4GMVA

Crystal structure of the coiled-coil, ra and ph domains of lamellipodin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
269
structure length
260
Chain Sequence
KAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-associated and pleckstrin homology domains-containing pr
publication title Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 77
structure length 260
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gmvA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gmvA01
4IUMB 3LDZE 3WAOA 3ULBA 3PVUA 2DAFA 1T0YA 4BBNC 5D3WA 3MDBC 5DI9B 2LZ6A 3W1YA 2KTFA 4HB2B 4MJSA 1V5MA 1WI0A 1ZVRA 2LGXA 1P6SA 4KSLC 4OVVA 3LJ3A 3O65B 5L95C 2LVOA 3PSEB 2KWVB 2Y5BB 3AXCA 2GMIC 3VOQA 2DZMA 3C0RB 1H10A 2OTXA 2DX5A 2LD9A 4FADA 1NTYA 3PHXB 2I1JA 2WWZA 1VD2A 2KDEB 1Z87A 2AYOB 1ZM0A 3ML4A 2J0MA 3F0WA 3CSTA 2IYBA 1E8XA 2L76A 3KUDB 3V60A 3NS8A 2Q13A 3VDZA 2COCA 1UPRA 2MA9B 3VIAA 4A3PA 4DK5A 5DPTA 3OJ4B 2UZSA 4ICVA 1WXVA 4BBKA 1WGQA 1WE7A 2K39A 4HB4B 3QBVB 4K2PA 1XCGA 3KUZA 2DKPA 1XQQA 3UINB 1I35A 3IFWB 3L17A 5LXHA 2XK5B 2Y8GA 1U5GA 2YRYA 4WWPA 1FXTB 2VKIA 5C6RA 3DPDA 4AJYB 1XX0A 5BO4B 2D2QA 4E74A 2FCQA 4GPTB 4MK0A 1P98A 3U8ZA 2C7HA 2BF8B 2KLGA 4GMXB 3PVWA 5AEKB 4KZ0A 2KOXA 2K8HA 3NY5A 5E6PA 4MM3A 3OANA 1MPHA 3NSUA 5DCNA 2GCJA 1E90A 1RAXA 3R7QA 4ANXA 2CRFA 4BOSC 1K5DB 2N9XA 2A4ZA 3KRXA 3RULA 2I5FA 2LXCA 1WH3A 2C5LC 3PEGA 1HE8A 3EHVA 5JHGA 3G9WA 4A3OA 1FB8A 3K9OB 2KJ6A 5LONB 2KJRA 3BINA 2BCJA 5LLIA 2LKOA 2BWFA 5GOWB 2DYMA 3NZUA 2NCNA 2FAZA 1YX6B 3DDCB 4JGHB 4MSQB 1FHWA 4E3CA 4LJOB 3H9DA 3EFUA 3SU8X 4FBJB 3H7PB 1W1HA 1KM7A 5J3TA 2ELAA 4JQWC 2O2VB 2VSZA 2KDFB 4GIVA 4ZYNA 3QC8B 1B55A 4I6PA 2KZRA 5DPRA 4DBGA 4EZJA 3IHPC 4FN2A 3SDLC 2M14A 1MAIA 5G55A 3VH3B 4HAUB 1YIWA 3H1UA 1LB1A 1WVHA 1TGZB 2DKQA 2D9XA 4D0NB 5KHOA 3NZSA 1TXDA 3GZNI 2KGXB 2IY1B 2NR2A 3HM6X 1YD8U 5L83A 1MIZB 2N7EA 2N1VA 2L05A 3DVGY 2M4NA 5D2MB 4W9FA 2LG1A 4A6FA 3IG3A 2K6DB 1IPGA 1X86A 5C23A 1WJMA 1WRDB 3ZNZB 2D10A 1UNPA 3KVFB 4A20A 4HAYB 4DHZB 4AUQC 2VRRB 3VTWA 5JHAA 4BOZB 4BKSD 4GXBA 2GBJA 4K81A 2L00B 5AZGA 1DDVA 4NJ6A 1V61A 1J19A 2BKRB 1S1QB 1WZ3A 3CXBB 4F7GA 1NI2A 1V49A 2G45B 4GDLA 4G0NB 2FCNA 4W9GA 2RPQA 5D3VA 4HPLB 3B1LX 3QA8A 5KQ4A 5JH5C 1J0GA 2BKFA 4DBBA 1L7YA 3U30A 2LXAA 2L2IA 1WF9A 1E8YA 2PE6B 1W1GA 2ROVA 2BYFA 1LW3A 3WALA 2KANA 3ZVVA 3KY9A 2N4FA 4PYUA 2G3QB 2AL3A 1WGGA 1FAOA 1WM2A 1MKEA 1WJNA 4MGKE 3F5RA 2MCNB 2ZVNA 1XR0B 2RSUA 1OQNA 3L10B 3VTUA 2PE9A 4K7WA 4FLHA 4KDIC 2RVBB 1V86A 1WJ1A 3HW2B 1C1YB 2C7NB 4WWOA 3JVZX 3SHQA 4NQKE 4RM8A 2L3ZA 3VQIA 2ZZPB 2LRUA 1WYWB 3V5WA 3ONSA 4ANVA 2KN5A 2DTCA 1KI1B 4G3XB 1SGHA 2XK5A 4MGIE 2Z0OA 2MWNB 2G4DB 1X11A 4W9DA 1W1DA 2RR9A 1EO6A 4CHMA 4CYEA 2NMBA 3EECA 2K8BA 5C16A 4NSWA 3QJZA 2ELBA 4HAXB 2M17A 3MTNB 2AWTA 1EF1A 2K1FA 3QARA 5G2NA 2YF0A 1EAZA 3KZ1A 2KVRA 2R2OA 4IM2A 3D32A 2MBEA 1Q5WB 4EUTA 4EEWA 4HK2A 2KDIA 2K00A 4K7SA 4ICUA 5CHVC 2IYDB 3A9KB 3WAMA 5AZFA 4EKUA 4KDLB 4WSFA 4BKSA 2GCLA 1YJ1A 3RUIB 1U4AA 1UGMA 3ZDTA 3ZVRA 1BT0A 4N9F4 1KZGA 2CKHB 4LCDE 3VUXA 2J59M 3H7PA 3N30A 2E2XA 3AU5A 4DXAB 2B3AA 2L0FA 2O2VA 2LGDA 1WX9A 4CHKA 4C0AA 1RFAA 2LASA 2DAJA 1DBHA 3DCGA 2ZNVB 4NQLB 2FNJB 4HB3B 2KCJA 3FM8C 1LXDA 3HQCA 2ZJDA 2N9PC 2IO1B 4MGYE 2KMCA 2M8SA 2HE7A 1Y8RC 5D6JB 3ECIA 4WJPA 1OEYJ 4FHJA 2ZPNA 4HVBA 1X1FA 2DZJA 4GMVA 3A1QB 3M62B 1P1AA 3QIJA 1DROA 1G6JA 1P0RA 3NHEB 4JL9A 3PHWB 2P0FA 3VHTC 2YSZA 3A33B 3Q3JA 5J18A 5LOPB 2MP2B 4XZ4A 4BKGA 3KH0A 2M1MA 3UIPB 4X57B 2C9WB 4HCPB 4W9HA 5HE0A 4EJNA 2K6QA 5J3YA 2W2XD 4TUUA 4IWOA 4NAWB 3LJUX 4II2B 2ZEQA 3GYPA 4KIKB 3DXEA 4IFSA 4W9EA 2CAYA 1WJUA 1WGYA 1UZXB 4IOYX 2UZRA 1EF5A 5D3XA 2PEAA 4WJQA 3JW0X 2DHZA 1U5DA 1GC7A 1OEYA 4F7HA 1Z5SB 3ZKJC 2KFKB 5JHHA 2MLBA 1AWEA 2YS3A 4AJWA 3A8QA 4XX5A 1WXAA 2W2WA 3QWMA 2FUHB 2QHOA 1ZSQA 4FJZA 4GZUA 2KX0A 4PYZA 1RLFA 2Z59B 1DDWA 2R0DA 3KRWA 3TMPB 2BGFA 1P3QU 2OJRA 2ROZB 3X23A 1UH6A 2UWQA 3QWZB 2DZKA 4AWJA 2XEWA 1WY8A 1H4RA 3RCZA 3TJPA 5JHBA 2LGYA 4KHAA 1Y5OA 1R4NI 2IFSA 2CODA 3V6CB 3WAPA 1QC6A 1V6EA 3QCAA 2W9NA 4PS8A 3B0AA 1UBQA 5J17A 1P5TA 3PG7A 3L0WB 2CHXA 4M0WB 4RMAA 4KVGB 2R2QA 4NNJB 2GJYA 2DENB 3ENEA 2R09A 5E6OA 2GBKA 2DHJA 4TKNA 1VCBA 2DZIA 2Y8FA 4I6LB 1FHXA 3WYFB 3WANA 1WXSA 4NPNA 5D3YA 3RZFA 3TO1A 2YVCA 1M7RA 1BWNA 3SNHA 2K25A 4IM3A 2JRHA 2YT0A 2Y7BA 1TBEA 4W9LA 4DHZE 3A9KA 3A9JB 3ZNGC 3ZDMC 2V4LA 4F7UP 1V81A 3X0WA 1U2BA 4A6HA 1FGZA 4HJKA 3AU4A 1OMWA 1X1GA 3HHMA 3TVVA 2JWZA 2O6VB 1BAKA 1V89A 2EJ8A 2JT4B 2BWES 1AQCA 1TQZA 2XQNM 1RRPB 3APCA 3MPXA 5E6NA 3JSVB 3L13A 4WQOB 5EFXA 2J0KA 4L6EA 5EDSA 1GNUA 4HATB 5KCVA 4WWNA 3HK0A 2KFJA 1E8ZA 2VRWB 2EKEC 3QHTA 1I2HA 4ANUA 4KSKC 2MDXA 4ANWA 2ASQA 1EUVB 1H8CA 1GUAB 4CHJA 3ZRFA 5J2RA 1WJ4A 2DLWA 1NTVA 2J0JA 5JZEB 3ULCA 3A1QA 2KLCA 2N1WA 2MBQA 4HAWB 4B6HA 3QK0A 4G11A 1OGWA 5FI1A 2MBBB 3PLUA 1YX5B 3RZWC 2NBUA 1NU2A 4HAZB 3SUZA 2MP2A 1OTRB 2K8CA 3PTFC 4Z2MB 4M8MA 2O6VD 1E7VA 4NAWA 4P7IA 2KTRB 3NOBA 2ZVOA 4KIKA 2KD0A 1P9DU 3V62A 1D3ZA 3ZNID 2LVQA 1EGXA 4GDKB 2PJHA 3UGBB 4HXDA 4ZRJA 4W9IA 2X18A 1Q0WB 2KJHB 3O96A 4PS7A 3UF8A 4PQ0A 4EMOA 3UQBA 3VUYA 2KMAA 1V80A 3CIKA 4GB9A 4H8SA 2L0TA 1F9JA 1E7UA 1V9JA 3IVFA 1KZ7A 2KFKA 2KC1A 3PLVA 2KKCA 3W1SC 3PSCA 5LXIB 4HAVB 2KWCA 2KXJA 2ZCBA 5DH9B 2LUEA 2NPTB 4KHOA 1R4MI 4DX8A 3A4SC 2KHWB 2DHIA 5FI0A 3ZIMA 5DHFB 3QAQA 4EFOA 2JRIB 3UIOB 2HJ8A 2BYVE 3DVNU 3DXCA 4MT7A 3ZUNA 4YL8A 1WGHA 3UZTA 3SV1A 2DYOA 2YS1A 3HM3A 4IWPA 2ZPYA 2L1CA 4E71A 2YT1A 2PPHA 2JVCA 1U27A 2MRPA 1Y19B 2V76A 2Z0DB 3CMMB 3APFA 2NS5A 4MY6A 2LVPA 1WGRA 2JP2A 2KQSA 3BJIA 2YLMA 1YQBA 4IWQA 4DHJB 5CTRC 5KHQA 5IA7A 2RNRB 2WYQA 3ZO5B 1U5EA 4W9CA 1LQBA 2LI5A 4GOCA 1IRSA 4IW0A 4DDGD 1V88A 1UBIA 3MHSD 3KYDD 2MSED 3WIMA 4IAPA 3ZW3A 3ALBA 1WR6E 1SE9A 1OQYA 3DOWA 3PP2A 3A9JA 3DBLI 2MX2A 4A5KA 2A5UA 4I6NB 4PS3A 2N0YA 4HHVA 4ZRKA 2LOZA 2NVUI 2RUKB 4EZKA 2KQ7A 4II3B 2JY6A 1DDMA 1V5UA 3AULA 1A5RA 2RLOA 1QZEA 3ZLZA 2JZ3B 4WJ7A 3ML9A 2O6VA 3H7SA 1WJ6A 5JP4A 2D9YA 1AARA 3JYUA 3T9LA 1MK7B 1QQGA 3D8DA 3GOEA 3JSVA 5HE3A 3DBHI 1P3RA 5KQ1A 3PT2B 3P6AA 4TQ0A 2HTHB 5FR6A 4XC2A 3DQVA 1XKEA 4LJPB 4DHJD 2GBMA 3PV1A 3B08A 4DX90 3H6NA 2EMSA 3A98B 3D8FA 4MH0E 3FSSA 4GGQA 2MKRA 3PZDA 4J6IA 4B6WA 4B95A 1IP9A 3SD5A 3K9PB 1BTNA 2I1KA 1Q1OA 4KV2A 2NZ8B 1PLSA 1UPQA 3N3KB 5CLQB 3ODWA 1U5FA 3T06A 4G50A 3EC8A 1MIXA 2MW5A 3AI5A 2D07B 4K17A 1WG7A 4PNKA 2I5CA 4GSWA 2IBIB 1SHCA 3RCPA 2COFA 5IAAC 2NBVB 1V2YA 1WGDA 2GBRA 2MFQA 2MBOA 3M3JA 4DDID 1N3HA 3PRZA 1UNQA 2KTRA 2GS0A 4ZDVA 2C60A 4F7ZA 3PREA 3FEHA 3R7RA 1U29A 2DFKA 3RYTA 4GDKA 4FHKA 4B9KA 1NBFC 1TJ6A 5D27A 1WFYA 4BFRA 3KSYA 3RT3B 4WJOA 4K1RB 3L54A 3IBEA 1S3SG 1PMSA 4AP4C 1FOEA 1ZKHA 1J0WA 1EVHA 4MELA 1FGYA 4A6KA 5DPWA 4HDOA 1WMHA 2CR5A 5J3QA 4HLEA 4F1SA 2NPTA 3U7DA 2V1YA 2EC1A 3VVWB 2RGNB 3KUCB 1E8WA 3R3MA 2LULA 2AL6A 4BKTA 3QX1A 3VAWA 1GJZA 1XT9B 4LDTB 1UD7A 4M8NA 1M94A 3DXDA 3TW1A 3PVLA 5C1ZA 1GG3A 5JLJB 2J7QB 2JXXA 1Z2MA 2KO3A 2UVMA 2N7DA 3T8MA 1I42A 2YS5A 3N32A 1WI1A 3UQAA 3M95A 5DIFB 3ZTCA 2PZ1A 2ADZA 1WR1A 4CO7A 2WDTB 2IO2B 4HB0B 2LJ5A 2JZZA 1K5GB 2KDBA 2MQJA 1WM3A 3M1IB 3A4RA 4KHBB 1I7AA 5HE1A 4MSMB 2LRWA 5CHFA 3ODOA 1WX7A 2EMTA 5C5BB 5D94A 2D9VA 1IYFA 4BVUC 2G35A 4TYZA 2W2XC 2LYDA 2C7MB 5D7GA 2BYEA 2DHKA 4IC7B 1ZW7A 2P0DA 3OJ3A 2GBNA 4RM9A 2ZNVC 1WX8A 2N9EB 5GMVA 1FHOA 2IZVB 1GC6A 4TV3A 4LDTD 2CHWA 4EOYA 1X05A 2DA0A 2KWUB 2FIDA 3GYOA 2WX1A 3VUWA 1V5TA 3VTVA 1PQSA 2FCSA 2JPHA 4KAXB 2Z0EB 2V3SA 2DX1A 4FJVB 4MJSB 5HKHA 2D9ZA 2DYNA 5DHAB 4HWIB 3SYXA 2HTHA 4GN1A 2M38A 3V6EB 2LWPA 4IG7B 4FJYA 1UNRA 2QKMA 3VXWA 3R66C 3D8EA 1WE6A 4W9KA 3SO6A 4FULA 2JF5A 2DX5B 2UYZB 3Q3FA 2L8JA 2ZCCA 4IM0A 3L08A 1KOTA 4GU2A 3ZRCA 5CX3A 1E5WA 2KUPA 1XODA 2FCMA 3L16A 4OVUA 4ZRIA 2H7EA 2BPSA 1V5PA 4Z2NA 3APDA 2DYBA 4DWFA 1TTNA 1ISNA 2WX0A 5DPSA 3TFMA 2L7RA 4HDQA 1TZ1A 1RRBA 4JLCA 4F8CB 2KX3A 1LFDA 3VFKA 3KYCD 2DN6A 4HPMB 1WIAA 2M0XA 2Z0QA 2H7DA 4AOFA 1K8RB 2IO0B 3DBRI 2GOWA 2CHZA 3ZTDA 3N7CA 2COAA 1ZC3B 1C3TA 1WMHB 2CY5A 2FIFA 1JRUA 2RSGA 1MK9B 2KC2A 3OAWA 3DBSA 3HIZA 3W1SA 2G4SA 5CLLB 1RJ2A 4TQ1A 2OOBB 2XBBC 1LM8B 3TIXA 1BTKA 2KK8A 1L2NA 3OLMD 2KNBA 3TL5A 4WJNA 4BBNF 1M7EA 3PS6A 4ASWC 2IO3B 3AJ4A 3I3TB 3BY4B 3TCAA 4WAAA 1CMXB 3S2AA 2HD5B 3TBLD 3A8PA 2AEHA 1ZC4B 3MJWA 1KLVA 1WZ0A 2CS4A 3CSFA 2MWSB 2K2JA 2DYQA 2D11A 2FJLA 4K2OA 1XD4A 3V61A 1MG8A 2P0HA 1UEFA 3M63B 2RD0A 1KJTA 4MDKE 2CU1A 3KW5B 2CY4A 2D3GA 3PPAA 4NJ7A 3VH4B 1WGUA 2K2UA 4MGZE 1SIFA 2MBHA 2N23A 1UELA 1PFJA 4URKA 5CHWA 3ODXA 3DVNV 2RGFA 4FA6A 4WVFB 1WXMA 3PRMB 3P7ZA 4YONA 2Z0PA 4HCNB 4EZLA 1NDDA 2D9WA 2JUOA 3RD2A 5C79A 5TR5A 2D4QA 1X1MA 1XD3B 4MEMA 4KZCA 4JIOU 2NBWB 1J8CA 2IY0B 2OQBA 4Y94A 5L81A 5C5BA 3WA0A 2LOXA 4XWXA 1DYNA 1V5OA 4A6FB 5HE2A 1OY2A 3ZNHB 2QKLA 3DVGX 3CF6E 2REXA 3P2BA 4W9JA 3QQ8B 4NY0A 5AZHA 2P8VA 1ZGUB 4K7UA 3PGEA 3PRPB 4GDLB 1Q67A 3ML8A
chains in the Genus database with same CATH superfamily
4IUMB 3LDZE 4LTUA 3Q69A 3WAOA 1N5XA 1XLPA 2AQ1B 3ULBA 3PVUA 3AE7B 2DAFA 2Y5CA 5H8YE 1T0YA 1TS4A 2KWDA 4BBNC 5D3WA 3MDBC 5DI9B 1QILA 1P7EA 2WXMA 2LZ6A 3W1YA 1SB3C 2KTFA 4WQMA 4HB2B 2J53A 4MJSA 3N1YC 1FIQA 1V5MA 1WI0A 1ZVRA 2LGXA 1P6SA 1STEA 4KSLC 5H92C 2KR0A 1P7FA 4OVVA 1FMAD 3BZDB 3Q3OC 3LJ3A 3O65B 5IOIA 5L95C 2LVOA 2N7JA 2KWVB 2Y5BB 3PSEB 3WCQA 3AXCA 2GMIC 3RPFC 1FO4A 3VOQA 3VRAB 2DZMA 3C0RB 3NS1A 1H10A 2OTXA 1ZE3D 2DX5A 2LD9A 4FADA 1NTYA 3PHXB 2I1JA 2WWZA 2WS3B 1VD2A 2KDEB 1Z87A 3SR6A 2AYOB 1ZM0A 3ML4A 4L1RA 1F77A 2J0MA 3F0WA 3CSTA 2IYBA 2YT2A 1E8XA 2L76A 3KUDB 3V60A 2NMQA 1BUIC 3NS8A 2Q13A 3VDZA 1HTQA 2COCA 4D6WA 1UPRA 3GS2A 5LG4B 2MA9B 3VIAA 4A3PA 4DK5A 1JWSD 5DPTA 3OJ4B 2UZSA 4ICVA 1WXVA 4BBKA 1WGQA 1WE7A 2K39A 4EE2A 4HB4B 3QBVB 4K2PA 1XCGA 3KUZA 3AE4B 2WXLA 2DKPA 1XQQA 3UINB 1I35A 2KIEA 3KQ4A 3IFWB 3L17A 2LMCA 5LXHA 2XK5B 2Y8GA 1U5GA 2YRYA 1L4DB 4WWPA 1FXTB 4US9A 2VKIA 3R8BA 3DBRB 2PLPA 5C6RA 3DPDA 4AJYB 1XX0A 3EUB2 5BO4B 2D2QA 2V3NA 4E74A 2FCQA 4GPTB 3IAM1 4MK0A 1P98A 3U8ZA 1SSNA 1YQ4B 2C7HA 2WHIA 2Y5PA 2BF8B 2KLGA 4GMXB 3PVWA 5AEKB 3ABVB 3IXSA 4KZ0A 2KOXA 3RFZB 2K8HA 3T3NA 3NY5A 2WXFA 5E6PA 4MM3A 3OANA 1MPHA 3NSUA 5DCNA 2GCJA 1E90A 1T5XD 1RAXA 4RFBA 3ZJVA 3R7QA 2WDQB 4ANXA 2CRFA 1F0ZA 4BOSC 1GOZA 1K5DB 2INDC 2N9XA 5T8IA 2A4ZA 3KRXA 3RULA 2I5FA 2BT6A 3U4EG 3U2SC 2LXCA 1WH3A 2C5LC 5I2MA 3PEGA 1HE8A 1RYJA 1ZXIA 2V3PA 1K51A 3EHVA 4NAMA 5JHGA 3G9WA 2R61A 4A3OA 1FB8A 3K9OB 2KJ6A 5LONB 2KJRA 1YN3A 3BINA 2BCJA 2KT7A 5LLIA 2LKOA 3Q3MC 5BMGA 2BWFA 4LNOA 5GOWB 2DYMA 2BB6A 3NZUA 3AE3B 2NCNA 2FAZA 1YX6B 3DDCB 4JGHB 1BXTA 4MSQB 1FHWA 4E3CA 4LJOB 4HJGE 3H9DA 3EFUA 3SU8X 4FBJB 3H7PB 1W1HA 1KM7A 5J3TA 5HI1A 2ELAA 4JQWC 2O2VB 2VSZA 2KDFB 5EE1A 4GIVA 3MC8A 3N1XC 2V4IB 4XDDA 4ZYNA 3QC8B 1B55A 2I2YA 3P4PB 1TYGB 2KZRA 1TY0A 4I6PA 5DPRA 4DBGA 4L2YA 4EZJA 3IHPC 4FN2A 3SDLC 2M14A 1MHXA 1MAIA 5G55A 2Q5WD 2Z4DA 3VH3B 2L52A 2ICIA 4HAUB 1YIWA 2RMMA 3H1UA 1LB1A 1WVHA 2PMVA 1TGZB 3MFGA 1PGBA 2DKQA 5G5HA 1K52A 2CJNA 2D9XA 4D0NB 1N63A 5KHOA 1TXDA 2LEKA 3NZSA 1TKYA 3GZNI 5BYSA 2KGXB 2IY1B 4OZBA 1FFUA 4NJCA 2NR2A 2W82A 2RDBC 2VZKB 3HM6X 1YD8U 1FD6A 5L83A 1MIZB 2N7EA 2N1VA 2L05A 1PGAA 1XXGA 3DVGY 2L32A 2M4NA 2ON8A 5D2MB 2LG1A 4A6FA 4W9FA 3IG3A 2K6DB 1IPGA 2K5PA 1X86A 5C23A 1WJMA 1WRDB 3ZNZB 2D10A 4YSXB 1B1ZA 4Q2JA 1UNPA 3KVFB 4A20A 4HAYB 4DHZB 4A8XC 1VLBA 4AUQC 5LNK1 4XWTA 2MJDA 4A55A 2VRRB 4PK1A 3VTWA 1ET9A 5BMIA 5JHAA 4RH6A 1WYGA 4BOZB 4BKSD 4GXBA 1QOAA 2GBJA 4K81A 3TSSA 3VRBB 1XEEA 2L00B 5AZGA 3GB1A 1DDVA 1KFYB 4OVZA 3UI3A 2LJIA 4NJ6A 1V61A 1J19A 2BKRB 1S1QB 1WZ3A 3W5VB 3CXBB 4F7GA 1NI2A 1V49A 2QSDA 2G45B 4GDLA 4G0NB 2FCNA 4W9GA 2RPQA 5D3VA 1PGXA 4HPLB 3B1LX 1C79A 1ENFA 1QOBA 3C8YA 3QA8A 3GE8C 5KQ4A 1ZDXA 5JH5C 1J0GA 3DWMA 2BKFA 4DBBA 4P16A 1EM7A 2NTSA 4ARCA 1EWYC 2KYWA 1L7YA 3U30A 2LXAA 2L2IA 1WF9A 1E8YA 4MACA 2PE6B 1W1GA 3C19A 1FNUA 3NWFA 2WXRA 2ROVA 2BYFA 1LW3A 3BYYB 3URYA 3LYYA 3WALA 3AM9A 2KANA 3ZVVA 3P1MA 3KY9A 2N4FA 3LXFA 4RF1A 4PYUA 2G3QB 2AL3A 1WGGA 1FAOA 4DXGA 1VRAB 1WM2A 2VZKD 1MKEA 2PW9A 1WJNA 4MGKE 3F5RA 2MCNB 2ZVNA 4RCOA 2ZW1A 1XR0B 2RSUA 1OQNA 2N9LA 4LNKA 1L0YB 3L10B 3VTUA 2PE9A 4K7WA 4FLHA 4KDIC 2RVBB 1V86A 1WJ1A 3HW2B 1C1YB 1DYQA 1T3QA 2C7NB 1FNWA 4WWOA 3JVZX 3RNCC 3SHQA 1RM6C 2KACA 1JQ4A 2CU3A 3AE8B 2D3CA 4C4VB 4NQKE 4RM8A 2WGSA 4LK0M 2L3ZA 4RGTA 2WXPA 3IAS1 3VQIA 2ZZPB 2LRUA 3R2IA 1WYWB 2MEKA 3V5WA 3ONSA 4ANVA 2KN5A 2DTCA 1KI1B 4G3XB 1SGHA 2XK5A 4MGIE 1OFFA 2Z0OA 2K22A 2MWNB 3W9CB 2G4DB 1X11A 1V8CA 4W9DA 1W1DA 2RR9A 1EO6A 4CHMA 4CYEA 2NMBA 3EECA 2K8BA 5C16A 1SBBB 4NSWA 1N62A 3QJZA 1YN5A 2ELBA 4HAXB 2M17A 3MTNB 2AWTA 4L1BA 1EF1A 2K1FA 3E56A 3QARA 1MG4A 2QMTA 3TEXA 4N6EB 5G2NA 2YF0A 1EAZA 2PVGC 2MH7A 4BZAA 3KZ1A 3AB5A 2EELA 1VZ7A 2D5GA 4QJ3B 2KVRA 2R2OA 2NTTA 4IM2A 3D32A 2BB5A 1Q5WB 2MBEA 4YTPB 4EUTA 4EEWA 4HK2A 2KDIA 1HZ6A 2BS2B 2K00A 3P4SB 4K7SA 4WURA 4ICUA 5CHVC 2IYDB 3A9KB 3WAMA 5AZFA 4EKUA 2B76B 2VH1A 3OG5A 4KDLB 4WSFA 2OHFA 4BKSA 2GCLA 1YJ1A 3RUIB 1U4AA 1UGMA 3ZDTA 3ZVRA 1BT0A 3Q8AA 4N9F4 3ETRA 1K53A 1KZGA 2WDRB 2CKHB 1TY2A 1OQQA 2QDFA 3P4QB 4LCDE 3VUXA 2J59M 3H7PA 3N30A 2E2XA 3AU5A 4DXAB 2B3AA 2D3BA 2L0FA 2O2VA 2LGDA 2L83A 1WX9A 4CHKA 1F2RI 4C0AA 3Q8CA 1FCLA 2J4XA 3SEBA 1RFAA 2K9XA 1CJEA 2LASA 4ZHPA 2TSSA 1L6VA 2DAJA 1K50A 4IDIA 1NVID 1DBHA 3DCGA 3ZJUA 2ZNVB 1T0SC 5G5GA 4XDCA 4NQLB 4H2AA 2FNJB 3P4RB 3AE9B 4JWSC 4HB3B 2KCJA 2INPE 3HIEA 1FRRA 3BYTB 3GZNB 3I57A 3FM8C 3DHGC 1LXDA 3HQCA 2ZJDA 3CWIA 1HXYD 3MC9A 2N9PC 3DHIC 2IO1B 4MGYE 2KMCA 1ET6A 4OHJA 2M8SA 2HE7A 1Y8RC 5D6JB 4L23A 3ECIA 4WJPA 1OEYJ 4FHJA 3ZQ4A 2ZPNA 4HVBA 1X1FA 4MH8A 3PZ7A 1HZ5A 2DZJA 4GMVA 2KUQA 3RNFC 3A1QB 3M62B 1P1AA 3QIJA 1DROA 1G6JA 1UWMA 5BYQA 4YWGG 1P0RA 4M01A 1PFDA 3NHEB 4JL9A 3PHWB 1TS2A 2P0FA 3VHTC 2M19A 2YSZA 3A33B 3Q3JA 5J18A 2G1EA 5LOPB 2MP2B 4XZ4A 4BKGA 2QCZA 3KH0A 1AWDA 1YNTE 1WRIA 1YJIA 2M1MA 3UIPB 4X57B 2C9WB 4HCPB 4W9HA 5HE0A 1QT9A 1YN4A 4EJNA 2K0PA 2K6QA 5J3YA 2W2XD 4QAYA 2W54A 4TUUA 4IWOA 4NAWB 1ZOYB 3LJUX 2K8EA 1SE3A 4II2B 2ZEQA 3GYPA 4KIKB 3DXEA 1SJED 4IFSA 4W9EA 2BBCA 2CAYA 1WJUA 1WGYA 4AS1A 5FR3A 1I4RA 1UZXB 5IO9A 4IOYX 4WWMA 1DOXA 1JWMD 1AYFA 2UZRA 1L0XB 1EF5A 1NEKB 5D3XA 1KTKA 2BYTA 2PEAA 1I4PA 1MJDA 3AEAB 3TEYA 4WJQA 4O1NA 1ZPSA 1B9RA 2FUG1 4US8A 3JW0X 4JPSA 3NRZA 3Q2AC 2DHZA 1U5DA 1QOFA 1GC7A 1OEYA 4F7HA 2JWUA 1Z5SB 3ZKJC 4GOUA 2KFKB 1T0QC 5JHHA 2MLBA 3P63A 1J7AA 1AWEA 4LLGM 1YMHE 1ZXHA 3NUHB 2YS3A 4GLSC 4AJWA 3A8QA 4XX5A 3MHZA 1WXAA 2W2WA 3QWMA 2FUHB 2QHOA 4JWUC 2HJ1A 2LGIA 1ZSQA 4FJZA 4GZUA 3SFDB 2KX0A 4PYZA 1RLFA 2LUMA 2ZKMX 2FBWB 2Z59B 1DDWA 4C4VA 2R0DA 3KRWA 3TMPB 2WXQA 2BGFA 1P3QU 4PT5A 2OJRA 2ROZB 3X23A 1UH6A 2UWQA 3FVCA 3QWZB 2DZKA 4AWJA 2XEWA 1UWXA 1WY8A 4YT0B 1ZYIA 4WH4A 1H4RA 3RCZA 3TJPA 3KLSX 5JHBA 1L4ZB 2ONQA 2LGYA 4KHAA 1Y5OA 1R4NI 4OW0A 2IFSA 2CODA 2R2YA 3V6CB 3WAPA 1ZUD2 1QC6A 1V6EA 1V97A 3QCAA 2W9NA 1CK1A 3HVDA 4PS8A 3B0AA 1UBQA 5J17A 1P5TA 3PG7A 3DHHC 3L0WB 2L1AA 2CHXA 4M0WB 4RMAA 3RN9C 2OJWA 2QC8A 3ZXRA 3U12A 4KVGB 2R2QA 4NNJB 2GJYA 2DENB 2WXOA 1VZ6A 3ENEA 2R09A 2GB1A 5E6OA 2GBKA 2PKOA 5D3IB 2DHJA 4TKNA 1VCBA 2DZIA 2Y8FA 5EE0A 1SXTA 4I6LB 1FHXA 3WYFB 1XLOA 5I4DA 1WXSA 3WANA 1DOYA 4NPNA 5D3YA 3RZFA 3TO1A 2W3RA 4C80A 2YVCA 5JXVA 1AN8A 1RWSA 2ZW0A 1M7RA 1BWNA 3SNHA 1N61A 5FKAC 1I4XA 1PDXA 3MC0B 2K25A 4IM3A 1GPXA 2XNAC 2JRHA 2YT0A 2Y7BA 1TBEA 4W9LA 4DHZE 3A9KA 3A9JB 4CSQA 3ZNGC 3ZDMC 1C76A 3PO0A 3RNGC 2V4LA 1JMLA 4F7UP 1WWTA 1V81A 4KGSA 5IN7A 4M00A 3X0WA 1U2BA 4A6HA 3J9CA 1FGZA 1R7SA 4HJKA 3AU4A 2WP9B 5HHDG 4KX6B 2DLBA 1OMWA 1X1GA 3MP9A 4TMAB 3HHMA 3TVVA 1GAQB 4OZCA 3AV8A 2JWZA 2O6VB 1BAKA 1HQRD 1V89A 2EJ8A 3V05A 3RI7C 2JT4B 2X38A 2BWES 1AQCA 1TQZA 2XQNM 1TIFA 1E9MA 3NWAA 1RRPB 3APCA 2K3UA 3MPXA 5E6NA 3JSVB 4RGOS 5IRSA 1Q10A 3L13A 1C4PA 4WQOB 5EFXA 1F52A 1MPEA 2J0KA 3N9YC 3HSAA 4LNFA 4L6EA 5EDSA 1GNUA 2Z14A 4HATB 5KCVA 4WWNA 3HK0A 1C9FA 2KFJA 1E8ZA 2VRWB 2EKEC 1FRDA 3QHTA 1I2HA 4ANUA 2WXNA 4KSKC 2MDXA 3RNBC 4ANWA 2ASQA 1EUVB 1C78A 1E6EB 1GUAB 1H8CA 4CHJA 1GB1A 3ZRFA 2N0SB 5J2RA 1WJ4A 2DLWA 1NTVA 2J0JA 1N5WA 5JZEB 3ULCA 3A1QA 2KLCA 2N1WA 2MBQA 4HAWB 4B6HA 1PYWD 3QK0A 3FC4A 4G11A 1L0VB 1OGWA 2I38A 1SF0A 1RFKA 4HKQA 5FI1A 2MBBB 1SEBD 3PLUA 1YX5B 2GI9A 3RZWC 2WDVB 2NBUA 1NU2A 1ZP0B 4HAZB 3SUZA 1T0RC 2MP2A 1OTRB 1M4VA 1NYRA 2K8CA 3PTFC 2XN9C 3HUIA 3H8HA 4DQOC 4Z2MB 1A70A 4M8MA 2O6VD 1E7VA 4KKIA 2JYEA 4NAWA 1LO5D 1I4QA 2KN4A 4P7IA 2KTRB 3NOBA 3TUOA 2ZVOA 2WXGA 4KIKA 4XYCA 2KD0A 1P9DU 3V62A 5C2TB 1D3ZA 3ZNID 2LVQA 1EGXA 4GDKB 2PJHA 4A9AA 2RRFA 4HXDA 2KAJA 3UGBB 4ZRJA 2WXJA 4TSSA 4W9IA 1WSPA 2X18A 2DBYA 1Q0WB 4A6QA 2KJHB 2LGSA 3O96A 4PS7A 3UF8A 1VJKA 4PQ0A 2W55A 4EMOA 1KH0A 1JWUD 3UQBA 1C4CA 3VUYA 2Z8LA 2KMAA 1V80A 3CIKA 4GB9A 4H8SA 1V1PB 2L0TA 1C77A 1F9JA 1E7UA 1V9JA 3IVFA 3KWVA 5HG2A 1KZ7A 1YJJA 4HPPA 2KFKA 2KC1A 3PLVA 1D5ZC 2KKCA 3W1SC 5FK9C 3PSCA 4YTNB 3OHMB 5LXIB 5AUKA 4HAVB 4DIXA 2KWCA 2KXJA 2ZCBA 3DWGC 3RMKC 2LHDA 2INNE 5DH9B 1KLGD 4REZA 2LUEA 2YEPB 2NPTB 4KHOA 1R4MI 4DX8A 1L6UA 3A4SC 2KHWB 1SIJA 1N6ZA 2Z59A 2DHIA 5FI0A 1QLBB 3ZIMA 5DHFB 4QJ4B 3QAQA 4EFOA 2JRIB 5BMHA 3UIOB 2HJ8A 2BYVE 2E6XA 3DVNU 3AE1B 3AEBB 3DXCA 3IT4B 1R4NB 3I9V1 4MT7A 3ZUNA 4YL8A 1WGHA 3UZTA 3SV1A 2DYOA 1EU3A 3AECB 2YS1A 3HM3A 4IWPA 2ZPYA 2L1CA 2WXIA 1IBXA 4E71A 3AN1A 1FPYA 2YT1A 4KGRA 2PPHA 2JVCA 1U27A 2MRPA 1Y19B 2V76A 1SJHD 2Z0DB 3CMMB 3APFA 2OEDA 2NS5A 4MY6A 2LVPA 3GP7A 1WGRA 2JP2A 3AEDB 4M0WA 2KQSA 3BJIA 2YLMA 1YQBA 4IWQA 2BTEA 4DHJB 5CTRC 5KHQA 5IA7A 2RNRB 2Z13A 2WYQA 3ZO5B 2RDGA 1U5EA 3P42A 4W9CA 1LQBA 4IOIE 2LI5A 4GOCA 1IRSA 4IW0A 4DDGD 1V88A 1UBIA 3ZXVA 2KDMA 3MHSD 3KYDD 2MSED 3WIMA 3A58A 4ZHOA 2LHEA 2KMMA 4IAPA 4N59A 3ZW3A 1YQ3B 4JX1C 2JYTA 3ALBA 1WR6E 4MT5A 2N9KA 1SE9A 1UNSA 5I2SA 4B0EA 1OQYA 4CQNA 3DOWA 4S0RA 3PP2A 3A9JA 3DBLI 2MX2A 3VR9B 4A5KA 2A5UA 4I6NB 4PS3A 2N0YA 4HHVA 1N60A 3LB8C 1XCQL 4ZRKA 3AE6B 2LOZA 2NVUI 2D3AA 2RUKB 4EZKA 2KQ7A 4II3B 2JY6A 1DDMA 1V5UA 3AULA 1MI0A 1A5RA 2RLOA 1QZEA 3Q3NC 1QF6A 2G9HD 3ZLZA 5IP4D 1IGCA 2AQ3B 2JZ3B 4WJ7A 3ML9A 2O6VA 3H7SA 1WJ6A 1T6BX 1FEHA 1XLNA 5JP4A 2J52A 3W5UB 2D9YA 1AARA 3U7ZA 1XCTL 3JYUA 3T9LA 1J7BA 1MK7B 1QQGA 3D8DA 3GOEA 3JSVA 2YEPF 3ZYYX 5HE3A 1KRHA 3DBHI 1P3RA 2WXKA 2QIEB 5KQ1A 3PT2B 3P6AA 4TQ0A 2J42A 1NI3A 3B2GA 2HTHB 5FR6A 2IGHA 4XC2A 5EE3A 3DQVA 1Y56A 3E9SA 1XKEA 4LJPB 1WGKA 4DHJD 2GBMA 1TS5A 3PV1A 3B08A 1NYQA 4DX90 2HTME 3H6NA 5HFYA 4C00A 3TEZA 2EMSA 3A98B 3D8FA 4MH0E 4KKJA 3PZ8A 1UGJA 3FSSA 3AEFB 4GGQA 2MKRA 3PZDA 1HA5A 2WNMA 4J6IA 4B6WA 5GXGB 4B95A 3FILB 1IP9A 4XGAB 3BIID 3SD5A 3K9PB 1BTNA 2I1KA 1Q1OA 2Y3AA 4KV2A 2NZ8B 1PLSA 1UPQA 2GRIA 3N3KB 4RNAA 2X8XX 5CLQB 4HSIA 1HEZE 2PVOD 3ODWA 1U5FA 3BVGA 2KQ4X 3T06A 4G50A 1MHHE 3EC8A 1MIXA 2MW5A 2E3TA 3AI5A 1V1OA 2D07B 4K17A 1WG7A 4PNKA 2I5CA 1HTOA 4GSWA 2IBIB 3Q8FA 1SHCA 1ROEA 3RCPA 2COFA 2QJLA 5IAAC 2NBVB 4HROA 1V2YA 1WGDA 2GBRA 2MFQA 2MBOA 3M3JA 4DDID 1N3HA 3PRZA 1UNQA 2KTRA 4DXFA 2GS0A 4UDUC 2BS4B 4ZDVA 3AH7A 2BS3B 2C60A 1FNVA 1JROA 3Q14C 4F7ZA 3PREA 2K49A 3FEHA 3R7RA 1U29A 2DFKA 3RYTA 4GDKA 4HRSA 3W2DA 4FHKA 4B9KA 4R3DA 1NBFC 3HVZA 1TJ6A 5D27A 1IGDA 4IKGA 1WFYA 4BFRA 3KSYA 4XWWA 3RT3B 2FE8A 1DGJA 2JQRB 3RNAC 4WJOA 4K1RB 1XF5L 3L54A 2LFIA 2KIGA 1FM0D 3IBEA 2PIAA 1S3SG 1V1PA 1PMSA 4AP4C 1FOEA 1ZKHA 1J0WA 1EVHA 3Q8BA 4MELA 1FGYA 3NVYA 4A6KA 3BVMA 1YOVB 5DPWA 3NVWA 2V9HA 2ACZB 1R4MB 4HDOA 1WMHA 5E6JA 2CR5A 5J3QA 2BQQA 1IBXB 4HLEA 4F1SA 2NPTA 3U7DA 2V1YA 2EC1A 4OZAA 3VVWB 2RGNB 3KUCB 1E8WA 1XO3A 3R3MA 2LULA 4C7ZA 2AL6A 3ZJTA 4BKTA 3QX1A 1MVKA 3VAWA 1GJZA 1XT9B 4LDTB 1JCKB 3NVVA 2H88B 1UD7A 4M8NA 1TS3A 1WXQA 1UF0A 1CZPA 4HEA1 1M94A 3HRDD 3DXDA 4GNKB 3TW1A 3NG0A 3PVLA 1JWBD 5C1ZA 1GG3A 5JLJB 1VDVA 3N1ZC 2J7QB 2JXXA 1Z2MA 2SEBD 2KO3A 5BYRA 2UVMA 2N7DA 3T8MA 1I42A 2YS5A 3R2TA 1FXAA 2WXHA 3N32A 1WI1A 3AEEB 3UQAA 3TEWA 1E10A 3M95A 5DIFB 3ZTCA 4RGMA 2PZ1A 2ADZA 4USAA 3ZGZA 1WR1A 2IPKD 4CO7A 2WDTB 2IO2B 4HB0B 2LJ5A 5D3DA 1ACCA 2MHJA 2JZZA 1K5GB 2KDBA 4M02A 4C7YA 2MQJA 3BK1A 1WM3A 1FCCC 1I4HA 2QEJC 3M1IB 3A4RA 4KHBB 3B9JA 3FKYA 2MJEA 1I7AA 4ACFA 5HE1A 3NZ3A 2MJ3A 4K3CA 4ZRQA 4MSMB 1QOGA 2LRWA 5CHFA 2WU2B 3ODOA 3GE3C 1WX7A 4LNNA 2EMTA 5C5BB 4YXDB 5D94A 2D9VA 3Q6BA 1IYFA 4BVUC 1JALA 2G35A 3OWEB 2M56B 4TYZA 3DBLB 1SE2A 2W2XC 2LYDA 2C7MB 4AQ7A 5D7GA 2BYEA 2DHKA 4J3OD 4IC7B 1ZW7A 2P0DA 2HDEA 2M0AA 3OJ3A 4FXCA 2RPVA 2GBNA 3BVZA 4RM9A 2ZNVC 1WX8A 2N9EB 5GMVA 1FHOA 2IZVB 1GC6A 4TV3A 4LDTD 2CHWA 4EOYA 1X05A 2DA0A 2GLSA 1GB4A 2KWUB 1LGRA 2FIDA 3GYOA 2WX1A 3VUWA 4OSNA 1F1HA 1V5TA 3VTVA 1PQSA 3AMZA 3DBHB 2FCSA 3AE5B 3T3OA 2JPHA 4KAXB 2H89B 2IGGA 2Z0EB 1J7CA 4ITKA 2V3SA 4RGNA 2DX1A 3N20C 4FJVB 4MJSB 2AQ2B 3EGRA 2D9ZA 4JE3B 5HKHA 3NWDA 2DYNA 5DHAB 4HWIB 3SYXA 1FFVA 4OT1A 2HTHA 4GN1A 2QILA 2M38A 4QJ5B 3NJTA 3V6EB 2EKIA 1CQVA 3I63C 2LWPA 3EFCA 4IG7B 4FJYA 3B2FA 5AUIA 1UNRA 2QKMA 3VXWA 3R66C 3D8EA 1WE6A 1PUTA 4W9KA 4YSYB 3SO6A 4FULA 2JF5A 2DX5B 3O13A 2UYZB 3Q3FA 2L8JA 2ZCCA 4IM0A 3L08A 1KOTA 4GU2A 3ZRCA 1TJEA 5CX3A 1E5WA 3U52E 2KUPA 1XODA 2FCMA 3L16A 4OVUA 4ZRIA 2H7EA 3FILA 2BPSA 4HKZE 3SFEB 3MJ5A 1V5PA 4Z2NA 1TZOA 2IGDA 3APDA 2DYBA 4DWFA 3VR8B 1TTNA 1ISNA 2WX0A 1EU4A 5DPSA 2JZPA 3TFMA 2L7RA 2RDHA 4HDQA 1TZ1A 1RRBA 2IJ0A 1MI1A 4JLCA 4F8CB 2KX3A 2NBVA 1LFDA 3VFKA 1E0ZA 3KYCD 2DN6A 4HPMB 2BW2A 1WIAA 2M0XA 4YTMB 2Z0QA 2H7DA 4AOFA 2IDYA 1K8RB 1TT5B 2IO0B 3DBRI 4P1BC 3AE2B 2GOWA 2CHZA 3ZTDA 3N7CA 2COAA 2GUMA 3I5JC 1ZC3B 1C3TA 1BMLC 1C4AA 2VH2A 1WMHB 2CY5A 1D5XC 2FIFA 1OQRA 4B0MA 5C3JB 1JRUA 1UUPA 5IKCM 3CIRB 2RSGA 1I7HA 1MK9B 2KC2A 3OAWA 4WIPA 4K3BA 3DBSA 3HIZA 4MM3B 2JU6X 4ZYSA 3W1SA 2KVZA 2G4SA 2FJUB 3L4PA 5CLLB 1RJ2A 4TQ1A 2BVCA 2OOBB 2XBBC 1LM8B 1SE4A 1IUEA 3TIXA 1BTKA 2WQYB 2KK8A 1L2NA 3OLMD 1QKZA 2KNBA 1TKGA 4WJNA 3TL5A 4BBNF 4A90A 1M7EA 3PS6A 4ASWC 2IO3B 3AJ4A 5MPOA 3I3TB 1ESFA 3BY4B 3DCXA 3TCAA 1VZ8A 4WAAA 1CMXB 2CJOA 1T77A 3S2AA 4QXAB 1FXIA 2HD5B 3TBLD 3A8PA 1D4BA 4LNIA 2AEHA 1L5PA 1ZC4B 3MJWA 1KLVA 1WZ0A 2CS4A 3CSFA 2MWSB 2WLBA 3IT6B 2JSVX 2K2JA 2PTLA 2DYQA 1ZDVA 2D11A 2FJLA 2INCC 4K2OA 3Q8EA 1XD4A 4C56C 3V61A 1MG8A 2P0HA 1UEFA 3M63B 2RD0A 1KJTA 1XLQA 4NZLB 4RF0A 4MDKE 2CU1A 3KW5B 2CY4A 2D3GA 3PPAA 4NJ7A 3VH4B 3KWLA 1WGUA 1JRPA 4KGTA 4P1CC 2K2UA 2AX5A 4MGZE 1EWCA 2MBHA 1SIFA 4WAFA 2N23A 1TKEA 2JXTA 2SAKA 1UELA 3EA6A 1PFJA 1QQRA 4URKA 4XE0A 5CHWA 3ODXA 3DVNV 1E7PB 3BK2A 4ZRPA 2RGFA 4FA6A 4WVFB 1WXMA 3PRMB 4BAXA 3P7ZA 4YONA 2Z0PA 3NW8A 2W3SA 4HCNB 3V3XA 1NDDA 2D9WA 4EZLA 2JUOA 3RD2A 4KHBA 4YSZB 5C79A 1D5MC 1JW9D 5TR5A 2D4QA 1X1MA 1DOIA 1XD3B 4MEMA 2DNFA 4KZCA 4D2KA 3AEGB 4JIOU 2NBWB 1J8CA 2IY0B 2V0GA 2OQBA 3B77A 1NENB 4ARIA 4Y94A 3RNEC 5L81A 5C5BA 3WA0A 3FAHA 2LOXA 1AW7A 4XWXA 1DYNA 1F2RC 1V5OA 4A6FB 5HE2A 1OY2A 3ZNHB 4S17A 2QKLA 3DVGX 3CF6E 1KF6B 2REXA 4ZOHC 2WU5B 3P2BA 3BWUD 1I4GA 4W9JA 3QQ8B 1VR9A 4NY0A 2DWQA 5TSSA 1D6EC 3NVZA 5AZHA 1JWAD 5EE9A 2P8VA 2UU7A 2JX5A 1ZGUB 4K7UA 3PGEA 3PRPB 4N58A 4GDLB 5M4YB 4P6VF 1KLUD 1MFWA 1Q67A 3ML8A
chains in the Genus database with same CATH topology
4IUMB 3LDZE 3WAOA 3ULBA 3PVUA 2DAFA 1T0YA 4BBNC 5D3WA 3MDBC 5DI9B 2LZ6A 3W1YA 2KTFA 4HB2B 4MJSA 1V5MA 1WI0A 1ZVRA 2LGXA 1P6SA 4KSLC 4OVVA 3LJ3A 3O65B 5L95C 2LVOA 3PSEB 2KWVB 2Y5BB 3AXCA 2GMIC 3VOQA 2DZMA 3C0RB 1H10A 2OTXA 2DX5A 2LD9A 4FADA 1NTYA 3PHXB 2I1JA 2WWZA 1VD2A 2KDEB 1Z87A 2AYOB 1ZM0A 3ML4A 2J0MA 3F0WA 3CSTA 2IYBA 1E8XA 2L76A 3KUDB 3V60A 3NS8A 2Q13A 3VDZA 2COCA 1UPRA 2MA9B 3VIAA 4A3PA 4DK5A 5DPTA 3OJ4B 2UZSA 4ICVA 1WXVA 4BBKA 1WGQA 1WE7A 2K39A 4HB4B 3QBVB 4K2PA 1XCGA 3KUZA 2DKPA 1XQQA 3UINB 1I35A 3IFWB 3L17A 5LXHA 2XK5B 2Y8GA 1U5GA 2YRYA 4WWPA 1FXTB 2VKIA 5C6RA 3DPDA 4AJYB 1XX0A 5BO4B 2D2QA 4E74A 2FCQA 4GPTB 4MK0A 1P98A 3U8ZA 2C7HA 2BF8B 2KLGA 4GMXB 3PVWA 5AEKB 4KZ0A 2KOXA 2K8HA 3NY5A 5E6PA 4MM3A 3OANA 1MPHA 3NSUA 5DCNA 2GCJA 1E90A 1RAXA 3R7QA 4ANXA 2CRFA 4BOSC 1K5DB 2N9XA 2A4ZA 3KRXA 3RULA 2I5FA 2LXCA 1WH3A 2C5LC 3PEGA 1HE8A 3EHVA 5JHGA 3G9WA 4A3OA 1FB8A 3K9OB 2KJ6A 5LONB 2KJRA 3BINA 2BCJA 5LLIA 2LKOA 2BWFA 5GOWB 2DYMA 3NZUA 2NCNA 2FAZA 1YX6B 3DDCB 4JGHB 4MSQB 1FHWA 4E3CA 4LJOB 3H9DA 3EFUA 3SU8X 4FBJB 3H7PB 1W1HA 1KM7A 5J3TA 2ELAA 4JQWC 2O2VB 2VSZA 2KDFB 4GIVA 4ZYNA 3QC8B 1B55A 4I6PA 2KZRA 5DPRA 4DBGA 4EZJA 3IHPC 4FN2A 3SDLC 2M14A 1MAIA 5G55A 3VH3B 4HAUB 1YIWA 3H1UA 1LB1A 1WVHA 1TGZB 2DKQA 2D9XA 4D0NB 5KHOA 3NZSA 1TXDA 3GZNI 2KGXB 2IY1B 2NR2A 3HM6X 1YD8U 5L83A 1MIZB 2N7EA 2N1VA 2L05A 3DVGY 2M4NA 5D2MB 4W9FA 2LG1A 4A6FA 3IG3A 2K6DB 1IPGA 1X86A 5C23A 1WJMA 1WRDB 3ZNZB 2D10A 1UNPA 3KVFB 4A20A 4HAYB 4DHZB 4AUQC 2VRRB 3VTWA 5JHAA 4BOZB 4BKSD 4GXBA 2GBJA 4K81A 2L00B 5AZGA 1DDVA 4NJ6A 1V61A 1J19A 2BKRB 1S1QB 1WZ3A 3CXBB 4F7GA 1NI2A 1V49A 2G45B 4GDLA 4G0NB 2FCNA 4W9GA 2RPQA 5D3VA 4HPLB 3B1LX 3QA8A 5KQ4A 5JH5C 1J0GA 2BKFA 4DBBA 1L7YA 3U30A 2LXAA 2L2IA 1WF9A 1E8YA 2PE6B 1W1GA 2ROVA 2BYFA 1LW3A 3WALA 2KANA 3ZVVA 3KY9A 2N4FA 4PYUA 2G3QB 2AL3A 1WGGA 1FAOA 1WM2A 1MKEA 1WJNA 4MGKE 3F5RA 2MCNB 2ZVNA 1XR0B 2RSUA 1OQNA 3L10B 3VTUA 2PE9A 4K7WA 4FLHA 4KDIC 2RVBB 1V86A 1WJ1A 3HW2B 1C1YB 2C7NB 4WWOA 3JVZX 3SHQA 4NQKE 4RM8A 2L3ZA 3VQIA 2ZZPB 2LRUA 1WYWB 3V5WA 3ONSA 4ANVA 2KN5A 2DTCA 1KI1B 4G3XB 1SGHA 2XK5A 4MGIE 2Z0OA 2MWNB 2G4DB 1X11A 4W9DA 1W1DA 2RR9A 1EO6A 4CHMA 4CYEA 2NMBA 3EECA 2K8BA 5C16A 4NSWA 3QJZA 2ELBA 4HAXB 2M17A 3MTNB 2AWTA 1EF1A 2K1FA 3QARA 5G2NA 2YF0A 1EAZA 3KZ1A 2KVRA 2R2OA 4IM2A 3D32A 2MBEA 1Q5WB 4EUTA 4EEWA 4HK2A 2KDIA 2K00A 4K7SA 4ICUA 5CHVC 2IYDB 3A9KB 3WAMA 5AZFA 4EKUA 4KDLB 4WSFA 4BKSA 2GCLA 1YJ1A 3RUIB 1U4AA 1UGMA 3ZDTA 3ZVRA 1BT0A 4N9F4 1KZGA 2CKHB 4LCDE 3VUXA 2J59M 3H7PA 3N30A 2E2XA 3AU5A 4DXAB 2B3AA 2L0FA 2O2VA 2LGDA 1WX9A 4CHKA 4C0AA 1RFAA 2LASA 2DAJA 1DBHA 3DCGA 2ZNVB 4NQLB 2FNJB 4HB3B 2KCJA 3FM8C 1LXDA 3HQCA 2ZJDA 2N9PC 2IO1B 4MGYE 2KMCA 2M8SA 2HE7A 1Y8RC 5D6JB 3ECIA 4WJPA 1OEYJ 4FHJA 2ZPNA 4HVBA 1X1FA 2DZJA 4GMVA 3A1QB 3M62B 1P1AA 3QIJA 1DROA 1G6JA 1P0RA 3NHEB 4JL9A 3PHWB 2P0FA 3VHTC 2YSZA 3A33B 3Q3JA 5J18A 5LOPB 2MP2B 4XZ4A 4BKGA 3KH0A 2M1MA 3UIPB 4X57B 2C9WB 4HCPB 4W9HA 5HE0A 4EJNA 2K6QA 5J3YA 2W2XD 4TUUA 4IWOA 4NAWB 3LJUX 4II2B 2ZEQA 3GYPA 4KIKB 3DXEA 4IFSA 4W9EA 2CAYA 1WJUA 1WGYA 1UZXB 4IOYX 2UZRA 1EF5A 5D3XA 2PEAA 4WJQA 3JW0X 2DHZA 1U5DA 1GC7A 1OEYA 4F7HA 1Z5SB 3ZKJC 2KFKB 5JHHA 2MLBA 1AWEA 2YS3A 4AJWA 3A8QA 4XX5A 1WXAA 2W2WA 3QWMA 2FUHB 2QHOA 1ZSQA 4FJZA 4GZUA 2KX0A 4PYZA 1RLFA 2Z59B 1DDWA 2R0DA 3KRWA 3TMPB 2BGFA 1P3QU 2OJRA 2ROZB 3X23A 1UH6A 2UWQA 3QWZB 2DZKA 4AWJA 2XEWA 1WY8A 1H4RA 3RCZA 3TJPA 5JHBA 2LGYA 4KHAA 1Y5OA 1R4NI 2IFSA 2CODA 3V6CB 3WAPA 1QC6A 1V6EA 3QCAA 2W9NA 4PS8A 3B0AA 1UBQA 5J17A 1P5TA 3PG7A 3L0WB 2CHXA 4M0WB 4RMAA 4KVGB 2R2QA 4NNJB 2GJYA 2DENB 3ENEA 2R09A 5E6OA 2GBKA 2DHJA 4TKNA 1VCBA 2DZIA 2Y8FA 4I6LB 1FHXA 3WYFB 3WANA 1WXSA 4NPNA 5D3YA 3RZFA 3TO1A 2YVCA 1M7RA 1BWNA 3SNHA 2K25A 4IM3A 2JRHA 2YT0A 2Y7BA 1TBEA 4W9LA 4DHZE 3A9KA 3A9JB 3ZNGC 3ZDMC 2V4LA 4F7UP 1V81A 3X0WA 1U2BA 4A6HA 1FGZA 4HJKA 3AU4A 1OMWA 1X1GA 3HHMA 3TVVA 2JWZA 2O6VB 1BAKA 1V89A 2EJ8A 2JT4B 2BWES 1AQCA 1TQZA 2XQNM 1RRPB 3APCA 3MPXA 5E6NA 3JSVB 3L13A 4WQOB 5EFXA 2J0KA 4L6EA 5EDSA 1GNUA 4HATB 5KCVA 4WWNA 3HK0A 2KFJA 1E8ZA 2VRWB 2EKEC 3QHTA 1I2HA 4ANUA 4KSKC 2MDXA 4ANWA 2ASQA 1EUVB 1H8CA 1GUAB 4CHJA 3ZRFA 5J2RA 1WJ4A 2DLWA 1NTVA 2J0JA 5JZEB 3ULCA 3A1QA 2KLCA 2N1WA 2MBQA 4HAWB 4B6HA 3QK0A 4G11A 1OGWA 5FI1A 2MBBB 3PLUA 1YX5B 3RZWC 2NBUA 1NU2A 4HAZB 3SUZA 2MP2A 1OTRB 2K8CA 3PTFC 4Z2MB 4M8MA 2O6VD 1E7VA 4NAWA 4P7IA 2KTRB 3NOBA 2ZVOA 4KIKA 2KD0A 1P9DU 3V62A 1D3ZA 3ZNID 2LVQA 1EGXA 4GDKB 2PJHA 3UGBB 4HXDA 4ZRJA 4W9IA 2X18A 1Q0WB 2KJHB 3O96A 4PS7A 3UF8A 4PQ0A 4EMOA 3UQBA 3VUYA 2KMAA 1V80A 3CIKA 4GB9A 4H8SA 2L0TA 1F9JA 1E7UA 1V9JA 3IVFA 1KZ7A 2KFKA 2KC1A 3PLVA 2KKCA 3W1SC 3PSCA 5LXIB 4HAVB 2KWCA 2KXJA 2ZCBA 5DH9B 2LUEA 2NPTB 4KHOA 1R4MI 4DX8A 3A4SC 2KHWB 2DHIA 5FI0A 3ZIMA 5DHFB 3QAQA 4EFOA 2JRIB 3UIOB 2HJ8A 2BYVE 3DVNU 3DXCA 4MT7A 3ZUNA 4YL8A 1WGHA 3UZTA 3SV1A 2DYOA 2YS1A 3HM3A 4IWPA 2ZPYA 2L1CA 4E71A 2YT1A 2PPHA 2JVCA 1U27A 2MRPA 1Y19B 2V76A 2Z0DB 3CMMB 3APFA 2NS5A 4MY6A 2LVPA 1WGRA 2JP2A 2KQSA 3BJIA 2YLMA 1YQBA 4IWQA 4DHJB 5CTRC 5KHQA 5IA7A 2RNRB 2WYQA 3ZO5B 1U5EA 4W9CA 1LQBA 2LI5A 4GOCA 1IRSA 4IW0A 4DDGD 1V88A 1UBIA 3MHSD 3KYDD 2MSED 3WIMA 4IAPA 3ZW3A 3ALBA 1WR6E 1SE9A 1OQYA 3DOWA 3PP2A 3A9JA 3DBLI 2MX2A 4A5KA 2A5UA 4I6NB 4PS3A 2N0YA 4HHVA 4ZRKA 2LOZA 2NVUI 2RUKB 4EZKA 2KQ7A 4II3B 2JY6A 1DDMA 1V5UA 3AULA 1A5RA 2RLOA 1QZEA 3ZLZA 2JZ3B 4WJ7A 3ML9A 2O6VA 3H7SA 1WJ6A 5JP4A 2D9YA 1AARA 3JYUA 3T9LA 1MK7B 1QQGA 3D8DA 3GOEA 3JSVA 5HE3A 3DBHI 1P3RA 5KQ1A 3PT2B 3P6AA 4TQ0A 2HTHB 5FR6A 4XC2A 3DQVA 1XKEA 4LJPB 4DHJD 2GBMA 3PV1A 3B08A 4DX90 3H6NA 2EMSA 3A98B 3D8FA 4MH0E 3FSSA 4GGQA 2MKRA 3PZDA 4J6IA 4B6WA 4B95A 1IP9A 3SD5A 3K9PB 1BTNA 2I1KA 1Q1OA 4KV2A 2NZ8B 1PLSA 1UPQA 3N3KB 5CLQB 3ODWA 1U5FA 3T06A 4G50A 3EC8A 1MIXA 2MW5A 3AI5A 2D07B 4K17A 1WG7A 4PNKA 2I5CA 4GSWA 2IBIB 1SHCA 3RCPA 2COFA 5IAAC 2NBVB 1V2YA 1WGDA 2GBRA 2MFQA 2MBOA 3M3JA 4DDID 1N3HA 3PRZA 1UNQA 2KTRA 2GS0A 4ZDVA 2C60A 4F7ZA 3PREA 3FEHA 3R7RA 1U29A 2DFKA 3RYTA 4GDKA 4FHKA 4B9KA 1NBFC 1TJ6A 5D27A 1WFYA 4BFRA 3KSYA 3RT3B 4WJOA 4K1RB 3L54A 3IBEA 1S3SG 1PMSA 4AP4C 1FOEA 1ZKHA 1J0WA 1EVHA 4MELA 1FGYA 4A6KA 5DPWA 4HDOA 1WMHA 2CR5A 5J3QA 4HLEA 4F1SA 2NPTA 3U7DA 2V1YA 2EC1A 3VVWB 2RGNB 3KUCB 1E8WA 3R3MA 2LULA 2AL6A 4BKTA 3QX1A 3VAWA 1GJZA 1XT9B 4LDTB 1UD7A 4M8NA 1M94A 3DXDA 3TW1A 3PVLA 5C1ZA 1GG3A 5JLJB 2J7QB 2JXXA 1Z2MA 2KO3A 2UVMA 2N7DA 3T8MA 1I42A 2YS5A 3N32A 1WI1A 3UQAA 3M95A 5DIFB 3ZTCA 2PZ1A 2ADZA 1WR1A 4CO7A 2WDTB 2IO2B 4HB0B 2LJ5A 2JZZA 1K5GB 2KDBA 2MQJA 1WM3A 3M1IB 3A4RA 4KHBB 1I7AA 5HE1A 4MSMB 2LRWA 5CHFA 3ODOA 1WX7A 2EMTA 5C5BB 5D94A 2D9VA 1IYFA 4BVUC 2G35A 4TYZA 2W2XC 2LYDA 2C7MB 5D7GA 2BYEA 2DHKA 4IC7B 1ZW7A 2P0DA 3OJ3A 2GBNA 4RM9A 2ZNVC 1WX8A 2N9EB 5GMVA 1FHOA 2IZVB 1GC6A 4TV3A 4LDTD 2CHWA 4EOYA 1X05A 2DA0A 2KWUB 2FIDA 3GYOA 2WX1A 3VUWA 1V5TA 3VTVA 1PQSA 2FCSA 2JPHA 4KAXB 2Z0EB 2V3SA 2DX1A 4FJVB 4MJSB 5HKHA 2D9ZA 2DYNA 5DHAB 4HWIB 3SYXA 2HTHA 4GN1A 2M38A 3V6EB 2LWPA 4IG7B 4FJYA 1UNRA 2QKMA 3VXWA 3R66C 3D8EA 1WE6A 4W9KA 3SO6A 4FULA 2JF5A 2DX5B 2UYZB 3Q3FA 2L8JA 2ZCCA 4IM0A 3L08A 1KOTA 4GU2A 3ZRCA 5CX3A 1E5WA 2KUPA 1XODA 2FCMA 3L16A 4OVUA 4ZRIA 2H7EA 2BPSA 1V5PA 4Z2NA 3APDA 2DYBA 4DWFA 1TTNA 1ISNA 2WX0A 5DPSA 3TFMA 2L7RA 4HDQA 1TZ1A 1RRBA 4JLCA 4F8CB 2KX3A 1LFDA 3VFKA 3KYCD 2DN6A 4HPMB 1WIAA 2M0XA 2Z0QA 2H7DA 4AOFA 1K8RB 2IO0B 3DBRI 2GOWA 2CHZA 3ZTDA 3N7CA 2COAA 1ZC3B 1C3TA 1WMHB 2CY5A 2FIFA 1JRUA 2RSGA 1MK9B 2KC2A 3OAWA 3DBSA 3HIZA 3W1SA 2G4SA 5CLLB 1RJ2A 4TQ1A 2OOBB 2XBBC 1LM8B 3TIXA 1BTKA 2KK8A 1L2NA 3OLMD 2KNBA 3TL5A 4WJNA 4BBNF 1M7EA 3PS6A 4ASWC 2IO3B 3AJ4A 3I3TB 3BY4B 3TCAA 4WAAA 1CMXB 3S2AA 2HD5B 3TBLD 3A8PA 2AEHA 1ZC4B 3MJWA 1KLVA 1WZ0A 2CS4A 3CSFA 2MWSB 2K2JA 2DYQA 2D11A 2FJLA 4K2OA 1XD4A 3V61A 1MG8A 2P0HA 1UEFA 3M63B 2RD0A 1KJTA 4MDKE 2CU1A 3KW5B 2CY4A 2D3GA 3PPAA 4NJ7A 3VH4B 1WGUA 2K2UA 4MGZE 1SIFA 2MBHA 2N23A 1UELA 1PFJA 4URKA 5CHWA 3ODXA 3DVNV 2RGFA 4FA6A 4WVFB 1WXMA 3PRMB 3P7ZA 4YONA 2Z0PA 4HCNB 4EZLA 1NDDA 2D9WA 2JUOA 3RD2A 5C79A 5TR5A 2D4QA 1X1MA 1XD3B 4MEMA 4KZCA 4JIOU 2NBWB 1J8CA 2IY0B 2OQBA 4Y94A 5L81A 5C5BA 3WA0A 2LOXA 4XWXA 1DYNA 1V5OA 4A6FB 5HE2A 1OY2A 3ZNHB 2QKLA 3DVGX 3CF6E 2REXA 3P2BA 4W9JA 3QQ8B 4NY0A 5AZHA 2P8VA 1ZGUB 4K7UA 3PGEA 3PRPB 4GDLB 1Q67A 3ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUM B;  3LDZ E;  3WAO A;  3ULB A;  3PVU A;  2DAF A;  1T0Y A;  4BBN C;  5D3W A;  3MDB C;  5DI9 B;  2LZ6 A;  3W1Y A;  2KTF A;  4HB2 B;  4MJS A;  1V5M A;  1WI0 A;  1ZVR A;  2LGX A;  1P6S A;  4KSL C;  4OVV A;  3LJ3 A;  3O65 B;  5L95 C;  2LVO A;  3PSE B;  2KWV B;  2Y5B B;  3AXC A;  2GMI C;  3VOQ A;  2DZM A;  3C0R B;  1H10 A;  2OTX A;  2DX5 A;  2LD9 A;  4FAD A;  1NTY A;  3PHX B;  2I1J A;  2WWZ A;  1VD2 A;  2KDE B;  1Z87 A;  2AYO B;  1ZM0 A;  3ML4 A;  2J0M A;  3F0W A;  3CST A;  2IYB A;  1E8X A;  2L76 A;  3KUD B;  3V60 A;  3NS8 A;  2Q13 A;  3VDZ A;  2COC A;  1UPR A;  2MA9 B;  3VIA A;  4A3P A;  4DK5 A;  5DPT A;  3OJ4 B;  2UZS A;  4ICV A;  1WXV A;  4BBK A;  1WGQ A;  1WE7 A;  2K39 A;  4HB4 B;  3QBV B;  4K2P A;  1XCG A;  3KUZ A;  2DKP A;  1XQQ A;  3UIN B;  1I35 A;  3IFW B;  3L17 A;  5LXH A;  2XK5 B;  2Y8G A;  1U5G A;  2YRY A;  4WWP A;  1FXT B;  2VKI A;  5C6R A;  3DPD A;  4AJY B;  1XX0 A;  5BO4 B;  2D2Q A;  4E74 A;  2FCQ A;  4GPT B;  4MK0 A;  1P98 A;  3U8Z A;  2C7H A;  2BF8 B;  2KLG A;  4GMX B;  3PVW A;  5AEK B;  4KZ0 A;  2KOX A;  2K8H A;  3NY5 A;  5E6P A;  4MM3 A;  3OAN A;  1MPH A;  3NSU A;  5DCN A;  2GCJ A;  1E90 A;  1RAX A;  3R7Q A;  4ANX A;  2CRF A;  4BOS C;  1K5D B;  2N9X A;  2A4Z A;  3KRX A;  3RUL A;  2I5F A;  2LXC A;  1WH3 A;  2C5L C;  3PEG A;  1HE8 A;  3EHV A;  5JHG A;  3G9W A;  4A3O A;  1FB8 A;  3K9O B;  2KJ6 A;  5LON B;  2KJR A;  3BIN A;  2BCJ A;  5LLI A;  2LKO A;  2BWF A;  5GOW B;  2DYM A;  3NZU A;  2NCN A;  2FAZ A;  1YX6 B;  3DDC B;  4JGH B;  4MSQ B;  1FHW A;  4E3C A;  4LJO B;  3H9D A;  3EFU A;  3SU8 X;  4FBJ B;  3H7P B;  1W1H A;  1KM7 A;  5J3T A;  2ELA A;  4JQW C;  2O2V B;  2VSZ A;  2KDF B;  4GIV A;  4ZYN A;  3QC8 B;  1B55 A;  4I6P A;  2KZR A;  5DPR A;  4DBG A;  4EZJ A;  3IHP C;  4FN2 A;  3SDL C;  2M14 A;  1MAI A;  5G55 A;  3VH3 B;  4HAU B;  1YIW A;  3H1U A;  1LB1 A;  1WVH A;  1TGZ B;  2DKQ A;  2D9X A;  4D0N B;  5KHO A;  3NZS A;  1TXD A;  3GZN I;  2KGX B;  2IY1 B;  2NR2 A;  3HM6 X;  1YD8 U;  5L83 A;  1MIZ B;  2N7E A;  2N1V A;  2L05 A;  3DVG Y;  2M4N A;  5D2M B;  4W9F A;  2LG1 A;  4A6F A;  3IG3 A;  2K6D B;  1IPG A;  1X86 A;  5C23 A;  1WJM A;  1WRD B;  3ZNZ B;  2D10 A;  1UNP A;  3KVF B;  4A20 A;  4HAY B;  4DHZ B;  4AUQ C;  2VRR B;  3VTW A;  5JHA A;  4BOZ B;  4BKS D;  4GXB A;  2GBJ A;  4K81 A;  2L00 B;  5AZG A;  1DDV A;  4NJ6 A;  1V61 A;  1J19 A;  2BKR B;  1S1Q B;  1WZ3 A;  3CXB B;  4F7G A;  1NI2 A;  1V49 A;  2G45 B;  4GDL A;  4G0N B;  2FCN A;  4W9G A;  2RPQ A;  5D3V A;  4HPL B;  3B1L X;  3QA8 A;  5KQ4 A;  5JH5 C;  1J0G A;  2BKF A;  4DBB A;  1L7Y A;  3U30 A;  2LXA A;  2L2I A;  1WF9 A;  1E8Y A;  2PE6 B;  1W1G A;  2ROV A;  2BYF A;  1LW3 A;  3WAL A;  2KAN A;  3ZVV A;  3KY9 A;  2N4F A;  4PYU A;  2G3Q B;  2AL3 A;  1WGG A;  1FAO A;  1WM2 A;  1MKE A;  1WJN A;  4MGK E;  3F5R A;  2MCN B;  2ZVN A;  1XR0 B;  2RSU A;  1OQN A;  3L10 B;  3VTU A;  2PE9 A;  4K7W A;  4FLH A;  4KDI C;  2RVB B;  1V86 A;  1WJ1 A;  3HW2 B;  1C1Y B;  2C7N B;  4WWO A;  3JVZ X;  3SHQ A;  4NQK E;  4RM8 A;  2L3Z A;  3VQI A;  2ZZP B;  2LRU A;  1WYW B;  3V5W A;  3ONS A;  4ANV A;  2KN5 A;  2DTC A;  1KI1 B;  4G3X B;  1SGH A;  2XK5 A;  4MGI E;  2Z0O A;  2MWN B;  2G4D B;  1X11 A;  4W9D A;  1W1D A;  2RR9 A;  1EO6 A;  4CHM A;  4CYE A;  2NMB A;  3EEC A;  2K8B A;  5C16 A;  4NSW A;  3QJZ A;  2ELB A;  4HAX B;  2M17 A;  3MTN B;  2AWT A;  1EF1 A;  2K1F A;  3QAR A;  5G2N A;  2YF0 A;  1EAZ A;  3KZ1 A;  2KVR A;  2R2O A;  4IM2 A;  3D32 A;  2MBE A;  1Q5W B;  4EUT A;  4EEW A;  4HK2 A;  2KDI A;  2K00 A;  4K7S A;  4ICU A;  5CHV C;  2IYD B;  3A9K B;  3WAM A;  5AZF A;  4EKU A;  4KDL B;  4WSF A;  4BKS A;  2GCL A;  1YJ1 A;  3RUI B;  1U4A A;  1UGM A;  3ZDT A;  3ZVR A;  1BT0 A;  4N9F 4;  1KZG A;  2CKH B;  4LCD E;  3VUX A;  2J59 M;  3H7P A;  3N30 A;  2E2X A;  3AU5 A;  4DXA B;  2B3A A;  2L0F A;  2O2V A;  2LGD A;  1WX9 A;  4CHK A;  4C0A A;  1RFA A;  2LAS A;  2DAJ A;  1DBH A;  3DCG A;  2ZNV B;  4NQL B;  2FNJ B;  4HB3 B;  2KCJ A;  3FM8 C;  1LXD A;  3HQC A;  2ZJD A;  2N9P C;  2IO1 B;  4MGY E;  2KMC A;  2M8S A;  2HE7 A;  1Y8R C;  5D6J B;  3ECI A;  4WJP A;  1OEY J;  4FHJ A;  2ZPN A;  4HVB A;  1X1F A;  2DZJ A;  4GMV A;  3A1Q B;  3M62 B;  1P1A A;  3QIJ A;  1DRO A;  1G6J A;  1P0R A;  3NHE B;  4JL9 A;  3PHW B;  2P0F A;  3VHT C;  2YSZ A;  3A33 B;  3Q3J A;  5J18 A;  5LOP B;  2MP2 B;  4XZ4 A;  4BKG A;  3KH0 A;  2M1M A;  3UIP B;  4X57 B;  2C9W B;  4HCP B;  4W9H A;  5HE0 A;  4EJN A;  2K6Q A;  5J3Y A;  2W2X D;  4TUU A;  4IWO A;  4NAW B;  3LJU X;  4II2 B;  2ZEQ A;  3GYP A;  4KIK B;  3DXE A;  4IFS A;  4W9E A;  2CAY A;  1WJU A;  1WGY A;  1UZX B;  4IOY X;  2UZR A;  1EF5 A;  5D3X A;  2PEA A;  4WJQ A;  3JW0 X;  2DHZ A;  1U5D A;  1GC7 A;  1OEY A;  4F7H A;  1Z5S B;  3ZKJ C;  2KFK B;  5JHH A;  2MLB A;  1AWE A;  2YS3 A;  4AJW A;  3A8Q A;  4XX5 A;  1WXA A;  2W2W A;  3QWM A;  2FUH B;  2QHO A;  1ZSQ A;  4FJZ A;  4GZU A;  2KX0 A;  4PYZ A;  1RLF A;  2Z59 B;  1DDW A;  2R0D A;  3KRW A;  3TMP B;  2BGF A;  1P3Q U;  2OJR A;  2ROZ B;  3X23 A;  1UH6 A;  2UWQ A;  3QWZ B;  2DZK A;  4AWJ A;  2XEW A;  1WY8 A;  1H4R A;  3RCZ A;  3TJP A;  5JHB A;  2LGY A;  4KHA A;  1Y5O A;  1R4N I;  2IFS A;  2COD A;  3V6C B;  3WAP A;  1QC6 A;  1V6E A;  3QCA A;  2W9N A;  4PS8 A;  3B0A A;  1UBQ A;  5J17 A;  1P5T A;  3PG7 A;  3L0W B;  2CHX A;  4M0W B;  4RMA A;  4KVG B;  2R2Q A;  4NNJ B;  2GJY A;  2DEN B;  3ENE A;  2R09 A;  5E6O A;  2GBK A;  2DHJ A;  4TKN A;  1VCB A;  2DZI A;  2Y8F A;  4I6L B;  1FHX A;  3WYF B;  3WAN A;  1WXS A;  4NPN A;  5D3Y A;  3RZF A;  3TO1 A;  2YVC A;  1M7R A;  1BWN A;  3SNH A;  2K25 A;  4IM3 A;  2JRH A;  2YT0 A;  2Y7B A;  1TBE A;  4W9L A;  4DHZ E;  3A9K A;  3A9J B;  3ZNG C;  3ZDM C;  2V4L A;  4F7U P;  1V81 A;  3X0W A;  1U2B A;  4A6H A;  1FGZ A;  4HJK A;  3AU4 A;  1OMW A;  1X1G A;  3HHM A;  3TVV A;  2JWZ A;  2O6V B;  1BAK A;  1V89 A;  2EJ8 A;  2JT4 B;  2BWE S;  1AQC A;  1TQZ A;  2XQN M;  1RRP B;  3APC A;  3MPX A;  5E6N A;  3JSV B;  3L13 A;  4WQO B;  5EFX A;  2J0K A;  4L6E A;  5EDS A;  1GNU A;  4HAT B;  5KCV A;  4WWN A;  3HK0 A;  2KFJ A;  1E8Z A;  2VRW B;  2EKE C;  3QHT A;  1I2H A;  4ANU A;  4KSK C;  2MDX A;  4ANW A;  2ASQ A;  1EUV B;  1H8C A;  1GUA B;  4CHJ A;  3ZRF A;  5J2R A;  1WJ4 A;  2DLW A;  1NTV A;  2J0J A;  5JZE B;  3ULC A;  3A1Q A;  2KLC A;  2N1W A;  2MBQ A;  4HAW B;  4B6H A;  3QK0 A;  4G11 A;  1OGW A;  5FI1 A;  2MBB B;  3PLU A;  1YX5 B;  3RZW C;  2NBU A;  1NU2 A;  4HAZ B;  3SUZ A;  2MP2 A;  1OTR B;  2K8C A;  3PTF C;  4Z2M B;  4M8M A;  2O6V D;  1E7V A;  4NAW A;  4P7I A;  2KTR B;  3NOB A;  2ZVO A;  4KIK A;  2KD0 A;  1P9D U;  3V62 A;  1D3Z A;  3ZNI D;  2LVQ A;  1EGX A;  4GDK B;  2PJH A;  3UGB B;  4HXD A;  4ZRJ A;  4W9I A;  2X18 A;  1Q0W B;  2KJH B;  3O96 A;  4PS7 A;  3UF8 A;  4PQ0 A;  4EMO A;  3UQB A;  3VUY A;  2KMA A;  1V80 A;  3CIK A;  4GB9 A;  4H8S A;  2L0T A;  1F9J A;  1E7U A;  1V9J A;  3IVF A;  1KZ7 A;  2KFK A;  2KC1 A;  3PLV A;  2KKC A;  3W1S C;  3PSC A;  5LXI B;  4HAV B;  2KWC A;  2KXJ A;  2ZCB A;  5DH9 B;  2LUE A;  2NPT B;  4KHO A;  1R4M I;  4DX8 A;  3A4S C;  2KHW B;  2DHI A;  5FI0 A;  3ZIM A;  5DHF B;  3QAQ A;  4EFO A;  2JRI B;  3UIO B;  2HJ8 A;  2BYV E;  3DVN U;  3DXC A;  4MT7 A;  3ZUN A;  4YL8 A;  1WGH A;  3UZT A;  3SV1 A;  2DYO A;  2YS1 A;  3HM3 A;  4IWP A;  2ZPY A;  2L1C A;  4E71 A;  2YT1 A;  2PPH A;  2JVC A;  1U27 A;  2MRP A;  1Y19 B;  2V76 A;  2Z0D B;  3CMM B;  3APF A;  2NS5 A;  4MY6 A;  2LVP A;  1WGR A;  2JP2 A;  2KQS A;  3BJI A;  2YLM A;  1YQB A;  4IWQ A;  4DHJ B;  5CTR C;  5KHQ A;  5IA7 A;  2RNR B;  2WYQ A;  3ZO5 B;  1U5E A;  4W9C A;  1LQB A;  2LI5 A;  4GOC A;  1IRS A;  4IW0 A;  4DDG D;  1V88 A;  1UBI A;  3MHS D;  3KYD D;  2MSE D;  3WIM A;  4IAP A;  3ZW3 A;  3ALB A;  1WR6 E;  1SE9 A;  1OQY A;  3DOW A;  3PP2 A;  3A9J A;  3DBL I;  2MX2 A;  4A5K A;  2A5U A;  4I6N B;  4PS3 A;  2N0Y A;  4HHV A;  4ZRK A;  2LOZ A;  2NVU I;  2RUK B;  4EZK A;  2KQ7 A;  4II3 B;  2JY6 A;  1DDM A;  1V5U A;  3AUL A;  1A5R A;  2RLO A;  1QZE A;  3ZLZ A;  2JZ3 B;  4WJ7 A;  3ML9 A;  2O6V A;  3H7S A;  1WJ6 A;  5JP4 A;  2D9Y A;  1AAR A;  3JYU A;  3T9L A;  1MK7 B;  1QQG A;  3D8D A;  3GOE A;  3JSV A;  5HE3 A;  3DBH I;  1P3R A;  5KQ1 A;  3PT2 B;  3P6A A;  4TQ0 A;  2HTH B;  5FR6 A;  4XC2 A;  3DQV A;  1XKE A;  4LJP B;  4DHJ D;  2GBM A;  3PV1 A;  3B08 A;  4DX9 0;  3H6N A;  2EMS A;  3A98 B;  3D8F A;  4MH0 E;  3FSS A;  4GGQ A;  2MKR A;  3PZD A;  4J6I A;  4B6W A;  4B95 A;  1IP9 A;  3SD5 A;  3K9P B;  1BTN A;  2I1K A;  1Q1O A;  4KV2 A;  2NZ8 B;  1PLS A;  1UPQ A;  3N3K B;  5CLQ B;  3ODW A;  1U5F A;  3T06 A;  4G50 A;  3EC8 A;  1MIX A;  2MW5 A;  3AI5 A;  2D07 B;  4K17 A;  1WG7 A;  4PNK A;  2I5C A;  4GSW A;  2IBI B;  1SHC A;  3RCP A;  2COF A;  5IAA C;  2NBV B;  1V2Y A;  1WGD A;  2GBR A;  2MFQ A;  2MBO A;  3M3J A;  4DDI D;  1N3H A;  3PRZ A;  1UNQ A;  2KTR A;  2GS0 A;  4ZDV A;  2C60 A;  4F7Z A;  3PRE A;  3FEH A;  3R7R A;  1U29 A;  2DFK A;  3RYT A;  4GDK A;  4FHK A;  4B9K A;  1NBF C;  1TJ6 A;  5D27 A;  1WFY A;  4BFR A;  3KSY A;  3RT3 B;  4WJO A;  4K1R B;  3L54 A;  3IBE A;  1S3S G;  1PMS A;  4AP4 C;  1FOE A;  1ZKH A;  1J0W A;  1EVH A;  4MEL A;  1FGY A;  4A6K A;  5DPW A;  4HDO A;  1WMH A;  2CR5 A;  5J3Q A;  4HLE A;  4F1S A;  2NPT A;  3U7D A;  2V1Y A;  2EC1 A;  3VVW B;  2RGN B;  3KUC B;  1E8W A;  3R3M A;  2LUL A;  2AL6 A;  4BKT A;  3QX1 A;  3VAW A;  1GJZ A;  1XT9 B;  4LDT B;  1UD7 A;  4M8N A;  1M94 A;  3DXD A;  3TW1 A;  3PVL A;  5C1Z A;  1GG3 A;  5JLJ B;  2J7Q B;  2JXX A;  1Z2M A;  2KO3 A;  2UVM A;  2N7D A;  3T8M A;  1I42 A;  2YS5 A;  3N32 A;  1WI1 A;  3UQA A;  3M95 A;  5DIF B;  3ZTC A;  2PZ1 A;  2ADZ A;  1WR1 A;  4CO7 A;  2WDT B;  2IO2 B;  4HB0 B;  2LJ5 A;  2JZZ A;  1K5G B;  2KDB A;  2MQJ A;  1WM3 A;  3M1I B;  3A4R A;  4KHB B;  1I7A A;  5HE1 A;  4MSM B;  2LRW A;  5CHF A;  3ODO A;  1WX7 A;  2EMT A;  5C5B B;  5D94 A;  2D9V A;  1IYF A;  4BVU C;  2G35 A;  4TYZ A;  2W2X C;  2LYD A;  2C7M B;  5D7G A;  2BYE A;  2DHK A;  4IC7 B;  1ZW7 A;  2P0D A;  3OJ3 A;  2GBN A;  4RM9 A;  2ZNV C;  1WX8 A;  2N9E B;  5GMV A;  1FHO A;  2IZV B;  1GC6 A;  4TV3 A;  4LDT D;  2CHW A;  4EOY A;  1X05 A;  2DA0 A;  2KWU B;  2FID A;  3GYO A;  2WX1 A;  3VUW A;  1V5T A;  3VTV A;  1PQS A;  2FCS A;  2JPH A;  4KAX B;  2Z0E B;  2V3S A;  2DX1 A;  4FJV B;  4MJS B;  5HKH A;  2D9Z A;  2DYN A;  5DHA B;  4HWI B;  3SYX A;  2HTH A;  4GN1 A;  2M38 A;  3V6E B;  2LWP A;  4IG7 B;  4FJY A;  1UNR A;  2QKM A;  3VXW A;  3R66 C;  3D8E A;  1WE6 A;  4W9K A;  3SO6 A;  4FUL A;  2JF5 A;  2DX5 B;  2UYZ B;  3Q3F A;  2L8J A;  2ZCC A;  4IM0 A;  3L08 A;  1KOT A;  4GU2 A;  3ZRC A;  5CX3 A;  1E5W A;  2KUP A;  1XOD A;  2FCM A;  3L16 A;  4OVU A;  4ZRI A;  2H7E A;  2BPS A;  1V5P A;  4Z2N A;  3APD A;  2DYB A;  4DWF A;  1TTN A;  1ISN A;  2WX0 A;  5DPS A;  3TFM A;  2L7R A;  4HDQ A;  1TZ1 A;  1RRB A;  4JLC A;  4F8C B;  2KX3 A;  1LFD A;  3VFK A;  3KYC D;  2DN6 A;  4HPM B;  1WIA A;  2M0X A;  2Z0Q A;  2H7D A;  4AOF A;  1K8R B;  2IO0 B;  3DBR I;  2GOW A;  2CHZ A;  3ZTD A;  3N7C A;  2COA A;  1ZC3 B;  1C3T A;  1WMH B;  2CY5 A;  2FIF A;  1JRU A;  2RSG A;  1MK9 B;  2KC2 A;  3OAW A;  3DBS A;  3HIZ A;  3W1S A;  2G4S A;  5CLL B;  1RJ2 A;  4TQ1 A;  2OOB B;  2XBB C;  1LM8 B;  3TIX A;  1BTK A;  2KK8 A;  1L2N A;  3OLM D;  2KNB A;  3TL5 A;  4WJN A;  4BBN F;  1M7E A;  3PS6 A;  4ASW C;  2IO3 B;  3AJ4 A;  3I3T B;  3BY4 B;  3TCA A;  4WAA A;  1CMX B;  3S2A A;  2HD5 B;  3TBL D;  3A8P A;  2AEH A;  1ZC4 B;  3MJW A;  1KLV A;  1WZ0 A;  2CS4 A;  3CSF A;  2MWS B;  2K2J A;  2DYQ A;  2D11 A;  2FJL A;  4K2O A;  1XD4 A;  3V61 A;  1MG8 A;  2P0H A;  1UEF A;  3M63 B;  2RD0 A;  1KJT A;  4MDK E;  2CU1 A;  3KW5 B;  2CY4 A;  2D3G A;  3PPA A;  4NJ7 A;  3VH4 B;  1WGU A;  2K2U A;  4MGZ E;  1SIF A;  2MBH A;  2N23 A;  1UEL A;  1PFJ A;  4URK A;  5CHW A;  3ODX A;  3DVN V;  2RGF A;  4FA6 A;  4WVF B;  1WXM A;  3PRM B;  3P7Z A;  4YON A;  2Z0P A;  4HCN B;  4EZL A;  1NDD A;  2D9W A;  2JUO A;  3RD2 A;  5C79 A;  5TR5 A;  2D4Q A;  1X1M A;  1XD3 B;  4MEM A;  4KZC A;  4JIO U;  2NBW B;  1J8C A;  2IY0 B;  2OQB A;  4Y94 A;  5L81 A;  5C5B A;  3WA0 A;  2LOX A;  4XWX A;  1DYN A;  1V5O A;  4A6F B;  5HE2 A;  1OY2 A;  3ZNH B;  2QKL A;  3DVG X;  3CF6 E;  2REX A;  3P2B A;  4W9J A;  3QQ8 B;  4NY0 A;  5AZH A;  2P8V A;  1ZGU B;  4K7U A;  3PGE A;  3PRP B;  4GDL B;  1Q67 A;  3ML8 A; 
#chains in the Genus database with same CATH topology
 4IUM B;  3LDZ E;  4LTU A;  3Q69 A;  3WAO A;  1N5X A;  1XLP A;  2AQ1 B;  3ULB A;  3PVU A;  3AE7 B;  2DAF A;  2Y5C A;  5H8Y E;  1T0Y A;  1TS4 A;  2KWD A;  4BBN C;  5D3W A;  3MDB C;  5DI9 B;  1QIL A;  1P7E A;  2WXM A;  2LZ6 A;  3W1Y A;  1SB3 C;  2KTF A;  4WQM A;  4HB2 B;  2J53 A;  4MJS A;  3N1Y C;  1FIQ A;  1V5M A;  1WI0 A;  1ZVR A;  2LGX A;  1P6S A;  1STE A;  4KSL C;  5H92 C;  2KR0 A;  1P7F A;  4OVV A;  1FMA D;  3BZD B;  3Q3O C;  3LJ3 A;  3O65 B;  5IOI A;  5L95 C;  2LVO A;  2N7J A;  2KWV B;  2Y5B B;  3PSE B;  3WCQ A;  3AXC A;  2GMI C;  3RPF C;  1FO4 A;  3VOQ A;  3VRA B;  2DZM A;  3C0R B;  3NS1 A;  1H10 A;  2OTX A;  1ZE3 D;  2DX5 A;  2LD9 A;  4FAD A;  1NTY A;  3PHX B;  2I1J A;  2WWZ A;  2WS3 B;  1VD2 A;  2KDE B;  1Z87 A;  3SR6 A;  2AYO B;  1ZM0 A;  3ML4 A;  4L1R A;  1F77 A;  2J0M A;  3F0W A;  3CST A;  2IYB A;  2YT2 A;  1E8X A;  2L76 A;  3KUD B;  3V60 A;  2NMQ A;  1BUI C;  3NS8 A;  2Q13 A;  3VDZ A;  1HTQ A;  2COC A;  4D6W A;  1UPR A;  3GS2 A;  5LG4 B;  2MA9 B;  3VIA A;  4A3P A;  4DK5 A;  1JWS D;  5DPT A;  3OJ4 B;  2UZS A;  4ICV A;  1WXV A;  4BBK A;  1WGQ A;  1WE7 A;  2K39 A;  4EE2 A;  4HB4 B;  3QBV B;  4K2P A;  1XCG A;  3KUZ A;  3AE4 B;  2WXL A;  2DKP A;  1XQQ A;  3UIN B;  1I35 A;  2KIE A;  3KQ4 A;  3IFW B;  3L17 A;  2LMC A;  5LXH A;  2XK5 B;  2Y8G A;  1U5G A;  2YRY A;  1L4D B;  4WWP A;  1FXT B;  4US9 A;  2VKI A;  3R8B A;  3DBR B;  2PLP A;  5C6R A;  3DPD A;  4AJY B;  1XX0 A;  3EUB 2;  5BO4 B;  2D2Q A;  2V3N A;  4E74 A;  2FCQ A;  4GPT B;  3IAM 1;  4MK0 A;  1P98 A;  3U8Z A;  1SSN A;  1YQ4 B;  2C7H A;  2WHI A;  2Y5P A;  2BF8 B;  2KLG A;  4GMX B;  3PVW A;  5AEK B;  3ABV B;  3IXS A;  4KZ0 A;  2KOX A;  3RFZ B;  2K8H A;  3T3N A;  3NY5 A;  2WXF A;  5E6P A;  4MM3 A;  3OAN A;  1MPH A;  3NSU A;  5DCN A;  2GCJ A;  1E90 A;  1T5X D;  1RAX A;  4RFB A;  3ZJV A;  3R7Q A;  2WDQ B;  4ANX A;  2CRF A;  1F0Z A;  4BOS C;  1GOZ A;  1K5D B;  2IND C;  2N9X A;  5T8I A;  2A4Z A;  3KRX A;  3RUL A;  2I5F A;  2BT6 A;  3U4E G;  3U2S C;  2LXC A;  1WH3 A;  2C5L C;  5I2M A;  3PEG A;  1HE8 A;  1RYJ A;  1ZXI A;  2V3P A;  1K51 A;  3EHV A;  4NAM A;  5JHG A;  3G9W A;  2R61 A;  4A3O A;  1FB8 A;  3K9O B;  2KJ6 A;  5LON B;  2KJR A;  1YN3 A;  3BIN A;  2BCJ A;  2KT7 A;  5LLI A;  2LKO A;  3Q3M C;  5BMG A;  2BWF A;  4LNO A;  5GOW B;  2DYM A;  2BB6 A;  3NZU A;  3AE3 B;  2NCN A;  2FAZ A;  1YX6 B;  3DDC B;  4JGH B;  1BXT A;  4MSQ B;  1FHW A;  4E3C A;  4LJO B;  4HJG E;  3H9D A;  3EFU A;  3SU8 X;  4FBJ B;  3H7P B;  1W1H A;  1KM7 A;  5J3T A;  5HI1 A;  2ELA A;  4JQW C;  2O2V B;  2VSZ A;  2KDF B;  5EE1 A;  4GIV A;  3MC8 A;  3N1X C;  2V4I B;  4XDD A;  4ZYN A;  3QC8 B;  1B55 A;  2I2Y A;  3P4P B;  1TYG B;  2KZR A;  1TY0 A;  4I6P A;  5DPR A;  4DBG A;  4L2Y A;  4EZJ A;  3IHP C;  4FN2 A;  3SDL C;  2M14 A;  1MHX A;  1MAI A;  5G55 A;  2Q5W D;  2Z4D A;  3VH3 B;  2L52 A;  2ICI A;  4HAU B;  1YIW A;  2RMM A;  3H1U A;  1LB1 A;  1WVH A;  2PMV A;  1TGZ B;  3MFG A;  1PGB A;  2DKQ A;  5G5H A;  1K52 A;  2CJN A;  2D9X A;  4D0N B;  1N63 A;  5KHO A;  1TXD A;  2LEK A;  3NZS A;  1TKY A;  3GZN I;  5BYS A;  2KGX B;  2IY1 B;  4OZB A;  1FFU A;  4NJC A;  2NR2 A;  2W82 A;  2RDB C;  2VZK B;  3HM6 X;  1YD8 U;  1FD6 A;  5L83 A;  1MIZ B;  2N7E A;  2N1V A;  2L05 A;  1PGA A;  1XXG A;  3DVG Y;  2L32 A;  2M4N A;  2ON8 A;  5D2M B;  2LG1 A;  4A6F A;  4W9F A;  3IG3 A;  2K6D B;  1IPG A;  2K5P A;  1X86 A;  5C23 A;  1WJM A;  1WRD B;  3ZNZ B;  2D10 A;  4YSX B;  1B1Z A;  4Q2J A;  1UNP A;  3KVF B;  4A20 A;  4HAY B;  4DHZ B;  4A8X C;  1VLB A;  4AUQ C;  5LNK 1;  4XWT A;  2MJD A;  4A55 A;  2VRR B;  4PK1 A;  3VTW A;  1ET9 A;  5BMI A;  5JHA A;  4RH6 A;  1WYG A;  4BOZ B;  4BKS D;  4GXB A;  1QOA A;  2GBJ A;  4K81 A;  3TSS A;  3VRB B;  1XEE A;  2L00 B;  5AZG A;  3GB1 A;  1DDV A;  1KFY B;  4OVZ A;  3UI3 A;  2LJI A;  4NJ6 A;  1V61 A;  1J19 A;  2BKR B;  1S1Q B;  1WZ3 A;  3W5V B;  3CXB B;  4F7G A;  1NI2 A;  1V49 A;  2QSD A;  2G45 B;  4GDL A;  4G0N B;  2FCN A;  4W9G A;  2RPQ A;  5D3V A;  1PGX A;  4HPL B;  3B1L X;  1C79 A;  1ENF A;  1QOB A;  3C8Y A;  3QA8 A;  3GE8 C;  5KQ4 A;  1ZDX A;  5JH5 C;  1J0G A;  3DWM A;  2BKF A;  4DBB A;  4P16 A;  1EM7 A;  2NTS A;  4ARC A;  1EWY C;  2KYW A;  1L7Y A;  3U30 A;  2LXA A;  2L2I A;  1WF9 A;  1E8Y A;  4MAC A;  2PE6 B;  1W1G A;  3C19 A;  1FNU A;  3NWF A;  2WXR A;  2ROV A;  2BYF A;  1LW3 A;  3BYY B;  3URY A;  3LYY A;  3WAL A;  3AM9 A;  2KAN A;  3ZVV A;  3P1M A;  3KY9 A;  2N4F A;  3LXF A;  4RF1 A;  4PYU A;  2G3Q B;  2AL3 A;  1WGG A;  1FAO A;  4DXG A;  1VRA B;  1WM2 A;  2VZK D;  1MKE A;  2PW9 A;  1WJN A;  4MGK E;  3F5R A;  2MCN B;  2ZVN A;  4RCO A;  2ZW1 A;  1XR0 B;  2RSU A;  1OQN A;  2N9L A;  4LNK A;  1L0Y B;  3L10 B;  3VTU A;  2PE9 A;  4K7W A;  4FLH A;  4KDI C;  2RVB B;  1V86 A;  1WJ1 A;  3HW2 B;  1C1Y B;  1DYQ A;  1T3Q A;  2C7N B;  1FNW A;  4WWO A;  3JVZ X;  3RNC C;  3SHQ A;  1RM6 C;  2KAC A;  1JQ4 A;  2CU3 A;  3AE8 B;  2D3C A;  4C4V B;  4NQK E;  4RM8 A;  2WGS A;  4LK0 M;  2L3Z A;  4RGT A;  2WXP A;  3IAS 1;  3VQI A;  2ZZP B;  2LRU A;  3R2I A;  1WYW B;  2MEK A;  3V5W A;  3ONS A;  4ANV A;  2KN5 A;  2DTC A;  1KI1 B;  4G3X B;  1SGH A;  2XK5 A;  4MGI E;  1OFF A;  2Z0O A;  2K22 A;  2MWN B;  3W9C B;  2G4D B;  1X11 A;  1V8C A;  4W9D A;  1W1D A;  2RR9 A;  1EO6 A;  4CHM A;  4CYE A;  2NMB A;  3EEC A;  2K8B A;  5C16 A;  1SBB B;  4NSW A;  1N62 A;  3QJZ A;  1YN5 A;  2ELB A;  4HAX B;  2M17 A;  3MTN B;  2AWT A;  4L1B A;  1EF1 A;  2K1F A;  3E56 A;  3QAR A;  1MG4 A;  2QMT A;  3TEX A;  4N6E B;  5G2N A;  2YF0 A;  1EAZ A;  2PVG C;  2MH7 A;  4BZA A;  3KZ1 A;  3AB5 A;  2EEL A;  1VZ7 A;  2D5G A;  4QJ3 B;  2KVR A;  2R2O A;  2NTT A;  4IM2 A;  3D32 A;  2BB5 A;  1Q5W B;  2MBE A;  4YTP B;  4EUT A;  4EEW A;  4HK2 A;  2KDI A;  1HZ6 A;  2BS2 B;  2K00 A;  3P4S B;  4K7S A;  4WUR A;  4ICU A;  5CHV C;  2IYD B;  3A9K B;  3WAM A;  5AZF A;  4EKU A;  2B76 B;  2VH1 A;  3OG5 A;  4KDL B;  4WSF A;  2OHF A;  4BKS A;  2GCL A;  1YJ1 A;  3RUI B;  1U4A A;  1UGM A;  3ZDT A;  3ZVR A;  1BT0 A;  3Q8A A;  4N9F 4;  3ETR A;  1K53 A;  1KZG A;  2WDR B;  2CKH B;  1TY2 A;  1OQQ A;  2QDF A;  3P4Q B;  4LCD E;  3VUX A;  2J59 M;  3H7P A;  3N30 A;  2E2X A;  3AU5 A;  4DXA B;  2B3A A;  2D3B A;  2L0F A;  2O2V A;  2LGD A;  2L83 A;  1WX9 A;  4CHK A;  1F2R I;  4C0A A;  3Q8C A;  1FCL A;  2J4X A;  3SEB A;  1RFA A;  2K9X A;  1CJE A;  2LAS A;  4ZHP A;  2TSS A;  1L6V A;  2DAJ A;  1K50 A;  4IDI A;  1NVI D;  1DBH A;  3DCG A;  3ZJU A;  2ZNV B;  1T0S C;  5G5G A;  4XDC A;  4NQL B;  4H2A A;  2FNJ B;  3P4R B;  3AE9 B;  4JWS C;  4HB3 B;  2KCJ A;  2INP E;  3HIE A;  1FRR A;  3BYT B;  3GZN B;  3I57 A;  3FM8 C;  3DHG C;  1LXD A;  3HQC A;  2ZJD A;  3CWI A;  1HXY D;  3MC9 A;  2N9P C;  3DHI C;  2IO1 B;  4MGY E;  2KMC A;  1ET6 A;  4OHJ A;  2M8S A;  2HE7 A;  1Y8R C;  5D6J B;  4L23 A;  3ECI A;  4WJP A;  1OEY J;  4FHJ A;  3ZQ4 A;  2ZPN A;  4HVB A;  1X1F A;  4MH8 A;  3PZ7 A;  1HZ5 A;  2DZJ A;  4GMV A;  2KUQ A;  3RNF C;  3A1Q B;  3M62 B;  1P1A A;  3QIJ A;  1DRO A;  1G6J A;  1UWM A;  5BYQ A;  4YWG G;  1P0R A;  4M01 A;  1PFD A;  3NHE B;  4JL9 A;  3PHW B;  1TS2 A;  2P0F A;  3VHT C;  2M19 A;  2YSZ A;  3A33 B;  3Q3J A;  5J18 A;  2G1E A;  5LOP B;  2MP2 B;  4XZ4 A;  4BKG A;  2QCZ A;  3KH0 A;  1AWD A;  1YNT E;  1WRI A;  1YJI A;  2M1M A;  3UIP B;  4X57 B;  2C9W B;  4HCP B;  4W9H A;  5HE0 A;  1QT9 A;  1YN4 A;  4EJN A;  2K0P A;  2K6Q A;  5J3Y A;  2W2X D;  4QAY A;  2W54 A;  4TUU A;  4IWO A;  4NAW B;  1ZOY B;  3LJU X;  2K8E A;  1SE3 A;  4II2 B;  2ZEQ A;  3GYP A;  4KIK B;  3DXE A;  1SJE D;  4IFS A;  4W9E A;  2BBC A;  2CAY A;  1WJU A;  1WGY A;  4AS1 A;  5FR3 A;  1I4R A;  1UZX B;  5IO9 A;  4IOY X;  4WWM A;  1DOX A;  1JWM D;  1AYF A;  2UZR A;  1L0X B;  1EF5 A;  1NEK B;  5D3X A;  1KTK A;  2BYT A;  2PEA A;  1I4P A;  1MJD A;  3AEA B;  3TEY A;  4WJQ A;  4O1N A;  1ZPS A;  1B9R A;  2FUG 1;  4US8 A;  3JW0 X;  4JPS A;  3NRZ A;  3Q2A C;  2DHZ A;  1U5D A;  1QOF A;  1GC7 A;  1OEY A;  4F7H A;  2JWU A;  1Z5S B;  3ZKJ C;  4GOU A;  2KFK B;  1T0Q C;  5JHH A;  2MLB A;  3P63 A;  1J7A A;  1AWE A;  4LLG M;  1YMH E;  1ZXH A;  3NUH B;  2YS3 A;  4GLS C;  4AJW A;  3A8Q A;  4XX5 A;  3MHZ A;  1WXA A;  2W2W A;  3QWM A;  2FUH B;  2QHO A;  4JWU C;  2HJ1 A;  2LGI A;  1ZSQ A;  4FJZ A;  4GZU A;  3SFD B;  2KX0 A;  4PYZ A;  1RLF A;  2LUM A;  2ZKM X;  2FBW B;  2Z59 B;  1DDW A;  4C4V A;  2R0D A;  3KRW A;  3TMP B;  2WXQ A;  2BGF A;  1P3Q U;  4PT5 A;  2OJR A;  2ROZ B;  3X23 A;  1UH6 A;  2UWQ A;  3FVC A;  3QWZ B;  2DZK A;  4AWJ A;  2XEW A;  1UWX A;  1WY8 A;  4YT0 B;  1ZYI A;  4WH4 A;  1H4R A;  3RCZ A;  3TJP A;  3KLS X;  5JHB A;  1L4Z B;  2ONQ A;  2LGY A;  4KHA A;  1Y5O A;  1R4N I;  4OW0 A;  2IFS A;  2COD A;  2R2Y A;  3V6C B;  3WAP A;  1ZUD 2;  1QC6 A;  1V6E A;  1V97 A;  3QCA A;  2W9N A;  1CK1 A;  3HVD A;  4PS8 A;  3B0A A;  1UBQ A;  5J17 A;  1P5T A;  3PG7 A;  3DHH C;  3L0W B;  2L1A A;  2CHX A;  4M0W B;  4RMA A;  3RN9 C;  2OJW A;  2QC8 A;  3ZXR A;  3U12 A;  4KVG B;  2R2Q A;  4NNJ B;  2GJY A;  2DEN B;  2WXO A;  1VZ6 A;  3ENE A;  2R09 A;  2GB1 A;  5E6O A;  2GBK A;  2PKO A;  5D3I B;  2DHJ A;  4TKN A;  1VCB A;  2DZI A;  2Y8F A;  5EE0 A;  1SXT A;  4I6L B;  1FHX A;  3WYF B;  1XLO A;  5I4D A;  1WXS A;  3WAN A;  1DOY A;  4NPN A;  5D3Y A;  3RZF A;  3TO1 A;  2W3R A;  4C80 A;  2YVC A;  5JXV A;  1AN8 A;  1RWS A;  2ZW0 A;  1M7R A;  1BWN A;  3SNH A;  1N61 A;  5FKA C;  1I4X A;  1PDX A;  3MC0 B;  2K25 A;  4IM3 A;  1GPX A;  2XNA C;  2JRH A;  2YT0 A;  2Y7B A;  1TBE A;  4W9L A;  4DHZ E;  3A9K A;  3A9J B;  4CSQ A;  3ZNG C;  3ZDM C;  1C76 A;  3PO0 A;  3RNG C;  2V4L A;  1JML A;  4F7U P;  1WWT A;  1V81 A;  4KGS A;  5IN7 A;  4M00 A;  3X0W A;  1U2B A;  4A6H A;  3J9C A;  1FGZ A;  1R7S A;  4HJK A;  3AU4 A;  2WP9 B;  5HHD G;  4KX6 B;  2DLB A;  1OMW A;  1X1G A;  3MP9 A;  4TMA B;  3HHM A;  3TVV A;  1GAQ B;  4OZC A;  3AV8 A;  2JWZ A;  2O6V B;  1BAK A;  1HQR D;  1V89 A;  2EJ8 A;  3V05 A;  3RI7 C;  2JT4 B;  2X38 A;  2BWE S;  1AQC A;  1TQZ A;  2XQN M;  1TIF A;  1E9M A;  3NWA A;  1RRP B;  3APC A;  2K3U A;  3MPX A;  5E6N A;  3JSV B;  4RGO S;  5IRS A;  1Q10 A;  3L13 A;  1C4P A;  4WQO B;  5EFX A;  1F52 A;  1MPE A;  2J0K A;  3N9Y C;  3HSA A;  4LNF A;  4L6E A;  5EDS A;  1GNU A;  2Z14 A;  4HAT B;  5KCV A;  4WWN A;  3HK0 A;  1C9F A;  2KFJ A;  1E8Z A;  2VRW B;  2EKE C;  1FRD A;  3QHT A;  1I2H A;  4ANU A;  2WXN A;  4KSK C;  2MDX A;  3RNB C;  4ANW A;  2ASQ A;  1EUV B;  1C78 A;  1E6E B;  1GUA B;  1H8C A;  4CHJ A;  1GB1 A;  3ZRF A;  2N0S B;  5J2R A;  1WJ4 A;  2DLW A;  1NTV A;  2J0J A;  1N5W A;  5JZE B;  3ULC A;  3A1Q A;  2KLC A;  2N1W A;  2MBQ A;  4HAW B;  4B6H A;  1PYW D;  3QK0 A;  3FC4 A;  4G11 A;  1L0V B;  1OGW A;  2I38 A;  1SF0 A;  1RFK A;  4HKQ A;  5FI1 A;  2MBB B;  1SEB D;  3PLU A;  1YX5 B;  2GI9 A;  3RZW C;  2WDV B;  2NBU A;  1NU2 A;  1ZP0 B;  4HAZ B;  3SUZ A;  1T0R C;  2MP2 A;  1OTR B;  1M4V A;  1NYR A;  2K8C A;  3PTF C;  2XN9 C;  3HUI A;  3H8H A;  4DQO C;  4Z2M B;  1A70 A;  4M8M A;  2O6V D;  1E7V A;  4KKI A;  2JYE A;  4NAW A;  1LO5 D;  1I4Q A;  2KN4 A;  4P7I A;  2KTR B;  3NOB A;  3TUO A;  2ZVO A;  2WXG A;  4KIK A;  4XYC A;  2KD0 A;  1P9D U;  3V62 A;  5C2T B;  1D3Z A;  3ZNI D;  2LVQ A;  1EGX A;  4GDK B;  2PJH A;  4A9A A;  2RRF A;  4HXD A;  2KAJ A;  3UGB B;  4ZRJ A;  2WXJ A;  4TSS A;  4W9I A;  1WSP A;  2X18 A;  2DBY A;  1Q0W B;  4A6Q A;  2KJH B;  2LGS A;  3O96 A;  4PS7 A;  3UF8 A;  1VJK A;  4PQ0 A;  2W55 A;  4EMO A;  1KH0 A;  1JWU D;  3UQB A;  1C4C A;  3VUY A;  2Z8L A;  2KMA A;  1V80 A;  3CIK A;  4GB9 A;  4H8S A;  1V1P B;  2L0T A;  1C77 A;  1F9J A;  1E7U A;  1V9J A;  3IVF A;  3KWV A;  5HG2 A;  1KZ7 A;  1YJJ A;  4HPP A;  2KFK A;  2KC1 A;  3PLV A;  1D5Z C;  2KKC A;  3W1S C;  5FK9 C;  3PSC A;  4YTN B;  3OHM B;  5LXI B;  5AUK A;  4HAV B;  4DIX A;  2KWC A;  2KXJ A;  2ZCB A;  3DWG C;  3RMK C;  2LHD A;  2INN E;  5DH9 B;  1KLG D;  4REZ A;  2LUE A;  2YEP B;  2NPT B;  4KHO A;  1R4M I;  4DX8 A;  1L6U A;  3A4S C;  2KHW B;  1SIJ A;  1N6Z A;  2Z59 A;  2DHI A;  5FI0 A;  1QLB B;  3ZIM A;  5DHF B;  4QJ4 B;  3QAQ A;  4EFO A;  2JRI B;  5BMH A;  3UIO B;  2HJ8 A;  2BYV E;  2E6X A;  3DVN U;  3AE1 B;  3AEB B;  3DXC A;  3IT4 B;  1R4N B;  3I9V 1;  4MT7 A;  3ZUN A;  4YL8 A;  1WGH A;  3UZT A;  3SV1 A;  2DYO A;  1EU3 A;  3AEC B;  2YS1 A;  3HM3 A;  4IWP A;  2ZPY A;  2L1C A;  2WXI A;  1IBX A;  4E71 A;  3AN1 A;  1FPY A;  2YT1 A;  4KGR A;  2PPH A;  2JVC A;  1U27 A;  2MRP A;  1Y19 B;  2V76 A;  1SJH D;  2Z0D B;  3CMM B;  3APF A;  2OED A;  2NS5 A;  4MY6 A;  2LVP A;  3GP7 A;  1WGR A;  2JP2 A;  3AED B;  4M0W A;  2KQS A;  3BJI A;  2YLM A;  1YQB A;  4IWQ A;  2BTE A;  4DHJ B;  5CTR C;  5KHQ A;  5IA7 A;  2RNR B;  2Z13 A;  2WYQ A;  3ZO5 B;  2RDG A;  1U5E A;  3P42 A;  4W9C A;  1LQB A;  4IOI E;  2LI5 A;  4GOC A;  1IRS A;  4IW0 A;  4DDG D;  1V88 A;  1UBI A;  3ZXV A;  2KDM A;  3MHS D;  3KYD D;  2MSE D;  3WIM A;  3A58 A;  4ZHO A;  2LHE A;  2KMM A;  4IAP A;  4N59 A;  3ZW3 A;  1YQ3 B;  4JX1 C;  2JYT A;  3ALB A;  1WR6 E;  4MT5 A;  2N9K A;  1SE9 A;  1UNS A;  5I2S A;  4B0E A;  1OQY A;  4CQN A;  3DOW A;  4S0R A;  3PP2 A;  3A9J A;  3DBL I;  2MX2 A;  3VR9 B;  4A5K A;  2A5U A;  4I6N B;  4PS3 A;  2N0Y A;  4HHV A;  1N60 A;  3LB8 C;  1XCQ L;  4ZRK A;  3AE6 B;  2LOZ A;  2NVU I;  2D3A A;  2RUK B;  4EZK A;  2KQ7 A;  4II3 B;  2JY6 A;  1DDM A;  1V5U A;  3AUL A;  1MI0 A;  1A5R A;  2RLO A;  1QZE A;  3Q3N C;  1QF6 A;  2G9H D;  3ZLZ A;  5IP4 D;  1IGC A;  2AQ3 B;  2JZ3 B;  4WJ7 A;  3ML9 A;  2O6V A;  3H7S A;  1WJ6 A;  1T6B X;  1FEH A;  1XLN A;  5JP4 A;  2J52 A;  3W5U B;  2D9Y A;  1AAR A;  3U7Z A;  1XCT L;  3JYU A;  3T9L A;  1J7B A;  1MK7 B;  1QQG A;  3D8D A;  3GOE A;  3JSV A;  2YEP F;  3ZYY X;  5HE3 A;  1KRH A;  3DBH I;  1P3R A;  2WXK A;  2QIE B;  5KQ1 A;  3PT2 B;  3P6A A;  4TQ0 A;  2J42 A;  1NI3 A;  3B2G A;  2HTH B;  5FR6 A;  2IGH A;  4XC2 A;  5EE3 A;  3DQV A;  1Y56 A;  3E9S A;  1XKE A;  4LJP B;  1WGK A;  4DHJ D;  2GBM A;  1TS5 A;  3PV1 A;  3B08 A;  1NYQ A;  4DX9 0;  2HTM E;  3H6N A;  5HFY A;  4C00 A;  3TEZ A;  2EMS A;  3A98 B;  3D8F A;  4MH0 E;  4KKJ A;  3PZ8 A;  1UGJ A;  3FSS A;  3AEF B;  4GGQ A;  2MKR A;  3PZD A;  1HA5 A;  2WNM A;  4J6I A;  4B6W A;  5GXG B;  4B95 A;  3FIL B;  1IP9 A;  4XGA B;  3BII D;  3SD5 A;  3K9P B;  1BTN A;  2I1K A;  1Q1O A;  2Y3A A;  4KV2 A;  2NZ8 B;  1PLS A;  1UPQ A;  2GRI A;  3N3K B;  4RNA A;  2X8X X;  5CLQ B;  4HSI A;  1HEZ E;  2PVO D;  3ODW A;  1U5F A;  3BVG A;  2KQ4 X;  3T06 A;  4G50 A;  1MHH E;  3EC8 A;  1MIX A;  2MW5 A;  2E3T A;  3AI5 A;  1V1O A;  2D07 B;  4K17 A;  1WG7 A;  4PNK A;  2I5C A;  1HTO A;  4GSW A;  2IBI B;  3Q8F A;  1SHC A;  1ROE A;  3RCP A;  2COF A;  2QJL A;  5IAA C;  2NBV B;  4HRO A;  1V2Y A;  1WGD A;  2GBR A;  2MFQ A;  2MBO A;  3M3J A;  4DDI D;  1N3H A;  3PRZ A;  1UNQ A;  2KTR A;  4DXF A;  2GS0 A;  4UDU C;  2BS4 B;  4ZDV A;  3AH7 A;  2BS3 B;  2C60 A;  1FNV A;  1JRO A;  3Q14 C;  4F7Z A;  3PRE A;  2K49 A;  3FEH A;  3R7R A;  1U29 A;  2DFK A;  3RYT A;  4GDK A;  4HRS A;  3W2D A;  4FHK A;  4B9K A;  4R3D A;  1NBF C;  3HVZ A;  1TJ6 A;  5D27 A;  1IGD A;  4IKG A;  1WFY A;  4BFR A;  3KSY A;  4XWW A;  3RT3 B;  2FE8 A;  1DGJ A;  2JQR B;  3RNA C;  4WJO A;  4K1R B;  1XF5 L;  3L54 A;  2LFI A;  2KIG A;  1FM0 D;  3IBE A;  2PIA A;  1S3S G;  1V1P A;  1PMS A;  4AP4 C;  1FOE A;  1ZKH A;  1J0W A;  1EVH A;  3Q8B A;  4MEL A;  1FGY A;  3NVY A;  4A6K A;  3BVM A;  1YOV B;  5DPW A;  3NVW A;  2V9H A;  2ACZ B;  1R4M B;  4HDO A;  1WMH A;  5E6J A;  2CR5 A;  5J3Q A;  2BQQ A;  1IBX B;  4HLE A;  4F1S A;  2NPT A;  3U7D A;  2V1Y A;  2EC1 A;  4OZA A;  3VVW B;  2RGN B;  3KUC B;  1E8W A;  1XO3 A;  3R3M A;  2LUL A;  4C7Z A;  2AL6 A;  3ZJT A;  4BKT A;  3QX1 A;  1MVK A;  3VAW A;  1GJZ A;  1XT9 B;  4LDT B;  1JCK B;  3NVV A;  2H88 B;  1UD7 A;  4M8N A;  1TS3 A;  1WXQ A;  1UF0 A;  1CZP A;  4HEA 1;  1M94 A;  3HRD D;  3DXD A;  4GNK B;  3TW1 A;  3NG0 A;  3PVL A;  1JWB D;  5C1Z A;  1GG3 A;  5JLJ B;  1VDV A;  3N1Z C;  2J7Q B;  2JXX A;  1Z2M A;  2SEB D;  2KO3 A;  5BYR A;  2UVM A;  2N7D A;  3T8M A;  1I42 A;  2YS5 A;  3R2T A;  1FXA A;  2WXH A;  3N32 A;  1WI1 A;  3AEE B;  3UQA A;  3TEW A;  1E10 A;  3M95 A;  5DIF B;  3ZTC A;  4RGM A;  2PZ1 A;  2ADZ A;  4USA A;  3ZGZ A;  1WR1 A;  2IPK D;  4CO7 A;  2WDT B;  2IO2 B;  4HB0 B;  2LJ5 A;  5D3D A;  1ACC A;  2MHJ A;  2JZZ A;  1K5G B;  2KDB A;  4M02 A;  4C7Y A;  2MQJ A;  3BK1 A;  1WM3 A;  1FCC C;  1I4H A;  2QEJ C;  3M1I B;  3A4R A;  4KHB B;  3B9J A;  3FKY A;  2MJE A;  1I7A A;  4ACF A;  5HE1 A;  3NZ3 A;  2MJ3 A;  4K3C A;  4ZRQ A;  4MSM B;  1QOG A;  2LRW A;  5CHF A;  2WU2 B;  3ODO A;  3GE3 C;  1WX7 A;  4LNN A;  2EMT A;  5C5B B;  4YXD B;  5D94 A;  2D9V A;  3Q6B A;  1IYF A;  4BVU C;  1JAL A;  2G35 A;  3OWE B;  2M56 B;  4TYZ A;  3DBL B;  1SE2 A;  2W2X C;  2LYD A;  2C7M B;  4AQ7 A;  5D7G A;  2BYE A;  2DHK A;  4J3O D;  4IC7 B;  1ZW7 A;  2P0D A;  2HDE A;  2M0A A;  3OJ3 A;  4FXC A;  2RPV A;  2GBN A;  3BVZ A;  4RM9 A;  2ZNV C;  1WX8 A;  2N9E B;  5GMV A;  1FHO A;  2IZV B;  1GC6 A;  4TV3 A;  4LDT D;  2CHW A;  4EOY A;  1X05 A;  2DA0 A;  2GLS A;  1GB4 A;  2KWU B;  1LGR A;  2FID A;  3GYO A;  2WX1 A;  3VUW A;  4OSN A;  1F1H A;  1V5T A;  3VTV A;  1PQS A;  3AMZ A;  3DBH B;  2FCS A;  3AE5 B;  3T3O A;  2JPH A;  4KAX B;  2H89 B;  2IGG A;  2Z0E B;  1J7C A;  4ITK A;  2V3S A;  4RGN A;  2DX1 A;  3N20 C;  4FJV B;  4MJS B;  2AQ2 B;  3EGR A;  2D9Z A;  4JE3 B;  5HKH A;  3NWD A;  2DYN A;  5DHA B;  4HWI B;  3SYX A;  1FFV A;  4OT1 A;  2HTH A;  4GN1 A;  2QIL A;  2M38 A;  4QJ5 B;  3NJT A;  3V6E B;  2EKI A;  1CQV A;  3I63 C;  2LWP A;  3EFC A;  4IG7 B;  4FJY A;  3B2F A;  5AUI A;  1UNR A;  2QKM A;  3VXW A;  3R66 C;  3D8E A;  1WE6 A;  1PUT A;  4W9K A;  4YSY B;  3SO6 A;  4FUL A;  2JF5 A;  2DX5 B;  3O13 A;  2UYZ B;  3Q3F A;  2L8J A;  2ZCC A;  4IM0 A;  3L08 A;  1KOT A;  4GU2 A;  3ZRC A;  1TJE A;  5CX3 A;  1E5W A;  3U52 E;  2KUP A;  1XOD A;  2FCM A;  3L16 A;  4OVU A;  4ZRI A;  2H7E A;  3FIL A;  2BPS A;  4HKZ E;  3SFE B;  3MJ5 A;  1V5P A;  4Z2N A;  1TZO A;  2IGD A;  3APD A;  2DYB A;  4DWF A;  3VR8 B;  1TTN A;  1ISN A;  2WX0 A;  1EU4 A;  5DPS A;  2JZP A;  3TFM A;  2L7R A;  2RDH A;  4HDQ A;  1TZ1 A;  1RRB A;  2IJ0 A;  1MI1 A;  4JLC A;  4F8C B;  2KX3 A;  2NBV A;  1LFD A;  3VFK A;  1E0Z A;  3KYC D;  2DN6 A;  4HPM B;  2BW2 A;  1WIA A;  2M0X A;  4YTM B;  2Z0Q A;  2H7D A;  4AOF A;  2IDY A;  1K8R B;  1TT5 B;  2IO0 B;  3DBR I;  4P1B C;  3AE2 B;  2GOW A;  2CHZ A;  3ZTD A;  3N7C A;  2COA A;  2GUM A;  3I5J C;  1ZC3 B;  1C3T A;  1BML C;  1C4A A;  2VH2 A;  1WMH B;  2CY5 A;  1D5X C;  2FIF A;  1OQR A;  4B0M A;  5C3J B;  1JRU A;  1UUP A;  5IKC M;  3CIR B;  2RSG A;  1I7H A;  1MK9 B;  2KC2 A;  3OAW A;  4WIP A;  4K3B A;  3DBS A;  3HIZ A;  4MM3 B;  2JU6 X;  4ZYS A;  3W1S A;  2KVZ A;  2G4S A;  2FJU B;  3L4P A;  5CLL B;  1RJ2 A;  4TQ1 A;  2BVC A;  2OOB B;  2XBB C;  1LM8 B;  1SE4 A;  1IUE A;  3TIX A;  1BTK A;  2WQY B;  2KK8 A;  1L2N A;  3OLM D;  1QKZ A;  2KNB A;  1TKG A;  4WJN A;  3TL5 A;  4BBN F;  4A90 A;  1M7E A;  3PS6 A;  4ASW C;  2IO3 B;  3AJ4 A;  5MPO A;  3I3T B;  1ESF A;  3BY4 B;  3DCX A;  3TCA A;  1VZ8 A;  4WAA A;  1CMX B;  2CJO A;  1T77 A;  3S2A A;  4QXA B;  1FXI A;  2HD5 B;  3TBL D;  3A8P A;  1D4B A;  4LNI A;  2AEH A;  1L5P A;  1ZC4 B;  3MJW A;  1KLV A;  1WZ0 A;  2CS4 A;  3CSF A;  2MWS B;  2WLB A;  3IT6 B;  2JSV X;  2K2J A;  2PTL A;  2DYQ A;  1ZDV A;  2D11 A;  2FJL A;  2INC C;  4K2O A;  3Q8E A;  1XD4 A;  4C56 C;  3V61 A;  1MG8 A;  2P0H A;  1UEF A;  3M63 B;  2RD0 A;  1KJT A;  1XLQ A;  4NZL B;  4RF0 A;  4MDK E;  2CU1 A;  3KW5 B;  2CY4 A;  2D3G A;  3PPA A;  4NJ7 A;  3VH4 B;  3KWL A;  1WGU A;  1JRP A;  4KGT A;  4P1C C;  2K2U A;  2AX5 A;  4MGZ E;  1EWC A;  2MBH A;  1SIF A;  4WAF A;  2N23 A;  1TKE A;  2JXT A;  2SAK A;  1UEL A;  3EA6 A;  1PFJ A;  1QQR A;  4URK A;  4XE0 A;  5CHW A;  3ODX A;  3DVN V;  1E7P B;  3BK2 A;  4ZRP A;  2RGF A;  4FA6 A;  4WVF B;  1WXM A;  3PRM B;  4BAX A;  3P7Z A;  4YON A;  2Z0P A;  3NW8 A;  2W3S A;  4HCN B;  3V3X A;  1NDD A;  2D9W A;  4EZL A;  2JUO A;  3RD2 A;  4KHB A;  4YSZ B;  5C79 A;  1D5M C;  1JW9 D;  5TR5 A;  2D4Q A;  1X1M A;  1DOI A;  1XD3 B;  4MEM A;  2DNF A;  4KZC A;  4D2K A;  3AEG B;  4JIO U;  2NBW B;  1J8C A;  2IY0 B;  2V0G A;  2OQB A;  3B77 A;  1NEN B;  4ARI A;  4Y94 A;  3RNE C;  5L81 A;  5C5B A;  3WA0 A;  3FAH A;  2LOX A;  1AW7 A;  4XWX A;  1DYN A;  1F2R C;  1V5O A;  4A6F B;  5HE2 A;  1OY2 A;  3ZNH B;  4S17 A;  2QKL A;  3DVG X;  3CF6 E;  1KF6 B;  2REX A;  4ZOH C;  2WU5 B;  3P2B A;  3BWU D;  1I4G A;  4W9J A;  3QQ8 B;  1VR9 A;  4NY0 A;  2DWQ A;  5TSS A;  1D6E C;  3NVZ A;  5AZH A;  1JWA D;  5EE9 A;  2P8V A;  2UU7 A;  2JX5 A;  1ZGU B;  4K7U A;  3PGE A;  3PRP B;  4N58 A;  4GDL B;  5M4Y B;  4P6V F;  1KLU D;  1MFW A;  1Q67 A;  3ML8 A; 
#chains in the Genus database with same CATH homology
 4IUM B;  3LDZ E;  3WAO A;  3ULB A;  3PVU A;  2DAF A;  1T0Y A;  4BBN C;  5D3W A;  3MDB C;  5DI9 B;  2LZ6 A;  3W1Y A;  2KTF A;  4HB2 B;  4MJS A;  1V5M A;  1WI0 A;  1ZVR A;  2LGX A;  1P6S A;  4KSL C;  4OVV A;  3LJ3 A;  3O65 B;  5L95 C;  2LVO A;  3PSE B;  2KWV B;  2Y5B B;  3AXC A;  2GMI C;  3VOQ A;  2DZM A;  3C0R B;  1H10 A;  2OTX A;  2DX5 A;  2LD9 A;  4FAD A;  1NTY A;  3PHX B;  2I1J A;  2WWZ A;  1VD2 A;  2KDE B;  1Z87 A;  2AYO B;  1ZM0 A;  3ML4 A;  2J0M A;  3F0W A;  3CST A;  2IYB A;  1E8X A;  2L76 A;  3KUD B;  3V60 A;  3NS8 A;  2Q13 A;  3VDZ A;  2COC A;  1UPR A;  2MA9 B;  3VIA A;  4A3P A;  4DK5 A;  5DPT A;  3OJ4 B;  2UZS A;  4ICV A;  1WXV A;  4BBK A;  1WGQ A;  1WE7 A;  2K39 A;  4HB4 B;  3QBV B;  4K2P A;  1XCG A;  3KUZ A;  2DKP A;  1XQQ A;  3UIN B;  1I35 A;  3IFW B;  3L17 A;  5LXH A;  2XK5 B;  2Y8G A;  1U5G A;  2YRY A;  4WWP A;  1FXT B;  2VKI A;  5C6R A;  3DPD A;  4AJY B;  1XX0 A;  5BO4 B;  2D2Q A;  4E74 A;  2FCQ A;  4GPT B;  4MK0 A;  1P98 A;  3U8Z A;  2C7H A;  2BF8 B;  2KLG A;  4GMX B;  3PVW A;  5AEK B;  4KZ0 A;  2KOX A;  2K8H A;  3NY5 A;  5E6P A;  4MM3 A;  3OAN A;  1MPH A;  3NSU A;  5DCN A;  2GCJ A;  1E90 A;  1RAX A;  3R7Q A;  4ANX A;  2CRF A;  4BOS C;  1K5D B;  2N9X A;  2A4Z A;  3KRX A;  3RUL A;  2I5F A;  2LXC A;  1WH3 A;  2C5L C;  3PEG A;  1HE8 A;  3EHV A;  5JHG A;  3G9W A;  4A3O A;  1FB8 A;  3K9O B;  2KJ6 A;  5LON B;  2KJR A;  3BIN A;  2BCJ A;  5LLI A;  2LKO A;  2BWF A;  5GOW B;  2DYM A;  3NZU A;  2NCN A;  2FAZ A;  1YX6 B;  3DDC B;  4JGH B;  4MSQ B;  1FHW A;  4E3C A;  4LJO B;  3H9D A;  3EFU A;  3SU8 X;  4FBJ B;  3H7P B;  1W1H A;  1KM7 A;  5J3T A;  2ELA A;  4JQW C;  2O2V B;  2VSZ A;  2KDF B;  4GIV A;  4ZYN A;  3QC8 B;  1B55 A;  4I6P A;  2KZR A;  5DPR A;  4DBG A;  4EZJ A;  3IHP C;  4FN2 A;  3SDL C;  2M14 A;  1MAI A;  5G55 A;  3VH3 B;  4HAU B;  1YIW A;  3H1U A;  1LB1 A;  1WVH A;  1TGZ B;  2DKQ A;  2D9X A;  4D0N B;  5KHO A;  3NZS A;  1TXD A;  3GZN I;  2KGX B;  2IY1 B;  2NR2 A;  3HM6 X;  1YD8 U;  5L83 A;  1MIZ B;  2N7E A;  2N1V A;  2L05 A;  3DVG Y;  2M4N A;  5D2M B;  4W9F A;  2LG1 A;  4A6F A;  3IG3 A;  2K6D B;  1IPG A;  1X86 A;  5C23 A;  1WJM A;  1WRD B;  3ZNZ B;  2D10 A;  1UNP A;  3KVF B;  4A20 A;  4HAY B;  4DHZ B;  4AUQ C;  2VRR B;  3VTW A;  5JHA A;  4BOZ B;  4BKS D;  4GXB A;  2GBJ A;  4K81 A;  2L00 B;  5AZG A;  1DDV A;  4NJ6 A;  1V61 A;  1J19 A;  2BKR B;  1S1Q B;  1WZ3 A;  3CXB B;  4F7G A;  1NI2 A;  1V49 A;  2G45 B;  4GDL A;  4G0N B;  2FCN A;  4W9G A;  2RPQ A;  5D3V A;  4HPL B;  3B1L X;  3QA8 A;  5KQ4 A;  5JH5 C;  1J0G A;  2BKF A;  4DBB A;  1L7Y A;  3U30 A;  2LXA A;  2L2I A;  1WF9 A;  1E8Y A;  2PE6 B;  1W1G A;  2ROV A;  2BYF A;  1LW3 A;  3WAL A;  2KAN A;  3ZVV A;  3KY9 A;  2N4F A;  4PYU A;  2G3Q B;  2AL3 A;  1WGG A;  1FAO A;  1WM2 A;  1MKE A;  1WJN A;  4MGK E;  3F5R A;  2MCN B;  2ZVN A;  1XR0 B;  2RSU A;  1OQN A;  3L10 B;  3VTU A;  2PE9 A;  4K7W A;  4FLH A;  4KDI C;  2RVB B;  1V86 A;  1WJ1 A;  3HW2 B;  1C1Y B;  2C7N B;  4WWO A;  3JVZ X;  3SHQ A;  4NQK E;  4RM8 A;  2L3Z A;  3VQI A;  2ZZP B;  2LRU A;  1WYW B;  3V5W A;  3ONS A;  4ANV A;  2KN5 A;  2DTC A;  1KI1 B;  4G3X B;  1SGH A;  2XK5 A;  4MGI E;  2Z0O A;  2MWN B;  2G4D B;  1X11 A;  4W9D A;  1W1D A;  2RR9 A;  1EO6 A;  4CHM A;  4CYE A;  2NMB A;  3EEC A;  2K8B A;  5C16 A;  4NSW A;  3QJZ A;  2ELB A;  4HAX B;  2M17 A;  3MTN B;  2AWT A;  1EF1 A;  2K1F A;  3QAR A;  5G2N A;  2YF0 A;  1EAZ A;  3KZ1 A;  2KVR A;  2R2O A;  4IM2 A;  3D32 A;  2MBE A;  1Q5W B;  4EUT A;  4EEW A;  4HK2 A;  2KDI A;  2K00 A;  4K7S A;  4ICU A;  5CHV C;  2IYD B;  3A9K B;  3WAM A;  5AZF A;  4EKU A;  4KDL B;  4WSF A;  4BKS A;  2GCL A;  1YJ1 A;  3RUI B;  1U4A A;  1UGM A;  3ZDT A;  3ZVR A;  1BT0 A;  4N9F 4;  1KZG A;  2CKH B;  4LCD E;  3VUX A;  2J59 M;  3H7P A;  3N30 A;  2E2X A;  3AU5 A;  4DXA B;  2B3A A;  2L0F A;  2O2V A;  2LGD A;  1WX9 A;  4CHK A;  4C0A A;  1RFA A;  2LAS A;  2DAJ A;  1DBH A;  3DCG A;  2ZNV B;  4NQL B;  2FNJ B;  4HB3 B;  2KCJ A;  3FM8 C;  1LXD A;  3HQC A;  2ZJD A;  2N9P C;  2IO1 B;  4MGY E;  2KMC A;  2M8S A;  2HE7 A;  1Y8R C;  5D6J B;  3ECI A;  4WJP A;  1OEY J;  4FHJ A;  2ZPN A;  4HVB A;  1X1F A;  2DZJ A;  4GMV A;  3A1Q B;  3M62 B;  1P1A A;  3QIJ A;  1DRO A;  1G6J A;  1P0R A;  3NHE B;  4JL9 A;  3PHW B;  2P0F A;  3VHT C;  2YSZ A;  3A33 B;  3Q3J A;  5J18 A;  5LOP B;  2MP2 B;  4XZ4 A;  4BKG A;  3KH0 A;  2M1M A;  3UIP B;  4X57 B;  2C9W B;  4HCP B;  4W9H A;  5HE0 A;  4EJN A;  2K6Q A;  5J3Y A;  2W2X D;  4TUU A;  4IWO A;  4NAW B;  3LJU X;  4II2 B;  2ZEQ A;  3GYP A;  4KIK B;  3DXE A;  4IFS A;  4W9E A;  2CAY A;  1WJU A;  1WGY A;  1UZX B;  4IOY X;  2UZR A;  1EF5 A;  5D3X A;  2PEA A;  4WJQ A;  3JW0 X;  2DHZ A;  1U5D A;  1GC7 A;  1OEY A;  4F7H A;  1Z5S B;  3ZKJ C;  2KFK B;  5JHH A;  2MLB A;  1AWE A;  2YS3 A;  4AJW A;  3A8Q A;  4XX5 A;  1WXA A;  2W2W A;  3QWM A;  2FUH B;  2QHO A;  1ZSQ A;  4FJZ A;  4GZU A;  2KX0 A;  4PYZ A;  1RLF A;  2Z59 B;  1DDW A;  2R0D A;  3KRW A;  3TMP B;  2BGF A;  1P3Q U;  2OJR A;  2ROZ B;  3X23 A;  1UH6 A;  2UWQ A;  3QWZ B;  2DZK A;  4AWJ A;  2XEW A;  1WY8 A;  1H4R A;  3RCZ A;  3TJP A;  5JHB A;  2LGY A;  4KHA A;  1Y5O A;  1R4N I;  2IFS A;  2COD A;  3V6C B;  3WAP A;  1QC6 A;  1V6E A;  3QCA A;  2W9N A;  4PS8 A;  3B0A A;  1UBQ A;  5J17 A;  1P5T A;  3PG7 A;  3L0W B;  2CHX A;  4M0W B;  4RMA A;  4KVG B;  2R2Q A;  4NNJ B;  2GJY A;  2DEN B;  3ENE A;  2R09 A;  5E6O A;  2GBK A;  2DHJ A;  4TKN A;  1VCB A;  2DZI A;  2Y8F A;  4I6L B;  1FHX A;  3WYF B;  3WAN A;  1WXS A;  4NPN A;  5D3Y A;  3RZF A;  3TO1 A;  2YVC A;  1M7R A;  1BWN A;  3SNH A;  2K25 A;  4IM3 A;  2JRH A;  2YT0 A;  2Y7B A;  1TBE A;  4W9L A;  4DHZ E;  3A9K A;  3A9J B;  3ZNG C;  3ZDM C;  2V4L A;  4F7U P;  1V81 A;  3X0W A;  1U2B A;  4A6H A;  1FGZ A;  4HJK A;  3AU4 A;  1OMW A;  1X1G A;  3HHM A;  3TVV A;  2JWZ A;  2O6V B;  1BAK A;  1V89 A;  2EJ8 A;  2JT4 B;  2BWE S;  1AQC A;  1TQZ A;  2XQN M;  1RRP B;  3APC A;  3MPX A;  5E6N A;  3JSV B;  3L13 A;  4WQO B;  5EFX A;  2J0K A;  4L6E A;  5EDS A;  1GNU A;  4HAT B;  5KCV A;  4WWN A;  3HK0 A;  2KFJ A;  1E8Z A;  2VRW B;  2EKE C;  3QHT A;  1I2H A;  4ANU A;  4KSK C;  2MDX A;  4ANW A;  2ASQ A;  1EUV B;  1H8C A;  1GUA B;  4CHJ A;  3ZRF A;  5J2R A;  1WJ4 A;  2DLW A;  1NTV A;  2J0J A;  5JZE B;  3ULC A;  3A1Q A;  2KLC A;  2N1W A;  2MBQ A;  4HAW B;  4B6H A;  3QK0 A;  4G11 A;  1OGW A;  5FI1 A;  2MBB B;  3PLU A;  1YX5 B;  3RZW C;  2NBU A;  1NU2 A;  4HAZ B;  3SUZ A;  2MP2 A;  1OTR B;  2K8C A;  3PTF C;  4Z2M B;  4M8M A;  2O6V D;  1E7V A;  4NAW A;  4P7I A;  2KTR B;  3NOB A;  2ZVO A;  4KIK A;  2KD0 A;  1P9D U;  3V62 A;  1D3Z A;  3ZNI D;  2LVQ A;  1EGX A;  4GDK B;  2PJH A;  3UGB B;  4HXD A;  4ZRJ A;  4W9I A;  2X18 A;  1Q0W B;  2KJH B;  3O96 A;  4PS7 A;  3UF8 A;  4PQ0 A;  4EMO A;  3UQB A;  3VUY A;  2KMA A;  1V80 A;  3CIK A;  4GB9 A;  4H8S A;  2L0T A;  1F9J A;  1E7U A;  1V9J A;  3IVF A;  1KZ7 A;  2KFK A;  2KC1 A;  3PLV A;  2KKC A;  3W1S C;  3PSC A;  5LXI B;  4HAV B;  2KWC A;  2KXJ A;  2ZCB A;  5DH9 B;  2LUE A;  2NPT B;  4KHO A;  1R4M I;  4DX8 A;  3A4S C;  2KHW B;  2DHI A;  5FI0 A;  3ZIM A;  5DHF B;  3QAQ A;  4EFO A;  2JRI B;  3UIO B;  2HJ8 A;  2BYV E;  3DVN U;  3DXC A;  4MT7 A;  3ZUN A;  4YL8 A;  1WGH A;  3UZT A;  3SV1 A;  2DYO A;  2YS1 A;  3HM3 A;  4IWP A;  2ZPY A;  2L1C A;  4E71 A;  2YT1 A;  2PPH A;  2JVC A;  1U27 A;  2MRP A;  1Y19 B;  2V76 A;  2Z0D B;  3CMM B;  3APF A;  2NS5 A;  4MY6 A;  2LVP A;  1WGR A;  2JP2 A;  2KQS A;  3BJI A;  2YLM A;  1YQB A;  4IWQ A;  4DHJ B;  5CTR C;  5KHQ A;  5IA7 A;  2RNR B;  2WYQ A;  3ZO5 B;  1U5E A;  4W9C A;  1LQB A;  2LI5 A;  4GOC A;  1IRS A;  4IW0 A;  4DDG D;  1V88 A;  1UBI A;  3MHS D;  3KYD D;  2MSE D;  3WIM A;  4IAP A;  3ZW3 A;  3ALB A;  1WR6 E;  1SE9 A;  1OQY A;  3DOW A;  3PP2 A;  3A9J A;  3DBL I;  2MX2 A;  4A5K A;  2A5U A;  4I6N B;  4PS3 A;  2N0Y A;  4HHV A;  4ZRK A;  2LOZ A;  2NVU I;  2RUK B;  4EZK A;  2KQ7 A;  4II3 B;  2JY6 A;  1DDM A;  1V5U A;  3AUL A;  1A5R A;  2RLO A;  1QZE A;  3ZLZ A;  2JZ3 B;  4WJ7 A;  3ML9 A;  2O6V A;  3H7S A;  1WJ6 A;  5JP4 A;  2D9Y A;  1AAR A;  3JYU A;  3T9L A;  1MK7 B;  1QQG A;  3D8D A;  3GOE A;  3JSV A;  5HE3 A;  3DBH I;  1P3R A;  5KQ1 A;  3PT2 B;  3P6A A;  4TQ0 A;  2HTH B;  5FR6 A;  4XC2 A;  3DQV A;  1XKE A;  4LJP B;  4DHJ D;  2GBM A;  3PV1 A;  3B08 A;  4DX9 0;  3H6N A;  2EMS A;  3A98 B;  3D8F A;  4MH0 E;  3FSS A;  4GGQ A;  2MKR A;  3PZD A;  4J6I A;  4B6W A;  4B95 A;  1IP9 A;  3SD5 A;  3K9P B;  1BTN A;  2I1K A;  1Q1O A;  4KV2 A;  2NZ8 B;  1PLS A;  1UPQ A;  3N3K B;  5CLQ B;  3ODW A;  1U5F A;  3T06 A;  4G50 A;  3EC8 A;  1MIX A;  2MW5 A;  3AI5 A;  2D07 B;  4K17 A;  1WG7 A;  4PNK A;  2I5C A;  4GSW A;  2IBI B;  1SHC A;  3RCP A;  2COF A;  5IAA C;  2NBV B;  1V2Y A;  1WGD A;  2GBR A;  2MFQ A;  2MBO A;  3M3J A;  4DDI D;  1N3H A;  3PRZ A;  1UNQ A;  2KTR A;  2GS0 A;  4ZDV A;  2C60 A;  4F7Z A;  3PRE A;  3FEH A;  3R7R A;  1U29 A;  2DFK A;  3RYT A;  4GDK A;  4FHK A;  4B9K A;  1NBF C;  1TJ6 A;  5D27 A;  1WFY A;  4BFR A;  3KSY A;  3RT3 B;  4WJO A;  4K1R B;  3L54 A;  3IBE A;  1S3S G;  1PMS A;  4AP4 C;  1FOE A;  1ZKH A;  1J0W A;  1EVH A;  4MEL A;  1FGY A;  4A6K A;  5DPW A;  4HDO A;  1WMH A;  2CR5 A;  5J3Q A;  4HLE A;  4F1S A;  2NPT A;  3U7D A;  2V1Y A;  2EC1 A;  3VVW B;  2RGN B;  3KUC B;  1E8W A;  3R3M A;  2LUL A;  2AL6 A;  4BKT A;  3QX1 A;  3VAW A;  1GJZ A;  1XT9 B;  4LDT B;  1UD7 A;  4M8N A;  1M94 A;  3DXD A;  3TW1 A;  3PVL A;  5C1Z A;  1GG3 A;  5JLJ B;  2J7Q B;  2JXX A;  1Z2M A;  2KO3 A;  2UVM A;  2N7D A;  3T8M A;  1I42 A;  2YS5 A;  3N32 A;  1WI1 A;  3UQA A;  3M95 A;  5DIF B;  3ZTC A;  2PZ1 A;  2ADZ A;  1WR1 A;  4CO7 A;  2WDT B;  2IO2 B;  4HB0 B;  2LJ5 A;  2JZZ A;  1K5G B;  2KDB A;  2MQJ A;  1WM3 A;  3M1I B;  3A4R A;  4KHB B;  1I7A A;  5HE1 A;  4MSM B;  2LRW A;  5CHF A;  3ODO A;  1WX7 A;  2EMT A;  5C5B B;  5D94 A;  2D9V A;  1IYF A;  4BVU C;  2G35 A;  4TYZ A;  2W2X C;  2LYD A;  2C7M B;  5D7G A;  2BYE A;  2DHK A;  4IC7 B;  1ZW7 A;  2P0D A;  3OJ3 A;  2GBN A;  4RM9 A;  2ZNV C;  1WX8 A;  2N9E B;  5GMV A;  1FHO A;  2IZV B;  1GC6 A;  4TV3 A;  4LDT D;  2CHW A;  4EOY A;  1X05 A;  2DA0 A;  2KWU B;  2FID A;  3GYO A;  2WX1 A;  3VUW A;  1V5T A;  3VTV A;  1PQS A;  2FCS A;  2JPH A;  4KAX B;  2Z0E B;  2V3S A;  2DX1 A;  4FJV B;  4MJS B;  5HKH A;  2D9Z A;  2DYN A;  5DHA B;  4HWI B;  3SYX A;  2HTH A;  4GN1 A;  2M38 A;  3V6E B;  2LWP A;  4IG7 B;  4FJY A;  1UNR A;  2QKM A;  3VXW A;  3R66 C;  3D8E A;  1WE6 A;  4W9K A;  3SO6 A;  4FUL A;  2JF5 A;  2DX5 B;  2UYZ B;  3Q3F A;  2L8J A;  2ZCC A;  4IM0 A;  3L08 A;  1KOT A;  4GU2 A;  3ZRC A;  5CX3 A;  1E5W A;  2KUP A;  1XOD A;  2FCM A;  3L16 A;  4OVU A;  4ZRI A;  2H7E A;  2BPS A;  1V5P A;  4Z2N A;  3APD A;  2DYB A;  4DWF A;  1TTN A;  1ISN A;  2WX0 A;  5DPS A;  3TFM A;  2L7R A;  4HDQ A;  1TZ1 A;  1RRB A;  4JLC A;  4F8C B;  2KX3 A;  1LFD A;  3VFK A;  3KYC D;  2DN6 A;  4HPM B;  1WIA A;  2M0X A;  2Z0Q A;  2H7D A;  4AOF A;  1K8R B;  2IO0 B;  3DBR I;  2GOW A;  2CHZ A;  3ZTD A;  3N7C A;  2COA A;  1ZC3 B;  1C3T A;  1WMH B;  2CY5 A;  2FIF A;  1JRU A;  2RSG A;  1MK9 B;  2KC2 A;  3OAW A;  3DBS A;  3HIZ A;  3W1S A;  2G4S A;  5CLL B;  1RJ2 A;  4TQ1 A;  2OOB B;  2XBB C;  1LM8 B;  3TIX A;  1BTK A;  2KK8 A;  1L2N A;  3OLM D;  2KNB A;  3TL5 A;  4WJN A;  4BBN F;  1M7E A;  3PS6 A;  4ASW C;  2IO3 B;  3AJ4 A;  3I3T B;  3BY4 B;  3TCA A;  4WAA A;  1CMX B;  3S2A A;  2HD5 B;  3TBL D;  3A8P A;  2AEH A;  1ZC4 B;  3MJW A;  1KLV A;  1WZ0 A;  2CS4 A;  3CSF A;  2MWS B;  2K2J A;  2DYQ A;  2D11 A;  2FJL A;  4K2O A;  1XD4 A;  3V61 A;  1MG8 A;  2P0H A;  1UEF A;  3M63 B;  2RD0 A;  1KJT A;  4MDK E;  2CU1 A;  3KW5 B;  2CY4 A;  2D3G A;  3PPA A;  4NJ7 A;  3VH4 B;  1WGU A;  2K2U A;  4MGZ E;  1SIF A;  2MBH A;  2N23 A;  1UEL A;  1PFJ A;  4URK A;  5CHW A;  3ODX A;  3DVN V;  2RGF A;  4FA6 A;  4WVF B;  1WXM A;  3PRM B;  3P7Z A;  4YON A;  2Z0P A;  4HCN B;  4EZL A;  1NDD A;  2D9W A;  2JUO A;  3RD2 A;  5C79 A;  5TR5 A;  2D4Q A;  1X1M A;  1XD3 B;  4MEM A;  4KZC A;  4JIO U;  2NBW B;  1J8C A;  2IY0 B;  2OQB A;  4Y94 A;  5L81 A;  5C5B A;  3WA0 A;  2LOX A;  4XWX A;  1DYN A;  1V5O A;  4A6F B;  5HE2 A;  1OY2 A;  3ZNH B;  2QKL A;  3DVG X;  3CF6 E;  2REX A;  3P2B A;  4W9J A;  3QQ8 B;  4NY0 A;  5AZH A;  2P8V A;  1ZGU B;  4K7U A;  3PGE A;  3PRP B;  4GDL B;  1Q67 A;  3ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...