZC3 B;  4CHJ A;  2L0T A;  2O2V A;  1EUV B;  1E8X A;  4F8C B;  1WF9 A;  2LKO A;  5DIF B;  1S1Q B;  2HTH A;  2MBO A;  2LI5 A;  4JL9 A;  1ZVR A;  1MG8 A;  2EC1 A;  2LG1 A;  3TFM A;  1DRO A;  1KLV A;  3V6C B;  4HPL B;  3L54 A;  3UQB A;  2EMT A;  4WJO A;  2HD5 B;  3A8P A;  1FGY A;  1EVH A;  4GPT B;  1P1A A;  4K7S A;  4A6F A;  1YQB A;  3BY4 B;  4HCN B;  2N1W A;  4FHK A;  3VTU A;  1UEF A;  1K5D B;  1S3S G;  2W9N A;  2AWT A;  2KDF B;  5G2N A;  1WE7 A;  3ZTC A;  2REX A;  3APD A;  3GOE A;  1WX8 A;  3ZVV A;  4MGI E;  2KHW B;  3PSC A;  5DI9 B;  2DX1 A;  1WM2 A;  2V3S A;  1AAR A;  4KDL B;  1V61 A;  2JXX A;  2KKC A;  3M62 B;  4MJS A;  4GN1 A;  4LDT D;  3UIO B;  4GSW A;  1UD7 A;  4KSL C;  5CLQ B;  3R66 C;  5DPR A;  3VHT C;  5HKH A;  3M3J A;  3HK0 A;  4FAD A;  4AJY B;  4BBN F;  4HAW B;  2PPH A;  2C7M B;  3WYF B;  5IA7 A;  2VRR B;  3DDC B;  4W9E A;  5BO4 B;  3ZTD A;  4EZJ A;  4HLE A;  4F7H A;  3DBH I;  2KTF A;  1GUA B;  2J59 M;  4MEM A;  4KHB B;  3DPD A;  4HXD A;  1WZ3 A;  3CMM B;  2GS0 A;  4IM0 A;  4RMA A;  2ZNV C;  2O2V B;  4A5K A;  1XD3 B;  4DHJ D;  2M17 A;  4E74 A;  3IBE A;  4MGY E;  5JHA A;  2KCJ A;  4M8M A;  2W2X D;  1J19 A;  1WGQ A;  3DVG X;  2BWF A;  3M95 A;  2YS1 A;  4A6H A;  4MM3 A;  3UIP B;  3PP2 A;  4ANV A;  3DXD A;  3AUL A;  2KK8 A;  2KLG A;  4FLH A;  2ZCB A;  3RZW C;  1KZG A;  2EMS A;  2CKH B;  2IZV B;  4KAX B;  4GDK B;  4MJS B;  4OVU A;  2P0F A;  1I35 A;  1DBH A;  3BIN A;  1X86 A;  1RLF A;  4HK2 A;  2YS3 A;  5HE1 A;  4H8S A;  3U30 A;  2J0K A;  1E7U A;  1FHX A;  2Z0P A;  3KZ1 A;  1LXD A;  1IP9 A;  5KCV A;  1UBI A;  3ONS A;  2I5C A;  2LGD A;  3KH0 A;  2N7E A;  4HAX B;  3TW1 A;  5C23 A;  3A9J A;  4C0A A;  3UIN B;  2PEA A;  1X1G A;  5GMV A;  1WE6 A;  4AJW A;  4KSK C;  4XC2 A;  3SU8 X;  3L0W B;  1V49 A;  4A3P A;  3KRX A;  2YLM A;  4KV2 A;  1DDM A;  1VD2 A;  2OOB B;  4IM2 A;  1WY8 A;  3FEH A;  1UEL A;  1MKE A;  3ECI A;  4IWQ A;  5HE0 A;  1C3T A;  1UBQ A;  1E5W A;  1K5G B;  4DXA B;  2LGX A;  2LJ5 A;  1ZM0 A;  3ALB A;  4HCP B;  3A8Q A;  2RSU A;  4BOZ B;  4HVB A;  5KHQ A;  1KJT A;  3OJ4 B;  2NR2 A;  1MIZ B;  3CIK A;  1VCB A;  3PRM B;  2LAS A;  2MP2 A;  2Y5B B;  1P3Q U;  3ZUN A;  3APF A;  1WMH B;  5IAA C;  3F0W A;  2NVU I;  5C1Z A;  3ZDM C;  3VTV A;  2KNB A;  3V61 A;  4ZRI A;  3VIA A;  1OMW A;  2P0H A;  1WXV A;  2CHZ A;  5KQ4 A;  1ZKH A;  2K8C A;  3JVZ X;  4G3X B;  3JSV B;  1NBF C;  3ZNH B;  2HE7 A;  2KN5 A;  4PYZ A;  2AYO B;  2XK5 A;  4PYU A;  2Y8G A;  3KUD B;  2KFK A;  2YT0 A;  4HB3 B;  4XX5 A;  5LON B;  2L7R A;  1XOD A;  3OAW A;  3U7D A;  1SHC A;  4GDK A;  5D2M B;  4ASW C;  1FXT B;  4L6E A;  2DYN A;  2LUE A;  4GZU A;  3QA8 A;  4W9H A;  2RLO A;  2LD9 A;  3H9D A;  2FCQ A;  4W9I A;  1U2B A;  4CHK A;  3AU5 A;  1TQZ A;  2L0F A;  1WGU A;  2LZ6 A;  3A4S C;  3DBS A;  1MK9 B;  1WVH A;  3R7R A;  4K2P A;  1WG7 A;  2CY4 A;  4BVU C;  5LXI B;  1UNR A;  3WAL A;  2J0M A;  1L2N A;  3PVL A;  1LM8 B;  1Y8R C;  4B6H A;  2ZZP B;  3K9P B;  3NZU A;  4W9L A;  3ZNG C;  3ZO5 B;  3KW5 B;  4GMX B;  1CMX B;  5DHF B;  1K8R B;  1V5U A;  1I7A A;  2GCL A;  2NBW B;  2DHK A;  4GB9 A;  2D9V A;  1P5T A;  4BKS D;  3W1Y A;  2OQB A;  1SE9 A;  3PSE B;  2RVB B;  4HAV B;  2C5L C;  5L81 A;  1Q67 A;  2YS5 A;  4WAA A;  4FN2 A;  1WX9 A;  2R2Q A;  4WJP A;  4IWP A;  3D8D A;  3MTN B;  1M7E A;  3N3K B;  4MDK E;  2MCN B;  2IY1 B;  4LDT B;  1BAK A;  3DQV A;  3D8F A;  4GDL A;  4PS8 A;  3DXC A;  3TO1 A;  3PS6 A;  2ELB A;  3DBR I;  3WAN A;  4FUL A;  1OEY J;  1YX5 B;  3C0R B;  4DBG A;  2DZM A;  2A4Z A;  1NU2 A;  1V88 A;  5C5B B;  4HDQ A;  2DHJ A;  2LVP A;  2W2W A;  4M0W B;  2GOW A;  4WSF A;  1MK7 B;  5G55 A;  4BBN C;  2KO3 A;  2D07 B;  5EDS A;  3TMP B;  1LW3 A;  2E2X A;  2H7D A;  3FSS A;  3P6A A;  1WGD A;  5D3W A;  1TZ1 A;  2CHW A;  4II2 B;  2DYB A;  4ICV A;  3VFK A;  3UQA A;  5CLL B;  2L76 A;  2KOX A;  1W1H A;  2OJR A;  4K7W A;  2ZVN A;  1KM7 A;  4W9K A;  1WR1 A;  1Q5W B;  4G0N B;  2YF0 A;  2N4F A;  2RPQ A;  2L00 B;  5CHF A;  5J17 A;  4HPM B;  4HDO A;  3QBV B;  1U5F A;  3HHM A;  3W1S C;  1DDW A;  1U27 A;  4Y94 A;  1E7V A;  1WX7 A;  2LWP A;  1WJU A;  2M14 A;  2FCN A;  1Z2M A;  4WQO B;  3TIX A;  1YX6 B;  1UH6 A;  2KDB A;  1MPH A;  3AI5 A;  4II3 B;  3MPX A;  4K2O A;  5D3Y A;  3V5W A;  4MGK E;  3TL5 A;  4F7U P;  5AZG A;  1GC6 A;  4NPN A;  1WGH A;  2UWQ A;  3WAM A;  2K8H A;  3DVN V;  3PGE A;  5JHG A;  4NJ7 A;  5DPT A;  3X0W A;  2JP2 A;  3PLV A;  2VRW B;  1X05 A;  4GOC A;  3D32 A;  2NBU A;  1GJZ A;  1V89 A;  3DCG A;  4M8N A;  3JSV A;  2K00 A;  3KUZ A;  2C9W B;  4JLC A;  2DA0 A;  2D10 A;  3BJI A;  5J2R A;  1WI0 A;  2H7E A;  2CHX A;  2JUO A;  2GMI C;  2LXA A;  2K25 A;  2BKF A;  2FJL A;  3WAP A;  3AJ4 A;  1WJM A;  3RCP A;  1WFY A;  3ZKJ C;  1L7Y A;  1FB8 A;  2GCJ A;  4FBJ B;  3ZVR A;  4IG7 B;  5LLI A;  4TYZ A;  4K7U A;  2JVC A;  4FHJ A;  3RYT A;  3A9K B; 
#chains in the Genus database with same CATH topology
 2MJE A;  1VLB A;  4ZDV A;  1W1G A;  2WXH A;  1VRA B;  1HTQ A;  3HIZ A;  4IKG A;  3U8Z A;  2DAF A;  1GC7 A;  2CY5 A;  3D8E A;  2BS2 B;  1GB1 A;  1N5X A;  4C7Y A;  2BT6 A;  3PG7 A;  2B76 B;  3PHX B;  4OVZ A;  3H7P A;  1TGZ B;  2OJW A;  1J8C A;  4KZ0 A;  2O6V D;  4EKU A;  2PZ1 A;  2Z0O A;  2Z59 B;  4N6E B;  4B95 A;  2MDX A;  4HHV A;  3ZQ4 A;  2ZCC A;  3OAN A;  4ZRK A;  4TQ1 A;  4XDD A;  4EEW A;  2DYM A;  1V6E A;  1OEY A;  2UZR A;  4OW0 A;  4RCO A;  1JWU D;  1T0Q C;  1PMS A;  4MT5 A;  1SIF A;  3B08 A;  3O65 B;  1HZ5 A;  2C7N B;  2KMA A;  3A1Q A;  2X8X X;  3P4S B;  1XQQ A;  1ZC4 B;  4AWJ A;  1IYF A;  4M02 A;  4DDI D;  2DEN B;  2G3Q B;  2Z59 A;  4YON A;  1EF1 A;  1P7E A;  2N9L A;  4J6I A;  4TV3 A;  2KXJ A;  5JZE B;  4KKI A;  1TY0 A;  4W9C A;  1B1Z A;  3RUI B;  1FNV A;  1XCT L;  1TJE A;  2LRW A;  3DBR B;  4DBB A;  2P8V A;  2JY6 A;  3SO6 A;  3C8Y A;  2L1C A;  2BTE A;  2KC2 A;  2UZS A;  2GBK A;  4UDU C;  2KTR B;  1E8W A;  2DN6 A;  3Q8F A;  1UPR A;  2D9W A;  3QWM A;  4K17 A;  1SGH A;  1EF5 A;  4EZL A;  1L0V B;  2DZK A;  5E6P A;  1NI2 A;  1UGM A;  3QC8 B;  4MM3 B;  4RGT A;  4KHA A;  2ROV A;  3PT2 B;  4US9 A;  4A3O A;  2KLC A;  2DWQ A;  3JW0 X;  4WVF B;  3IHP C;  5FK9 C;  3R7Q A;  4KVG B;  3GP7 A;  4IAP A;  1EM7 A;  4EZK A;  4OSN A;  1BWN A;  2JWZ A;  4HWI B;  5G5G A;  2IPK D;  3DVG Y;  2LEK A;  3UZT A;  4W9G A;  4C7Z A;  1SB3 C;  4YWG G;  2KZR A;  1N3H A;  3SDL C;  1NEN B;  2G4S A;  2LRU A;  3VAW A;  4L1B A;  3CWI A;  4JX1 C;  3SD5 A;  1V9J A;  2GBR A;  1V80 A;  4EUT A;  2WXM A;  3PO0 A;  5LG4 B;  2KQ4 X;  1KH0 A;  2NBV B;  2N7D A;  2MBQ A;  3B0A A;  3PVW A;  4WJ7 A;  1OQN A;  2K6D B;  2KTR A;  4W9F A;  4BKT A;  2DFK A;  3TEZ A;  4PNK A;  4DHZ B;  2N1V A;  4MH8 A;  5CTR C;  3IT6 B;  4MAC A;  4MEL A;  1MFW A;  2AEH A;  1I42 A;  2D9Y A;  1L4D B;  1TKG A;  1VZ7 A;  4YSX B;  2WWZ A;  4C4V B;  2KC1 A;  1XLN A;  3K9O B;  2DTC A;  1PGB A;  4EFO A;  1R4M B;  2P0D A;  1YN3 A;  1C78 A;  2D9Z A;  3AH7 A;  3U4E G;  3Q69 A;  2KMC A;  4LJP B;  1P3R A;  3ODW A;  3SEB A;  5JXV A;  3FM8 C;  1Y5O A;  1C4P A;  2KWC A;  3DVN U;  3GZN I;  3P7Z A;  3LJ3 A;  4GNK B;  1U4A A;  2SAK A;  3ULC A;  1KOT A;  2DZJ A;  2I5F A;  1XCQ L;  2KQ7 A;  2MRP A;  2MWS B;  3AXC A;  4IUM B;  4XZ4 A;  4S17 A;  1ISN A;  3AEB B;  3Q14 C;  1WYW B;  1XT9 B;  2GBM A;  1NYQ A;  2N9E B;  4DWF A;  1J0W A;  4LNO A;  2IO2 B;  5C5B A;  3OJ3 A;  4M0W A;  3PPA A;  2JYT A;  2G35 A;  2KJR A;  1AQC A;  1YMH E;  3QIJ A;  1RWS A;  2VSZ A;  2IGD A;  1WXM A;  3EFU A;  1SIJ A;  1YNT E;  4ZHP A;  2M56 B;  3GYP A;  2XBB C;  3T9L A;  2DX5 A;  4A9A A;  1L6V A;  4A6K A;  1I4X A;  2NMQ A;  4FJY A;  3RMK C;  1FNW A;  4JQW C;  2L52 A;  2ELA A;  4D6W A;  1FMA D;  3ENE A;  4EE2 A;  4NAM A;  2X18 A;  1PLS A;  3OHM B;  1EGX A;  2MJD A;  2WXN A;  2ASQ A;  2JYE A;  1D5M C;  1ZDV A;  1UPQ A;  2LOZ A;  5BYQ A;  1SXT A;  2M1M A;  3RNE C;  1ZC3 B;  4F8C B;  1WF9 A;  4JL9 A;  3TFM A;  2HTM E;  2EMT A;  1EVH A;  4RGN A;  1P1A A;  3BY4 B;  4N59 A;  1F77 A;  4FHK A;  1V1P B;  1UEF A;  5G2N A;  5BMI A;  1I7H A;  2REX A;  5HFY A;  1WX8 A;  3ZVV A;  1WM2 A;  2QIL A;  3RNG C;  4ZOH C;  1AAR A;  2JXX A;  4MJS A;  4GN1 A;  1PGX A;  3UIO B;  5HKH A;  1UD7 A;  3R66 C;  2INC C;  2BYT A;  3HK0 A;  4HAW B;  5BO4 B;  4HLE A;  1YQ4 B;  4KHB B;  3P4R B;  3CMM B;  4IM0 A;  2HDE A;  4DHJ D;  2M17 A;  1TYG B;  2RPV A;  4KGS A;  1L0Y B;  3AUL A;  3AN1 A;  3AE1 B;  4MJS B;  4OVU A;  1FCL A;  1DBH A;  1X86 A;  2YS3 A;  5HE1 A;  4H8S A;  2MHJ A;  2J0K A;  4M00 A;  1SJH D;  1XLO A;  1IP9 A;  4M01 A;  1UBI A;  1ZXI A;  5GMV A;  3E56 A;  2DLB A;  1TT5 B;  3FEH A;  1UEL A;  4RGM A;  1C3T A;  4HCP B;  3ALB A;  2RSU A;  3DWM A;  5KHQ A;  2JZP A;  3PRM B;  2LAS A;  4YTP B;  4RH6 A;  5H8Y E;  4ZRI A;  1QOF A;  3NVZ A;  1JWB D;  2Q5W D;  1NBF C;  2HE7 A;  2VZK D;  3KUD B;  2KFK A;  2YT0 A;  5LON B;  1XOD A;  3OAW A;  1P7F A;  2RLO A;  2LD9 A;  4W9I A;  1U2B A;  3R7R A;  1TQZ A;  4K2P A;  1UNR A;  2KIE A;  3PVL A;  1Y8R C;  3K9P B;  5E6J A;  2ZZP B;  3MFG A;  5DHF B;  1K8R B;  1I7A A;  2GCL A;  3HSA A;  1T0S C;  4GB9 A;  2K3U A;  3PSE B;  3ZJV A;  2C5L C;  5L81 A;  2YS5 A;  4WAA A;  4FN2 A;  2R2Q A;  1QT9 A;  4MDK E;  4A8X C;  3DQV A;  4GDL A;  1SE4 A;  2QSD A;  2WXJ A;  1YX5 B;  3C0R B;  1KLG D;  5G55 A;  2W2W A;  1YJJ A;  4WSF A;  2GOW A;  3TMP B;  2H7D A;  1FXI A;  2L76 A;  3P42 A;  1HEZ E;  1W1H A;  2OJR A;  4A90 A;  2ZVN A;  4W9K A;  4G0N B;  5CHF A;  2EEL A;  2L00 B;  5HI1 A;  1Z2M A;  4DXF A;  1YX6 B;  1UH6 A;  3MPX A;  5D3Y A;  1ZOY B;  4MGK E;  3BVM A;  4F7U P;  1GC6 A;  5IO9 A;  1WGH A;  2UWQ A;  3WAM A;  3PGE A;  3VR9 B;  3NVY A;  4KKJ A;  5HG2 A;  4M8N A;  2C9W B;  5J2R A;  2W54 A;  2GMI C;  1T3Q A;  5TSS A;  4D2K A;  3RPF C;  3MC0 B;  3RCP A;  3ZKJ C;  1I4Q A;  4IG7 B;  3T3N A;  3DHH C;  3RYT A;  1JCK B;  4RF0 A;  1EWC A;  1ET9 A;  4L1R A;  3A9K A;  4TSS A;  4KHO A;  2I1K A;  1KZ7 A;  3HVZ A;  2FUG 1;  2G1E A;  3I5J C;  1HE8 A;  2WX1 A;  2YEP F;  2WXK A;  2KN4 A;  4K3B A;  2K8E A;  5J3Q A;  1ENF A;  2BPS A;  5GXG B;  3UI3 A;  2JSV X;  2KAC A;  5KHO A;  2WYQ A;  3BII D;  1ZP0 B;  2ON8 A;  5TR5 A;  1P9D U;  5EFX A;  1Z5S B;  4TQ0 A;  1MIX A;  3RNA C;  2MLB A;  2M4N A;  4KZC A;  2WGS A;  1WH3 A;  2MFQ A;  3CSF A;  3PVU A;  2J7Q B;  3IAS 1;  1HTO A;  2KDE B;  5KQ1 A;  3FIL B;  4HB0 B;  2CRF A;  2RNR B;  3I63 C;  2HTH B;  3H1U A;  2BKR B;  2LMC A;  4URK A;  1CJE A;  2INN E;  2PVG C;  1QC6 A;  3X23 A;  3NOB A;  3L4P A;  2FBW B;  2Z13 A;  1WXS A;  4W9J A;  1NYR A;  3Q3J A;  2H89 B;  3LYY A;  4DHZ E;  2OED A;  2WDT B;  2MEK A;  2VH2 A;  4ITK A;  5L95 C;  2DHZ A;  3ZXR A;  3HM6 X;  4MK0 A;  4KGR A;  4NAW A;  4PS3 A;  3V6E B;  1UNS A;  4Z2N A;  2PE9 A;  2C60 A;  1WMH A;  4F1S A;  1C1Y B;  3EC8 A;  2V4I B;  2PE6 B;  4RM8 A;  2DKQ A;  3QAR A;  3O13 A;  5JHH A;  3A33 B;  2IJ0 A;  1MAI A;  1C79 A;  4GXB A;  2JQR B;  2D2Q A;  1YN5 A;  1WJ6 A;  1FGZ A;  3VH4 B;  2KJH B;  1GAQ B;  3N30 A;  4CYE A;  3U12 A;  5D3D A;  2M8S A;  3WIM A;  2ZPN A;  2WDR B;  1V5M A;  2JZ3 B;  4JIO U;  5C79 A;  1FNU A;  4P7I A;  3B9J A;  1KFY B;  2K0P A;  1GNU A;  1Z87 A;  2AL3 A;  3AE7 B;  3MJW A;  1JWM D;  2IGG A;  2RUK B;  4YT0 B;  2J52 A;  1Y56 A;  5CHV C;  4XWX A;  4ARI A;  3SV1 A;  3TCA A;  2DX5 B;  5JH5 C;  4S0R A;  3A9J B;  4AP4 C;  5EE0 A;  2NPT A;  1E90 A;  2Y3A A;  2J0J A;  3RD2 A;  1K51 A;  2FAZ A;  4OT1 A;  2QEJ C;  1V2Y A;  5D7G A;  4PS7 A;  2L32 A;  1WRD B;  4WWN A;  3S2A A;  3TVV A;  3PZD A;  1P6S A;  1JML A;  2WDQ B;  2GI9 A;  4D0N B;  4W9D A;  4JPS A;  1EU3 A;  4QAY A;  2BCJ A;  3N32 A;  2RD0 A;  1PYW D;  1TTN A;  3LJU X;  4IW0 A;  4GIV A;  1H10 A;  3PEG A;  4EMO A;  1TS5 A;  3W5V B;  3QJZ A;  4R3D A;  4I6P A;  4NJC A;  3OLM D;  1N5W A;  3KRW A;  2KGX B;  1L4Z B;  3ZLZ A;  2D4Q A;  2WXI A;  2COA A;  2LOX A;  1QZE A;  4ANW A;  4CQN A;  4F7Z A;  1T6B X;  5BYR A;  5E6N A;  4RM9 A;  5DPR A;  1JWA D;  2ZJD A;  3O96 A;  2IYB A;  4A6F B;  5AZH A;  3ZYY X;  3SFD B;  1HXY D;  3T8M A;  2MWN B;  4WWO A;  2UVM A;  1V86 A;  1XXG A;  4AOF A;  3PRP B;  3RNB C;  3UGB B;  2HJ8 A;  4J3O D;  4L23 A;  1L6U A;  4BAX A;  1QKZ A;  2DZI A;  3L08 A;  1D3Z A;  4MT7 A;  2BGF A;  1YIW A;  3QHT A;  4REZ A;  1WXQ A;  2PLP A;  3I9V 1;  2WXP A;  1KF6 B;  1L0X B;  2JT4 B;  2K22 A;  3B1L X;  1BUI C;  2J4X A;  2B3A A;  1X11 A;  1YJI A;  3NW8 A;  2M0X A;  3KY9 A;  2QMT A;  2ACZ B;  4I6L B;  4NSW A;  3NG0 A;  3ABV B;  4HJG E;  2J53 A;  1MPE A;  2AL6 A;  4YL8 A;  5LOP B;  1Q1O A;  3N1Z C;  2QDF A;  4AJW A;  2KWD A;  2EKE C;  1X1F A;  3VQI A;  2KFJ A;  1M7R A;  2CAY A;  3I57 A;  1I4P A;  2Z0Q A;  3GE3 C;  1DDV A;  2KFK B;  5HHD G;  1V5P A;  5JP4 A;  4JE3 B;  3MHZ A;  1D6E C;  2XN9 C;  2DKP A;  1FHW A;  1UWX A;  1RFK A;  4LCD E;  4P6V F;  1KI1 B;  2MA9 B;  4CO7 A;  3ZRC A;  1V5T A;  3PRE A;  4HJK A;  1PFJ A;  2WX0 A;  1XX0 A;  4QXA B;  3ZIM A;  1IRS A;  2QCZ A;  1WJ1 A;  3QK0 A;  4NAW B;  2IO0 B;  5FI1 A;  5IA7 A;  2KT7 A;  2NTT A;  1LGR A;  1N60 A;  1XR0 B;  1AN8 A;  3DOW A;  2K1F A;  2KAJ A;  3P4P B;  2LVO A;  2IDY A;  2MH7 A;  1IBX A;  2ZVO A;  1ZYI A;  4WQM A;  2OTX A;  4KDI C;  5I2S A;  2O2V A;  2L0T A;  2HTH A;  2LKO A;  2FJU B;  2MBO A;  2EC1 A;  1KLV A;  3RN9 C;  2JWU A;  4HPL B;  3L54 A;  5IP4 D;  2E6X A;  2HD5 B;  1FGY A;  4GPT B;  4A6F A;  4HCN B;  3VTU A;  4QJ3 B;  2AWT A;  3APD A;  4MGI E;  2KHW B;  3PSC A;  5DI9 B;  3Q3O C;  4KDL B;  1V61 A;  2KKC A;  2QC8 A;  3OG5 A;  1NEK B;  2KR0 A;  4GSW A;  3VHT C;  5CLQ B;  4Q2J A;  4LNN A;  1V1P A;  2PPH A;  2C7M B;  3WYF B;  3DBH I;  1GUA B;  1WZ3 A;  3NWD A;  2XNA C;  2ZNV C;  2O2V B;  4A5K A;  1FRR A;  3IBE A;  2W2X D;  1J19 A;  1WGQ A;  1D5X C;  1TS4 A;  4A6H A;  4ANV A;  3DXD A;  4FLH A;  2KK8 A;  2SEB D;  5M4Y B;  1KZG A;  2CKH B;  2IZV B;  3DBH B;  1E7U A;  3HVD A;  2Z0P A;  3KZ1 A;  1DYQ A;  1FCC C;  2LGD A;  3KH0 A;  3A9J A;  1A70 A;  3UIN B;  4KSK C;  3SU8 X;  1V49 A;  4WAF A;  1B9R A;  1PFD A;  2OOB B;  5HE0 A;  2LGX A;  3A8Q A;  4HVB A;  4LK0 M;  3OJ4 B;  1MIZ B;  2MP2 A;  2Y5B B;  1P3Q U;  2ZKM X;  3AEG B;  3F0W A;  1TS2 A;  2W3S A;  1C76 A;  3VTV A;  3VIA A;  1WXV A;  2PMV A;  4XGA B;  1K52 A;  3JSV B;  3ZNH B;  1DOX A;  2KN5 A;  4PYZ A;  3W5U B;  4C56 C;  3EA6 A;  4HB3 B;  5LNK 1;  1UWM A;  3U7D A;  1SHC A;  4ASW C;  1FXT B;  3R2I A;  2DYN A;  2LUE A;  3NVW A;  2LZ6 A;  4XYC A;  1WVH A;  1WG7 A;  3AV8 A;  2CY4 A;  5LXI B;  1L2N A;  3TEX A;  2W3R A;  1SJE D;  4TMA B;  4YTM B;  4GMX B;  1CMX B;  3HRD D;  2DHK A;  1P5T A;  4KGT A;  1SE9 A;  1C9F A;  3B2G A;  1M7E A;  2MCN B;  3BWU D;  4LDT B;  2J42 A;  3PS6 A;  2ELB A;  3WAN A;  5I2M A;  4FUL A;  3NRZ A;  5C2T B;  4M0W B;  2MJ3 A;  3VUX A;  5C5B B;  4HDQ A;  3IT4 B;  1MK7 B;  4BBN C;  2KO3 A;  3HIE A;  2D07 B;  2UU7 A;  2CHW A;  1LW3 A;  2E2X A;  4ICV A;  3VFK A;  1ESF A;  1N6Z A;  3PZ8 A;  4K7W A;  3SFE B;  4QJ5 B;  2YF0 A;  2G9H D;  1JAL A;  2N4F A;  3BYT B;  5J17 A;  4HDO A;  3QBV B;  3HHM A;  3W1S C;  1DDW A;  1U27 A;  1E7V A;  1WJU A;  4WQO B;  3TIX A;  1C4A A;  1MPH A;  4II3 B;  4K2O A;  3V5W A;  3E9S A;  1FM0 D;  1QOG A;  4NPN A;  1MJD A;  5JHG A;  5AUK A;  3KLS X;  2NBU A;  4H2A A;  3DCG A;  3J9C A;  3R8B A;  2K00 A;  4JLC A;  3BJI A;  1WI0 A;  2H7E A;  2JUO A;  3Q8E A;  1R7S A;  3WCQ A;  4PT5 A;  1AYF A;  1TY2 A;  1WFY A;  1DOI A;  4RF1 A;  2GCJ A;  1XLP A;  3NZ3 A;  4TYZ A;  2NBV A;  2JVC A;  3DHI C;  4FHJ A;  3U52 E;  3A9K B;  3JVZ X;  2K6Q A;  3M1I B;  2I1J A;  4N58 A;  1UNP A;  3AEE B;  1XCG A;  3HQC A;  3BZD B;  3IXS A;  3GS2 A;  4LTU A;  2G45 B;  2Y8F A;  3VVW B;  1XO3 A;  2V3P A;  1NDD A;  4MSM B;  5L83 A;  2KUP A;  2NS5 A;  1E8Y A;  5DPS A;  3CF6 E;  1BTN A;  1OGW A;  2D3G A;  1NI3 A;  1XF5 L;  5HE3 A;  1WGY A;  2VZK B;  4ZYS A;  1I4G A;  3M63 B;  4G11 A;  4HB2 B;  3MC8 A;  3V05 A;  2NPT B;  2BYE A;  2N23 A;  3P2B A;  2MBB B;  4N9F 4;  1YJ1 A;  2M0A A;  5JLJ B;  1T0R C;  4KX6 B;  3ML9 A;  2QKM A;  4ZHO A;  1YQ3 B;  1TKY A;  3VXW A;  2IFS A;  4DXG A;  3AED B;  4ZRJ A;  1XEE A;  4YXD B;  2R0D A;  1RAX A;  2FCS A;  2JXT A;  2QKL A;  1AWE A;  3H7S A;  4JWU C;  1H4R A;  1WIA A;  2M19 A;  1F2R I;  5JHB A;  2LVQ A;  4CSQ A;  2FID A;  3Q8A A;  2MSE D;  3BVZ A;  2BWE S;  2MBH A;  1XKE A;  3IFW B;  4PK1 A;  2KVR A;  3B2F A;  4ARC A;  5BMG A;  2EKI A;  3Q3F A;  3BVG A;  1JRO A;  2L8J A;  3PHW B;  3AM9 A;  5BMH A;  4E3C A;  1WGK A;  4IOY X;  3N1Y C;  2XQN M;  1WI1 A;  5D27 A;  3FKY A;  2V76 A;  4IFS A;  2KVZ A;  1U5G A;  2FIF A;  2KJ6 A;  3HM3 A;  5T8I A;  3ZRF A;  1ZGU B;  1FOE A;  3NZS A;  3KWL A;  4OZB A;  1RRP B;  1FHO A;  3U2S C;  4US8 A;  2KWU B;  1GPX A;  3QCA A;  3MDB C;  1NTV A;  3CIR B;  1D4B A;  4KIK B;  2BYF A;  2ZW1 A;  2RR9 A;  1QLB B;  2HJ1 A;  2CJO A;  1MI1 A;  2YT2 A;  4MGZ E;  1WGR A;  2YVC A;  1TJ6 A;  1BML C;  1J0G A;  2L05 A;  2GUM A;  1TS3 A;  2LUM A;  2BQQ A;  3N20 C;  4K81 A;  2DHI A;  2WXR A;  1KLU D;  1OQR A;  2ZPY A;  2MBE A;  3AU4 A;  2D11 A;  1KRH A;  3A1Q B;  2H88 B;  2NTS A;  4NY0 A;  3NSU A;  2LUL A;  1ZW7 A;  3IG3 A;  3AEF B;  3PRZ A;  3Q3M C;  2MW5 A;  5MPO A;  1IPG A;  1QF6 A;  3L16 A;  2BS3 B;  1JRP A;  4BFR A;  4KIK A;  1N62 A;  4C80 A;  4YSZ B;  1SE2 A;  2RDB C;  5J18 A;  4DQO C;  2DYQ A;  5D3V A;  4B0E A;  2N9K A;  2ICI A;  3RCZ A;  4NNJ B;  4HPP A;  4HAT B;  4AUQ C;  2V4L A;  2GJY A;  2N9P C;  2N9X A;  3NHE B;  1Q0W B;  4X57 B;  3DBL I;  2ADZ A;  1P98 A;  2MP2 B;  4HAY B;  2L3Z A;  3A98 B;  4LJO B;  3MHS D;  1G6J A;  3NS8 A;  3WA0 A;  2LXC A;  4I6N B;  4GGQ A;  3NS1 A;  3H6N A;  2MKR A;  2ROZ B;  3V60 A;  1AWD A;  3EEC A;  1M4V A;  1RFA A;  3EHV A;  2BB6 A;  3EGR A;  2FNJ B;  1TBE A;  3VOQ A;  1ZPS A;  1E0Z A;  2BYV E;  2EJ8 A;  1K53 A;  3ZNI D;  2RRF A;  4WJQ A;  1XD4 A;  2QHO A;  2LGI A;  1F9J A;  1BTK A;  1FFU A;  4WJN A;  3RT3 B;  1V81 A;  3AE4 B;  4OZA A;  4IDI A;  4XWT A;  3QX1 A;  2L1A A;  1T0Y A;  4AS1 A;  1RJ2 A;  2W2X C;  4FJZ A;  5C6R A;  3V62 A;  1EAZ A;  5FR6 A;  2BB5 A;  2BF8 B;  3VTW A;  2WQY B;  1Y19 B;  4FA6 A;  3ULB A;  4HRO A;  5H92 C;  1FIQ A;  3C19 A;  2PVO D;  5I4D A;  1XLQ A;  2PKO A;  5C3J B;  2OHF A;  5AZF A;  4HSI A;  3DWG C;  4XDC A;  4RGO S;  3DXE A;  1R4N B;  3APC A;  3IVF A;  1FPY A;  3SYX A;  5FI0 A;  2GBN A;  3ODX A;  2IO1 B;  3TBL D;  1C4C A;  5CX3 A;  3A4R A;  4A20 A;  1WM3 A;  1F0Z A;  1FRD A;  2XK5 B;  4F7G A;  1PQS A;  5DPW A;  1EO6 A;  2XEW A;  4ICU A;  3H7P B;  1NVI D;  1OTR B;  4OZC A;  4HRS A;  2Q13 A;  1FXA A;  2QJL A;  5AEK B;  3AE6 B;  3AE3 B;  3F5R A;  3KYD D;  1TZO A;  3GYO A;  4LLG M;  3VUW A;  3L13 A;  3I3T B;  1FO4 A;  3EFC A;  3ZDT A;  2YT1 A;  4YTN B;  5DIF B;  1S1Q B;  2LI5 A;  1ZVR A;  2D5G A;  3DHG C;  2WU2 B;  1ET6 A;  4K7S A;  3DBL B;  1WE7 A;  3ZTC A;  3GOE A;  2DX1 A;  3RNF C;  1QOA A;  3M62 B;  3ETR A;  2BBC A;  4KSL C;  4FAD A;  4AJY B;  4BBN F;  3DDC B;  3HUI A;  4W9E A;  3ZTD A;  4EZJ A;  4F7H A;  2D3C A;  4MEM A;  3DPD A;  4RFB A;  3OWE B;  1C77 A;  4RMA A;  3Q6B A;  1XD3 B;  2K5P A;  4MGY E;  1YN4 A;  5JHA A;  2KCJ A;  4M8M A;  1JQ4 A;  1ROE A;  3DVG X;  4MM3 A;  4ZRP A;  2E3T A;  2KLG A;  2ZCB A;  2EMS A;  1VZ6 A;  5G5H A;  2P0F A;  1CK1 A;  1RLF A;  3BIN A;  4HK2 A;  3U30 A;  1LXD A;  2I5C A;  4DIX A;  2PW9 A;  5C23 A;  4C0A A;  1X1G A;  1WE6 A;  4LNF A;  4XC2 A;  3L0W B;  3KRX A;  1DDM A;  1EWY C;  1WY8 A;  3ECI A;  4IWQ A;  1ZM0 A;  1FD6 A;  1WMH B;  1QQR A;  5IAA C;  2NVU I;  5C1Z A;  3IAM 1;  3ZDM C;  3V61 A;  2JX5 A;  2K8C A;  1V97 A;  3TEW A;  4PYU A;  1T77 A;  5D2M B;  4GZU A;  1L5P A;  3AU5 A;  2L0F A;  1WGU A;  3A4S C;  1MK9 B;  3MC9 A;  3Q3N C;  1KTK A;  1VDV A;  4BVU C;  2Y5C A;  3AEC B;  3WAL A;  2J0M A;  1LM8 B;  3ZO5 B;  2INP E;  1V5U A;  2D9V A;  2WXL A;  2LFI A;  3W1Y A;  2I38 A;  1DOY A;  4HAV B;  3ZJU A;  1Q67 A;  1MVK A;  2KIG A;  4WJP A;  1I4R A;  1WX9 A;  4IWP A;  3N3K B;  1BAK A;  4PS8 A;  3VRB B;  2WP9 B;  1OEY J;  2KDM A;  3T3O A;  1AW7 A;  4A6Q A;  2WXQ A;  5EDS A;  1WGD A;  3FSS A;  3P6A A;  1F1H A;  5D3W A;  2DYB A;  4WIP A;  1KM7 A;  2RPQ A;  1U5F A;  1WX7 A;  2LWP A;  3N1X C;  3PZ7 A;  2M14 A;  1ZUD 2;  2DBY A;  2KDB A;  1K50 A;  3TL5 A;  2V3N A;  4C4V A;  3EUB 2;  5AZG A;  3AE8 B;  1IBX B;  4L2Y A;  5DPT A;  3X0W A;  2JP2 A;  3P1M A;  3PLV A;  1X05 A;  5FKA C;  1GJZ A;  1V89 A;  4OHJ A;  2Z14 A;  3KUZ A;  3A58 A;  1E9M A;  5BYS A;  4P16 A;  2CHX A;  2ZW0 A;  2BKF A;  3WAP A;  1WJM A;  1L7Y A;  1FB8 A;  4FBJ B;  4K7U A;  3N7C A;  1JRU A;  2BS4 B;  3R3M A;  1VZ8 A;  4BKS A;  1ZE3 D;  2K2J A;  1E7P B;  3AB5 A;  2V1Y A;  4XE0 A;  4HAZ B;  2WNM A;  3GB1 A;  4WWP A;  1U5D A;  2NZ8 B;  3TJP A;  2N0Y A;  2IO3 B;  2AQ1 B;  2CJN A;  2K9X A;  3DCX A;  4ZYN A;  1MI0 A;  2JRI B;  2KX0 A;  4OVV A;  4GMV A;  4HAU B;  3NUH B;  5GOW B;  1H8C A;  3L17 A;  4YSY B;  4HB4 B;  3LXF A;  1A5R A;  1E8Z A;  1V1O A;  2COD A;  4JWS C;  4A55 A;  2R09 A;  3BK2 A;  3URY A;  2JPH A;  4G50 A;  1R4N I;  2LGS A;  2M38 A;  2KYW A;  5FR3 A;  4RNA A;  3PTF C;  1STE A;  5C16 A;  1UUP A;  5J3Y A;  5D94 A;  1WZ0 A;  1I4H A;  4FJV B;  1W1D A;  4BOS C;  1CZP A;  3SHQ A;  3VRA B;  1P0R A;  3KSY A;  2Z0D B;  3ZNZ B;  1R4M I;  3VH3 B;  3MJ5 A;  1U29 A;  1GG3 A;  2AQ3 B;  4DX8 A;  5D6J B;  1ZDX A;  4EOY A;  2DYO A;  2D9X A;  2Y7B A;  1J7C A;  5DCN A;  5LXH A;  1YOV B;  3RFZ B;  1BXT A;  4LNI A;  4NQK E;  2RGF A;  3VDZ A;  2IND C;  2RGN B;  1NTY A;  2COC A;  2RDG A;  3NY5 A;  2IY0 B;  2KDI A;  5IRS A;  2D3B A;  1OY2 A;  3SUZ A;  4PQ0 A;  2GRI A;  2O6V B;  2FCM A;  4NJ6 A;  2ZNV B;  5IN7 A;  2YRY A;  2X38 A;  4MH0 E;  2COF A;  1SBB B;  2VKI A;  4GU2 A;  2GB1 A;  5DHA B;  2R2O A;  4DDG D;  1WJ4 A;  3AE2 B;  2RDH A;  3AE9 B;  2KD0 A;  3QWZ B;  2BW2 A;  4LNK A;  1SF0 A;  2RMM A;  3MP9 A;  2JF5 A;  3T06 A;  1ZSQ A;  2FE8 A;  1E10 A;  2DAJ A;  2PTL A;  1U5E A;  2ZEQ A;  4ANU A;  5EE1 A;  1EU4 A;  1BT0 A;  3FC4 A;  2IYD B;  1TKE A;  4GDL B;  3AMZ A;  2A5U A;  2NMB A;  1WSP A;  4HEA 1;  1T5X D;  4K1R B;  2K39 A;  1QQG A;  3UF8 A;  3Q2A C;  4Z2M B;  3RNC C;  3QQ8 B;  3KQ4 A;  2CU1 A;  1D5Z C;  2LGY A;  4IC7 B;  2KUQ A;  1QOB A;  4NQL B;  1DYN A;  3JYU A;  2K2U A;  2Z0E B;  5CHW A;  4ANX A;  1VR9 A;  3HW2 B;  1RRB A;  3QAQ A;  1LFD A;  1WXA A;  1F2R C;  3LB8 C;  5IKC M;  4WUR A;  4IWO A;  2JU6 X;  3NWA A;  1OFF A;  4B6W A;  5D3X A;  1UNQ A;  2DLW A;  1PDX A;  5HE2 A;  5E6O A;  2K49 A;  1WGG A;  2G4D B;  3KVF B;  1SSN A;  2MQJ A;  1QIL A;  4MSQ B;  2WLB A;  3CXB B;  3ZW3 A;  4DK5 A;  4EJN A;  1LO5 D;  1IGC A;  3CST A;  3W1S A;  2GBJ A;  4BKG A;  1N63 A;  3ODO A;  3ML4 A;  1X1M A;  4GOU A;  3KYC D;  5J3T A;  1LB1 A;  2RSG A;  4DHJ B;  2I2Y A;  2JZZ A;  3KWV A;  4NZL B;  2DNF A;  1I2H A;  3R2T A;  2AX5 A;  2UYZ B;  2WDV B;  2KX3 A;  1CQV A;  1WWT A;  1HA5 A;  1WJN A;  2NCN A;  3GZN B;  2D3A A;  2CR5 A;  1MG4 A;  4TUU A;  4C00 A;  2IBI B;  2JRH A;  3BK1 A;  3L10 B;  1UZX B;  4WH4 A;  4CHM A;  2CS4 A;  3G9W A;  1UGJ A;  2C7H A;  1LQB A;  4JGH B;  3ZGZ A;  2KWV B;  3RZF A;  4HKQ A;  2VH1 A;  2O6V A;  2WU5 B;  2PJH A;  3WAO A;  1Q10 A;  3KUC B;  2LYD A;  3SNH A;  2KMM A;  3H8H A;  2KAN A;  1FAO A;  4MY6 A;  4E71 A;  1TXD A;  2YSZ A;  1B55 A;  3LDZ E;  4DX9 0;  3P4Q B;  1WR6 E;  3NWF A;  4TKN A;  3ML8 A;  5DH9 B;  3TSS A;  1J7B A;  3NVV A;  1JWS D;  2KQS A;  2FUH B;  2WS3 B;  4IM3 A;  4ZRQ A;  3RUL A;  3TEY A;  1V5O A;  1FFV A;  4BBK A;  3PLU A;  3ZXV A;  3PV1 A;  1IUE A;  1OQY A;  2K8B A;  1VJK A;  1YD8 U;  2LHD A;  1UF0 A;  2L2I A;  2MX2 A;  1M94 A;  4CHJ A;  1EUV B;  3AE5 B;  1E8X A;  1MG8 A;  2LG1 A;  1DRO A;  3V6C B;  3ZJT A;  2N0S B;  3UQB A;  2LJI A;  4WJO A;  3A8P A;  3Q8C A;  2R2Y A;  1YQB A;  3VR8 B;  2N1W A;  3NJT A;  1K5D B;  1S3S G;  2W9N A;  2KDF B;  2ONQ A;  5EE9 A;  1HZ6 A;  2V3S A;  4P1C C;  1HQR D;  4LDT D;  3M3J A;  2VRR B;  2Y5P A;  1RYJ A;  2KTF A;  2AQ2 B;  2J59 M;  4HXD A;  2Z8L A;  2GS0 A;  3N9Y C;  4E74 A;  1WYG A;  3P63 A;  4FXC A;  2WXO A;  1FEH A;  1PUT A;  2BWF A;  2V9H A;  3FIL A;  3M95 A;  3W9C B;  2YS1 A;  2QIE B;  3BYY B;  4USA A;  3UIP B;  3PP2 A;  3RZW C;  1ACC A;  2IGH A;  4KAX B;  4GDK B;  4HKZ E;  4QJ4 B;  1I35 A;  2WXG A;  1V8C A;  5IOI A;  1FHX A;  5KCV A;  3ONS A;  2Z4D A;  2N7E A;  4HAX B;  3TW1 A;  2YEP B;  2PEA A;  4K3C A;  4A3P A;  2YLM A;  1F52 A;  4KV2 A;  1VD2 A;  4IM2 A;  2WXF A;  2N7J A;  1DGJ A;  1MKE A;  4O1N A;  1JW9 D;  1UBQ A;  1E5W A;  1K5G B;  4DXA B;  2LJ5 A;  4BOZ B;  2LHE A;  1KJT A;  1IGD A;  2NR2 A;  3CIK A;  1VCB A;  3ZUN A;  3APF A;  4WWM A;  1MHX A;  2KNB A;  2CHZ A;  1OMW A;  2P0H A;  1RM6 C;  3RI7 C;  5KQ4 A;  1ZKH A;  2V0G A;  4G3X B;  2PIA A;  2AYO B;  2XK5 A;  2Y8G A;  4B0M A;  4XX5 A;  2L7R A;  5AUI A;  5EE3 A;  4AQ7 A;  4GDK A;  3U7Z A;  4L6E A;  3QA8 A;  4W9H A;  3H9D A;  2FCQ A;  3FVC A;  4CHK A;  3DBS A;  1MHH E;  3V3X A;  2WHI A;  3W2D A;  4KHB A;  4W9L A;  4B6H A;  3ZNG C;  3NZU A;  3KW5 B;  1N61 A;  2R61 A;  3SR6 A;  2NBW B;  3TUO A;  4BKS D;  4ACF A;  4BZA A;  1SE3 A;  2OQB A;  1OQQ A;  2RVB B;  2W82 A;  1WRI A;  3D8D A;  3MTN B;  2W55 A;  2CU3 A;  2IY1 B;  3B77 A;  3D8F A;  4GLS C;  2L83 A;  3DXC A;  3TO1 A;  3DBR I;  1E6E B;  4DBG A;  2DZM A;  2A4Z A;  1NU2 A;  1V88 A;  2DHJ A;  2LVP A;  2BVC A;  5D3I B;  1TIF A;  1TZ1 A;  4II2 B;  3UQA A;  5CLL B;  2KOX A;  3FAH A;  1WR1 A;  1Q5W B;  1ZXH A;  4HPM B;  4Y94 A;  1SEB D;  3VUY A;  1PGA A;  2FCN A;  3AI5 A;  1GOZ A;  3AEA B;  2K8H A;  3DVN V;  4NJ7 A;  4XWW A;  4P1B C;  2VRW B;  4GOC A;  3D32 A;  3GE8 C;  3JSV A;  2DA0 A;  2D10 A;  4IOI E;  1GB4 A;  2LXA A;  2K25 A;  3Q8B A;  1J7A A;  2FJL A;  3AJ4 A;  2GLS A;  3ZVR A;  2TSS A;  5LLI A;  4B9K A; 
#chains in the Genus database with same CATH homology
 3N7C A;  1JRU A;  3M1I B;  2K6Q A;  3R3M A;  2I1J A;  3A9K A;  4ZDV A;  1W1G A;  4KHO A;  4BKS A;  1UNP A;  1KZ7 A;  2I1K A;  2K2J A;  2V1Y A;  4HAZ B;  1HE8 A;  1XCG A;  2WX1 A;  4WWP A;  3HQC A;  1U5D A;  2NZ8 B;  3TJP A;  2N0Y A;  2IO3 B;  2G45 B;  3HIZ A;  2Y8F A;  5J3Q A;  4ZYN A;  3U8Z A;  2JRI B;  2DAF A;  2BPS A;  3VVW B;  2KX0 A;  4OVV A;  1GC7 A;  2CY5 A;  3D8E A;  1NDD A;  4MSM B;  4GMV A;  4HAU B;  5KHO A;  5L83 A;  2KUP A;  2WYQ A;  2NS5 A;  1E8Y A;  3PG7 A;  5GOW B;  3CF6 E;  5DPS A;  1P9D U;  3L17 A;  5EFX A;  1TGZ B;  3H7P A;  1BTN A;  3PHX B;  1OGW A;  4KZ0 A;  4HB4 B;  2D3G A;  2O6V D;  4EKU A;  1Z5S B;  1J8C A;  4TQ0 A;  1A5R A;  1MIX A;  2PZ1 A;  5HE3 A;  2Z0O A;  1E8Z A;  1WGY A;  2Z59 B;  2MLB A;  2M4N A;  4KZC A;  2COD A;  1WH3 A;  2MFQ A;  3CSF A;  3PVU A;  4HB2 B;  2J7Q B;  3M63 B;  4G11 A;  2MDX A;  5KQ1 A;  2KDE B;  2NPT B;  2BYE A;  4HB0 B;  2N23 A;  4HHV A;  2CRF A;  2R09 A;  3P2B A;  2ZCC A;  3OAN A;  2RNR B;  4ZRK A;  2JPH A;  1R4N I;  2MBB B;  4G50 A;  2DYM A;  1V6E A;  4N9F 4;  4TQ1 A;  1YJ1 A;  2M38 A;  1OEY A;  4EEW A;  5JLJ B;  3ML9 A;  2QKM A;  3PTF C;  2UZR A;  2HTH B;  3H1U A;  3VXW A;  2BKR B;  1PMS A;  2IFS A;  4URK A;  4ZRJ A;  5C16 A;  5J3Y A;  1SIF A;  3B08 A;  2R0D A;  3O65 B;  5D94 A;  1RAX A;  1WZ0 A;  2C7N B;  1QC6 A;  2FCS A;  3X23 A;  2KMA A;  3A1Q A;  1XQQ A;  2QKL A;  1ZC4 B;  3NOB A;  4FJV B;  1W1D A;  1AWE A;  4AWJ A;  4BOS C;  1IYF A;  3H7S A;  1WXS A;  4W9J A;  3SHQ A;  4DDI D;  1P0R A;  2DEN B;  2G3Q B;  3Q3J A;  4DHZ E;  2WDT B;  1H4R A;  3KSY A;  4YON A;  2Z0D B;  1WIA A;  1EF1 A;  1R4M I;  3ZNZ B;  5JHB A;  3VH3 B;  4J6I A;  2LVQ A;  4TV3 A;  5L95 C;  2KXJ A;  1U29 A;  2DHZ A;  2FID A;  3HM6 X;  4MK0 A;  4NAW A;  5JZE B;  1GG3 A;  4PS3 A;  3V6E B;  4Z2N A;  2PE9 A;  2C60 A;  2MSE D;  1WMH A;  4DX8 A;  1C1Y B;  5D6J B;  4EOY A;  3EC8 A;  4F1S A;  2DYO A;  2PE6 B;  2BWE S;  2MBH A;  4W9C A;  2D9X A;  1XKE A;  2Y7B A;  3IFW B;  4RM8 A;  5DCN A;  2KVR A;  2DKQ A;  5LXH A;  3QAR A;  3RUI B;  5JHH A;  3A33 B;  1MAI A;  3Q3F A;  4GXB A;  2LRW A;  2D2Q A;  4DBB A;  1WJ6 A;  1FGZ A;  2L8J A;  3PHW B;  3VH4 B;  2P8V A;  2KJH B;  4E3C A;  2JY6 A;  4IOY X;  3SO6 A;  3N30 A;  2L1C A;  2XQN M;  1WI1 A;  5D27 A;  4NQK E;  2RGF A;  3VDZ A;  2V76 A;  4CYE A;  2KC2 A;  2RGN B;  2UZS A;  1NTY A;  2COC A;  4IFS A;  2M8S A;  3NY5 A;  3WIM A;  1U5G A;  2IY0 B;  2FIF A;  2GBK A;  2ZPN A;  2KDI A;  2KJ6 A;  1V5M A;  3HM3 A;  3ZRF A;  2JZ3 B;  1OY2 A;  1FOE A;  3SUZ A;  1ZGU B;  4PQ0 A;  2DN6 A;  1E8W A;  1UPR A;  5C79 A;  2KTR B;  2O6V B;  3NZS A;  2FCM A;  2D9W A;  4NJ6 A;  2ZNV B;  1RRP B;  4AUQ C;  1FHO A;  4P7I A;  2YRY A;  3QWM A;  2KWU B;  4K17 A;  4MH0 E;  1SGH A;  1EF5 A;  2COF A;  4EZL A;  2VKI A;  2DZK A;  3QCA A;  1NI2 A;  4GU2 A;  1GNU A;  1Z87 A;  3MDB C;  1NTV A;  5DHA B;  1UGM A;  2AL3 A;  2R2O A;  3QC8 B;  3MJW A;  4KHA A;  2ROV A;  4KIK B;  3PT2 B;  4DDG D;  2BYF A;  1WJ4 A;  4A3O A;  2RUK B;  2KLC A;  2RR9 A;  2KD0 A;  5CHV C;  4XWX A;  3QWZ B;  3SV1 A;  3TCA A;  2DX5 B;  3JW0 X;  5JH5 C;  4WVF B;  2JF5 A;  3T06 A;  1ZSQ A;  3IHP C;  3A9J B;  4MGZ E;  4AP4 C;  1WGR A;  2YVC A;  1TJ6 A;  1J0G A;  2NPT A;  2L05 A;  1E90 A;  3R7Q A;  2J0J A;  4KVG B;  2DAJ A;  4IAP A;  2FAZ A;  3RD2 A;  4EZK A;  1V2Y A;  5D7G A;  1U5E A;  2ZEQ A;  4PS7 A;  1BWN A;  4ANU A;  1WRD B;  4WWN A;  4K81 A;  3S2A A;  2DHI A;  2JWZ A;  4HWI B;  3TVV A;  3PZD A;  1P6S A;  2ZPY A;  2MBE A;  3AU4 A;  1BT0 A;  3DVG Y;  2IYD B;  3UZT A;  4W9G A;  2D11 A;  4D0N B;  4W9D A;  4GDL B;  3VUY A;  3A1Q B;  2BCJ A;  1N3H A;  2A5U A;  2KZR A;  2NMB A;  3N32 A;  2RD0 A;  3SDL C;  2G4S A;  4NY0 A;  3NSU A;  2LUL A;  1TTN A;  1ZW7 A;  2LRU A;  3LJU X;  3IG3 A;  4K1R B;  3VAW A;  2K39 A;  1QQG A;  4IW0 A;  3PRZ A;  4GIV A;  1H10 A;  3PEG A;  4Z2M B;  2MW5 A;  3UF8 A;  4EMO A;  3QQ8 B;  3SD5 A;  1H8C A;  1IPG A;  1V9J A;  3L16 A;  3QJZ A;  2CU1 A;  2GBR A;  4I6P A;  2LGY A;  4IC7 B;  1V80 A;  4NQL B;  4BFR A;  4KIK A;  4EUT A;  3OLM D;  1DYN A;  2KGX B;  3KRW A;  3JYU A;  3ZLZ A;  2D4Q A;  5J18 A;  2COA A;  2K2U A;  2LOX A;  1QZE A;  2Z0E B;  5CHW A;  4ANW A;  3HW2 B;  4ANX A;  4F7Z A;  2DYQ A;  5D3V A;  1RRB A;  3QAQ A;  2NBV B;  2N7D A;  1LFD A;  1WXA A;  5E6N A;  2MBQ A;  3RCZ A;  4NNJ B;  3B0A A;  3PVW A;  4RM9 A;  4WJ7 A;  1OQN A;  4HAT B;  2K6D B;  2KTR A;  4IWO A;  2ZJD A;  2V4L A;  2GJY A;  4W9F A;  2DFK A;  3O96 A;  2IYB A;  2N9P C;  5E6P A;  4A6F B;  4PNK A;  4BKT A;  4DHZ B;  2N9X A;  2N1V A;  5AZH A;  4B6W A;  3NHE B;  5CTR C;  1Q0W B;  5D3X A;  3T8M A;  2MWN B;  4WWO A;  4MEL A;  2UVM A;  1UNQ A;  2AEH A;  2DLW A;  4X57 B;  1I42 A;  1V86 A;  2D9Y A;  3DBL I;  5TR5 A;  5HE2 A;  2WWZ A;  2ADZ A;  2KC1 A;  1P98 A;  2MP2 B;  4AOF A;  4HAY B;  2L3Z A;  3A98 B;  2DTC A;  3K9O B;  3PRP B;  4LJO B;  4EFO A;  5E6O A;  3MHS D;  3UGB B;  1WGG A;  3NS8 A;  2P0D A;  2G4D B;  3KVF B;  3WA0 A;  2HJ8 A;  2LXC A;  1G6J A;  2MQJ A;  4I6N B;  2D9Z A;  4GGQ A;  4MSQ B;  4JIO U;  2DZI A;  4LJP B;  2KMC A;  3H6N A;  2MKR A;  2ROZ B;  3L08 A;  3V60 A;  1P3R A;  1D3Z A;  3CXB B;  3ODW A;  3FM8 C;  3ZW3 A;  3EEC A;  1Y5O A;  4MT7 A;  1RFA A;  3EHV A;  2BGF A;  4DK5 A;  1YIW A;  3QHT A;  2FNJ B;  1TBE A;  3VOQ A;  2KWC A;  4EJN A;  3CST A;  3DVN U;  3W1S A;  3GZN I;  2GBJ A;  2JT4 B;  2BYV E;  4BKG A;  3P7Z A;  3B1L X;  2EJ8 A;  1X1M A;  3ODO A;  3ML4 A;  3KYC D;  3LJ3 A;  1U4A A;  5J3T A;  3ZNI D;  1LB1 A;  4B95 A;  2RSG A;  4WJQ A;  1XD4 A;  4DHJ B;  2JZZ A;  2B3A A;  2QHO A;  1I2H A;  3ULC A;  1X11 A;  1KOT A;  2DZJ A;  2I5F A;  2M0X A;  3KY9 A;  2UYZ B;  2KQ7 A;  2MRP A;  1F9J A;  2MWS B;  3AXC A;  4I6L B;  4IUM B;  4NSW A;  1BTK A;  4XZ4 A;  2KX3 A;  4WJN A;  3RT3 B;  1V81 A;  1ISN A;  1WJN A;  1WYW B;  1XT9 B;  2GBM A;  2NCN A;  3QX1 A;  1T0Y A;  2CR5 A;  1RJ2 A;  2AL6 A;  4YL8 A;  5LOP B;  1Q1O A;  2N9E B;  4TUU A;  4DWF A;  1J0W A;  2W2X C;  2IO2 B;  2IBI B;  2JRH A;  3L10 B;  4FJZ A;  1UZX B;  5C6R A;  5C5B A;  4CHM A;  2CS4 A;  3OJ3 A;  1EAZ A;  5FR6 A;  3V62 A;  3G9W A;  2BF8 B;  2C7H A;  2EKE C;  3PPA A;  3VTW A;  1X1F A;  1LQB A;  2KFJ A;  4JGH B;  3VQI A;  1Y19 B;  2G35 A;  1M7R A;  2KJR A;  2CAY A;  1AQC A;  3ULB A;  2KWV B;  3RZF A;  2Z0Q A;  4FA6 A;  3QIJ A;  1DDV A;  2O6V A;  2VSZ A;  2KFK B;  2PJH A;  1WXM A;  3WAO A;  3EFU A;  3KUC B;  1V5P A;  5JP4 A;  2LYD A;  5AZF A;  3SNH A;  3GYP A;  2KAN A;  2XBB C;  2DX5 A;  3T9L A;  1FAO A;  4MY6 A;  3DXE A;  4E71 A;  2DKP A;  1FHW A;  3APC A;  1TXD A;  2YSZ A;  3IVF A;  1B55 A;  3LDZ E;  4DX9 0;  3VUX A;  4A6K A;  4LCD E;  1WR6 E;  3SYX A;  5FI0 A;  2GBN A;  1KI1 B;  3ODX A;  2IO1 B;  2MA9 B;  4FJY A;  3TBL D;  4TKN A;  3ZRC A;  4CO7 A;  4JQW C;  5CX3 A;  1V5T A;  3A4R A;  3ML8 A;  5DH9 B;  1PFJ A;  2WX0 A;  3PRE A;  1XX0 A;  4HJK A;  4A20 A;  3ZIM A;  2ELA A;  1WM3 A;  1IRS A;  2XK5 B;  2KQS A;  2FUH B;  1WJ1 A;  3ENE A;  4IM3 A;  3RUL A;  3QK0 A;  4NAW B;  1V5O A;  4F7G A;  2X18 A;  1PLS A;  5FI1 A;  1EGX A;  1EO6 A;  1PQS A;  2IO0 B;  2XEW A;  4ICU A;  4BBK A;  2ASQ A;  3H7P B;  1OTR B;  2Q13 A;  3PLU A;  3PV1 A;  1UPQ A;  1XR0 B;  5DPW A;  1OQY A;  2K8B A;  2K1F A;  3DOW A;  1YD8 U;  2LVO A;  2LOZ A;  5AEK B;  3F5R A;  3KYD D;  4B9K A;  3GYO A;  2ZVO A;  2L2I A;  3VUW A;  2MX2 A;  2M1M A;  3I3T B;  2OTX A;  1M94 A;  3L13 A;  3ZDT A;  4KDI C;  2YT1 A;  1ZC3 B;  4CHJ A;  2L0T A;  2O2V A;  1EUV B;  1E8X A;  4F8C B;  1WF9 A;  2LKO A;  5DIF B;  1S1Q B;  2HTH A;  2MBO A;  2LI5 A;  4JL9 A;  1ZVR A;  1MG8 A;  2EC1 A;  2LG1 A;  3TFM A;  1DRO A;  1KLV A;  3V6C B;  4HPL B;  3L54 A;  3UQB A;  2EMT A;  4WJO A;  2HD5 B;  3A8P A;  1FGY A;  1EVH A;  4GPT B;  1P1A A;  4K7S A;  4A6F A;  1YQB A;  3BY4 B;  4HCN B;  2N1W A;  4FHK A;  3VTU A;  1UEF A;  1K5D B;  1S3S G;  2W9N A;  2AWT A;  2KDF B;  5G2N A;  1WE7 A;  3ZTC A;  2REX A;  3APD A;  3GOE A;  1WX8 A;  3ZVV A;  4MGI E;  2KHW B;  3PSC A;  5DI9 B;  2DX1 A;  1WM2 A;  2V3S A;  1AAR A;  4KDL B;  1V61 A;  2JXX A;  2KKC A;  3M62 B;  4MJS A;  4GN1 A;  4LDT D;  3UIO B;  4GSW A;  1UD7 A;  4KSL C;  5CLQ B;  3R66 C;  5DPR A;  3VHT C;  5HKH A;  3M3J A;  3HK0 A;  4FAD A;  4AJY B;  4BBN F;  4HAW B;  2PPH A;  2C7M B;  3WYF B;  5IA7 A;  2VRR B;  3DDC B;  4W9E A;  5BO4 B;  3ZTD A;  4EZJ A;  4HLE A;  4F7H A;  3DBH I;  2KTF A;  1GUA B;  2J59 M;  4MEM A;  4KHB B;  3DPD A;  4HXD A;  1WZ3 A;  3CMM B;  2GS0 A;  4IM0 A;  4RMA A;  2ZNV C;  2O2V B;  4A5K A;  1XD3 B;  4DHJ D;  2M17 A;  4E74 A;  3IBE A;  4MGY E;  5JHA A;  2KCJ A;  4M8M A;  2W2X D;  1J19 A;  1WGQ A;  3DVG X;  2BWF A;  3M95 A;  2YS1 A;  4A6H A;  4MM3 A;  3UIP B;  3PP2 A;  4ANV A;  3DXD A;  3AUL A;  2KK8 A;  2KLG A;  4FLH A;  2ZCB A;  3RZW C;  1KZG A;  2EMS A;  2CKH B;  2IZV B;  4KAX B;  4GDK B;  4MJS B;  4OVU A;  2P0F A;  1I35 A;  1DBH A;  3BIN A;  1X86 A;  1RLF A;  4HK2 A;  2YS3 A;  5HE1 A;  4H8S A;  3U30 A;  2J0K A;  1E7U A;  1FHX A;  2Z0P A;  3KZ1 A;  1LXD A;  1IP9 A;  5KCV A;  1UBI A;  3ONS A;  2I5C A;  2LGD A;  3KH0 A;  2N7E A;  4HAX B;  3TW1 A;  5C23 A;  3A9J A;  4C0A A;  3UIN B;  2PEA A;  1X1G A;  5GMV A;  1WE6 A;  4AJW A;  4KSK C;  4XC2 A;  3SU8 X;  3L0W B;  1V49 A;  4A3P A;  3KRX A;  2YLM A;  4KV2 A;  1DDM A;  1VD2 A;  2OOB B;  4IM2 A;  1WY8 A;  3FEH A;  1UEL A;  1MKE A;  3ECI A;  4IWQ A;  5HE0 A;  1C3T A;  1UBQ A;  1E5W A;  1K5G B;  4DXA B;  2LGX A;  2LJ5 A;  1ZM0 A;  3ALB A;  4HCP B;  3A8Q A;  2RSU A;  4BOZ B;  4HVB A;  5KHQ A;  1KJT A;  3OJ4 B;  2NR2 A;  1MIZ B;  3CIK A;  1VCB A;  3PRM B;  2LAS A;  2MP2 A;  2Y5B B;  1P3Q U;  3ZUN A;  3APF A;  1WMH B;  5IAA C;  3F0W A;  2NVU I;  5C1Z A;  3ZDM C;  3VTV A;  2KNB A;  3V61 A;  4ZRI A;  3VIA A;  1OMW A;  2P0H A;  1WXV A;  2CHZ A;  5KQ4 A;  1ZKH A;  2K8C A;  3JVZ X;  4G3X B;  3JSV B;  1NBF C;  3ZNH B;  2HE7 A;  2KN5 A;  4PYZ A;  2AYO B;  2XK5 A;  4PYU A;  2Y8G A;  3KUD B;  2KFK A;  2YT0 A;  4HB3 B;  4XX5 A;  5LON B;  2L7R A;  1XOD A;  3OAW A;  3U7D A;  1SHC A;  4GDK A;  5D2M B;  4ASW C;  1FXT B;  4L6E A;  2DYN A;  2LUE A;  4GZU A;  3QA8 A;  4W9H A;  2RLO A;  2LD9 A;  3H9D A;  2FCQ A;  4W9I A;  1U2B A;  4CHK A;  3AU5 A;  1TQZ A;  2L0F A;  1WGU A;  2LZ6 A;  3A4S C;  3DBS A;  1MK9 B;  1WVH A;  3R7R A;  4K2P A;  1WG7 A;  2CY4 A;  4BVU C;  5LXI B;  1UNR A;  3WAL A;  2J0M A;  1L2N A;  3PVL A;  1LM8 B;  1Y8R C;  4B6H A;  2ZZP B;  3K9P B;  3NZU A;  4W9L A;  3ZNG C;  3ZO5 B;  3KW5 B;  4GMX B;  1CMX B;  5DHF B;  1K8R B;  1V5U A;  1I7A A;  2GCL A;  2NBW B;  2DHK A;  4GB9 A;  2D9V A;  1P5T A;  4BKS D;  3W1Y A;  2OQB A;  1SE9 A;  3PSE B;  2RVB B;  4HAV B;  2C5L C;  5L81 A;  1Q67 A;  2YS5 A;  4WAA A;  4FN2 A;  1WX9 A;  2R2Q A;  4WJP A;  4IWP A;  3D8D A;  3MTN B;  1M7E A;  3N3K B;  4MDK E;  2MCN B;  2IY1 B;  4LDT B;  1BAK A;  3DQV A;  3D8F A;  4GDL A;  4PS8 A;  3DXC A;  3TO1 A;  3PS6 A;  2ELB A;  3DBR I;  3WAN A;  4FUL A;  1OEY J;  1YX5 B;  3C0R B;  4DBG A;  2DZM A;  2A4Z A;  1NU2 A;  1V88 A;  5C5B B;  4HDQ A;  2DHJ A;  2LVP A;  2W2W A;  4M0W B;  2GOW A;  4WSF A;  1MK7 B;  5G55 A;  4BBN C;  2KO3 A;  2D07 B;  5EDS A;  3TMP B;  1LW3 A;  2E2X A;  2H7D A;  3FSS A;  3P6A A;  1WGD A;  5D3W A;  1TZ1 A;  2CHW A;  4II2 B;  2DYB A;  4ICV A;  3VFK A;  3UQA A;  5CLL B;  2L76 A;  2KOX A;  1W1H A;  2OJR A;  4K7W A;  2ZVN A;  1KM7 A;  4W9K A;  1WR1 A;  1Q5W B;  4G0N B;  2YF0 A;  2N4F A;  2RPQ A;  2L00 B;  5CHF A;  5J17 A;  4HPM B;  4HDO A;  3QBV B;  1U5F A;  3HHM A;  3W1S C;  1DDW A;  1U27 A;  4Y94 A;  1E7V A;  1WX7 A;  2LWP A;  1WJU A;  2M14 A;  2FCN A;  1Z2M A;  4WQO B;  3TIX A;  1YX6 B;  1UH6 A;  2KDB A;  1MPH A;  3AI5 A;  4II3 B;  3MPX A;  4K2O A;  5D3Y A;  3V5W A;  4MGK E;  3TL5 A;  4F7U P;  5AZG A;  1GC6 A;  4NPN A;  1WGH A;  2UWQ A;  3WAM A;  2K8H A;  3DVN V;  3PGE A;  5JHG A;  4NJ7 A;  5DPT A;  3X0W A;  2JP2 A;  3PLV A;  2VRW B;  1X05 A;  4GOC A;  3D32 A;  2NBU A;  1GJZ A;  1V89 A;  3DCG A;  4M8N A;  3JSV A;  2K00 A;  3KUZ A;  2C9W B;  4JLC A;  2DA0 A;  2D10 A;  3BJI A;  5J2R A;  1WI0 A;  2H7E A;  2CHX A;  2JUO A;  2GMI C;  2LXA A;  2K25 A;  2BKF A;  2FJL A;  3WAP A;  3AJ4 A;  1WJM A;  3RCP A;  1WFY A;  3ZKJ C;  1L7Y A;  1FB8 A;  2GCJ A;  4FBJ B;  3ZVR A;  4IG7 B;  5LLI A;  4TYZ A;  4K7U A;  2JVC A;  4FHJ A;  3RYT A;  3A9K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...