4GMVA

Crystal structure of the coiled-coil, ra and ph domains of lamellipodin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
269
structure length
260
Chain Sequence
KAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Ras-associated and pleckstrin homology domains-containing pr
total genus 77
structure length 260
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gmvA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gmvA01
1V89A 4YL8A 2KC1A 2FCSA 4K17A 2LD9A 1WGDA 4P7IA 5CHFA 3TMPB 2DYNA 3BJIA 1AARA 4ZYNA 2M14A 2D9YA 2MX2A 3TFMA 2V3SA 4K7SA 4BFRA 2DN6A 2L3ZA 5CHWA 2N4FA 2N1VA 3ZKJC 3ZRFA 4IUMB 3RCZA 1J0GA 3FM8C 2Z0QA 2Z0DB 2QKLA 3GYPA 1Q67A 2C7NB 4WWPA 4WQOB 1EF1A 4DBBA 1A5RA 5IA7A 2EJ8A 1WXSA 2KFKA 1V5OA 4HB3B 2WYQA 1Y5OA 5C16A 2N1WA 2WDTB 2L1CA 5DPTA 1LW3A 1DDWA 5D27A 2Z0OA 5D3WA 3IHPC 4WJNA 2KJHB 4HB4B 3WYFB 4Z2NA 2GBKA 5TR5A 1UPRA 1UBQA 3VQIA 3CIKA 1TBEA 3DBRI 1LQBA 1K5GB 1ZC4B 2NR2A 3DVNV 3VUYA 4W9EA 4F8CB 5L83A 2KQSA 4AOFA 3ZDTA 3ZTCA 5G2NA 2LWPA 1WI1A 4A20A 3CSFA 2IBIB 4GZUA 3SO6A 3A1QA 2JRIB 3PSCA 2MBHA 1K5DB 4MH0E 3HK0A 2LGDA 1PFJA 2BKRB 1KOTA 5J3TA 3PPAA 4WSFA 2OTXA 2JUOA 4ANUA 3DCGA 2O2VB 3V60A 2YS5A 1KM7A 1YIWA 3LJ3A 2K8CA 2MDXA 1WH3A 4GB9A 4OVUA 3L13A 4E74A 4FJZA 4AP4C 2DLWA 1E8XA 1WJUA 5KQ1A 3OLMD 4MDKE 1I7AA 1LM8B 4DDGD 1I35A 2KK8A 2RGNB 1KLVA 2EMSA 4TYZA 5J17A 1OTRB 1EAZA 1FHWA 1P5TA 1WY8A 3ZNGC 2D9VA 2RVBB 3QQ8B 3W1SA 2RLOA 1WF9A 2N9PC 2ZJDA 5DPWA 3ZDMC 3DXEA 4HATB 2K25A 3JYUA 4MGYE 2RSUA 4MGKE 3WALA 2OQBA 2CU1A 4HDOA 5HE0A 2P0DA 3SU8X 5EDSA 1SE9A 3PLUA 1IRSA 1OQNA 3ODXA 4RM8A 2DAFA 2LGYA 2L00B 1WM3A 3KZ1A 1I2HA 3TJPA 2WX0A 4HAUB 3LJUX 1P9DU 2D9WA 2JWZA 2DX1A 4F7HA 3UINB 3VDZA 2AYOB 1GUAB 1BTNA 3PGEA 3KW5B 2ASQA 3AXCA 2D07B 2LRUA 3N32A 1YX5B 2DENB 2KLGA 3T06A 2Y8FA 2LI5A 1PQSA 3BY4B 2KWUB 4IM3A 1J8CA 2J0MA 4HWIB 2LVPA 1YJ1A 2RSGA 2NBUA 3B1LX 1C3TA 1U2BA 2KDBA 2R0DA 2W2XC 5CX3A 1P6SA 4Z2MB 4A6FB 4AUQC 2M17A 3PREA 4A5KA 2OJRA 4GDKB 2YLMA 4HLEA 2KLCA 5CLLB 4YONA 2ROZB 4XZ4A 4G11A 3ZIMA 1XT9B 1IYFA 1DROA 1FGYA 1WVHA 2NVUI 3QCAA 5DPRA 3IBEA 3ALBA 4IW0A 4HB2B 2D4QA 3VHTC 4A3PA 4URKA 1RRBA 3N7CA 3M3JA 4HPLB 2FCMA 4CYEA 1MIXA 2W9NA 2EKEC 3KVFB 2DKQA 3NS8A 4HK2A 1UNQA 3RZWC 5E6OA 3DVGX 3DBLI 2LKOA 4DBGA 1YD8U 2K6DB 3L08A 3N3KB 4GN1A 1XR0B 2LASA 1RLFA 2GJYA 2C9WB 3PV1A 2DZMA 1Z87A 4WJQA 4EOYA 1XD3B 3JVZX 3BINA 1DDMA 4GXBA 4TKNA 1EUVB 1P3QU 2COCA 2MBBB 5JHBA 1RFAA 1U29A 2DZJA 1EO6A 2O6VB 2RD0A 3DBSA 2W2XD 3ML8A 2K2UA 1V5MA 3WAPA 1WX9A 3SD5A 2JP2A 3L54A 2VRRB 2HE7A 4ANVA 5E6PA 1S1QB 5LLIA 3ZNID 3QA8A 2ADZA 3PT2B 1WMHA 2HTHB 1V5UA 3UZTA 1ZM0A 1OQYA 5JHGA 1WZ0A 2DYOA 1LB1A 2JF5A 2MWSB 2UYZB 5HE1A 3B08A 2Y8GA 1KI1B 1W1GA 4MEMA 4NAWB 3S2AA 4F7UP 4G0NB 4IC7B 3DOWA 1TXDA 2LYDA 2NZ8B 1W1DA 4KHAA 5CLQB 2N7DA 2A5UA 2GCJA 5FI0A 3PVWA 1OEYA 2ZCBA 1HE8A 5DIFB 2ELBA 2GBRA 2GBNA 2YS1A 2OOBB 3PSEB 2K1FA 4KDLB 2B3AA 3P2BA 1UH6A 3APDA 2KC2A 4LDTB 2KANA 4II3B 3KSYA 4K7WA 3CMMB 4WJPA 2DHKA 5GMVA 4AWJA 1D3ZA 4II2B 1M7EA 5E6NA 3QIJA 3A8QA 3DPDA 4KHBB 4CHMA 5C79A 3A98B 3IVFA 3HHMA 5CHVC 1V2YA 2HTHA 4X57B 3R7QA 3WAOA 1R4MI 4FHJA 1NBFC 4ZRIA 4BBNF 1V9JA 1ZGUB 2ZCCA 4GDLB 2DYBA 2V76A 3NZUA 3PHWB 3TIXA 3RZFA 1E5WA 1F9JA 2ZEQA 4WVFB 4EUTA 4NNJB 1WI0A 2NPTA 5AZGA 4HAYB 3R3MA 1QZEA 3RYTA 4MK0A 1BT0A 2KQ7A 2H7EA 3SNHA 3K9PB 1KZ7A 3X23A 4TV3A 5IAAC 3UIOB 3A9KB 4IAPA 1Z5SB 1U27A 2DTCA 2KD0A 2O2VA 2DKPA 2W2WA 2KVRA 2KX0A 2LZ6A 5D7GA 2H7DA 1K8RB 2RGFA 3RUIB 2MLBA 1S3SG 2L76A 2PE6B 1WMHB 3QX1A 4XC2A 3PHXB 3PRPB 1MPHA 5LOPB 1UZXB 4HXDA 4WAAA 3V6EB 4W9JA 3NSUA 1XCGA 2XK5A 4IWQA 5LXIB 4WJOA 3QHTA 2CY5A 3KUZA 1EF5A 2NCNA 5HE3A 1ZC3B 1RAXA 3ZNHB 3ZW3A 2Y7BA 1TGZB 2KXJA 2QKMA 1BAKA 4NY0A 2R09A 1MK7B 4LJPB 4NPNA 3TL5A 1X1FA 3UQAA 2J0JA 2G35A 3AU4A 3SUZA 1C1YB 2AL6A 2G4SA 4JIOU 5D2MB 2D9ZA 1N3HA 1EVHA 1VD2A 3ZTDA 2LULA 4M8NA 3GYOA 2DA0A 2GCLA 2YT1A 3ULCA 4FN2A 1KZGA 4NJ7A 1UPQA 4D0NB 3SHQA 4IWOA 2KDEB 5C6RA 5AZHA 5G55A 4NJ6A 2N0YA 5LONB 2FJLA 2LRWA 4W9LA 3RD2A 4AJWA 4HHVA 3VXWA 2BF8B 4MSMB 5J3QA 4EFOA 1J0WA 2FIFA 1TZ1A 2EMTA 3ZLZA 4DDID 3DVNU 3ML9A 3V5WA 2BCJA 4HAXB 3APCA 2N9XA 3ULBA 2PZ1A 5EFXA 2BYEA 1U5GA 2ELAA 4F7GA 1UELA 2LG1A 2G45B 2N23A 1TJ6A 2NPTB 1ISNA 1QQGA 4W9CA 1DYNA 2J0KA 4JL9A 4BKTA 4KAXB 2KFJA 4EZKA 1UBIA 4A6FA 2KMCA 2KHWB 2ZPNA 5DHAB 2IZVB 2CKHB 5GOWB 3WA0A 2CHXA 2UWQA 3FEHA 3NOBA 3D8EA 4MELA 1H4RA 4DHZB 1MAIA 1X1MA 4FJYA 4MSQB 4KV2A 1WYWB 2DFKA 4DK5A 4GIVA 3AULA 2NS5A 3VFKA 5JZEB 2LJ5A 3X0WA 3MDBC 3QJZA 2KUPA 1H8CA 2GOWA 4FBJB 1Y8RC 4FJVB 4HVBA 3WAMA 3QK0A 1X11A 2I5CA 1WRDB 3C0RB 1XD4A 2BGFA 2CS4A 4K2PA 4HDQA 1EGXA 1WGRA 2IO0B 1MIZB 2MP2B 2FCQA 2N7EA 3HM3A 4GMVA 1Z2MA 1BWNA 2COAA 3N30A 4HPMB 4OVVA 3VH3B 3QAQA 2UZSA 5DH9B 2ZPYA 4I6NB 3A4SC 4MGIE 4RM9A 5JLJB 4B95A 1V6EA 3H7PB 3IG3A 4JGHB 3P6AA 4ICVA 2UZRA 2KCJA 2J7QB 3PRMB 2RPQA 2N9EB 1LXDA 2KO3A 2XK5B 3W1SC 4F7ZA 4ICUA 1WG7A 4JQWC 4DHZE 4I6PA 5LXHA 4PQ0A 2IYBA 5KCVA 2L8JA 2HJ8A 2MQJA 4BKGA 1V49A 1GC6A 1Q0WB 3VTUA 2JXXA 2Z0EB 3A1QB 1PLSA 5D3VA 1WIAA 2DX5A 2C7MB 2FIDA 3JW0X 2KOXA 2I5FA 2VRWB 1WX8A 2L05A 3NY5A 3HW2B 5C23A 1IP9A 4IOYX 3H7SA 3PG7A 4DX90 1WGHA 3KRXA 4GGQA 4HAWB 4GSWA 1V86A 3R66C 5JH5C 5D3XA 4KVGB 4MJSA 2CODA 2MWNB 5JHAA 5AEKB 1GC7A 2ZVOA 2CRFA 4NAWA 3L0WB 2DYMA 2L0FA 4BKSD 3HM6X 3PLVA 3Q3JA 3D8FA 1X05A 1V5TA 3KUCB 3ML4A 4WWOA 5JHHA 4BOSC 2CHWA 1VCBA 2K2JA 3G9WA 5AZFA 1UNRA 1V88A 2CY4A 3FSSA 3QBVB 4MY6A 1T0YA 4LJOB 4W9GA 3UF8A 4K81A 5KHOA 2GBJA 1U4AA 5D3YA 2JVCA 3PS6A 1I42A 1L2NA 3O65B 2KKCA 2XEWA 1H10A 4DHJB 2CAYA 2WX1A 5DCNA 2LVQA 2BYVE 4CHKA 4DWFA 3ODWA 3VVWB 2V1YA 3H6NA 1QC6A 1NTYA 2GS0A 4Y94A 1PMSA 4HAZB 1WGQA 2DZIA 2JZ3B 4XX5A 2FNJB 2LUEA 4GDLA 4KIKB 1UNPA 3O96A 3PP2A 3M62B 2O6VD 2KNBA 1WXAA 2MBOA 3ZO5B 3L10B 4NSWA 3QC8B 2MBEA 3ECIA 1V5PA 1Y19B 1ZSQA 2EC1A 2D10A 2AWTA 1OGWA 5HE2A 4DXAB 2BKFA 4DHJD 3H7PA 3ZRCA 2G4DB 4G50A 2KDIA 2IY0B 1XX0A 1GNUA 4EMOA 2A4ZA 2ZVNA 2I1JA 2ZZPB 3L16A 2GBMA 3ZVVA 1FOEA 2E2XA 1WJ1A 5DI9B 1KJTA 2YSZA 1UGMA 3A9JA 2I1KA 3ZUNA 4EZJA 4EZLA 5JP4A 2D11A 1Q5WB 2VKIA 1P3RA 1FHOA 2FAZA 4PS3A 2X18A 2K8HA 4GDKA 2JZZA 4PS7A 5D6JB 3VH4B 4ASWC 4F1SA 2RNRB 2BYFA 2M8SA 3VUXA 3VOQA 5C5BB 4EKUA 4HAVB 2DZKA 3P7ZA 2L0TA 1WM2A 2IY1B 3GOEA 3SV1A 5KHQA 1GJZA 5J2RA 1P1AA 2K8BA 2P0FA 1DBHA 1UEFA 3KRWA 1M94A 1Q1OA 2G3QB 3JSVB 1RRPB 4IM0A 4FHKA 4W9DA 2O6VA 3OJ3A 4MGZE 1R4NI 2COFA 3TVVA 2PPHA 3CF6E 1U5FA 2CR5A 4HCPB 4WWNA 3KYDD 2XBBC 3UQBA 2BWFA 2R2OA 3HQCA 2Y5BB 3DQVA 4TUUA 3PEGA 2M1MA 3M63B 1WE7A 3DVGY 3MJWA 3U7DA 1TQZA 1V81A 1L7YA 3AJ4A 3ZVRA 4CHJA 1WR1A 2V4LA 4GU2A 4K1RB 3KH0A 4KZ0A 4PYUA 2KGXB 5CTRC 3M1IB 1J19A 1WZ3A 4HB0B 1WGYA 3SDLC 2J59M 3CXBB 3DBHI 2K00A 3V61A 4FA6A 1E8WA 5FI1A 4JLCA 2RUKB 3PVLA 4LCDE 3DDCB 3PZDA 1OMWA 3VTVA 4H8SA 2LVOA 3KUDB 1NU2A 4K2OA 1U5DA 3EC8A 1WGUA 3WANA 4ZRKA 4BOZB 4KSLC 4M0WB 4BKSA 5KQ4A 1WX7A 2L2IA 4MT7A 1X86A 1MKEA 1WJ4A 1LFDA 1WJ6A 2MP2A 2PE9A 3A9JB 3D32A 1MK9B 2DHIA 3I3TB 2MBQA 4J6IA 2MA9B 5D94A 4CO7A 3D8DA 1V80A 1SIFA 3T8MA 4FADA 4IFSA 2NBWB 4A3OA 1YQBA 2JPHA 2D3GA 2YRYA 3NHEB 1YX6B 3VUWA 3QWZB 1GG3A 2FUHB 2ZNVC 3CSTA 2C60A 3ONSA 1V61A 2JY6A 3AI5A 4B9KA 2P0HA 5C5BA 4BBKA 2MSED 4C0AA 2KWCA 1W1HA 4ANWA 3DXDA 2DHJA 4TQ0A 3UIPB 2YF0A 1ZKHA 2KTFA 4HJKA 2D2QA 1OY2A 1E90A 2KMAA 2LXAA 2R2QA 4EJNA 1E7VA 1FXTB 3MPXA 1M7RA 2KTRA 3KYCD 2DHZA 4KDIC 3U30A 2C7HA 2WWZA 1WJMA 3MHSD 3TCAA 1IPGA 1MG8A 1U5EA 3H9DA 3GZNI 4M8MA 4E3CA 1BTKA 2RR9A 2IO1B 1OEYJ 1ZW7A 2KZRA 2IO2B 3A4RA 3TBLD 1E8ZA 1FHXA 2P8VA 1B55A 1AQCA 3SYXA 2MRPA 3PTFC 3RULA 4A6KA 4B6HA 2K39A 4A6HA 4MM3A 2CHZA 2KDFB 5L81A 4TQ1A 3F0WA 1SHCA 4W9HA 4B6WA 4AJYB 1G6JA 1WR6E 1WXMA 3TW1A 2NMBA 2GMIC 2PEAA 2BWES 5L95C 2L7RA 4KHOA 4MJSB 2UVMA 4GOCA 4EEWA 3RT3B 4WJ7A 4BVUC 3OAWA 2KJRA 3R7RA 2Z0PA 1WXVA 3QWMA 3RCPA 2IO3B 2JT4B 2KTRB 2MFQA 3EFUA 3NZSA 1JRUA 4HCNB 4K7UA 2PJHA 4PYZA 2DYQA 5C1ZA 2M4NA 2Z59B 2MW5A 3H1UA 2DX5B 4N9F4 2Q13A 2M0XA 3L17A 4RMAA 1FB8A 4NQKE 1TTNA 3EHVA 4I6LB 3KY9A 3V6CB 2AEHA 4XWXA 3ZNZB 4W9IA 3MTNB 2DAJA 2IYDB 1AWEA 3TO1A 3A9KA 3U8ZA 1SGHA 4ZDVA 4W9FA 4PS8A 3EECA 2IFSA 2MKRA 3ODOA 1DDVA 4BBNC 4KSKC 3QARA 3WIMA 3A8PA 3OANA 2NBVB 5FR6A 3PVUA 1NTVA 2AL3A 3APFA 5BO4B 1XKEA 1P98A 2XQNM 2YT0A 4KZCA 2HD5B 3M95A 2LOZA 4ANXA 3OJ4B 1XQQA 3B0AA 2KX3A 3A33B 2JRHA 1CMXB 5DPSA 4LDTD 1WJNA 2K6QA 4FULA 3VTWA 3HIZA 3V62A 1WGGA 3VIAA 3Q3FA 3IFWB 1FAOA 2ROVA 1E8YA 5J18A 4FLHA 2KN5A 1RJ2A 4DX8A 4G3XB 2LXCA 3PRZA 1ZVRA 4W9KA 1WE6A 1P0RA 3DXCA 4ZRJA 2MCNB 1UD7A 2KJ6A 1WFYA 1NI2A 4IG7B 1XODA 2LOXA 3T9LA 3W1YA 2M38A 5DHFB 4E71A 2YS3A 4KIKA 2ZNVB 4GPTB 2KWVB 3K9OB 3JSVA 4IM2A 2C5LC 2KFKB 1NDDA 4IWPA 2D9XA 4L6EA 2BPSA 2FCNA 3LDZE 2LGXA 3UGBB 3ENEA 1FGZA 3F5RA 4GMXB 1X1GA 5J3YA 4PNKA 2REXA 3AU5A 4NQLB 3VAWA 2YVCA 5HKHA 1E7UA 2VSZA 2QHOA
chains in the Genus database with same CATH superfamily
2KC1A 2FCSA 3ABVB 3BJIA 1MHHE 4ITKA 2V3SA 1I4QA 2N4FA 3GYPA 1E10A 3AEEB 3AV8A 4NJCA 2YEPB 2N1WA 2WDTB 2L1CA 2WXMA 2JSVX 5D27A 5D3WA 1TJEA 4WJNA 1SJED 1NYQA 2WXPA 2K5PA 1LGRA 1K5GB 2R61A 4KGTA 2LWPA 2MEKA 2NMQA 2WNMA 4YTMB 4GZUA 4ZHPA 2MBHA 3PSCA 3TEZA 4ANUA 2LUMA 3DCGA 1KM7A 1WH3A 4FJZA 5IO9A 4C4VA 4MDKE 2RGNB 1OTRB 2JZPA 1FHWA 1P5TA 3QQ8B 2RLOA 4C80A 2RRFA 2HDEA 3ZDMC 4XYCA 1UWXA 2V3PA 4ZRQA 3NS1A 3KWVA 5EE0A 1IRSA 2QIEB 3AE8B 2LGYA 1WM3A 2PLPA 3TJPA 4HAUB 1R4NB 4WH4A 3Q6BA 1BTNA 1SE2A 2J52A 4XGAB 1VLBA 1CJEA 1BUIC 2Y8FA 2QC8A 3BY4B 2KWUB 1C3TA 4ZHOA 1FPYA 5CX3A 3PREA 1T77A 2GI9A 4GDKB 2YLMA 4S17A 2ROZB 3V05A 2K49A 4G11A 1K51A 1FGYA 2D4QA 3VHTC 1RRBA 2W9NA 4HK2A 1UNQA 3L08A 2GJYA 2C9WB 3AEDB 2Z8LA 1Z87A 2RDBC 1P3QU 2MBBB 1EO6A 2H89B 5BMHA 3Q8AA 2JP2A 3TSSA 5E6PA 5LLIA 3ZNID 5G5GA 1WMHA 1OQYA 2JF5A 2DYOA 1W1GA 4REZA 4WQMA 3RNAC 2N9KA 2A5UA 1L0YB 1HE8A 5BYRA 2OOBB 4KDLB 3APDA 4AWJA 4R3DA 3QIJA 1B1ZA 2KQ4X 4IDIA 5FKAC 3A98B 4S0RA 5CHVC 3WAOA 1SIJA 4FHJA 4BBNF 4ZRIA 1JWUD 4LLGM 2ZCCA 2DYBA 4O1NA 1F9JA 2ZEQA 1WI0A 1MJDA 2NPTA 2ONQA 4HAYB 3ETRA 3R3MA 1QZEA 3RYTA 1STEA 1KZ7A 3X23A 2WXKA 1U27A 2KVRA 2RGFA 4XC2A 2R2YA 4IWQA 2PKOA 4OW0A 1XCQL 2CY5A 1I4XA 4QJ3B 1EF5A 3E56A 1ZC3B 1YQ3B 2Y7BA 3Q14C 2GLSA 1BAKA 1ZP0B 4TMAB 2J0JA 4JIOU 3AU4A 3SUZA 1KOTA 3ZTDA 1SJHD 5D2MB 2D9ZA 2DA0A 2YT1A 3SHQA 4D0NB 2KDEB 1IGCA 2N0YA 1C4CA 2CJOA 2BCJA 4HAXB 3ULBA 5EFXA 3AXCA 2ELAA 2N23A 1I4HA 2J0KA 4BKTA 4YSZB 2KFJA 4OVZA 2KMCA 2UWQA 2CKHB 5GOWB 4GOUA 4MELA 4KV2A 1NENB 3ZJTA 5JZEB 2NS5A 1H8CA 3X0WA 2KUPA 1N6ZA 1Y8RC 4MH8A 4HVBA 1B9RA 3BYYB 1HTOA 3QK0A 2JYTA 1X11A 5BO4B 3HM3A 3OJ4B 1UNSA 1MIZB 2N7EA 1FO4A 4GMVA 1Z2MA 3QAQA 2EELA 5JLJB 1FXAA 4B95A 4OT1A 4ICVA 2KCJA 2J7QB 3AE1B 2QDFA 1BXTA 3HIEA 2IYBA 1V49A 1GC6A 2Z0EB 1JW9D 2DX5A 2I5FA 2VRWB 1WX8A 3HW2B 1R4MB 3PG7A 2GUMA 5JH5C 1GC7A 2CRFA 3L0WB 1OFFA 1T0SC 3C8YA 2WQYB 3D8FA 3ML4A 1C9FA 3QBVB 1V88A 1T0YA 1I42A 1JWAD 1L2NA 2KKCA 1H10A 4DHJB 1ET9A 5DCNA 4H2AA 4XDDA 2V1YA 2GS0A 2LHEA 3SFDB 3PP2A 1QF6A 2V9HA 1V5PA 1ZSQA 1JMLA 1OGWA 3NZ3A 2BKFA 1XX0A 1ROEA 2ZVNA 2ZZPB 1FOEA 5DI9B 4EZJA 1Q5WB 1P3RA 1FHOA 2FAZA 4GDKA 4PS7A 3VUXA 1P1AA 2P0FA 1UEFA 1Q1OA 4W9DA 1OQQA 3FKYA 4IM0A 4FHKA 2O6VA 2COFA 1FD6A 4WWNA 3L4PA 5AUIA 3HQCA 2Y5BB 4TUUA 3M63B 3T3NA 3B9JA 1L7YA 3AJ4A 1WR1A 4KZ0A 4M00A 4K1RB 4RFBA 3DHHC 2WU2B 2K00A 4OZCA 1EWYC 3V61A 2RUKB 3NWFA 1MPEA 4H8SA 3ZJUA 1DOXA 1ET6A 4KSLC 3SFEB 2ZW0A 1WJ4A 2PE9A 1X86A 2INDC 2MP2A 3I3TB 3A9JB 5D94A 3TEYA 3VRBB 2D3GA 1YX6B 2ZNVC 1D6EC 2X38A 2JWUA 4P1BC 2P0HA 4BBKA 4HPPA 2MSED 2KWCA 2WXRA 4TQ0A 5D3DA 2YF0A 2BBCA 2R2QA 3MPXA 3B77A 1L4DB 1MG8A 1BTKA 1KFYB 2G1EA 4US9A 1ZW7A 3P1MA 1FHXA 4XDCA 2K0PA 4B6HA 2RDGA 4MM3A 2CHZA 4KKJA 3F0WA 1WR6E 3Q3NC 5L95C 2PEAA 3AMZA 4RH6A 5T8IA 4MJSB 3NW8A 1J7BA 4WJ7A 2D3CA 3RCPA 2JT4B 1WYGA 2E6XA 2Z59B 2MW5A 4N9F4 4M02A 4RMAA 4I6LB 1SGHA 4ZDVA 1ENFA 2IFSA 2MKRA 3W9CB 1DDVA 3AEGB 3IT4B 3AEAB 3A8PA 5FR6A 3PVUA 2AL3A 1XKEA 2HD5B 1P7EA 4ANXA 2K8EA 3B0AA 2K6QA 2Q5WD 3BVGA 3VTWA 1K52A 2BB5A 4HEA1 3VIAA 1FAOA 2ROVA 1E8YA 3AE3B 1QKZA 1ZXHA 2KN5A 4W9KA 4C7ZA 1ZVRA 2BYTA 1UD7A 2KJ6A 1JALA 1XODA 2LOXA 2QJLA 3HSAA 4K3BA 4L6EA 3ENEA 4MT5A 2MJ3A 1X1GA 2REXA 2YVCA 1FFUA 1E7UA 2QHOA 1V89A 2M56B 2DYNA 1XLOA 2DN6A 5CHWA 2N1VA 4IUMB 3RCZA 5EE9A 2Z0DB 4RGMA 4WWPA 4DBBA 5IA7A 2EJ8A 1QILA 4HB3B 1Y5OA 5C16A 5DPTA 5MPOA 1VZ6A 3Q8CA 3WYFB 4Z2NA 4BZAA 5HI1A 3VQIA 1JQ4A 3MC8A 1ZC4B 2NR2A 5L83A 2MJDA 4F8CB 1L0VB 2I2YA 4AOFA 3ZDTA 3ZTCA 1WI1A 3CSFA 3SO6A 2JRIB 3OWEB 1PFJA 2BKRB 3FAHA 3PPAA 4WSFA 2OTXA 1RWSA 1UWMA 2XN9C 3Q69A 2D3AA 3L13A 4E74A 4YTPB 3RNFC 1EWCA 3RI7C 2DBYA 3OLMD 4TYZA 1RYJA 3ZNGC 3DXEA 2VZKB 3JYUA 3TUOA 1HZ6A 3GS2A 2LHDA 3R2TA 3SU8X 3ODXA 1EU3A 2BB6A 2IJ0A 2K9XA 3LJUX 2D9WA 2JWZA 2W54A 3DWMA 3PGEA 1F52A 2DENB 3T06A 1J8CA 4IM3A 2PMVA 2J0MA 1YJ1A 2KDBA 1P6SA 4Z2MB 1DYQA 4YT0B 2KLCA 4YONA 4XZ4A 2ZW1A 2BS2B 3ZIMA 1XT9B 1DROA 2NVUI 1WVHA 1C78A 4HB2B 2N9LA 3N7CA 1YMHE 4CYEA 1I4PA 3KVFB 2EKEC 5E6OA 3DVGX 3DBLI 1YD8U 3N3KB 1RLFA 3PV1A 3EUB2 1GOZA 1EUVB 1DDMA 4GXBA 2COCA 5JHBA 1RFAA 2PTLA 3DBSA 1T0QC 1XLPA 3ML8A 3WAPA 5JXVA 2N0SB 3QA8A 1VR9A 2HTHB 2MWSB 1ZM0A 4KIKA 3B08A 3NVWA 4F7UP 4G0NB 1TXDA 5CLQB 2NZ8B 2N7DA 1OEYA 5DIFB 2YS1A 2K1FA 3WCQA 2KC2A 2AX5A 2KANA 3KSYA 1D3ZA 3CMMB 2DHKA 5GMVA 5E6NA 3A8QA 3DPDA 4KHBB 4CHMA 2FBWB 3IVFA 3P4QB 3Q3OC 3AE7B 1R4MI 1TY0A 1NBFC 1ZGUB 2V76A 3RZFA 1E5WA 3OG5A 4WVFB 3BK1A 2G9HD 1TY2A 1SE4A 3DHIC 1BT0A 5IAAC 3SNHA 3UIOB 4IAPA 1Z5SB 2KD0A 4RCOA 2O2VA 2BTEA 2W2WA 2X8XX 3RUIB 2I38A 3QX1A 3ZQ4A 1F1HA 3PHXB 4WAAA 3V6EB 1YN3A 3MFGA 5HE3A 1RAXA 3ZNHB 1TZOA 4PT5A 4YSYB 2XNAC 3N9YC 3TEXA 2WGSA 4IWOA 3BVZA 1WRIA 4NJ6A 2FJLA 4AJWA 3N20C 4MSMB 2FIFA 2EMTA 3DVNU 3FC4A 2PZ1A 4WJPA 3ZLZA 2NPTB 2LG1A 1UGJA 2G45B 1TJ6A 1KH0A 4W9CA 1HTQA 2WXHA 2IZVB 4BKGA 1X1MA 4FJYA 4D2KA 4MSQB 1WYWB 4DK5A 3AULA 3VFKA 1XCTL 2LJ5A 2GOWA 1FCCC 5AUKA 1AWDA 4FJVB 1HA5A 3AM9A 3WAMA 3C0RB 1J7AA 1WRDB 5IN7A 1XD4A 2CS4A 2IO0B 1EGXA 2MP2B 1PGAA 3P42A 3NWDA 2ZPYA 3A4SC 4MGIE 4RM9A 1V6EA 3H7PB 1D5ZC 2RPQA 1LXDA 3NJTA 4I6PA 1GB1A 1PLSA 5D3VA 2C7MB 3JW0X 5C2TB 4IOYX 1GPXA 1WGHA 3FVCA 4GSWA 3R66C 4OHJA 5D3XA 4MJSA 1YOVB 4NAWA 4L1BA 2DYMA 3PLVA 2PVOD 3Q3JA 1X05A 1V5TA 1A70A 3KUCB 4WWOA 5JHHA 2CHWA 4JX1C 4ZRPA 2K2JA 3BVMA 1UNRA 3FSSA 4MY6A 3UF8A 2RDHA 1UUPA 2GBJA 4A8XC 2CAYA 2WX1A 4CHKA 1NTYA 4GDLA 4RF1A 2O6VD 2KNBA 3ZO5B 3CIRB 3U4EG 1PUTA 3L10B 2WXQA 2MBEA 3QC8B 1TS4A 4ACFA 1L6VA 2EC1A 2AWTA 5HE2A 4DHJD 1E6EB 2G4DB 4G50A 1GNUA 4EMOA 2I1JA 1EM7A 3ZVVA 1KJTA 1UGMA 3RPFC 5LNK1 5JP4A 3AE2B 2VKIA 4PS3A 2X18A 2K8HA 3URYA 2BYFA 2M8SA 2DZKA 2L0TA 4EKUA 3GOEA 1GJZA 3P7ZA 2IY1B 3SV1A 5J2RA 2K8BA 3P63A 3KRWA 2AQ1B 2G3QB 3OJ3A 4MGZE 1VDVA 5BYQA 4J3OD 3TVVA 1U5FA 2CR5A 4DXFA 2XBBC 3UQBA 2E3TA 3ZGZA 3DVGY 1V81A 2V4LA 2INCC 5CTRC 1JWBD 1XEEA 1WZ3A 3U12A 3SDLC 1N63A 4FA6A 1E8WA 4LCDE 2TSSA 3PVLA 5M4YB 3PZDA 1OMWA 3BWUD 3WANA 1NU2A 3SR6A 4ZRKA 4BOZB 2OJWA 4BKSA 1WX7A 2L2IA 4MT7A 1WJ6A 1V1PA 3MJWA 3D32A 1MK9B 4CO7A 4K3CA 3T8MA 3E9SA 4FADA 4IFSA 1HEZE 4XE0A 3NHEB 3EA6A 3QWZB 3CSTA 2C60A 3ONSA 2V3NA 3AI5A 1WXQA 4ANWA 3UIPB 2KTFA 5BMGA 2C7HA 1WJMA 3AEFB 3MHSD 3TCAA 3NUHB 3H9DA 1U5EA 3GZNI 3MJ5A 3A4RA 3BK2A 1E8ZA 3RULA 3PTFC 3PZ8A 2MRPA 4FXCA 4LNKA 2K39A 1T0RC 2WXGA 4B6WA 3AE9B 4LNOA 4AJYB 2GMIC 1J7CA 3NRZA 4KHOA 1KTKA 4EEWA 3KLSX 3MC0B 3OAWA 1WXVA 3VVWB 2IO3B 4FBJB 1I4RA 4PYZA 4N6EB 1JRUA 3DHGC 2IGGA 2PJHA 2DYQA 1L6UA 3PO0A 4P6VF 3H1UA 3KWLA 2Q13A 1CK1A 2KN4A 1FNVA 3B2FA 1FB8A 4NQKE 3ZXVA 2DAJA 3A9KA 2K22A 4W9FA 4ARCA 3W5UB 3U52E 1AN8A 1SXTA 3APFA 1DOYA 1P98A 4N59A 3P4PB 1E7PB 5HG2A 4KZCA 2ICIA 3M95A 2LOZA 4A6QA 3DCXA 3R8BA 4G3XB 1RJ2A 2HJ1A 2KT7A 4A9AA 5HHDG 1P0RA 2MCNB 5FK9C 1WFYA 1TS3A 1NI2A 4IG7B 3AN1A 4E71A 1T3QA 4GPTB 2AQ3B 1AYFA 2D9XA 3F5RA 5J3YA 4MACA 5HKHA 1RM6C 1XXGA 3TMPB 5CHFA 1WGDA 4P7IA 4DXGA 1KRHA 4ZYNA 2M14A 2D9YA 2MX2A 3TFMA 4C4VB 4BFRA 3ZKJC 3ZRFA 2JX5A 1J0GA 3FM8C 3HVZA 4WQOB 1JCKB 1VRAB 4KKIA 1FXIA 1WXSA 1V5OA 2KFKA 1LW3A 1DDWA 2LMCA 2W3RA 2KJHB 4A55A 4HB4B 3N1ZC 4B0EA 2KR0A 1P7FA 3DBRI 3DVNV 2JXTA 4GNKB 2KQSA 1YN4A 4P1CC 5I2MA 2IBIB 3A1QA 3MP9A 3AH7A 1K5DB 4MH0E 1ZDVA 2LGDA 3LYYA 1PGXA 2WHIA 2JUOA 3V60A 2LEKA 2YS5A 1YIWA 1N62A 4GB9A 4OVUA 4AP4C 2DLWA 5KQ1A 3P4RB 4YXDB 1I7AA 2NTSA 1D4BA 2YT2A 1LM8B 1I35A 1KLVA 2EMSA 1NI3A 5J17A 5LG4B 1EAZA 1WY8A 2D9VA 3KQ4A 1N61A 1V1OA 2KWDA 2N9PC 2ZJDA 4HATB 4YTNB 4MGYE 4YSXB 4NAMA 2UU7A 4HDOA 2P0DA 1SE9A 3PLUA 4RM8A 2L00B 3KZ1A 1I2HA 2WX0A 3UINB 1T6BX 3KW5B 3N32A 2D07B 2LRUA 1YX5B 3UI3A 3BZDB 2RMMA 1PQSA 4ZYSA 2LVPA 3B1LX 4WAFA 2W2XC 2W82A 3HVDA 2OJRA 3NG0A 2ACZB 4HLEA 5CLLB 3NVVA 2WLBA 1FCLA 1ZUD2 3QCAA 5DPRA 3IBEA 4IW0A 4URKA 3M3JA 4HPLB 5EE1A 2FCMA 3RZWC 1WGKA 3NS8A 3VR8B 4DBGA 4GN1A 1XR0B 2LASA 2DZMA 1XD3B 3BINA 4TKNA 2QILA 2DZJA 2W2XD 1DGJA 1V5MA 1WX9A 2BS3B 3SD5A 4UDUC 1YQ4B 2HE7A 2RPVA 2VRRB 1S1QB 3C19A 2KIEA 2INPE 3RNGC 4ANVA 2ADZA 3PT2B 3T3OA 1V5UA 5JHGA 1WZ0A 2UYZB 3ZJVA 2Z14A 3VDZA 5HE1A 4MEMA 3S2AA 4AS1A 4IC7B 3DOWA 1W1DA 2ZCBA 2GCJA 1XLNA 2ELBA 2GBRA 4M0WA 4JWUC 2B3AA 2JQRB 1UH6A 2PVGC 4RNAA 3FILA 4II3B 4N58A 1FRDA 2BQQA 4KGRA 3HHMA 2HTHA 5TSSA 4GDLB 2W55A 3NZUA 3PHWB 3TIXA 5C3JB 4EUTA 3O13A 2QCZA 3N1XC 1A5RA 4TV3A 3K9PB 4CQNA 3A9KB 2DTCA 2DKPA 2KX0A 2NTTA 4JWSC 2H7DA 2PE6B 1NVID 3PRPB 2XK5A 1IBXA 5IKCM 5LXIB 4WJOA 3KUZA 2BW2A 3AE4B 3VRAB 1D5MC 1TGZB 2KXJA 2QKMA 4NY0A 2R09A 1MK7B 1I4GA 4NPNA 4L2YA 3UQAA 2G35A 3VR9B 1N3HA 1EVHA 2J4XA 2LULA 4M8NA 4NJ7A 2GCLA 2FUG1 1KZGA 5C6RA 3RD2A 4HHVA 3VXWA 2BF8B 5J3QA 4DDID 5FR3A 3V5WA 2N9XA 1UELA 4F7GA 3HRDD 4KAXB 1UBIA 4A6FA 2KHWB 2IPKD 3GB1A 3NOBA 2WU5B 4GIVA 2VH1A 2Y3AA 4RGTA 1C77A 4K2PA 4HDQA 2FCQA 4OVVA 2COAA 5H92C 1PGBA 4I6NB 1OQRA 2MH7A 3IG3A 4JGHB 2WDQB 3I63C 3W1SC 1GB4A 2XK5B 1IBXB 2Z4DA 2KO3A 2MJEA 4F7ZA 4ICUA 1WG7A 1IUEA 5LXHA 4PQ0A 1HQRD 2MQJA 3CWIA 1Q0WB 3VTUA 2JXXA 3A1QB 3LXFA 5C23A 3NY5A 3H7SA 1TKEA 1MHXA 3IAS1 4DX90 2FJUB 3KRXA 4GGQA 4HAWB 1V86A 4LTUA 2CODA 3H8HA 5AEKB 2L0FA 4BKSD 2D5GA 3IAM1 4L23A 1VCBA 2VZKD 3G9WA 5GXGB 3AB5A 4W9GA 1U4AA 2XEWA 3DBRB 4HKZE 4JPSA 2BYVE 2QSDA 3ODWA 3HUIA 4M01A 1PMSA 2JZ3B 4CSQA 4XX5A 2FNJB 3O96A 3M62B 2MBOA 1Y19B 2KDIA 2IY0B 1V1PB 2A4ZA 3L16A 1WJ1A 1HZ5A 4EZLA 2I1KA 2JZZA 4ASWC 4DIXA 2W3SA 2RNRB 5I2SA 4EE2A 1DBHA 3JSVB 1MVKA 1R4NI 3CF6E 4HCPB 3RFZB 3KYDD 2BWFA 2R2OA 2M1MA 3U7DA 1TQZA 4PYUA 4GU2A 3KH0A 3M1IB 1N5XA 4HB0B 3DBHI 4JLCA 5FI1A 3VTVA 3AEBB 2LVOA 4OSNA 2PIAA 1U5DA 1WGUA 4M0WB 5KQ4A 1HXYD 1LFDA 4W9JA 2MBQA 2MA9B 1SIFA 4A3OA 1YQBA 2YRYA 3TEWA 3AE6B 2SEBD 3MC9A 1C4PA 4B9KA 5C5BA 1QOGA 5EE3A 1W1HA 2PW9A 2DHJA 3RNCC 1ZKHA 4WWMA 1E90A 2LXAA 1M7RA 3U30A 1L4ZB 2WWZA 1IPGA 4E3CA 2KACA 3I5JC 2RR9A 2IO1B 4RGOS 4KX6B 1SB3C 1BMLC 3TBLD 2P8VA 1SSNA 1AQCA 2D3BA 3R2IA 1QOFA 4A6HA 5L81A 4TQ1A 1SHCA 4W9HA 2BWES 2L7RA 2UVMA 4GOCA 1TS5A 4BVUC 3W2DA 3QWMA 3EFUA 2MFQA 3NZSA 5C1ZA 1UF0A 2M4NA 2KYWA 3W5VB 3L17A 2M0XA 1YNTE 2L52A 5E6JA 3EHVA 3KY9A 2AEHA 4W9IA 2JU6X 2IYDB 3TO1A 3U8ZA 4PS8A 3ODOA 3P4SB 4KSKC 3NVZA 1WSPA 2NBVB 2FE8A 3I9V1 2XQNM 1XQQA 2CU3A 2KX3A 4LDTD 4ARIA 1GAQB 1E0ZA 3V62A 1XLQA 5BYSA 5J18A 2LXCA 2LGSA 3DXCA 1TKGA 1F2RC 5DHFB 3JSVA 4IM2A 2C5LC 2FCNA 2LGXA 1FGZA 4PNKA 3VAWA 2BYEA 3FILB 4YL8A 2KAJA 2LD9A 4K17A 1TT5B 1AARA 1V97A 2SAKA 4K7SA 2L3ZA 4TSSA 2Z0QA 2QKLA 1Q67A 2C7NB 1ZXIA 2KDMA 4KGSA 1EF1A 1FM0D 2WYQA 2Z0OA 4JE3B 3IHPC 2GBKA 5TR5A 1UPRA 1UBQA 4PK1A 3CIKA 1TBEA 5H8YE 1LQBA 3VUYA 4W9EA 5G2NA 4A20A 2B76B 3Q3MC 1QQRA 5HFYA 3HK0A 5J3TA 2O2VB 2WDVB 5BMIA 3LJ3A 2K8CA 2MDXA 1Q10A 1XO3A 2BVCA 2YEPF 1E8XA 1WJUA 1FMAD 4DDGD 1JWSD 1YN5A 2KK8A 3BYTB 3SEBA 4RGNA 2RVBB 1I7HA 3W1SA 1WF9A 5DPWA 2K25A 1T5XD 2RSUA 4MGKE 3WALA 2OQBA 2CU1A 5HE0A 2GB1A 3AECB 5EDSA 2WXLA 1OQNA 2DAFA 2ZKMX 2Z59A 5IP4D 4IKGA 1KLGD 2MHJA 1P9DU 1C76A 2DX1A 4F7HA 2AYOB 1KF6B 1CQVA 1GUAB 2ASQA 2WXIA 1R7SA 4LK0M 2KLGA 4LNIA 2LI5A 1N5WA 4HWIB 1JWMD 2OEDA 2RSGA 2NBUA 1N60A 1U2BA 2R0DA 4A6FB 4GLSC 4AUQC 2M17A 4A5KA 1SEBD 1PDXA 1VZ7A 4XWWA 2QEJC 1IYFA 4QXAB 2BS4B 4QAYA 3ALBA 4A3PA 1L0XB 1MG4A 1MIXA 2DKQA 4C00A 3GE3C 4KHBA 2LKOA 2K6DB 4WJQA 4EOYA 3JVZX 2WXNA 3MHZA 1U29A 2O6VB 2RD0A 3IT6B 5D3IB 2K2UA 4L1RA 3L54A 1YJIA 1QLBB 3UZTA 5KHQA 2LFIA 1LB1A 3N1YC 2Y8GA 1KI1B 4NAWB 3PZ7A 4KHAA 2LYDA 3LB8C 5FI0A 3PVWA 4OZAA 3PSEB 2GBNA 4HROA 5IRSA 1K50A 3P2BA 4WIPA 1ZDXA 1VJKA 4LDTB 4K7WA 4RF0A 4II2B 1M7EA 4LNFA 5C79A 1V2YA 4X57B 2WS3B 3R7QA 3U2SC 1V9JA 2Y5PA 1M4VA 1SF0A 1QOBA 4NNJB 2J53A 1DOIA 4MK0A 2KQ7A 4LNNA 2H7EA 4ZOHC 2LZ6A 5D7GA 1K8RB 2MLBA 1S3SG 2L76A 1WMHB 1FEHA 1MPHA 5LOPB 1UZXB 4HXDA 1IP9A 3NSUA 1XCGA 1ZOYB 3QHTA 3RNBC 4XWTA 2NCNA 3ZW3A 1MI0A 2KUQA 3TL5A 4LJPB 2LJIA 1X1FA 1IGDA 4USAA 1C1YB 2G4SA 2AL6A 3EGRA 4AQ7A 1VD2A 1AW7A 1ESFA 3GYOA 4DWFA 4FN2A 3ULCA 4OZBA 3RN9C 1UPQA 5AZHA 5G55A 5LONB 2LRWA 4W9LA 4QJ4B 4WURA 1JRPA 4EFOA 1J0WA 4P16A 1TZ1A 3ML9A 3APCA 1U5GA 1K53A 1ISNA 1QQGA 1DYNA 4JL9A 4EZKA 2CJNA 1ACCA 2ZPNA 5DHAB 3U7ZA 3WA0A 1TKYA 2CHXA 4DHZB 3FEHA 3D8EA 1H4RA 1MAIA 2DFKA 4B0MA 3MDBC 3QJZA 3Q2AC 5G5HA 1FRRA 2WP9B 1TIFA 1ZPSA 2I5CA 3GZNB 4HJGE 2BGFA 1WGRA 1NEKB 4HPMB 1Y56A 1CZPA 1BWNA 3N30A 3VH3B 2DNFA 2UZSA 5DH9B 1JROA 2GRIA 2EKIA 2JYEA 3P6AA 2UZRA 3PRMB 1NYRA 2N9EB 1F2RI 1YJJA 3Q8EA 4JQWC 4DHZE 2IDYA 5KCVA 2L8JA 2HJ8A 3RNEC 1C4AA 1WIAA 2FIDA 3B2GA 4K7UA 2KOXA 2L05A 2K3UA 4KVGB 1E9MA 2MWNB 5JHAA 2ZVOA 3ZYYX 3HM6X 1WWTA 4BOSC 2KVZA 5AZFA 2KMMA 2CY4A 4LJOB 4K81A 1V8CA 5KHOA 2WXJA 2JVCA 5D3YA 3PS6A 1ZE3D 2H88B 3O65B 4HSIA 2OHFA 3EFCA 2LVQA 3H6NA 1QC6A 4Y94A 4HAZB 3A58A 1WGQA 2DZIA 4NZLB 2LUEA 4HRSA 4KIKB 1F0ZA 1UNPA 3V3XA 1WXAA 1PFDA 4NSWA 2AQ2B 2M19A 3ECIA 3J9CA 3NWAA 2D10A 4DXAB 1TYGB 3H7PA 3ZRCA 1FFVA 1PYWD 3GP7A 1SBBB 2GBMA 2E2XA 3A9JA 2YSZA 1FNWA 3ZUNA 2D11A 1RFKA 5D6JB 3AE5B 3VH4B 4F1SA 3VOQA 5C5BB 4HAVB 1WM2A 1L5PA 2INNE 4C7YA 1M94A 1FNUA 1RRPB 3DBLB 2PPHA 4YWGG 2IGHA 3NVYA 3DQVA 2KIGA 3PEGA 1QOAA 1WE7A 3ZVRA 4CHJA 2KGXB 1J19A 1WGYA 2J59M 3DBHB 3CXBB 2DLBA 3DDCB 3I57A 3KUDB 4K2OA 3EC8A 2WXOA 2L83A 3VUWA 1MKEA 2DHIA 3RMKC 4J6IA 3D8DA 1V80A 1VZ8A 2NBWB 2JPHA 2WXFA 1GG3A 1TS2A 2FUHB 1V61A 2JY6A 5I4DA 4C0AA 3DXDA 4HJKA 2D2QA 1OY2A 2KMAA 4EJNA 1E7VA 1FIQA 1FXTB 2KTRA 3KYCD 4KDIC 2DHZA 3Q8BA 1QT9A 2NBVA 2WDRB 4M8MA 1MFWA 3OHMB 1OEYJ 2KZRA 2VH2A 2IO2B 5IOIA 2DWQA 1B55A 3SYXA 4A6KA 3GE8C 1D5XC 2KDFB 1F77A 2L32A 1XF5L 1G6JA 1WXMA 2IGDA 3TW1A 2HTME 2NMBA 2L1AA 3RT3B 2M0AA 2KJRA 3R7RA 2Z0PA 2KTRB 4HCNB 4US8A 1LO5D 2DX5B 1EU4A 4Q2JA 1MI1A 1TTNA 3V6CB 2V0GA 4XWXA 3ZNZB 3MTNB 2Z13A 1AWEA 3EECA 3ZXRA 4D6WA 2LGIA 2N7JA 1ZYIA 4BBNC 3QARA 3WIMA 3OANA 1C79A 1NTVA 2V4IB 4QJ5B 2YT0A 2BT6A 3Q8FA 4MM3B 3A33B 4DQOC 2JRHA 1CMXB 5DPSA 1WJNA 4FULA 4IOIE 2Y5CA 3HIZA 1WGGA 4A90A 3Q3FA 3IFWB 4FLHA 4DX8A 3PRZA 3IXSA 2ON8A 1WE6A 4ZRJA 4C56C 1KLUD 3T9LA 3W1YA 2M38A 2J42A 2YS3A 1SE3A 2ZNVB 3DWGC 2KWVB 3K9OB 2KFKB 4IWPA 1NDDA 4BAXA 3LDZE 2BPSA 3UGBB 4GMXB 4HKQA 4NQLB 3AU5A 5AZGA 2QMTA 2VSZA 3BIID
chains in the Genus database with same CATH topology
1V89A 4YL8A 2KC1A 2FCSA 4K17A 2LD9A 1WGDA 4P7IA 5CHFA 3TMPB 2DYNA 3BJIA 1AARA 4ZYNA 2M14A 2D9YA 2MX2A 3TFMA 2V3SA 4K7SA 4BFRA 2DN6A 2L3ZA 5CHWA 2N4FA 2N1VA 3ZKJC 3ZRFA 4IUMB 3RCZA 1J0GA 3FM8C 2Z0QA 2Z0DB 2QKLA 3GYPA 1Q67A 2C7NB 4WWPA 4WQOB 1EF1A 4DBBA 1A5RA 5IA7A 2EJ8A 1WXSA 2KFKA 1V5OA 4HB3B 2WYQA 1Y5OA 5C16A 2N1WA 2WDTB 2L1CA 5DPTA 1LW3A 1DDWA 5D27A 2Z0OA 5D3WA 3IHPC 4WJNA 2KJHB 4HB4B 3WYFB 4Z2NA 2GBKA 5TR5A 1UPRA 1UBQA 3VQIA 3CIKA 1TBEA 3DBRI 1LQBA 1K5GB 1ZC4B 2NR2A 3DVNV 3VUYA 4W9EA 4F8CB 5L83A 2KQSA 4AOFA 3ZDTA 3ZTCA 5G2NA 2LWPA 1WI1A 4A20A 3CSFA 2IBIB 4GZUA 3SO6A 3A1QA 2JRIB 3PSCA 2MBHA 1K5DB 4MH0E 3HK0A 2LGDA 1PFJA 2BKRB 1KOTA 5J3TA 3PPAA 4WSFA 2OTXA 2JUOA 4ANUA 3DCGA 2O2VB 3V60A 2YS5A 1KM7A 1YIWA 3LJ3A 2K8CA 2MDXA 1WH3A 4GB9A 4OVUA 3L13A 4E74A 4FJZA 4AP4C 2DLWA 1E8XA 1WJUA 5KQ1A 3OLMD 4MDKE 1I7AA 1LM8B 4DDGD 1I35A 2KK8A 2RGNB 1KLVA 2EMSA 4TYZA 5J17A 1OTRB 1EAZA 1FHWA 1P5TA 1WY8A 3ZNGC 2D9VA 2RVBB 3QQ8B 3W1SA 2RLOA 1WF9A 2N9PC 2ZJDA 5DPWA 3ZDMC 3DXEA 4HATB 2K25A 3JYUA 4MGYE 2RSUA 4MGKE 3WALA 2OQBA 2CU1A 4HDOA 5HE0A 2P0DA 3SU8X 5EDSA 1SE9A 3PLUA 1IRSA 1OQNA 3ODXA 4RM8A 2DAFA 2LGYA 2L00B 1WM3A 3KZ1A 1I2HA 3TJPA 2WX0A 4HAUB 3LJUX 1P9DU 2D9WA 2JWZA 2DX1A 4F7HA 3UINB 3VDZA 2AYOB 1GUAB 1BTNA 3PGEA 3KW5B 2ASQA 3AXCA 2D07B 2LRUA 3N32A 1YX5B 2DENB 2KLGA 3T06A 2Y8FA 2LI5A 1PQSA 3BY4B 2KWUB 4IM3A 1J8CA 2J0MA 4HWIB 2LVPA 1YJ1A 2RSGA 2NBUA 3B1LX 1C3TA 1U2BA 2KDBA 2R0DA 2W2XC 5CX3A 1P6SA 4Z2MB 4A6FB 4AUQC 2M17A 3PREA 4A5KA 2OJRA 4GDKB 2YLMA 4HLEA 2KLCA 5CLLB 4YONA 2ROZB 4XZ4A 4G11A 3ZIMA 1XT9B 1IYFA 1DROA 1FGYA 1WVHA 2NVUI 3QCAA 5DPRA 3IBEA 3ALBA 4IW0A 4HB2B 2D4QA 3VHTC 4A3PA 4URKA 1RRBA 3N7CA 3M3JA 4HPLB 2FCMA 4CYEA 1MIXA 2W9NA 2EKEC 3KVFB 2DKQA 3NS8A 4HK2A 1UNQA 3RZWC 5E6OA 3DVGX 3DBLI 2LKOA 4DBGA 1YD8U 2K6DB 3L08A 3N3KB 4GN1A 1XR0B 2LASA 1RLFA 2GJYA 2C9WB 3PV1A 2DZMA 1Z87A 4WJQA 4EOYA 1XD3B 3JVZX 3BINA 1DDMA 4GXBA 4TKNA 1EUVB 1P3QU 2COCA 2MBBB 5JHBA 1RFAA 1U29A 2DZJA 1EO6A 2O6VB 2RD0A 3DBSA 2W2XD 3ML8A 2K2UA 1V5MA 3WAPA 1WX9A 3SD5A 2JP2A 3L54A 2VRRB 2HE7A 4ANVA 5E6PA 1S1QB 5LLIA 3ZNID 3QA8A 2ADZA 3PT2B 1WMHA 2HTHB 1V5UA 3UZTA 1ZM0A 1OQYA 5JHGA 1WZ0A 2DYOA 1LB1A 2JF5A 2MWSB 2UYZB 5HE1A 3B08A 2Y8GA 1KI1B 1W1GA 4MEMA 4NAWB 3S2AA 4F7UP 4G0NB 4IC7B 3DOWA 1TXDA 2LYDA 2NZ8B 1W1DA 4KHAA 5CLQB 2N7DA 2A5UA 2GCJA 5FI0A 3PVWA 1OEYA 2ZCBA 1HE8A 5DIFB 2ELBA 2GBRA 2GBNA 2YS1A 2OOBB 3PSEB 2K1FA 4KDLB 2B3AA 3P2BA 1UH6A 3APDA 2KC2A 4LDTB 2KANA 4II3B 3KSYA 4K7WA 3CMMB 4WJPA 2DHKA 5GMVA 4AWJA 1D3ZA 4II2B 1M7EA 5E6NA 3QIJA 3A8QA 3DPDA 4KHBB 4CHMA 5C79A 3A98B 3IVFA 3HHMA 5CHVC 1V2YA 2HTHA 4X57B 3R7QA 3WAOA 1R4MI 4FHJA 1NBFC 4ZRIA 4BBNF 1V9JA 1ZGUB 2ZCCA 4GDLB 2DYBA 2V76A 3NZUA 3PHWB 3TIXA 3RZFA 1E5WA 1F9JA 2ZEQA 4WVFB 4EUTA 4NNJB 1WI0A 2NPTA 5AZGA 4HAYB 3R3MA 1QZEA 3RYTA 4MK0A 1BT0A 2KQ7A 2H7EA 3SNHA 3K9PB 1KZ7A 3X23A 4TV3A 5IAAC 3UIOB 3A9KB 4IAPA 1Z5SB 1U27A 2DTCA 2KD0A 2O2VA 2DKPA 2W2WA 2KVRA 2KX0A 2LZ6A 5D7GA 2H7DA 1K8RB 2RGFA 3RUIB 2MLBA 1S3SG 2L76A 2PE6B 1WMHB 3QX1A 4XC2A 3PHXB 3PRPB 1MPHA 5LOPB 1UZXB 4HXDA 4WAAA 3V6EB 4W9JA 3NSUA 1XCGA 2XK5A 4IWQA 5LXIB 4WJOA 3QHTA 2CY5A 3KUZA 1EF5A 2NCNA 5HE3A 1ZC3B 1RAXA 3ZNHB 3ZW3A 2Y7BA 1TGZB 2KXJA 2QKMA 1BAKA 4NY0A 2R09A 1MK7B 4LJPB 4NPNA 3TL5A 1X1FA 3UQAA 2J0JA 2G35A 3AU4A 3SUZA 1C1YB 2AL6A 2G4SA 4JIOU 5D2MB 2D9ZA 1N3HA 1EVHA 1VD2A 3ZTDA 2LULA 4M8NA 3GYOA 2DA0A 2GCLA 2YT1A 3ULCA 4FN2A 1KZGA 4NJ7A 1UPQA 4D0NB 3SHQA 4IWOA 2KDEB 5C6RA 5AZHA 5G55A 4NJ6A 2N0YA 5LONB 2FJLA 2LRWA 4W9LA 3RD2A 4AJWA 4HHVA 3VXWA 2BF8B 4MSMB 5J3QA 4EFOA 1J0WA 2FIFA 1TZ1A 2EMTA 3ZLZA 4DDID 3DVNU 3ML9A 3V5WA 2BCJA 4HAXB 3APCA 2N9XA 3ULBA 2PZ1A 5EFXA 2BYEA 1U5GA 2ELAA 4F7GA 1UELA 2LG1A 2G45B 2N23A 1TJ6A 2NPTB 1ISNA 1QQGA 4W9CA 1DYNA 2J0KA 4JL9A 4BKTA 4KAXB 2KFJA 4EZKA 1UBIA 4A6FA 2KMCA 2KHWB 2ZPNA 5DHAB 2IZVB 2CKHB 5GOWB 3WA0A 2CHXA 2UWQA 3FEHA 3NOBA 3D8EA 4MELA 1H4RA 4DHZB 1MAIA 1X1MA 4FJYA 4MSQB 4KV2A 1WYWB 2DFKA 4DK5A 4GIVA 3AULA 2NS5A 3VFKA 5JZEB 2LJ5A 3X0WA 3MDBC 3QJZA 2KUPA 1H8CA 2GOWA 4FBJB 1Y8RC 4FJVB 4HVBA 3WAMA 3QK0A 1X11A 2I5CA 1WRDB 3C0RB 1XD4A 2BGFA 2CS4A 4K2PA 4HDQA 1EGXA 1WGRA 2IO0B 1MIZB 2MP2B 2FCQA 2N7EA 3HM3A 4GMVA 1Z2MA 1BWNA 2COAA 3N30A 4HPMB 4OVVA 3VH3B 3QAQA 2UZSA 5DH9B 2ZPYA 4I6NB 3A4SC 4MGIE 4RM9A 5JLJB 4B95A 1V6EA 3H7PB 3IG3A 4JGHB 3P6AA 4ICVA 2UZRA 2KCJA 2J7QB 3PRMB 2RPQA 2N9EB 1LXDA 2KO3A 2XK5B 3W1SC 4F7ZA 4ICUA 1WG7A 4JQWC 4DHZE 4I6PA 5LXHA 4PQ0A 2IYBA 5KCVA 2L8JA 2HJ8A 2MQJA 4BKGA 1V49A 1GC6A 1Q0WB 3VTUA 2JXXA 2Z0EB 3A1QB 1PLSA 5D3VA 1WIAA 2DX5A 2C7MB 2FIDA 3JW0X 2KOXA 2I5FA 2VRWB 1WX8A 2L05A 3NY5A 3HW2B 5C23A 1IP9A 4IOYX 3H7SA 3PG7A 4DX90 1WGHA 3KRXA 4GGQA 4HAWB 4GSWA 1V86A 3R66C 5JH5C 5D3XA 4KVGB 4MJSA 2CODA 2MWNB 5JHAA 5AEKB 1GC7A 2ZVOA 2CRFA 4NAWA 3L0WB 2DYMA 2L0FA 4BKSD 3HM6X 3PLVA 3Q3JA 3D8FA 1X05A 1V5TA 3KUCB 3ML4A 4WWOA 5JHHA 4BOSC 2CHWA 1VCBA 2K2JA 3G9WA 5AZFA 1UNRA 1V88A 2CY4A 3FSSA 3QBVB 4MY6A 1T0YA 4LJOB 4W9GA 3UF8A 4K81A 5KHOA 2GBJA 1U4AA 5D3YA 2JVCA 3PS6A 1I42A 1L2NA 3O65B 2KKCA 2XEWA 1H10A 4DHJB 2CAYA 2WX1A 5DCNA 2LVQA 2BYVE 4CHKA 4DWFA 3ODWA 3VVWB 2V1YA 3H6NA 1QC6A 1NTYA 2GS0A 4Y94A 1PMSA 4HAZB 1WGQA 2DZIA 2JZ3B 4XX5A 2FNJB 2LUEA 4GDLA 4KIKB 1UNPA 3O96A 3PP2A 3M62B 2O6VD 2KNBA 1WXAA 2MBOA 3ZO5B 3L10B 4NSWA 3QC8B 2MBEA 3ECIA 1V5PA 1Y19B 1ZSQA 2EC1A 2D10A 2AWTA 1OGWA 5HE2A 4DXAB 2BKFA 4DHJD 3H7PA 3ZRCA 2G4DB 4G50A 2KDIA 2IY0B 1XX0A 1GNUA 4EMOA 2A4ZA 2ZVNA 2I1JA 2ZZPB 3L16A 2GBMA 3ZVVA 1FOEA 2E2XA 1WJ1A 5DI9B 1KJTA 2YSZA 1UGMA 3A9JA 2I1KA 3ZUNA 4EZJA 4EZLA 5JP4A 2D11A 1Q5WB 2VKIA 1P3RA 1FHOA 2FAZA 4PS3A 2X18A 2K8HA 4GDKA 2JZZA 4PS7A 5D6JB 3VH4B 4ASWC 4F1SA 2RNRB 2BYFA 2M8SA 3VUXA 3VOQA 5C5BB 4EKUA 4HAVB 2DZKA 3P7ZA 2L0TA 1WM2A 2IY1B 3GOEA 3SV1A 5KHQA 1GJZA 5J2RA 1P1AA 2K8BA 2P0FA 1DBHA 1UEFA 3KRWA 1M94A 1Q1OA 2G3QB 3JSVB 1RRPB 4IM0A 4FHKA 4W9DA 2O6VA 3OJ3A 4MGZE 1R4NI 2COFA 3TVVA 2PPHA 3CF6E 1U5FA 2CR5A 4HCPB 4WWNA 3KYDD 2XBBC 3UQBA 2BWFA 2R2OA 3HQCA 2Y5BB 3DQVA 4TUUA 3PEGA 2M1MA 3M63B 1WE7A 3DVGY 3MJWA 3U7DA 1TQZA 1V81A 1L7YA 3AJ4A 3ZVRA 4CHJA 1WR1A 2V4LA 4GU2A 4K1RB 3KH0A 4KZ0A 4PYUA 2KGXB 5CTRC 3M1IB 1J19A 1WZ3A 4HB0B 1WGYA 3SDLC 2J59M 3CXBB 3DBHI 2K00A 3V61A 4FA6A 1E8WA 5FI1A 4JLCA 2RUKB 3PVLA 4LCDE 3DDCB 3PZDA 1OMWA 3VTVA 4H8SA 2LVOA 3KUDB 1NU2A 4K2OA 1U5DA 3EC8A 1WGUA 3WANA 4ZRKA 4BOZB 4KSLC 4M0WB 4BKSA 5KQ4A 1WX7A 2L2IA 4MT7A 1X86A 1MKEA 1WJ4A 1LFDA 1WJ6A 2MP2A 2PE9A 3A9JB 3D32A 1MK9B 2DHIA 3I3TB 2MBQA 4J6IA 2MA9B 5D94A 4CO7A 3D8DA 1V80A 1SIFA 3T8MA 4FADA 4IFSA 2NBWB 4A3OA 1YQBA 2JPHA 2D3GA 2YRYA 3NHEB 1YX6B 3VUWA 3QWZB 1GG3A 2FUHB 2ZNVC 3CSTA 2C60A 3ONSA 1V61A 2JY6A 3AI5A 4B9KA 2P0HA 5C5BA 4BBKA 2MSED 4C0AA 2KWCA 1W1HA 4ANWA 3DXDA 2DHJA 4TQ0A 3UIPB 2YF0A 1ZKHA 2KTFA 4HJKA 2D2QA 1OY2A 1E90A 2KMAA 2LXAA 2R2QA 4EJNA 1E7VA 1FXTB 3MPXA 1M7RA 2KTRA 3KYCD 2DHZA 4KDIC 3U30A 2C7HA 2WWZA 1WJMA 3MHSD 3TCAA 1IPGA 1MG8A 1U5EA 3H9DA 3GZNI 4M8MA 4E3CA 1BTKA 2RR9A 2IO1B 1OEYJ 1ZW7A 2KZRA 2IO2B 3A4RA 3TBLD 1E8ZA 1FHXA 2P8VA 1B55A 1AQCA 3SYXA 2MRPA 3PTFC 3RULA 4A6KA 4B6HA 2K39A 4A6HA 4MM3A 2CHZA 2KDFB 5L81A 4TQ1A 3F0WA 1SHCA 4W9HA 4B6WA 4AJYB 1G6JA 1WR6E 1WXMA 3TW1A 2NMBA 2GMIC 2PEAA 2BWES 5L95C 2L7RA 4KHOA 4MJSB 2UVMA 4GOCA 4EEWA 3RT3B 4WJ7A 4BVUC 3OAWA 2KJRA 3R7RA 2Z0PA 1WXVA 3QWMA 3RCPA 2IO3B 2JT4B 2KTRB 2MFQA 3EFUA 3NZSA 1JRUA 4HCNB 4K7UA 2PJHA 4PYZA 2DYQA 5C1ZA 2M4NA 2Z59B 2MW5A 3H1UA 2DX5B 4N9F4 2Q13A 2M0XA 3L17A 4RMAA 1FB8A 4NQKE 1TTNA 3EHVA 4I6LB 3KY9A 3V6CB 2AEHA 4XWXA 3ZNZB 4W9IA 3MTNB 2DAJA 2IYDB 1AWEA 3TO1A 3A9KA 3U8ZA 1SGHA 4ZDVA 4W9FA 4PS8A 3EECA 2IFSA 2MKRA 3ODOA 1DDVA 4BBNC 4KSKC 3QARA 3WIMA 3A8PA 3OANA 2NBVB 5FR6A 3PVUA 1NTVA 2AL3A 3APFA 5BO4B 1XKEA 1P98A 2XQNM 2YT0A 4KZCA 2HD5B 3M95A 2LOZA 4ANXA 3OJ4B 1XQQA 3B0AA 2KX3A 3A33B 2JRHA 1CMXB 5DPSA 4LDTD 1WJNA 2K6QA 4FULA 3VTWA 3HIZA 3V62A 1WGGA 3VIAA 3Q3FA 3IFWB 1FAOA 2ROVA 1E8YA 5J18A 4FLHA 2KN5A 1RJ2A 4DX8A 4G3XB 2LXCA 3PRZA 1ZVRA 4W9KA 1WE6A 1P0RA 3DXCA 4ZRJA 2MCNB 1UD7A 2KJ6A 1WFYA 1NI2A 4IG7B 1XODA 2LOXA 3T9LA 3W1YA 2M38A 5DHFB 4E71A 2YS3A 4KIKA 2ZNVB 4GPTB 2KWVB 3K9OB 3JSVA 4IM2A 2C5LC 2KFKB 1NDDA 4IWPA 2D9XA 4L6EA 2BPSA 2FCNA 3LDZE 2LGXA 3UGBB 3ENEA 1FGZA 3F5RA 4GMXB 1X1GA 5J3YA 4PNKA 2REXA 3AU5A 4NQLB 3VAWA 2YVCA 5HKHA 1E7UA 2VSZA 2QHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V89 A;  4YL8 A;  2KC1 A;  2FCS A;  4K17 A;  2LD9 A;  1WGD A;  4P7I A;  5CHF A;  3TMP B;  2DYN A;  3BJI A;  1AAR A;  4ZYN A;  2M14 A;  2D9Y A;  2MX2 A;  3TFM A;  2V3S A;  4K7S A;  4BFR A;  2DN6 A;  2L3Z A;  5CHW A;  2N4F A;  2N1V A;  3ZKJ C;  3ZRF A;  4IUM B;  3RCZ A;  1J0G A;  3FM8 C;  2Z0Q A;  2Z0D B;  2QKL A;  3GYP A;  1Q67 A;  2C7N B;  4WWP A;  4WQO B;  1EF1 A;  4DBB A;  1A5R A;  5IA7 A;  2EJ8 A;  1WXS A;  2KFK A;  1V5O A;  4HB3 B;  2WYQ A;  1Y5O A;  5C16 A;  2N1W A;  2WDT B;  2L1C A;  5DPT A;  1LW3 A;  1DDW A;  5D27 A;  2Z0O A;  5D3W A;  3IHP C;  4WJN A;  2KJH B;  4HB4 B;  3WYF B;  4Z2N A;  2GBK A;  5TR5 A;  1UPR A;  1UBQ A;  3VQI A;  3CIK A;  1TBE A;  3DBR I;  1LQB A;  1K5G B;  1ZC4 B;  2NR2 A;  3DVN V;  3VUY A;  4W9E A;  4F8C B;  5L83 A;  2KQS A;  4AOF A;  3ZDT A;  3ZTC A;  5G2N A;  2LWP A;  1WI1 A;  4A20 A;  3CSF A;  2IBI B;  4GZU A;  3SO6 A;  3A1Q A;  2JRI B;  3PSC A;  2MBH A;  1K5D B;  4MH0 E;  3HK0 A;  2LGD A;  1PFJ A;  2BKR B;  1KOT A;  5J3T A;  3PPA A;  4WSF A;  2OTX A;  2JUO A;  4ANU A;  3DCG A;  2O2V B;  3V60 A;  2YS5 A;  1KM7 A;  1YIW A;  3LJ3 A;  2K8C A;  2MDX A;  1WH3 A;  4GB9 A;  4OVU A;  3L13 A;  4E74 A;  4FJZ A;  4AP4 C;  2DLW A;  1E8X A;  1WJU A;  5KQ1 A;  3OLM D;  4MDK E;  1I7A A;  1LM8 B;  4DDG D;  1I35 A;  2KK8 A;  2RGN B;  1KLV A;  2EMS A;  4TYZ A;  5J17 A;  1OTR B;  1EAZ A;  1FHW A;  1P5T A;  1WY8 A;  3ZNG C;  2D9V A;  2RVB B;  3QQ8 B;  3W1S A;  2RLO A;  1WF9 A;  2N9P C;  2ZJD A;  5DPW A;  3ZDM C;  3DXE A;  4HAT B;  2K25 A;  3JYU A;  4MGY E;  2RSU A;  4MGK E;  3WAL A;  2OQB A;  2CU1 A;  4HDO A;  5HE0 A;  2P0D A;  3SU8 X;  5EDS A;  1SE9 A;  3PLU A;  1IRS A;  1OQN A;  3ODX A;  4RM8 A;  2DAF A;  2LGY A;  2L00 B;  1WM3 A;  3KZ1 A;  1I2H A;  3TJP A;  2WX0 A;  4HAU B;  3LJU X;  1P9D U;  2D9W A;  2JWZ A;  2DX1 A;  4F7H A;  3UIN B;  3VDZ A;  2AYO B;  1GUA B;  1BTN A;  3PGE A;  3KW5 B;  2ASQ A;  3AXC A;  2D07 B;  2LRU A;  3N32 A;  1YX5 B;  2DEN B;  2KLG A;  3T06 A;  2Y8F A;  2LI5 A;  1PQS A;  3BY4 B;  2KWU B;  4IM3 A;  1J8C A;  2J0M A;  4HWI B;  2LVP A;  1YJ1 A;  2RSG A;  2NBU A;  3B1L X;  1C3T A;  1U2B A;  2KDB A;  2R0D A;  2W2X C;  5CX3 A;  1P6S A;  4Z2M B;  4A6F B;  4AUQ C;  2M17 A;  3PRE A;  4A5K A;  2OJR A;  4GDK B;  2YLM A;  4HLE A;  2KLC A;  5CLL B;  4YON A;  2ROZ B;  4XZ4 A;  4G11 A;  3ZIM A;  1XT9 B;  1IYF A;  1DRO A;  1FGY A;  1WVH A;  2NVU I;  3QCA A;  5DPR A;  3IBE A;  3ALB A;  4IW0 A;  4HB2 B;  2D4Q A;  3VHT C;  4A3P A;  4URK A;  1RRB A;  3N7C A;  3M3J A;  4HPL B;  2FCM A;  4CYE A;  1MIX A;  2W9N A;  2EKE C;  3KVF B;  2DKQ A;  3NS8 A;  4HK2 A;  1UNQ A;  3RZW C;  5E6O A;  3DVG X;  3DBL I;  2LKO A;  4DBG A;  1YD8 U;  2K6D B;  3L08 A;  3N3K B;  4GN1 A;  1XR0 B;  2LAS A;  1RLF A;  2GJY A;  2C9W B;  3PV1 A;  2DZM A;  1Z87 A;  4WJQ A;  4EOY A;  1XD3 B;  3JVZ X;  3BIN A;  1DDM A;  4GXB A;  4TKN A;  1EUV B;  1P3Q U;  2COC A;  2MBB B;  5JHB A;  1RFA A;  1U29 A;  2DZJ A;  1EO6 A;  2O6V B;  2RD0 A;  3DBS A;  2W2X D;  3ML8 A;  2K2U A;  1V5M A;  3WAP A;  1WX9 A;  3SD5 A;  2JP2 A;  3L54 A;  2VRR B;  2HE7 A;  4ANV A;  5E6P A;  1S1Q B;  5LLI A;  3ZNI D;  3QA8 A;  2ADZ A;  3PT2 B;  1WMH A;  2HTH B;  1V5U A;  3UZT A;  1ZM0 A;  1OQY A;  5JHG A;  1WZ0 A;  2DYO A;  1LB1 A;  2JF5 A;  2MWS B;  2UYZ B;  5HE1 A;  3B08 A;  2Y8G A;  1KI1 B;  1W1G A;  4MEM A;  4NAW B;  3S2A A;  4F7U P;  4G0N B;  4IC7 B;  3DOW A;  1TXD A;  2LYD A;  2NZ8 B;  1W1D A;  4KHA A;  5CLQ B;  2N7D A;  2A5U A;  2GCJ A;  5FI0 A;  3PVW A;  1OEY A;  2ZCB A;  1HE8 A;  5DIF B;  2ELB A;  2GBR A;  2GBN A;  2YS1 A;  2OOB B;  3PSE B;  2K1F A;  4KDL B;  2B3A A;  3P2B A;  1UH6 A;  3APD A;  2KC2 A;  4LDT B;  2KAN A;  4II3 B;  3KSY A;  4K7W A;  3CMM B;  4WJP A;  2DHK A;  5GMV A;  4AWJ A;  1D3Z A;  4II2 B;  1M7E A;  5E6N A;  3QIJ A;  3A8Q A;  3DPD A;  4KHB B;  4CHM A;  5C79 A;  3A98 B;  3IVF A;  3HHM A;  5CHV C;  1V2Y A;  2HTH A;  4X57 B;  3R7Q A;  3WAO A;  1R4M I;  4FHJ A;  1NBF C;  4ZRI A;  4BBN F;  1V9J A;  1ZGU B;  2ZCC A;  4GDL B;  2DYB A;  2V76 A;  3NZU A;  3PHW B;  3TIX A;  3RZF A;  1E5W A;  1F9J A;  2ZEQ A;  4WVF B;  4EUT A;  4NNJ B;  1WI0 A;  2NPT A;  5AZG A;  4HAY B;  3R3M A;  1QZE A;  3RYT A;  4MK0 A;  1BT0 A;  2KQ7 A;  2H7E A;  3SNH A;  3K9P B;  1KZ7 A;  3X23 A;  4TV3 A;  5IAA C;  3UIO B;  3A9K B;  4IAP A;  1Z5S B;  1U27 A;  2DTC A;  2KD0 A;  2O2V A;  2DKP A;  2W2W A;  2KVR A;  2KX0 A;  2LZ6 A;  5D7G A;  2H7D A;  1K8R B;  2RGF A;  3RUI B;  2MLB A;  1S3S G;  2L76 A;  2PE6 B;  1WMH B;  3QX1 A;  4XC2 A;  3PHX B;  3PRP B;  1MPH A;  5LOP B;  1UZX B;  4HXD A;  4WAA A;  3V6E B;  4W9J A;  3NSU A;  1XCG A;  2XK5 A;  4IWQ A;  5LXI B;  4WJO A;  3QHT A;  2CY5 A;  3KUZ A;  1EF5 A;  2NCN A;  5HE3 A;  1ZC3 B;  1RAX A;  3ZNH B;  3ZW3 A;  2Y7B A;  1TGZ B;  2KXJ A;  2QKM A;  1BAK A;  4NY0 A;  2R09 A;  1MK7 B;  4LJP B;  4NPN A;  3TL5 A;  1X1F A;  3UQA A;  2J0J A;  2G35 A;  3AU4 A;  3SUZ A;  1C1Y B;  2AL6 A;  2G4S A;  4JIO U;  5D2M B;  2D9Z A;  1N3H A;  1EVH A;  1VD2 A;  3ZTD A;  2LUL A;  4M8N A;  3GYO A;  2DA0 A;  2GCL A;  2YT1 A;  3ULC A;  4FN2 A;  1KZG A;  4NJ7 A;  1UPQ A;  4D0N B;  3SHQ A;  4IWO A;  2KDE B;  5C6R A;  5AZH A;  5G55 A;  4NJ6 A;  2N0Y A;  5LON B;  2FJL A;  2LRW A;  4W9L A;  3RD2 A;  4AJW A;  4HHV A;  3VXW A;  2BF8 B;  4MSM B;  5J3Q A;  4EFO A;  1J0W A;  2FIF A;  1TZ1 A;  2EMT A;  3ZLZ A;  4DDI D;  3DVN U;  3ML9 A;  3V5W A;  2BCJ A;  4HAX B;  3APC A;  2N9X A;  3ULB A;  2PZ1 A;  5EFX A;  2BYE A;  1U5G A;  2ELA A;  4F7G A;  1UEL A;  2LG1 A;  2G45 B;  2N23 A;  1TJ6 A;  2NPT B;  1ISN A;  1QQG A;  4W9C A;  1DYN A;  2J0K A;  4JL9 A;  4BKT A;  4KAX B;  2KFJ A;  4EZK A;  1UBI A;  4A6F A;  2KMC A;  2KHW B;  2ZPN A;  5DHA B;  2IZV B;  2CKH B;  5GOW B;  3WA0 A;  2CHX A;  2UWQ A;  3FEH A;  3NOB A;  3D8E A;  4MEL A;  1H4R A;  4DHZ B;  1MAI A;  1X1M A;  4FJY A;  4MSQ B;  4KV2 A;  1WYW B;  2DFK A;  4DK5 A;  4GIV A;  3AUL A;  2NS5 A;  3VFK A;  5JZE B;  2LJ5 A;  3X0W A;  3MDB C;  3QJZ A;  2KUP A;  1H8C A;  2GOW A;  4FBJ B;  1Y8R C;  4FJV B;  4HVB A;  3WAM A;  3QK0 A;  1X11 A;  2I5C A;  1WRD B;  3C0R B;  1XD4 A;  2BGF A;  2CS4 A;  4K2P A;  4HDQ A;  1EGX A;  1WGR A;  2IO0 B;  1MIZ B;  2MP2 B;  2FCQ A;  2N7E A;  3HM3 A;  4GMV A;  1Z2M A;  1BWN A;  2COA A;  3N30 A;  4HPM B;  4OVV A;  3VH3 B;  3QAQ A;  2UZS A;  5DH9 B;  2ZPY A;  4I6N B;  3A4S C;  4MGI E;  4RM9 A;  5JLJ B;  4B95 A;  1V6E A;  3H7P B;  3IG3 A;  4JGH B;  3P6A A;  4ICV A;  2UZR A;  2KCJ A;  2J7Q B;  3PRM B;  2RPQ A;  2N9E B;  1LXD A;  2KO3 A;  2XK5 B;  3W1S C;  4F7Z A;  4ICU A;  1WG7 A;  4JQW C;  4DHZ E;  4I6P A;  5LXH A;  4PQ0 A;  2IYB A;  5KCV A;  2L8J A;  2HJ8 A;  2MQJ A;  4BKG A;  1V49 A;  1GC6 A;  1Q0W B;  3VTU A;  2JXX A;  2Z0E B;  3A1Q B;  1PLS A;  5D3V A;  1WIA A;  2DX5 A;  2C7M B;  2FID A;  3JW0 X;  2KOX A;  2I5F A;  2VRW B;  1WX8 A;  2L05 A;  3NY5 A;  3HW2 B;  5C23 A;  1IP9 A;  4IOY X;  3H7S A;  3PG7 A;  4DX9 0;  1WGH A;  3KRX A;  4GGQ A;  4HAW B;  4GSW A;  1V86 A;  3R66 C;  5JH5 C;  5D3X A;  4KVG B;  4MJS A;  2COD A;  2MWN B;  5JHA A;  5AEK B;  1GC7 A;  2ZVO A;  2CRF A;  4NAW A;  3L0W B;  2DYM A;  2L0F A;  4BKS D;  3HM6 X;  3PLV A;  3Q3J A;  3D8F A;  1X05 A;  1V5T A;  3KUC B;  3ML4 A;  4WWO A;  5JHH A;  4BOS C;  2CHW A;  1VCB A;  2K2J A;  3G9W A;  5AZF A;  1UNR A;  1V88 A;  2CY4 A;  3FSS A;  3QBV B;  4MY6 A;  1T0Y A;  4LJO B;  4W9G A;  3UF8 A;  4K81 A;  5KHO A;  2GBJ A;  1U4A A;  5D3Y A;  2JVC A;  3PS6 A;  1I42 A;  1L2N A;  3O65 B;  2KKC A;  2XEW A;  1H10 A;  4DHJ B;  2CAY A;  2WX1 A;  5DCN A;  2LVQ A;  2BYV E;  4CHK A;  4DWF A;  3ODW A;  3VVW B;  2V1Y A;  3H6N A;  1QC6 A;  1NTY A;  2GS0 A;  4Y94 A;  1PMS A;  4HAZ B;  1WGQ A;  2DZI A;  2JZ3 B;  4XX5 A;  2FNJ B;  2LUE A;  4GDL A;  4KIK B;  1UNP A;  3O96 A;  3PP2 A;  3M62 B;  2O6V D;  2KNB A;  1WXA A;  2MBO A;  3ZO5 B;  3L10 B;  4NSW A;  3QC8 B;  2MBE A;  3ECI A;  1V5P A;  1Y19 B;  1ZSQ A;  2EC1 A;  2D10 A;  2AWT A;  1OGW A;  5HE2 A;  4DXA B;  2BKF A;  4DHJ D;  3H7P A;  3ZRC A;  2G4D B;  4G50 A;  2KDI A;  2IY0 B;  1XX0 A;  1GNU A;  4EMO A;  2A4Z A;  2ZVN A;  2I1J A;  2ZZP B;  3L16 A;  2GBM A;  3ZVV A;  1FOE A;  2E2X A;  1WJ1 A;  5DI9 B;  1KJT A;  2YSZ A;  1UGM A;  3A9J A;  2I1K A;  3ZUN A;  4EZJ A;  4EZL A;  5JP4 A;  2D11 A;  1Q5W B;  2VKI A;  1P3R A;  1FHO A;  2FAZ A;  4PS3 A;  2X18 A;  2K8H A;  4GDK A;  2JZZ A;  4PS7 A;  5D6J B;  3VH4 B;  4ASW C;  4F1S A;  2RNR B;  2BYF A;  2M8S A;  3VUX A;  3VOQ A;  5C5B B;  4EKU A;  4HAV B;  2DZK A;  3P7Z A;  2L0T A;  1WM2 A;  2IY1 B;  3GOE A;  3SV1 A;  5KHQ A;  1GJZ A;  5J2R A;  1P1A A;  2K8B A;  2P0F A;  1DBH A;  1UEF A;  3KRW A;  1M94 A;  1Q1O A;  2G3Q B;  3JSV B;  1RRP B;  4IM0 A;  4FHK A;  4W9D A;  2O6V A;  3OJ3 A;  4MGZ E;  1R4N I;  2COF A;  3TVV A;  2PPH A;  3CF6 E;  1U5F A;  2CR5 A;  4HCP B;  4WWN A;  3KYD D;  2XBB C;  3UQB A;  2BWF A;  2R2O A;  3HQC A;  2Y5B B;  3DQV A;  4TUU A;  3PEG A;  2M1M A;  3M63 B;  1WE7 A;  3DVG Y;  3MJW A;  3U7D A;  1TQZ A;  1V81 A;  1L7Y A;  3AJ4 A;  3ZVR A;  4CHJ A;  1WR1 A;  2V4L A;  4GU2 A;  4K1R B;  3KH0 A;  4KZ0 A;  4PYU A;  2KGX B;  5CTR C;  3M1I B;  1J19 A;  1WZ3 A;  4HB0 B;  1WGY A;  3SDL C;  2J59 M;  3CXB B;  3DBH I;  2K00 A;  3V61 A;  4FA6 A;  1E8W A;  5FI1 A;  4JLC A;  2RUK B;  3PVL A;  4LCD E;  3DDC B;  3PZD A;  1OMW A;  3VTV A;  4H8S A;  2LVO A;  3KUD B;  1NU2 A;  4K2O A;  1U5D A;  3EC8 A;  1WGU A;  3WAN A;  4ZRK A;  4BOZ B;  4KSL C;  4M0W B;  4BKS A;  5KQ4 A;  1WX7 A;  2L2I A;  4MT7 A;  1X86 A;  1MKE A;  1WJ4 A;  1LFD A;  1WJ6 A;  2MP2 A;  2PE9 A;  3A9J B;  3D32 A;  1MK9 B;  2DHI A;  3I3T B;  2MBQ A;  4J6I A;  2MA9 B;  5D94 A;  4CO7 A;  3D8D A;  1V80 A;  1SIF A;  3T8M A;  4FAD A;  4IFS A;  2NBW B;  4A3O A;  1YQB A;  2JPH A;  2D3G A;  2YRY A;  3NHE B;  1YX6 B;  3VUW A;  3QWZ B;  1GG3 A;  2FUH B;  2ZNV C;  3CST A;  2C60 A;  3ONS A;  1V61 A;  2JY6 A;  3AI5 A;  4B9K A;  2P0H A;  5C5B A;  4BBK A;  2MSE D;  4C0A A;  2KWC A;  1W1H A;  4ANW A;  3DXD A;  2DHJ A;  4TQ0 A;  3UIP B;  2YF0 A;  1ZKH A;  2KTF A;  4HJK A;  2D2Q A;  1OY2 A;  1E90 A;  2KMA A;  2LXA A;  2R2Q A;  4EJN A;  1E7V A;  1FXT B;  3MPX A;  1M7R A;  2KTR A;  3KYC D;  2DHZ A;  4KDI C;  3U30 A;  2C7H A;  2WWZ A;  1WJM A;  3MHS D;  3TCA A;  1IPG A;  1MG8 A;  1U5E A;  3H9D A;  3GZN I;  4M8M A;  4E3C A;  1BTK A;  2RR9 A;  2IO1 B;  1OEY J;  1ZW7 A;  2KZR A;  2IO2 B;  3A4R A;  3TBL D;  1E8Z A;  1FHX A;  2P8V A;  1B55 A;  1AQC A;  3SYX A;  2MRP A;  3PTF C;  3RUL A;  4A6K A;  4B6H A;  2K39 A;  4A6H A;  4MM3 A;  2CHZ A;  2KDF B;  5L81 A;  4TQ1 A;  3F0W A;  1SHC A;  4W9H A;  4B6W A;  4AJY B;  1G6J A;  1WR6 E;  1WXM A;  3TW1 A;  2NMB A;  2GMI C;  2PEA A;  2BWE S;  5L95 C;  2L7R A;  4KHO A;  4MJS B;  2UVM A;  4GOC A;  4EEW A;  3RT3 B;  4WJ7 A;  4BVU C;  3OAW A;  2KJR A;  3R7R A;  2Z0P A;  1WXV A;  3QWM A;  3RCP A;  2IO3 B;  2JT4 B;  2KTR B;  2MFQ A;  3EFU A;  3NZS A;  1JRU A;  4HCN B;  4K7U A;  2PJH A;  4PYZ A;  2DYQ A;  5C1Z A;  2M4N A;  2Z59 B;  2MW5 A;  3H1U A;  2DX5 B;  4N9F 4;  2Q13 A;  2M0X A;  3L17 A;  4RMA A;  1FB8 A;  4NQK E;  1TTN A;  3EHV A;  4I6L B;  3KY9 A;  3V6C B;  2AEH A;  4XWX A;  3ZNZ B;  4W9I A;  3MTN B;  2DAJ A;  2IYD B;  1AWE A;  3TO1 A;  3A9K A;  3U8Z A;  1SGH A;  4ZDV A;  4W9F A;  4PS8 A;  3EEC A;  2IFS A;  2MKR A;  3ODO A;  1DDV A;  4BBN C;  4KSK C;  3QAR A;  3WIM A;  3A8P A;  3OAN A;  2NBV B;  5FR6 A;  3PVU A;  1NTV A;  2AL3 A;  3APF A;  5BO4 B;  1XKE A;  1P98 A;  2XQN M;  2YT0 A;  4KZC A;  2HD5 B;  3M95 A;  2LOZ A;  4ANX A;  3OJ4 B;  1XQQ A;  3B0A A;  2KX3 A;  3A33 B;  2JRH A;  1CMX B;  5DPS A;  4LDT D;  1WJN A;  2K6Q A;  4FUL A;  3VTW A;  3HIZ A;  3V62 A;  1WGG A;  3VIA A;  3Q3F A;  3IFW B;  1FAO A;  2ROV A;  1E8Y A;  5J18 A;  4FLH A;  2KN5 A;  1RJ2 A;  4DX8 A;  4G3X B;  2LXC A;  3PRZ A;  1ZVR A;  4W9K A;  1WE6 A;  1P0R A;  3DXC A;  4ZRJ A;  2MCN B;  1UD7 A;  2KJ6 A;  1WFY A;  1NI2 A;  4IG7 B;  1XOD A;  2LOX A;  3T9L A;  3W1Y A;  2M38 A;  5DHF B;  4E71 A;  2YS3 A;  4KIK A;  2ZNV B;  4GPT B;  2KWV B;  3K9O B;  3JSV A;  4IM2 A;  2C5L C;  2KFK B;  1NDD A;  4IWP A;  2D9X A;  4L6E A;  2BPS A;  2FCN A;  3LDZ E;  2LGX A;  3UGB B;  3ENE A;  1FGZ A;  3F5R A;  4GMX B;  1X1G A;  5J3Y A;  4PNK A;  2REX A;  3AU5 A;  4NQL B;  3VAW A;  2YVC A;  5HKH A;  1E7U A;  2VSZ A;  2QHO A; 
#chains in the Genus database with same CATH topology
 2KC1 A;  2FCS A;  3ABV B;  3BJI A;  1MHH E;  4ITK A;  2V3S A;  1I4Q A;  2N4F A;  3GYP A;  1E10 A;  3AEE B;  3AV8 A;  4NJC A;  2YEP B;  2N1W A;  2WDT B;  2L1C A;  2WXM A;  2JSV X;  5D27 A;  5D3W A;  1TJE A;  4WJN A;  1SJE D;  1NYQ A;  2WXP A;  2K5P A;  1LGR A;  1K5G B;  2R61 A;  4KGT A;  2LWP A;  2MEK A;  2NMQ A;  2WNM A;  4YTM B;  4GZU A;  4ZHP A;  2MBH A;  3PSC A;  3TEZ A;  4ANU A;  2LUM A;  3DCG A;  1KM7 A;  1WH3 A;  4FJZ A;  5IO9 A;  4C4V A;  4MDK E;  2RGN B;  1OTR B;  2JZP A;  1FHW A;  1P5T A;  3QQ8 B;  2RLO A;  4C80 A;  2RRF A;  2HDE A;  3ZDM C;  4XYC A;  1UWX A;  2V3P A;  4ZRQ A;  3NS1 A;  3KWV A;  5EE0 A;  1IRS A;  2QIE B;  3AE8 B;  2LGY A;  1WM3 A;  2PLP A;  3TJP A;  4HAU B;  1R4N B;  4WH4 A;  3Q6B A;  1BTN A;  1SE2 A;  2J52 A;  4XGA B;  1VLB A;  1CJE A;  1BUI C;  2Y8F A;  2QC8 A;  3BY4 B;  2KWU B;  1C3T A;  4ZHO A;  1FPY A;  5CX3 A;  3PRE A;  1T77 A;  2GI9 A;  4GDK B;  2YLM A;  4S17 A;  2ROZ B;  3V05 A;  2K49 A;  4G11 A;  1K51 A;  1FGY A;  2D4Q A;  3VHT C;  1RRB A;  2W9N A;  4HK2 A;  1UNQ A;  3L08 A;  2GJY A;  2C9W B;  3AED B;  2Z8L A;  1Z87 A;  2RDB C;  1P3Q U;  2MBB B;  1EO6 A;  2H89 B;  5BMH A;  3Q8A A;  2JP2 A;  3TSS A;  5E6P A;  5LLI A;  3ZNI D;  5G5G A;  1WMH A;  1OQY A;  2JF5 A;  2DYO A;  1W1G A;  4REZ A;  4WQM A;  3RNA C;  2N9K A;  2A5U A;  1L0Y B;  1HE8 A;  5BYR A;  2OOB B;  4KDL B;  3APD A;  4AWJ A;  4R3D A;  3QIJ A;  1B1Z A;  2KQ4 X;  4IDI A;  5FKA C;  3A98 B;  4S0R A;  5CHV C;  3WAO A;  1SIJ A;  4FHJ A;  4BBN F;  4ZRI A;  1JWU D;  4LLG M;  2ZCC A;  2DYB A;  4O1N A;  1F9J A;  2ZEQ A;  1WI0 A;  1MJD A;  2NPT A;  2ONQ A;  4HAY B;  3ETR A;  3R3M A;  1QZE A;  3RYT A;  1STE A;  1KZ7 A;  3X23 A;  2WXK A;  1U27 A;  2KVR A;  2RGF A;  4XC2 A;  2R2Y A;  4IWQ A;  2PKO A;  4OW0 A;  1XCQ L;  2CY5 A;  1I4X A;  4QJ3 B;  1EF5 A;  3E56 A;  1ZC3 B;  1YQ3 B;  2Y7B A;  3Q14 C;  2GLS A;  1BAK A;  1ZP0 B;  4TMA B;  2J0J A;  4JIO U;  3AU4 A;  3SUZ A;  1KOT A;  3ZTD A;  1SJH D;  5D2M B;  2D9Z A;  2DA0 A;  2YT1 A;  3SHQ A;  4D0N B;  2KDE B;  1IGC A;  2N0Y A;  1C4C A;  2CJO A;  2BCJ A;  4HAX B;  3ULB A;  5EFX A;  3AXC A;  2ELA A;  2N23 A;  1I4H A;  2J0K A;  4BKT A;  4YSZ B;  2KFJ A;  4OVZ A;  2KMC A;  2UWQ A;  2CKH B;  5GOW B;  4GOU A;  4MEL A;  4KV2 A;  1NEN B;  3ZJT A;  5JZE B;  2NS5 A;  1H8C A;  3X0W A;  2KUP A;  1N6Z A;  1Y8R C;  4MH8 A;  4HVB A;  1B9R A;  3BYY B;  1HTO A;  3QK0 A;  2JYT A;  1X11 A;  5BO4 B;  3HM3 A;  3OJ4 B;  1UNS A;  1MIZ B;  2N7E A;  1FO4 A;  4GMV A;  1Z2M A;  3QAQ A;  2EEL A;  5JLJ B;  1FXA A;  4B95 A;  4OT1 A;  4ICV A;  2KCJ A;  2J7Q B;  3AE1 B;  2QDF A;  1BXT A;  3HIE A;  2IYB A;  1V49 A;  1GC6 A;  2Z0E B;  1JW9 D;  2DX5 A;  2I5F A;  2VRW B;  1WX8 A;  3HW2 B;  1R4M B;  3PG7 A;  2GUM A;  5JH5 C;  1GC7 A;  2CRF A;  3L0W B;  1OFF A;  1T0S C;  3C8Y A;  2WQY B;  3D8F A;  3ML4 A;  1C9F A;  3QBV B;  1V88 A;  1T0Y A;  1I42 A;  1JWA D;  1L2N A;  2KKC A;  1H10 A;  4DHJ B;  1ET9 A;  5DCN A;  4H2A A;  4XDD A;  2V1Y A;  2GS0 A;  2LHE A;  3SFD B;  3PP2 A;  1QF6 A;  2V9H A;  1V5P A;  1ZSQ A;  1JML A;  1OGW A;  3NZ3 A;  2BKF A;  1XX0 A;  1ROE A;  2ZVN A;  2ZZP B;  1FOE A;  5DI9 B;  4EZJ A;  1Q5W B;  1P3R A;  1FHO A;  2FAZ A;  4GDK A;  4PS7 A;  3VUX A;  1P1A A;  2P0F A;  1UEF A;  1Q1O A;  4W9D A;  1OQQ A;  3FKY A;  4IM0 A;  4FHK A;  2O6V A;  2COF A;  1FD6 A;  4WWN A;  3L4P A;  5AUI A;  3HQC A;  2Y5B B;  4TUU A;  3M63 B;  3T3N A;  3B9J A;  1L7Y A;  3AJ4 A;  1WR1 A;  4KZ0 A;  4M00 A;  4K1R B;  4RFB A;  3DHH C;  2WU2 B;  2K00 A;  4OZC A;  1EWY C;  3V61 A;  2RUK B;  3NWF A;  1MPE A;  4H8S A;  3ZJU A;  1DOX A;  1ET6 A;  4KSL C;  3SFE B;  2ZW0 A;  1WJ4 A;  2PE9 A;  1X86 A;  2IND C;  2MP2 A;  3I3T B;  3A9J B;  5D94 A;  3TEY A;  3VRB B;  2D3G A;  1YX6 B;  2ZNV C;  1D6E C;  2X38 A;  2JWU A;  4P1B C;  2P0H A;  4BBK A;  4HPP A;  2MSE D;  2KWC A;  2WXR A;  4TQ0 A;  5D3D A;  2YF0 A;  2BBC A;  2R2Q A;  3MPX A;  3B77 A;  1L4D B;  1MG8 A;  1BTK A;  1KFY B;  2G1E A;  4US9 A;  1ZW7 A;  3P1M A;  1FHX A;  4XDC A;  2K0P A;  4B6H A;  2RDG A;  4MM3 A;  2CHZ A;  4KKJ A;  3F0W A;  1WR6 E;  3Q3N C;  5L95 C;  2PEA A;  3AMZ A;  4RH6 A;  5T8I A;  4MJS B;  3NW8 A;  1J7B A;  4WJ7 A;  2D3C A;  3RCP A;  2JT4 B;  1WYG A;  2E6X A;  2Z59 B;  2MW5 A;  4N9F 4;  4M02 A;  4RMA A;  4I6L B;  1SGH A;  4ZDV A;  1ENF A;  2IFS A;  2MKR A;  3W9C B;  1DDV A;  3AEG B;  3IT4 B;  3AEA B;  3A8P A;  5FR6 A;  3PVU A;  2AL3 A;  1XKE A;  2HD5 B;  1P7E A;  4ANX A;  2K8E A;  3B0A A;  2K6Q A;  2Q5W D;  3BVG A;  3VTW A;  1K52 A;  2BB5 A;  4HEA 1;  3VIA A;  1FAO A;  2ROV A;  1E8Y A;  3AE3 B;  1QKZ A;  1ZXH A;  2KN5 A;  4W9K A;  4C7Z A;  1ZVR A;  2BYT A;  1UD7 A;  2KJ6 A;  1JAL A;  1XOD A;  2LOX A;  2QJL A;  3HSA A;  4K3B A;  4L6E A;  3ENE A;  4MT5 A;  2MJ3 A;  1X1G A;  2REX A;  2YVC A;  1FFU A;  1E7U A;  2QHO A;  1V89 A;  2M56 B;  2DYN A;  1XLO A;  2DN6 A;  5CHW A;  2N1V A;  4IUM B;  3RCZ A;  5EE9 A;  2Z0D B;  4RGM A;  4WWP A;  4DBB A;  5IA7 A;  2EJ8 A;  1QIL A;  4HB3 B;  1Y5O A;  5C16 A;  5DPT A;  5MPO A;  1VZ6 A;  3Q8C A;  3WYF B;  4Z2N A;  4BZA A;  5HI1 A;  3VQI A;  1JQ4 A;  3MC8 A;  1ZC4 B;  2NR2 A;  5L83 A;  2MJD A;  4F8C B;  1L0V B;  2I2Y A;  4AOF A;  3ZDT A;  3ZTC A;  1WI1 A;  3CSF A;  3SO6 A;  2JRI B;  3OWE B;  1PFJ A;  2BKR B;  3FAH A;  3PPA A;  4WSF A;  2OTX A;  1RWS A;  1UWM A;  2XN9 C;  3Q69 A;  2D3A A;  3L13 A;  4E74 A;  4YTP B;  3RNF C;  1EWC A;  3RI7 C;  2DBY A;  3OLM D;  4TYZ A;  1RYJ A;  3ZNG C;  3DXE A;  2VZK B;  3JYU A;  3TUO A;  1HZ6 A;  3GS2 A;  2LHD A;  3R2T A;  3SU8 X;  3ODX A;  1EU3 A;  2BB6 A;  2IJ0 A;  2K9X A;  3LJU X;  2D9W A;  2JWZ A;  2W54 A;  3DWM A;  3PGE A;  1F52 A;  2DEN B;  3T06 A;  1J8C A;  4IM3 A;  2PMV A;  2J0M A;  1YJ1 A;  2KDB A;  1P6S A;  4Z2M B;  1DYQ A;  4YT0 B;  2KLC A;  4YON A;  4XZ4 A;  2ZW1 A;  2BS2 B;  3ZIM A;  1XT9 B;  1DRO A;  2NVU I;  1WVH A;  1C78 A;  4HB2 B;  2N9L A;  3N7C A;  1YMH E;  4CYE A;  1I4P A;  3KVF B;  2EKE C;  5E6O A;  3DVG X;  3DBL I;  1YD8 U;  3N3K B;  1RLF A;  3PV1 A;  3EUB 2;  1GOZ A;  1EUV B;  1DDM A;  4GXB A;  2COC A;  5JHB A;  1RFA A;  2PTL A;  3DBS A;  1T0Q C;  1XLP A;  3ML8 A;  3WAP A;  5JXV A;  2N0S B;  3QA8 A;  1VR9 A;  2HTH B;  2MWS B;  1ZM0 A;  4KIK A;  3B08 A;  3NVW A;  4F7U P;  4G0N B;  1TXD A;  5CLQ B;  2NZ8 B;  2N7D A;  1OEY A;  5DIF B;  2YS1 A;  2K1F A;  3WCQ A;  2KC2 A;  2AX5 A;  2KAN A;  3KSY A;  1D3Z A;  3CMM B;  2DHK A;  5GMV A;  5E6N A;  3A8Q A;  3DPD A;  4KHB B;  4CHM A;  2FBW B;  3IVF A;  3P4Q B;  3Q3O C;  3AE7 B;  1R4M I;  1TY0 A;  1NBF C;  1ZGU B;  2V76 A;  3RZF A;  1E5W A;  3OG5 A;  4WVF B;  3BK1 A;  2G9H D;  1TY2 A;  1SE4 A;  3DHI C;  1BT0 A;  5IAA C;  3SNH A;  3UIO B;  4IAP A;  1Z5S B;  2KD0 A;  4RCO A;  2O2V A;  2BTE A;  2W2W A;  2X8X X;  3RUI B;  2I38 A;  3QX1 A;  3ZQ4 A;  1F1H A;  3PHX B;  4WAA A;  3V6E B;  1YN3 A;  3MFG A;  5HE3 A;  1RAX A;  3ZNH B;  1TZO A;  4PT5 A;  4YSY B;  2XNA C;  3N9Y C;  3TEX A;  2WGS A;  4IWO A;  3BVZ A;  1WRI A;  4NJ6 A;  2FJL A;  4AJW A;  3N20 C;  4MSM B;  2FIF A;  2EMT A;  3DVN U;  3FC4 A;  2PZ1 A;  4WJP A;  3ZLZ A;  2NPT B;  2LG1 A;  1UGJ A;  2G45 B;  1TJ6 A;  1KH0 A;  4W9C A;  1HTQ A;  2WXH A;  2IZV B;  4BKG A;  1X1M A;  4FJY A;  4D2K A;  4MSQ B;  1WYW B;  4DK5 A;  3AUL A;  3VFK A;  1XCT L;  2LJ5 A;  2GOW A;  1FCC C;  5AUK A;  1AWD A;  4FJV B;  1HA5 A;  3AM9 A;  3WAM A;  3C0R B;  1J7A A;  1WRD B;  5IN7 A;  1XD4 A;  2CS4 A;  2IO0 B;  1EGX A;  2MP2 B;  1PGA A;  3P42 A;  3NWD A;  2ZPY A;  3A4S C;  4MGI E;  4RM9 A;  1V6E A;  3H7P B;  1D5Z C;  2RPQ A;  1LXD A;  3NJT A;  4I6P A;  1GB1 A;  1PLS A;  5D3V A;  2C7M B;  3JW0 X;  5C2T B;  4IOY X;  1GPX A;  1WGH A;  3FVC A;  4GSW A;  3R66 C;  4OHJ A;  5D3X A;  4MJS A;  1YOV B;  4NAW A;  4L1B A;  2DYM A;  3PLV A;  2PVO D;  3Q3J A;  1X05 A;  1V5T A;  1A70 A;  3KUC B;  4WWO A;  5JHH A;  2CHW A;  4JX1 C;  4ZRP A;  2K2J A;  3BVM A;  1UNR A;  3FSS A;  4MY6 A;  3UF8 A;  2RDH A;  1UUP A;  2GBJ A;  4A8X C;  2CAY A;  2WX1 A;  4CHK A;  1NTY A;  4GDL A;  4RF1 A;  2O6V D;  2KNB A;  3ZO5 B;  3CIR B;  3U4E G;  1PUT A;  3L10 B;  2WXQ A;  2MBE A;  3QC8 B;  1TS4 A;  4ACF A;  1L6V A;  2EC1 A;  2AWT A;  5HE2 A;  4DHJ D;  1E6E B;  2G4D B;  4G50 A;  1GNU A;  4EMO A;  2I1J A;  1EM7 A;  3ZVV A;  1KJT A;  1UGM A;  3RPF C;  5LNK 1;  5JP4 A;  3AE2 B;  2VKI A;  4PS3 A;  2X18 A;  2K8H A;  3URY A;  2BYF A;  2M8S A;  2DZK A;  2L0T A;  4EKU A;  3GOE A;  1GJZ A;  3P7Z A;  2IY1 B;  3SV1 A;  5J2R A;  2K8B A;  3P63 A;  3KRW A;  2AQ1 B;  2G3Q B;  3OJ3 A;  4MGZ E;  1VDV A;  5BYQ A;  4J3O D;  3TVV A;  1U5F A;  2CR5 A;  4DXF A;  2XBB C;  3UQB A;  2E3T A;  3ZGZ A;  3DVG Y;  1V81 A;  2V4L A;  2INC C;  5CTR C;  1JWB D;  1XEE A;  1WZ3 A;  3U12 A;  3SDL C;  1N63 A;  4FA6 A;  1E8W A;  4LCD E;  2TSS A;  3PVL A;  5M4Y B;  3PZD A;  1OMW A;  3BWU D;  3WAN A;  1NU2 A;  3SR6 A;  4ZRK A;  4BOZ B;  2OJW A;  4BKS A;  1WX7 A;  2L2I A;  4MT7 A;  1WJ6 A;  1V1P A;  3MJW A;  3D32 A;  1MK9 B;  4CO7 A;  4K3C A;  3T8M A;  3E9S A;  4FAD A;  4IFS A;  1HEZ E;  4XE0 A;  3NHE B;  3EA6 A;  3QWZ B;  3CST A;  2C60 A;  3ONS A;  2V3N A;  3AI5 A;  1WXQ A;  4ANW A;  3UIP B;  2KTF A;  5BMG A;  2C7H A;  1WJM A;  3AEF B;  3MHS D;  3TCA A;  3NUH B;  3H9D A;  1U5E A;  3GZN I;  3MJ5 A;  3A4R A;  3BK2 A;  1E8Z A;  3RUL A;  3PTF C;  3PZ8 A;  2MRP A;  4FXC A;  4LNK A;  2K39 A;  1T0R C;  2WXG A;  4B6W A;  3AE9 B;  4LNO A;  4AJY B;  2GMI C;  1J7C A;  3NRZ A;  4KHO A;  1KTK A;  4EEW A;  3KLS X;  3MC0 B;  3OAW A;  1WXV A;  3VVW B;  2IO3 B;  4FBJ B;  1I4R A;  4PYZ A;  4N6E B;  1JRU A;  3DHG C;  2IGG A;  2PJH A;  2DYQ A;  1L6U A;  3PO0 A;  4P6V F;  3H1U A;  3KWL A;  2Q13 A;  1CK1 A;  2KN4 A;  1FNV A;  3B2F A;  1FB8 A;  4NQK E;  3ZXV A;  2DAJ A;  3A9K A;  2K22 A;  4W9F A;  4ARC A;  3W5U B;  3U52 E;  1AN8 A;  1SXT A;  3APF A;  1DOY A;  1P98 A;  4N59 A;  3P4P B;  1E7P B;  5HG2 A;  4KZC A;  2ICI A;  3M95 A;  2LOZ A;  4A6Q A;  3DCX A;  3R8B A;  4G3X B;  1RJ2 A;  2HJ1 A;  2KT7 A;  4A9A A;  5HHD G;  1P0R A;  2MCN B;  5FK9 C;  1WFY A;  1TS3 A;  1NI2 A;  4IG7 B;  3AN1 A;  4E71 A;  1T3Q A;  4GPT B;  2AQ3 B;  1AYF A;  2D9X A;  3F5R A;  5J3Y A;  4MAC A;  5HKH A;  1RM6 C;  1XXG A;  3TMP B;  5CHF A;  1WGD A;  4P7I A;  4DXG A;  1KRH A;  4ZYN A;  2M14 A;  2D9Y A;  2MX2 A;  3TFM A;  4C4V B;  4BFR A;  3ZKJ C;  3ZRF A;  2JX5 A;  1J0G A;  3FM8 C;  3HVZ A;  4WQO B;  1JCK B;  1VRA B;  4KKI A;  1FXI A;  1WXS A;  1V5O A;  2KFK A;  1LW3 A;  1DDW A;  2LMC A;  2W3R A;  2KJH B;  4A55 A;  4HB4 B;  3N1Z C;  4B0E A;  2KR0 A;  1P7F A;  3DBR I;  3DVN V;  2JXT A;  4GNK B;  2KQS A;  1YN4 A;  4P1C C;  5I2M A;  2IBI B;  3A1Q A;  3MP9 A;  3AH7 A;  1K5D B;  4MH0 E;  1ZDV A;  2LGD A;  3LYY A;  1PGX A;  2WHI A;  2JUO A;  3V60 A;  2LEK A;  2YS5 A;  1YIW A;  1N62 A;  4GB9 A;  4OVU A;  4AP4 C;  2DLW A;  5KQ1 A;  3P4R B;  4YXD B;  1I7A A;  2NTS A;  1D4B A;  2YT2 A;  1LM8 B;  1I35 A;  1KLV A;  2EMS A;  1NI3 A;  5J17 A;  5LG4 B;  1EAZ A;  1WY8 A;  2D9V A;  3KQ4 A;  1N61 A;  1V1O A;  2KWD A;  2N9P C;  2ZJD A;  4HAT B;  4YTN B;  4MGY E;  4YSX B;  4NAM A;  2UU7 A;  4HDO A;  2P0D A;  1SE9 A;  3PLU A;  4RM8 A;  2L00 B;  3KZ1 A;  1I2H A;  2WX0 A;  3UIN B;  1T6B X;  3KW5 B;  3N32 A;  2D07 B;  2LRU A;  1YX5 B;  3UI3 A;  3BZD B;  2RMM A;  1PQS A;  4ZYS A;  2LVP A;  3B1L X;  4WAF A;  2W2X C;  2W82 A;  3HVD A;  2OJR A;  3NG0 A;  2ACZ B;  4HLE A;  5CLL B;  3NVV A;  2WLB A;  1FCL A;  1ZUD 2;  3QCA A;  5DPR A;  3IBE A;  4IW0 A;  4URK A;  3M3J A;  4HPL B;  5EE1 A;  2FCM A;  3RZW C;  1WGK A;  3NS8 A;  3VR8 B;  4DBG A;  4GN1 A;  1XR0 B;  2LAS A;  2DZM A;  1XD3 B;  3BIN A;  4TKN A;  2QIL A;  2DZJ A;  2W2X D;  1DGJ A;  1V5M A;  1WX9 A;  2BS3 B;  3SD5 A;  4UDU C;  1YQ4 B;  2HE7 A;  2RPV A;  2VRR B;  1S1Q B;  3C19 A;  2KIE A;  2INP E;  3RNG C;  4ANV A;  2ADZ A;  3PT2 B;  3T3O A;  1V5U A;  5JHG A;  1WZ0 A;  2UYZ B;  3ZJV A;  2Z14 A;  3VDZ A;  5HE1 A;  4MEM A;  3S2A A;  4AS1 A;  4IC7 B;  3DOW A;  1W1D A;  2ZCB A;  2GCJ A;  1XLN A;  2ELB A;  2GBR A;  4M0W A;  4JWU C;  2B3A A;  2JQR B;  1UH6 A;  2PVG C;  4RNA A;  3FIL A;  4II3 B;  4N58 A;  1FRD A;  2BQQ A;  4KGR A;  3HHM A;  2HTH A;  5TSS A;  4GDL B;  2W55 A;  3NZU A;  3PHW B;  3TIX A;  5C3J B;  4EUT A;  3O13 A;  2QCZ A;  3N1X C;  1A5R A;  4TV3 A;  3K9P B;  4CQN A;  3A9K B;  2DTC A;  2DKP A;  2KX0 A;  2NTT A;  4JWS C;  2H7D A;  2PE6 B;  1NVI D;  3PRP B;  2XK5 A;  1IBX A;  5IKC M;  5LXI B;  4WJO A;  3KUZ A;  2BW2 A;  3AE4 B;  3VRA B;  1D5M C;  1TGZ B;  2KXJ A;  2QKM A;  4NY0 A;  2R09 A;  1MK7 B;  1I4G A;  4NPN A;  4L2Y A;  3UQA A;  2G35 A;  3VR9 B;  1N3H A;  1EVH A;  2J4X A;  2LUL A;  4M8N A;  4NJ7 A;  2GCL A;  2FUG 1;  1KZG A;  5C6R A;  3RD2 A;  4HHV A;  3VXW A;  2BF8 B;  5J3Q A;  4DDI D;  5FR3 A;  3V5W A;  2N9X A;  1UEL A;  4F7G A;  3HRD D;  4KAX B;  1UBI A;  4A6F A;  2KHW B;  2IPK D;  3GB1 A;  3NOB A;  2WU5 B;  4GIV A;  2VH1 A;  2Y3A A;  4RGT A;  1C77 A;  4K2P A;  4HDQ A;  2FCQ A;  4OVV A;  2COA A;  5H92 C;  1PGB A;  4I6N B;  1OQR A;  2MH7 A;  3IG3 A;  4JGH B;  2WDQ B;  3I63 C;  3W1S C;  1GB4 A;  2XK5 B;  1IBX B;  2Z4D A;  2KO3 A;  2MJE A;  4F7Z A;  4ICU A;  1WG7 A;  1IUE A;  5LXH A;  4PQ0 A;  1HQR D;  2MQJ A;  3CWI A;  1Q0W B;  3VTU A;  2JXX A;  3A1Q B;  3LXF A;  5C23 A;  3NY5 A;  3H7S A;  1TKE A;  1MHX A;  3IAS 1;  4DX9 0;  2FJU B;  3KRX A;  4GGQ A;  4HAW B;  1V86 A;  4LTU A;  2COD A;  3H8H A;  5AEK B;  2L0F A;  4BKS D;  2D5G A;  3IAM 1;  4L23 A;  1VCB A;  2VZK D;  3G9W A;  5GXG B;  3AB5 A;  4W9G A;  1U4A A;  2XEW A;  3DBR B;  4HKZ E;  4JPS A;  2BYV E;  2QSD A;  3ODW A;  3HUI A;  4M01 A;  1PMS A;  2JZ3 B;  4CSQ A;  4XX5 A;  2FNJ B;  3O96 A;  3M62 B;  2MBO A;  1Y19 B;  2KDI A;  2IY0 B;  1V1P B;  2A4Z A;  3L16 A;  1WJ1 A;  1HZ5 A;  4EZL A;  2I1K A;  2JZZ A;  4ASW C;  4DIX A;  2W3S A;  2RNR B;  5I2S A;  4EE2 A;  1DBH A;  3JSV B;  1MVK A;  1R4N I;  3CF6 E;  4HCP B;  3RFZ B;  3KYD D;  2BWF A;  2R2O A;  2M1M A;  3U7D A;  1TQZ A;  4PYU A;  4GU2 A;  3KH0 A;  3M1I B;  1N5X A;  4HB0 B;  3DBH I;  4JLC A;  5FI1 A;  3VTV A;  3AEB B;  2LVO A;  4OSN A;  2PIA A;  1U5D A;  1WGU A;  4M0W B;  5KQ4 A;  1HXY D;  1LFD A;  4W9J A;  2MBQ A;  2MA9 B;  1SIF A;  4A3O A;  1YQB A;  2YRY A;  3TEW A;  3AE6 B;  2SEB D;  3MC9 A;  1C4P A;  4B9K A;  5C5B A;  1QOG A;  5EE3 A;  1W1H A;  2PW9 A;  2DHJ A;  3RNC C;  1ZKH A;  4WWM A;  1E90 A;  2LXA A;  1M7R A;  3U30 A;  1L4Z B;  2WWZ A;  1IPG A;  4E3C A;  2KAC A;  3I5J C;  2RR9 A;  2IO1 B;  4RGO S;  4KX6 B;  1SB3 C;  1BML C;  3TBL D;  2P8V A;  1SSN A;  1AQC A;  2D3B A;  3R2I A;  1QOF A;  4A6H A;  5L81 A;  4TQ1 A;  1SHC A;  4W9H A;  2BWE S;  2L7R A;  2UVM A;  4GOC A;  1TS5 A;  4BVU C;  3W2D A;  3QWM A;  3EFU A;  2MFQ A;  3NZS A;  5C1Z A;  1UF0 A;  2M4N A;  2KYW A;  3W5V B;  3L17 A;  2M0X A;  1YNT E;  2L52 A;  5E6J A;  3EHV A;  3KY9 A;  2AEH A;  4W9I A;  2JU6 X;  2IYD B;  3TO1 A;  3U8Z A;  4PS8 A;  3ODO A;  3P4S B;  4KSK C;  3NVZ A;  1WSP A;  2NBV B;  2FE8 A;  3I9V 1;  2XQN M;  1XQQ A;  2CU3 A;  2KX3 A;  4LDT D;  4ARI A;  1GAQ B;  1E0Z A;  3V62 A;  1XLQ A;  5BYS A;  5J18 A;  2LXC A;  2LGS A;  3DXC A;  1TKG A;  1F2R C;  5DHF B;  3JSV A;  4IM2 A;  2C5L C;  2FCN A;  2LGX A;  1FGZ A;  4PNK A;  3VAW A;  2BYE A;  3FIL B;  4YL8 A;  2KAJ A;  2LD9 A;  4K17 A;  1TT5 B;  1AAR A;  1V97 A;  2SAK A;  4K7S A;  2L3Z A;  4TSS A;  2Z0Q A;  2QKL A;  1Q67 A;  2C7N B;  1ZXI A;  2KDM A;  4KGS A;  1EF1 A;  1FM0 D;  2WYQ A;  2Z0O A;  4JE3 B;  3IHP C;  2GBK A;  5TR5 A;  1UPR A;  1UBQ A;  4PK1 A;  3CIK A;  1TBE A;  5H8Y E;  1LQB A;  3VUY A;  4W9E A;  5G2N A;  4A20 A;  2B76 B;  3Q3M C;  1QQR A;  5HFY A;  3HK0 A;  5J3T A;  2O2V B;  2WDV B;  5BMI A;  3LJ3 A;  2K8C A;  2MDX A;  1Q10 A;  1XO3 A;  2BVC A;  2YEP F;  1E8X A;  1WJU A;  1FMA D;  4DDG D;  1JWS D;  1YN5 A;  2KK8 A;  3BYT B;  3SEB A;  4RGN A;  2RVB B;  1I7H A;  3W1S A;  1WF9 A;  5DPW A;  2K25 A;  1T5X D;  2RSU A;  4MGK E;  3WAL A;  2OQB A;  2CU1 A;  5HE0 A;  2GB1 A;  3AEC B;  5EDS A;  2WXL A;  1OQN A;  2DAF A;  2ZKM X;  2Z59 A;  5IP4 D;  4IKG A;  1KLG D;  2MHJ A;  1P9D U;  1C76 A;  2DX1 A;  4F7H A;  2AYO B;  1KF6 B;  1CQV A;  1GUA B;  2ASQ A;  2WXI A;  1R7S A;  4LK0 M;  2KLG A;  4LNI A;  2LI5 A;  1N5W A;  4HWI B;  1JWM D;  2OED A;  2RSG A;  2NBU A;  1N60 A;  1U2B A;  2R0D A;  4A6F B;  4GLS C;  4AUQ C;  2M17 A;  4A5K A;  1SEB D;  1PDX A;  1VZ7 A;  4XWW A;  2QEJ C;  1IYF A;  4QXA B;  2BS4 B;  4QAY A;  3ALB A;  4A3P A;  1L0X B;  1MG4 A;  1MIX A;  2DKQ A;  4C00 A;  3GE3 C;  4KHB A;  2LKO A;  2K6D B;  4WJQ A;  4EOY A;  3JVZ X;  2WXN A;  3MHZ A;  1U29 A;  2O6V B;  2RD0 A;  3IT6 B;  5D3I B;  2K2U A;  4L1R A;  3L54 A;  1YJI A;  1QLB B;  3UZT A;  5KHQ A;  2LFI A;  1LB1 A;  3N1Y C;  2Y8G A;  1KI1 B;  4NAW B;  3PZ7 A;  4KHA A;  2LYD A;  3LB8 C;  5FI0 A;  3PVW A;  4OZA A;  3PSE B;  2GBN A;  4HRO A;  5IRS A;  1K50 A;  3P2B A;  4WIP A;  1ZDX A;  1VJK A;  4LDT B;  4K7W A;  4RF0 A;  4II2 B;  1M7E A;  4LNF A;  5C79 A;  1V2Y A;  4X57 B;  2WS3 B;  3R7Q A;  3U2S C;  1V9J A;  2Y5P A;  1M4V A;  1SF0 A;  1QOB A;  4NNJ B;  2J53 A;  1DOI A;  4MK0 A;  2KQ7 A;  4LNN A;  2H7E A;  4ZOH C;  2LZ6 A;  5D7G A;  1K8R B;  2MLB A;  1S3S G;  2L76 A;  1WMH B;  1FEH A;  1MPH A;  5LOP B;  1UZX B;  4HXD A;  1IP9 A;  3NSU A;  1XCG A;  1ZOY B;  3QHT A;  3RNB C;  4XWT A;  2NCN A;  3ZW3 A;  1MI0 A;  2KUQ A;  3TL5 A;  4LJP B;  2LJI A;  1X1F A;  1IGD A;  4USA A;  1C1Y B;  2G4S A;  2AL6 A;  3EGR A;  4AQ7 A;  1VD2 A;  1AW7 A;  1ESF A;  3GYO A;  4DWF A;  4FN2 A;  3ULC A;  4OZB A;  3RN9 C;  1UPQ A;  5AZH A;  5G55 A;  5LON B;  2LRW A;  4W9L A;  4QJ4 B;  4WUR A;  1JRP A;  4EFO A;  1J0W A;  4P16 A;  1TZ1 A;  3ML9 A;  3APC A;  1U5G A;  1K53 A;  1ISN A;  1QQG A;  1DYN A;  4JL9 A;  4EZK A;  2CJN A;  1ACC A;  2ZPN A;  5DHA B;  3U7Z A;  3WA0 A;  1TKY A;  2CHX A;  4DHZ B;  3FEH A;  3D8E A;  1H4R A;  1MAI A;  2DFK A;  4B0M A;  3MDB C;  3QJZ A;  3Q2A C;  5G5H A;  1FRR A;  2WP9 B;  1TIF A;  1ZPS A;  2I5C A;  3GZN B;  4HJG E;  2BGF A;  1WGR A;  1NEK B;  4HPM B;  1Y56 A;  1CZP A;  1BWN A;  3N30 A;  3VH3 B;  2DNF A;  2UZS A;  5DH9 B;  1JRO A;  2GRI A;  2EKI A;  2JYE A;  3P6A A;  2UZR A;  3PRM B;  1NYR A;  2N9E B;  1F2R I;  1YJJ A;  3Q8E A;  4JQW C;  4DHZ E;  2IDY A;  5KCV A;  2L8J A;  2HJ8 A;  3RNE C;  1C4A A;  1WIA A;  2FID A;  3B2G A;  4K7U A;  2KOX A;  2L05 A;  2K3U A;  4KVG B;  1E9M A;  2MWN B;  5JHA A;  2ZVO A;  3ZYY X;  3HM6 X;  1WWT A;  4BOS C;  2KVZ A;  5AZF A;  2KMM A;  2CY4 A;  4LJO B;  4K81 A;  1V8C A;  5KHO A;  2WXJ A;  2JVC A;  5D3Y A;  3PS6 A;  1ZE3 D;  2H88 B;  3O65 B;  4HSI A;  2OHF A;  3EFC A;  2LVQ A;  3H6N A;  1QC6 A;  4Y94 A;  4HAZ B;  3A58 A;  1WGQ A;  2DZI A;  4NZL B;  2LUE A;  4HRS A;  4KIK B;  1F0Z A;  1UNP A;  3V3X A;  1WXA A;  1PFD A;  4NSW A;  2AQ2 B;  2M19 A;  3ECI A;  3J9C A;  3NWA A;  2D10 A;  4DXA B;  1TYG B;  3H7P A;  3ZRC A;  1FFV A;  1PYW D;  3GP7 A;  1SBB B;  2GBM A;  2E2X A;  3A9J A;  2YSZ A;  1FNW A;  3ZUN A;  2D11 A;  1RFK A;  5D6J B;  3AE5 B;  3VH4 B;  4F1S A;  3VOQ A;  5C5B B;  4HAV B;  1WM2 A;  1L5P A;  2INN E;  4C7Y A;  1M94 A;  1FNU A;  1RRP B;  3DBL B;  2PPH A;  4YWG G;  2IGH A;  3NVY A;  3DQV A;  2KIG A;  3PEG A;  1QOA A;  1WE7 A;  3ZVR A;  4CHJ A;  2KGX B;  1J19 A;  1WGY A;  2J59 M;  3DBH B;  3CXB B;  2DLB A;  3DDC B;  3I57 A;  3KUD B;  4K2O A;  3EC8 A;  2WXO A;  2L83 A;  3VUW A;  1MKE A;  2DHI A;  3RMK C;  4J6I A;  3D8D A;  1V80 A;  1VZ8 A;  2NBW B;  2JPH A;  2WXF A;  1GG3 A;  1TS2 A;  2FUH B;  1V61 A;  2JY6 A;  5I4D A;  4C0A A;  3DXD A;  4HJK A;  2D2Q A;  1OY2 A;  2KMA A;  4EJN A;  1E7V A;  1FIQ A;  1FXT B;  2KTR A;  3KYC D;  4KDI C;  2DHZ A;  3Q8B A;  1QT9 A;  2NBV A;  2WDR B;  4M8M A;  1MFW A;  3OHM B;  1OEY J;  2KZR A;  2VH2 A;  2IO2 B;  5IOI A;  2DWQ A;  1B55 A;  3SYX A;  4A6K A;  3GE8 C;  1D5X C;  2KDF B;  1F77 A;  2L32 A;  1XF5 L;  1G6J A;  1WXM A;  2IGD A;  3TW1 A;  2HTM E;  2NMB A;  2L1A A;  3RT3 B;  2M0A A;  2KJR A;  3R7R A;  2Z0P A;  2KTR B;  4HCN B;  4US8 A;  1LO5 D;  2DX5 B;  1EU4 A;  4Q2J A;  1MI1 A;  1TTN A;  3V6C B;  2V0G A;  4XWX A;  3ZNZ B;  3MTN B;  2Z13 A;  1AWE A;  3EEC A;  3ZXR A;  4D6W A;  2LGI A;  2N7J A;  1ZYI A;  4BBN C;  3QAR A;  3WIM A;  3OAN A;  1C79 A;  1NTV A;  2V4I B;  4QJ5 B;  2YT0 A;  2BT6 A;  3Q8F A;  4MM3 B;  3A33 B;  4DQO C;  2JRH A;  1CMX B;  5DPS A;  1WJN A;  4FUL A;  4IOI E;  2Y5C A;  3HIZ A;  1WGG A;  4A90 A;  3Q3F A;  3IFW B;  4FLH A;  4DX8 A;  3PRZ A;  3IXS A;  2ON8 A;  1WE6 A;  4ZRJ A;  4C56 C;  1KLU D;  3T9L A;  3W1Y A;  2M38 A;  2J42 A;  2YS3 A;  1SE3 A;  2ZNV B;  3DWG C;  2KWV B;  3K9O B;  2KFK B;  4IWP A;  1NDD A;  4BAX A;  3LDZ E;  2BPS A;  3UGB B;  4GMX B;  4HKQ A;  4NQL B;  3AU5 A;  5AZG A;  2QMT A;  2VSZ A;  3BII D; 
#chains in the Genus database with same CATH homology
 1V89 A;  4YL8 A;  2KC1 A;  2FCS A;  4K17 A;  2LD9 A;  1WGD A;  4P7I A;  5CHF A;  3TMP B;  2DYN A;  3BJI A;  1AAR A;  4ZYN A;  2M14 A;  2D9Y A;  2MX2 A;  3TFM A;  2V3S A;  4K7S A;  4BFR A;  2DN6 A;  2L3Z A;  5CHW A;  2N4F A;  2N1V A;  3ZKJ C;  3ZRF A;  4IUM B;  3RCZ A;  1J0G A;  3FM8 C;  2Z0Q A;  2Z0D B;  2QKL A;  3GYP A;  1Q67 A;  2C7N B;  4WWP A;  4WQO B;  1EF1 A;  4DBB A;  1A5R A;  5IA7 A;  2EJ8 A;  1WXS A;  2KFK A;  1V5O A;  4HB3 B;  2WYQ A;  1Y5O A;  5C16 A;  2N1W A;  2WDT B;  2L1C A;  5DPT A;  1LW3 A;  1DDW A;  5D27 A;  2Z0O A;  5D3W A;  3IHP C;  4WJN A;  2KJH B;  4HB4 B;  3WYF B;  4Z2N A;  2GBK A;  5TR5 A;  1UPR A;  1UBQ A;  3VQI A;  3CIK A;  1TBE A;  3DBR I;  1LQB A;  1K5G B;  1ZC4 B;  2NR2 A;  3DVN V;  3VUY A;  4W9E A;  4F8C B;  5L83 A;  2KQS A;  4AOF A;  3ZDT A;  3ZTC A;  5G2N A;  2LWP A;  1WI1 A;  4A20 A;  3CSF A;  2IBI B;  4GZU A;  3SO6 A;  3A1Q A;  2JRI B;  3PSC A;  2MBH A;  1K5D B;  4MH0 E;  3HK0 A;  2LGD A;  1PFJ A;  2BKR B;  1KOT A;  5J3T A;  3PPA A;  4WSF A;  2OTX A;  2JUO A;  4ANU A;  3DCG A;  2O2V B;  3V60 A;  2YS5 A;  1KM7 A;  1YIW A;  3LJ3 A;  2K8C A;  2MDX A;  1WH3 A;  4GB9 A;  4OVU A;  3L13 A;  4E74 A;  4FJZ A;  4AP4 C;  2DLW A;  1E8X A;  1WJU A;  5KQ1 A;  3OLM D;  4MDK E;  1I7A A;  1LM8 B;  4DDG D;  1I35 A;  2KK8 A;  2RGN B;  1KLV A;  2EMS A;  4TYZ A;  5J17 A;  1OTR B;  1EAZ A;  1FHW A;  1P5T A;  1WY8 A;  3ZNG C;  2D9V A;  2RVB B;  3QQ8 B;  3W1S A;  2RLO A;  1WF9 A;  2N9P C;  2ZJD A;  5DPW A;  3ZDM C;  3DXE A;  4HAT B;  2K25 A;  3JYU A;  4MGY E;  2RSU A;  4MGK E;  3WAL A;  2OQB A;  2CU1 A;  4HDO A;  5HE0 A;  2P0D A;  3SU8 X;  5EDS A;  1SE9 A;  3PLU A;  1IRS A;  1OQN A;  3ODX A;  4RM8 A;  2DAF A;  2LGY A;  2L00 B;  1WM3 A;  3KZ1 A;  1I2H A;  3TJP A;  2WX0 A;  4HAU B;  3LJU X;  1P9D U;  2D9W A;  2JWZ A;  2DX1 A;  4F7H A;  3UIN B;  3VDZ A;  2AYO B;  1GUA B;  1BTN A;  3PGE A;  3KW5 B;  2ASQ A;  3AXC A;  2D07 B;  2LRU A;  3N32 A;  1YX5 B;  2DEN B;  2KLG A;  3T06 A;  2Y8F A;  2LI5 A;  1PQS A;  3BY4 B;  2KWU B;  4IM3 A;  1J8C A;  2J0M A;  4HWI B;  2LVP A;  1YJ1 A;  2RSG A;  2NBU A;  3B1L X;  1C3T A;  1U2B A;  2KDB A;  2R0D A;  2W2X C;  5CX3 A;  1P6S A;  4Z2M B;  4A6F B;  4AUQ C;  2M17 A;  3PRE A;  4A5K A;  2OJR A;  4GDK B;  2YLM A;  4HLE A;  2KLC A;  5CLL B;  4YON A;  2ROZ B;  4XZ4 A;  4G11 A;  3ZIM A;  1XT9 B;  1IYF A;  1DRO A;  1FGY A;  1WVH A;  2NVU I;  3QCA A;  5DPR A;  3IBE A;  3ALB A;  4IW0 A;  4HB2 B;  2D4Q A;  3VHT C;  4A3P A;  4URK A;  1RRB A;  3N7C A;  3M3J A;  4HPL B;  2FCM A;  4CYE A;  1MIX A;  2W9N A;  2EKE C;  3KVF B;  2DKQ A;  3NS8 A;  4HK2 A;  1UNQ A;  3RZW C;  5E6O A;  3DVG X;  3DBL I;  2LKO A;  4DBG A;  1YD8 U;  2K6D B;  3L08 A;  3N3K B;  4GN1 A;  1XR0 B;  2LAS A;  1RLF A;  2GJY A;  2C9W B;  3PV1 A;  2DZM A;  1Z87 A;  4WJQ A;  4EOY A;  1XD3 B;  3JVZ X;  3BIN A;  1DDM A;  4GXB A;  4TKN A;  1EUV B;  1P3Q U;  2COC A;  2MBB B;  5JHB A;  1RFA A;  1U29 A;  2DZJ A;  1EO6 A;  2O6V B;  2RD0 A;  3DBS A;  2W2X D;  3ML8 A;  2K2U A;  1V5M A;  3WAP A;  1WX9 A;  3SD5 A;  2JP2 A;  3L54 A;  2VRR B;  2HE7 A;  4ANV A;  5E6P A;  1S1Q B;  5LLI A;  3ZNI D;  3QA8 A;  2ADZ A;  3PT2 B;  1WMH A;  2HTH B;  1V5U A;  3UZT A;  1ZM0 A;  1OQY A;  5JHG A;  1WZ0 A;  2DYO A;  1LB1 A;  2JF5 A;  2MWS B;  2UYZ B;  5HE1 A;  3B08 A;  2Y8G A;  1KI1 B;  1W1G A;  4MEM A;  4NAW B;  3S2A A;  4F7U P;  4G0N B;  4IC7 B;  3DOW A;  1TXD A;  2LYD A;  2NZ8 B;  1W1D A;  4KHA A;  5CLQ B;  2N7D A;  2A5U A;  2GCJ A;  5FI0 A;  3PVW A;  1OEY A;  2ZCB A;  1HE8 A;  5DIF B;  2ELB A;  2GBR A;  2GBN A;  2YS1 A;  2OOB B;  3PSE B;  2K1F A;  4KDL B;  2B3A A;  3P2B A;  1UH6 A;  3APD A;  2KC2 A;  4LDT B;  2KAN A;  4II3 B;  3KSY A;  4K7W A;  3CMM B;  4WJP A;  2DHK A;  5GMV A;  4AWJ A;  1D3Z A;  4II2 B;  1M7E A;  5E6N A;  3QIJ A;  3A8Q A;  3DPD A;  4KHB B;  4CHM A;  5C79 A;  3A98 B;  3IVF A;  3HHM A;  5CHV C;  1V2Y A;  2HTH A;  4X57 B;  3R7Q A;  3WAO A;  1R4M I;  4FHJ A;  1NBF C;  4ZRI A;  4BBN F;  1V9J A;  1ZGU B;  2ZCC A;  4GDL B;  2DYB A;  2V76 A;  3NZU A;  3PHW B;  3TIX A;  3RZF A;  1E5W A;  1F9J A;  2ZEQ A;  4WVF B;  4EUT A;  4NNJ B;  1WI0 A;  2NPT A;  5AZG A;  4HAY B;  3R3M A;  1QZE A;  3RYT A;  4MK0 A;  1BT0 A;  2KQ7 A;  2H7E A;  3SNH A;  3K9P B;  1KZ7 A;  3X23 A;  4TV3 A;  5IAA C;  3UIO B;  3A9K B;  4IAP A;  1Z5S B;  1U27 A;  2DTC A;  2KD0 A;  2O2V A;  2DKP A;  2W2W A;  2KVR A;  2KX0 A;  2LZ6 A;  5D7G A;  2H7D A;  1K8R B;  2RGF A;  3RUI B;  2MLB A;  1S3S G;  2L76 A;  2PE6 B;  1WMH B;  3QX1 A;  4XC2 A;  3PHX B;  3PRP B;  1MPH A;  5LOP B;  1UZX B;  4HXD A;  4WAA A;  3V6E B;  4W9J A;  3NSU A;  1XCG A;  2XK5 A;  4IWQ A;  5LXI B;  4WJO A;  3QHT A;  2CY5 A;  3KUZ A;  1EF5 A;  2NCN A;  5HE3 A;  1ZC3 B;  1RAX A;  3ZNH B;  3ZW3 A;  2Y7B A;  1TGZ B;  2KXJ A;  2QKM A;  1BAK A;  4NY0 A;  2R09 A;  1MK7 B;  4LJP B;  4NPN A;  3TL5 A;  1X1F A;  3UQA A;  2J0J A;  2G35 A;  3AU4 A;  3SUZ A;  1C1Y B;  2AL6 A;  2G4S A;  4JIO U;  5D2M B;  2D9Z A;  1N3H A;  1EVH A;  1VD2 A;  3ZTD A;  2LUL A;  4M8N A;  3GYO A;  2DA0 A;  2GCL A;  2YT1 A;  3ULC A;  4FN2 A;  1KZG A;  4NJ7 A;  1UPQ A;  4D0N B;  3SHQ A;  4IWO A;  2KDE B;  5C6R A;  5AZH A;  5G55 A;  4NJ6 A;  2N0Y A;  5LON B;  2FJL A;  2LRW A;  4W9L A;  3RD2 A;  4AJW A;  4HHV A;  3VXW A;  2BF8 B;  4MSM B;  5J3Q A;  4EFO A;  1J0W A;  2FIF A;  1TZ1 A;  2EMT A;  3ZLZ A;  4DDI D;  3DVN U;  3ML9 A;  3V5W A;  2BCJ A;  4HAX B;  3APC A;  2N9X A;  3ULB A;  2PZ1 A;  5EFX A;  2BYE A;  1U5G A;  2ELA A;  4F7G A;  1UEL A;  2LG1 A;  2G45 B;  2N23 A;  1TJ6 A;  2NPT B;  1ISN A;  1QQG A;  4W9C A;  1DYN A;  2J0K A;  4JL9 A;  4BKT A;  4KAX B;  2KFJ A;  4EZK A;  1UBI A;  4A6F A;  2KMC A;  2KHW B;  2ZPN A;  5DHA B;  2IZV B;  2CKH B;  5GOW B;  3WA0 A;  2CHX A;  2UWQ A;  3FEH A;  3NOB A;  3D8E A;  4MEL A;  1H4R A;  4DHZ B;  1MAI A;  1X1M A;  4FJY A;  4MSQ B;  4KV2 A;  1WYW B;  2DFK A;  4DK5 A;  4GIV A;  3AUL A;  2NS5 A;  3VFK A;  5JZE B;  2LJ5 A;  3X0W A;  3MDB C;  3QJZ A;  2KUP A;  1H8C A;  2GOW A;  4FBJ B;  1Y8R C;  4FJV B;  4HVB A;  3WAM A;  3QK0 A;  1X11 A;  2I5C A;  1WRD B;  3C0R B;  1XD4 A;  2BGF A;  2CS4 A;  4K2P A;  4HDQ A;  1EGX A;  1WGR A;  2IO0 B;  1MIZ B;  2MP2 B;  2FCQ A;  2N7E A;  3HM3 A;  4GMV A;  1Z2M A;  1BWN A;  2COA A;  3N30 A;  4HPM B;  4OVV A;  3VH3 B;  3QAQ A;  2UZS A;  5DH9 B;  2ZPY A;  4I6N B;  3A4S C;  4MGI E;  4RM9 A;  5JLJ B;  4B95 A;  1V6E A;  3H7P B;  3IG3 A;  4JGH B;  3P6A A;  4ICV A;  2UZR A;  2KCJ A;  2J7Q B;  3PRM B;  2RPQ A;  2N9E B;  1LXD A;  2KO3 A;  2XK5 B;  3W1S C;  4F7Z A;  4ICU A;  1WG7 A;  4JQW C;  4DHZ E;  4I6P A;  5LXH A;  4PQ0 A;  2IYB A;  5KCV A;  2L8J A;  2HJ8 A;  2MQJ A;  4BKG A;  1V49 A;  1GC6 A;  1Q0W B;  3VTU A;  2JXX A;  2Z0E B;  3A1Q B;  1PLS A;  5D3V A;  1WIA A;  2DX5 A;  2C7M B;  2FID A;  3JW0 X;  2KOX A;  2I5F A;  2VRW B;  1WX8 A;  2L05 A;  3NY5 A;  3HW2 B;  5C23 A;  1IP9 A;  4IOY X;  3H7S A;  3PG7 A;  4DX9 0;  1WGH A;  3KRX A;  4GGQ A;  4HAW B;  4GSW A;  1V86 A;  3R66 C;  5JH5 C;  5D3X A;  4KVG B;  4MJS A;  2COD A;  2MWN B;  5JHA A;  5AEK B;  1GC7 A;  2ZVO A;  2CRF A;  4NAW A;  3L0W B;  2DYM A;  2L0F A;  4BKS D;  3HM6 X;  3PLV A;  3Q3J A;  3D8F A;  1X05 A;  1V5T A;  3KUC B;  3ML4 A;  4WWO A;  5JHH A;  4BOS C;  2CHW A;  1VCB A;  2K2J A;  3G9W A;  5AZF A;  1UNR A;  1V88 A;  2CY4 A;  3FSS A;  3QBV B;  4MY6 A;  1T0Y A;  4LJO B;  4W9G A;  3UF8 A;  4K81 A;  5KHO A;  2GBJ A;  1U4A A;  5D3Y A;  2JVC A;  3PS6 A;  1I42 A;  1L2N A;  3O65 B;  2KKC A;  2XEW A;  1H10 A;  4DHJ B;  2CAY A;  2WX1 A;  5DCN A;  2LVQ A;  2BYV E;  4CHK A;  4DWF A;  3ODW A;  3VVW B;  2V1Y A;  3H6N A;  1QC6 A;  1NTY A;  2GS0 A;  4Y94 A;  1PMS A;  4HAZ B;  1WGQ A;  2DZI A;  2JZ3 B;  4XX5 A;  2FNJ B;  2LUE A;  4GDL A;  4KIK B;  1UNP A;  3O96 A;  3PP2 A;  3M62 B;  2O6V D;  2KNB A;  1WXA A;  2MBO A;  3ZO5 B;  3L10 B;  4NSW A;  3QC8 B;  2MBE A;  3ECI A;  1V5P A;  1Y19 B;  1ZSQ A;  2EC1 A;  2D10 A;  2AWT A;  1OGW A;  5HE2 A;  4DXA B;  2BKF A;  4DHJ D;  3H7P A;  3ZRC A;  2G4D B;  4G50 A;  2KDI A;  2IY0 B;  1XX0 A;  1GNU A;  4EMO A;  2A4Z A;  2ZVN A;  2I1J A;  2ZZP B;  3L16 A;  2GBM A;  3ZVV A;  1FOE A;  2E2X A;  1WJ1 A;  5DI9 B;  1KJT A;  2YSZ A;  1UGM A;  3A9J A;  2I1K A;  3ZUN A;  4EZJ A;  4EZL A;  5JP4 A;  2D11 A;  1Q5W B;  2VKI A;  1P3R A;  1FHO A;  2FAZ A;  4PS3 A;  2X18 A;  2K8H A;  4GDK A;  2JZZ A;  4PS7 A;  5D6J B;  3VH4 B;  4ASW C;  4F1S A;  2RNR B;  2BYF A;  2M8S A;  3VUX A;  3VOQ A;  5C5B B;  4EKU A;  4HAV B;  2DZK A;  3P7Z A;  2L0T A;  1WM2 A;  2IY1 B;  3GOE A;  3SV1 A;  5KHQ A;  1GJZ A;  5J2R A;  1P1A A;  2K8B A;  2P0F A;  1DBH A;  1UEF A;  3KRW A;  1M94 A;  1Q1O A;  2G3Q B;  3JSV B;  1RRP B;  4IM0 A;  4FHK A;  4W9D A;  2O6V A;  3OJ3 A;  4MGZ E;  1R4N I;  2COF A;  3TVV A;  2PPH A;  3CF6 E;  1U5F A;  2CR5 A;  4HCP B;  4WWN A;  3KYD D;  2XBB C;  3UQB A;  2BWF A;  2R2O A;  3HQC A;  2Y5B B;  3DQV A;  4TUU A;  3PEG A;  2M1M A;  3M63 B;  1WE7 A;  3DVG Y;  3MJW A;  3U7D A;  1TQZ A;  1V81 A;  1L7Y A;  3AJ4 A;  3ZVR A;  4CHJ A;  1WR1 A;  2V4L A;  4GU2 A;  4K1R B;  3KH0 A;  4KZ0 A;  4PYU A;  2KGX B;  5CTR C;  3M1I B;  1J19 A;  1WZ3 A;  4HB0 B;  1WGY A;  3SDL C;  2J59 M;  3CXB B;  3DBH I;  2K00 A;  3V61 A;  4FA6 A;  1E8W A;  5FI1 A;  4JLC A;  2RUK B;  3PVL A;  4LCD E;  3DDC B;  3PZD A;  1OMW A;  3VTV A;  4H8S A;  2LVO A;  3KUD B;  1NU2 A;  4K2O A;  1U5D A;  3EC8 A;  1WGU A;  3WAN A;  4ZRK A;  4BOZ B;  4KSL C;  4M0W B;  4BKS A;  5KQ4 A;  1WX7 A;  2L2I A;  4MT7 A;  1X86 A;  1MKE A;  1WJ4 A;  1LFD A;  1WJ6 A;  2MP2 A;  2PE9 A;  3A9J B;  3D32 A;  1MK9 B;  2DHI A;  3I3T B;  2MBQ A;  4J6I A;  2MA9 B;  5D94 A;  4CO7 A;  3D8D A;  1V80 A;  1SIF A;  3T8M A;  4FAD A;  4IFS A;  2NBW B;  4A3O A;  1YQB A;  2JPH A;  2D3G A;  2YRY A;  3NHE B;  1YX6 B;  3VUW A;  3QWZ B;  1GG3 A;  2FUH B;  2ZNV C;  3CST A;  2C60 A;  3ONS A;  1V61 A;  2JY6 A;  3AI5 A;  4B9K A;  2P0H A;  5C5B A;  4BBK A;  2MSE D;  4C0A A;  2KWC A;  1W1H A;  4ANW A;  3DXD A;  2DHJ A;  4TQ0 A;  3UIP B;  2YF0 A;  1ZKH A;  2KTF A;  4HJK A;  2D2Q A;  1OY2 A;  1E90 A;  2KMA A;  2LXA A;  2R2Q A;  4EJN A;  1E7V A;  1FXT B;  3MPX A;  1M7R A;  2KTR A;  3KYC D;  2DHZ A;  4KDI C;  3U30 A;  2C7H A;  2WWZ A;  1WJM A;  3MHS D;  3TCA A;  1IPG A;  1MG8 A;  1U5E A;  3H9D A;  3GZN I;  4M8M A;  4E3C A;  1BTK A;  2RR9 A;  2IO1 B;  1OEY J;  1ZW7 A;  2KZR A;  2IO2 B;  3A4R A;  3TBL D;  1E8Z A;  1FHX A;  2P8V A;  1B55 A;  1AQC A;  3SYX A;  2MRP A;  3PTF C;  3RUL A;  4A6K A;  4B6H A;  2K39 A;  4A6H A;  4MM3 A;  2CHZ A;  2KDF B;  5L81 A;  4TQ1 A;  3F0W A;  1SHC A;  4W9H A;  4B6W A;  4AJY B;  1G6J A;  1WR6 E;  1WXM A;  3TW1 A;  2NMB A;  2GMI C;  2PEA A;  2BWE S;  5L95 C;  2L7R A;  4KHO A;  4MJS B;  2UVM A;  4GOC A;  4EEW A;  3RT3 B;  4WJ7 A;  4BVU C;  3OAW A;  2KJR A;  3R7R A;  2Z0P A;  1WXV A;  3QWM A;  3RCP A;  2IO3 B;  2JT4 B;  2KTR B;  2MFQ A;  3EFU A;  3NZS A;  1JRU A;  4HCN B;  4K7U A;  2PJH A;  4PYZ A;  2DYQ A;  5C1Z A;  2M4N A;  2Z59 B;  2MW5 A;  3H1U A;  2DX5 B;  4N9F 4;  2Q13 A;  2M0X A;  3L17 A;  4RMA A;  1FB8 A;  4NQK E;  1TTN A;  3EHV A;  4I6L B;  3KY9 A;  3V6C B;  2AEH A;  4XWX A;  3ZNZ B;  4W9I A;  3MTN B;  2DAJ A;  2IYD B;  1AWE A;  3TO1 A;  3A9K A;  3U8Z A;  1SGH A;  4ZDV A;  4W9F A;  4PS8 A;  3EEC A;  2IFS A;  2MKR A;  3ODO A;  1DDV A;  4BBN C;  4KSK C;  3QAR A;  3WIM A;  3A8P A;  3OAN A;  2NBV B;  5FR6 A;  3PVU A;  1NTV A;  2AL3 A;  3APF A;  5BO4 B;  1XKE A;  1P98 A;  2XQN M;  2YT0 A;  4KZC A;  2HD5 B;  3M95 A;  2LOZ A;  4ANX A;  3OJ4 B;  1XQQ A;  3B0A A;  2KX3 A;  3A33 B;  2JRH A;  1CMX B;  5DPS A;  4LDT D;  1WJN A;  2K6Q A;  4FUL A;  3VTW A;  3HIZ A;  3V62 A;  1WGG A;  3VIA A;  3Q3F A;  3IFW B;  1FAO A;  2ROV A;  1E8Y A;  5J18 A;  4FLH A;  2KN5 A;  1RJ2 A;  4DX8 A;  4G3X B;  2LXC A;  3PRZ A;  1ZVR A;  4W9K A;  1WE6 A;  1P0R A;  3DXC A;  4ZRJ A;  2MCN B;  1UD7 A;  2KJ6 A;  1WFY A;  1NI2 A;  4IG7 B;  1XOD A;  2LOX A;  3T9L A;  3W1Y A;  2M38 A;  5DHF B;  4E71 A;  2YS3 A;  4KIK A;  2ZNV B;  4GPT B;  2KWV B;  3K9O B;  3JSV A;  4IM2 A;  2C5L C;  2KFK B;  1NDD A;  4IWP A;  2D9X A;  4L6E A;  2BPS A;  2FCN A;  3LDZ E;  2LGX A;  3UGB B;  3ENE A;  1FGZ A;  3F5R A;  4GMX B;  1X1G A;  5J3Y A;  4PNK A;  2REX A;  3AU5 A;  4NQL B;  3VAW A;  2YVC A;  5HKH A;  1E7U A;  2VSZ A;  2QHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...