4GMVA

Crystal structure of the coiled-coil, ra and ph domains of lamellipodin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
269
structure length
260
Chain Sequence
KAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-associated and pleckstrin homology domains-containing pr
publication title Crystal structure of Lamellipodin implicates diverse functions in actin polymerization and Ras signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 77
structure length 260
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gmvA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gmvA01
3PEGA 2JF5A 2L1CA 2JUOA 2R0DA 3QJZA 1Y5OA 4Z2MB 1EUVB 3O96A 3KSYA 2K8BA 2D2QA 3W1YA 5CHWA 1Q1OA 2KGXB 3M1IB 3KUCB 3D8FA 1WI0A 2EJ8A 4OVVA 2IO0B 2RR9A 4EMOA 3QK0A 3B08A 1ZC3B 5D27A 2DHZA 4GSWA 4LDTD 3M63B 1DBHA 1XD4A 4IFSA 4F7HA 3W1SA 4F7ZA 3OANA 5HKHA 2LXAA 1I7AA 1WJ6A 2H7DA 2YRYA 4FN2A 1RRPB 2L05A 2KN5A 3UINB 2V1YA 2KJ6A 4AOFA 3GZNI 2KDBA 3PPAA 3VTWA 1V5MA 5L81A 3U7DA 4A6KA 4K1RB 4W9LA 4II3B 3PS6A 3KVFB 1QZEA 1Y8RC 5GOWB 3RUIB 2CY5A 3DVNV 5FI0A 4J6IA 1ZKHA 3TL5A 2K6QA 4AP4C 1J0GA 3Q3JA 1WI1A 5L95C 1Z2MA 1K5DB 3M62B 5KQ1A 4MJSA 3IFWB 4GDLA 1R4MI 3N3KB 3NHEB 5AZHA 2DLWA 3OJ3A 4WJ7A 3F0WA 2KTRA 5DPRA 1FB8A 4P7IA 4IOYX 3DVGX 5JHHA 5D3YA 2A4ZA 1YX6B 5DCNA 2J7QB 2G4DB 4K81A 3PRPB 3JW0X 4MJSB 4GDLB 2W2XC 4OVUA 2LGDA 3L08A 4ZYNA 5D94A 4HVBA 2NS5A 1BAKA 3SV1A 2IBIB 1C1YB 4IM3A 1WJ4A 3MTNB 4K7SA 4FBJB 4DBGA 1AQCA 2DFKA 3TMPB 4B6WA 3CSTA 2YLMA 2YS3A 1UNQA 5DPTA 3ECIA 4K2OA 1MKEA 4AUQC 3R7RA 2Z0DB 3ML9A 5DPWA 3AXCA 4MELA 1HE8A 2ROZB 3A8QA 1KJTA 1XQQA 2UVMA 2KC1A 3KYCD 3ZKJC 3QCAA 1PLSA 2IZVB 4WJNA 5LOPB 5E6NA 3CF6E 2DHKA 4FHJA 3AJ4A 1P5TA 3KW5B 2CR5A 2FNJB 1UGMA 1LM8B 4IW0A 4DK5A 1N3HA 4A3OA 5G2NA 4TYZA 2D9VA 1R4NI 2Z0OA 2J0KA 4MGKE 4MEMA 2BYFA 3WALA 1DDWA 3VQIA 2WWZA 2X18A 2KHWB 1XR0B 2O6VA 2MBHA 2MWNB 4ANUA 4DHJD 2LGXA 2KK8A 4ANWA 3UQBA 3ENEA 1FAOA 3PHXB 1OQNA 4DBBA 2ELAA 2IYBA 4I6LB 3QARA 1UZXB 3ULCA 3JVZX 4JLCA 4GZUA 2LASA 2O6VB 2BGFA 2PZ1A 2HTHA 2CHXA 1E8YA 2I1KA 2CRFA 4HHVA 1TZ1A 4ZRJA 1WZ3A 3DPDA 4MH0E 1IPGA 3B0AA 2P0FA 4GIVA 2JRHA 1Y19B 1WM2A 2FJLA 1V88A 3QC8B 2KJRA 4ANXA 2LULA 2L8JA 2C5LC 3DXEA 1TJ6A 1H8CA 2NVUI 3NY5A 3ZNGC 4CHMA 1UBQA 2N9EB 4NAWA 2HTHB 1KLVA 2N9XA 2O2VB 4I6NB 5AZFA 2FUHB 4CHKA 3EHVA 4KHAA 2GCLA 3H7SA 1E7VA 2XQNM 4RMAA 1MIZB 4W9CA 3KH0A 4KIKA 1I35A 5CLQB 1V49A 1WZ0A 1V5UA 3H9DA 3HM3A 2Y8FA 3KYDD 3L0WB 5D7GA 3EFUA 4DXAB 4CYEA 2RD0A 3CXBB 2CHZA 2DHJA 1M94A 1OGWA 1K5GB 2G35A 2NBWB 1AWEA 4KHOA 1OTRB 5J3QA 3S2AA 4C0AA 3A33B 4WVFB 1NTYA 4NY0A 1SE9A 3BY4B 2UZRA 4PYZA 3ZNID 4NSWA 1Q0WB 1V2YA 1EF1A 4PS7A 2ZVNA 1ZGUB 1VCBA 3QBVB 1WGQA 4F1SA 4JQWC 4YL8A 2WYQA 3NSUA 1WR6E 5J3TA 2LVPA 1RFAA 1U29A 2LRUA 1V5PA 2DZMA 4BKGA 1S1QB 4F7UP 2KMAA 3KRWA 3ML4A 5C6RA 3UQAA 1XD3B 1NTVA 1H10A 3BJIA 2Z0QA 2BYVE 1LB1A 3WA0A 1V80A 2K1FA 1BTKA 3PV1A 1V6EA 4MGIE 5DHAB 3A8PA 2K2UA 1SHCA 3DXCA 3UIOB 2EMSA 2GBJA 3X0WA 4ZDVA 5IAAC 2OOBB 3RD2A 2ASQA 3R7QA 2KDEB 1BT0A 2COFA 1WXSA 1X1FA 2NBVB 2KLCA 4XZ4A 2MWSB 1AARA 1WRDB 2CHWA 3VH4B 3ML8A 3DBSA 2MP2A 3QIJA 2DYOA 2G45B 1V9JA 1LW3A 4DX8A 3PVWA 1YIWA 4BKTA 1P98A 4H8SA 3DVNU 4N9F4 1Q5WB 2DKQA 2BF8B 4W9KA 4ANVA 1UD7A 4EFOA 1QQGA 2P8VA 2JY6A 2ZEQA 4GB9A 3VIAA 1P3QU 2N4FA 2PEAA 2N23A 4G11A 4GDKA 1WR1A 4IG7B 2C7HA 3IVFA 2M4NA 4RM9A 1E8ZA 5C23A 2B3AA 3H1UA 1IP9A 2NMBA 3ONSA 1UELA 3FM8C 2IYDB 3WANA 2DN6A 5JP4A 1BTNA 3LJUX 2KKCA 2AEHA 2KLGA 4HAUB 3X23A 3DQVA 5JHBA 4GDKB 1OQYA 3APDA 3L54A 5J3YA 3OLMD 1U2BA 4IC7B 4MGZE 4IWPA 4IWOA 4MK0A 4G3XB 3MPXA 4RM8A 2LG1A 2D9YA 3HHMA 3VVWB 2V76A 1WVHA 5CLLB 1FHOA 3ZVRA 4HPMB 1UNPA 1LFDA 2XK5A 3VHTC 4K17A 1X1GA 4BFRA 4XWXA 3TCAA 4A6FA 4KHBB 3RCPA 1T0YA 1RLFA 1J0WA 4GN1A 2PE9A 1P6SA 3TO1A 4KZ0A 3L13A 2YF0A 2EKEC 4BBNF 2EMTA 2N1VA 1YQBA 2XK5B 2DX5A 1E8XA 4A6FB 4WWOA 1UPQA 3ZDTA 1DYNA 5L83A 3SNHA 2YS5A 2M8SA 2MA9B 2IO2B 5J18A 4W9GA 2N1WA 3EC8A 3G9WA 2KFJA 1WH3A 5HE2A 3SYXA 2QKLA 2D07B 4EEWA 1IYFA 2IY0B 1U5DA 2FAZA 5LONB 1NU2A 1PFJA 2DZIA 3PTFC 2FCNA 2DX5B 1Z87A 2V3SA 3ZTDA 2LOXA 3JSVA 4URKA 3UZTA 1P3RA 1UPRA 4KDLB 4DX90 3VAWA 4HAVB 1KZGA 4AWJA 4EZKA 4DHJB 1B55A 2GMIC 3H7PA 2KTRB 4TQ1A 3F5RA 4IM0A 2KDIA 2LGYA 2C9WB 4M0WB 4JIOU 5KQ4A 2W9NA 2RGNB 3UIPB 2VSZA 1E90A 5C79A 2MKRA 3JSVB 3QAQA 2KD0A 1WJUA 3SDLC 4WJQA 4W9HA 2LJ5A 2C60A 3HQCA 2M1MA 4PYUA 4W9IA 2UYZB 3K9PB 3Q3FA 1L2NA 4DDGD 2MX2A 2K8HA 2COCA 3CIKA 3KZ1A 1OMWA 2RUKB 2ELBA 2DYQA 3RULA 3TFMA 3NS8A 4M8MA 3KUZA 1J19A 1I2HA 2N9PC 1EVHA 2RGFA 2ZNVC 1EO6A 4HCPB 1P0RA 1MK7B 4ICUA 3BINA 2GBNA 2DTCA 4FLHA 2RNRB 2DENB 1RJ2A 3IHPC 3FEHA 5DIFB 2M14A 2DYNA 1BWNA 3CSFA 1WGGA 2KVRA 4IWQA 4K7UA 5AZGA 1GUAB 3L17A 2J59M 4X57B 2H7EA 2MFQA 3ZDMC 2BPSA 4KV2A 3MDBC 4PS8A 1FHXA 1WE7A 4AJYB 2L2IA 2GJYA 3ODOA 3WAMA 5D3WA 2KTFA 4MM3A 2KO3A 3PT2B 2D4QA 2MBQA 2DX1A 2G3QB 4HLEA 2LVQA 2LXCA 5CTRC 4DWFA 5DH9B 2K39A 3A9KA 2W2XD 2MW5A 3CMMB 4KZCA 1TTNA 2LWPA 5HE1A 3TJPA 4HAXB 2BYEA 1H4RA 2CU1A 5JLJB 3FSSA 2FIFA 4GPTB 2I5CA 1A5RA 2PJHA 2MLBA 2A5UA 5KHQA 1DDVA 2KNBA 3A9KB 3VOQA 2KWUB 3NZSA 1KM7A 4NJ7A 1U4AA 2L7RA 1M7EA 3DBRI 2Q13A 1Q67A 2LI5A 4GXBA 3PVLA 5TR5A 4NAWB 2L0TA 3U8ZA 4HPLB 4HXDA 2JP2A 3SD5A 2N0YA 5FI1A 1P1AA 4KIKB 2ZCCA 4DHZB 1X11A 2VKIA 4NJ6A 3L16A 3GYOA 4GMVA 5AEKB 3ODWA 2N7DA 2MBOA 1V61A 1WXVA 4B6HA 2HE7A 2JRIB 1RAXA 1WF9A 2WDTB 4GGQA 1EAZA 4HJKA 3PHWB 4E71A 1FHWA 3A98B 5EFXA 3B1LX 4CO7A 1KZ7A 3V5WA 2KX0A 3SO6A 1WE6A 3V62A 3LDZE 4W9FA 1I42A 2BCJA 3RZWC 2GBKA 2RVBB 2CY4A 5DI9B 2Z0PA 1VD2A 3DBHI 1XODA 1MIXA 1X05A 4DDID 1ZM0A 2COAA 1UNRA 3UGBB 2QHOA 4II2B 1WGHA 1IRSA 5C5BA 2VRRB 1WYWB 4WWPA 2NZ8B 5JHGA 2D9WA 3N7CA 2KJHB 2QKMA 3RZFA 1YX5B 2DA0A 4FULA 1TXDA 2OJRA 2YVCA 3PSEB 3VUYA 3VTUA 1WFYA 1XX0A 4FHKA 4A6HA 2UWQA 2Y8GA 1WG7A 1M7RA 5CHVC 2M17A 2C7NB 2DKPA 3DXDA 2L00B 4KAXB 3IBEA 3RYTA 1F9JA 5C5BB 1V89A 3K9OB 1ZVRA 2JWZA 1E8WA 3QX1A 4Z2NA 4L6EA 2CS4A 4B9KA 4KDIC 3OAWA 4FJZA 2KFKA 4IUMB 2LUEA 1OEYA 2DYMA 5D6JB 2ZVOA 2MP2B 2JPHA 1LQBA 2K8CA 3D32A 4EKUA 4MDKE 2YS1A 3ZNHB 1YJ1A 1LXDA 1E7UA 4DHZE 2K6DB 2KXJA 1GC7A 3ZTCA 1ISNA 2WX1A 3OJ4B 1RRBA 2MRPA 4GU2A 3KY9A 1WJMA 1EF5A 2KFKB 1S3SG 3QA8A 4HB2B 1FGYA 1U5EA 3HK0A 3ZO5B 3RCZA 3TBLD 3JYUA 3WIMA 1P9DU 4EZLA 3AI5A 2WX0A 3P6AA 1WM3A 4EZJA 4D0NB 2W2WA 3APCA 3M3JA 2E2XA 2LZ6A 2MBEA 3ALBA 3W1SC 2PPHA 2ADZA 3VUXA 3KRXA 1K8RB 5JHAA 1KOTA 3VTVA 3VH3B 2Z59B 4KSKC 3A4RA 3V6EB 3HM6X 4FJVB 3DBLI 1JRUA 1ZC4B 4LJOB 3QWMA 3P7ZA 1WGRA 4GOCA 4TUUA 4K2PA 3PVUA 2L3ZA 2N7EA 2D10A 2OTXA 1MAIA 4IAPA 3PP2A 3V6CB 4KVGB 4EJNA 4HCNB 1GJZA 1G6JA 4A5KA 3PGEA 1V5TA 2BKFA 3ZVVA 1EGXA 4FA6A 1MPHA 2ZJDA 1UBIA 5CX3A 4W9EA 5D3VA 3DVGY 1C3TA 5LXIB 5E6PA 5DHFB 2LYDA 2FCQA 4WAAA 3TIXA 3N30A 2UZSA 2AWTA 1WXAA 4NQKE 3EECA 3WYFB 2M38A 4MSMB 3T9LA 4BKSA 3QHTA 2LVOA 2L76A 2K00A 3C0RB 5CHFA 4W9JA 1UH6A 4BOZB 3T8MA 2KWCA 4BBKA 2KQ7A 4MGYE 5D3XA 5E6OA 1WJ1A 2HD5B 2ZZPB 1DDMA 3T06A 4NNJB 3I3TB 2RLOA 1QC6A 3GYPA 2RPQA 5IA7A 1V86A 2IY1B 2LOZA 3DOWA 5JH5C 3L10B 3WAPA 4LJPB 2DHIA 5DPSA 1MG8A 2AYOB 1WGYA 3TW1A 1FGZA 2C7MB 4TV3A 3UF8A 4BBNC 3VDZA 1TBEA 2KCJA 2KC2A 2DAJA 5JZEB 3H7PB 1V5OA 4I6PA 3ZIMA 3VXWA 4NQLB 3A4SC 2KQSA 2CODA 3D8EA 1WX9A 1XCGA 4ZRIA 1WMHA 3DDCB 1NDDA 2MBBB 2KWVB 3NZUA 2D9XA 2GS0A 3PSCA 2K25A 4G0NB 1E5WA 5C16A 5HE3A 2I1JA 3AU4A 4M8NA 4MY6A 1WIAA 2RSUA 5LXHA 2MDXA 3AU5A 2KUPA 2L0FA 1FOEA 3A9JA 3QWZB 4AJWA 3NOBA 2IFSA 2YSZA 2ROVA 2AL6A 2FIDA 1ZSQA 4A20A 1WMHB 2JZZA 1ZW7A 3IG3A 1PMSA 4G50A 2ZPYA 4WJPA 2J0JA 2NBUA 2R2QA 4HAYB 2GBMA 4TQ0A 4XC2A 4WQOB 4WJOA 4BOSC 2D11A 3ZRFA 4BKSD 4A3PA 2I5FA 4GMXB 5KCVA 4HK2A 1GC6A 2NPTA 4F8CB 1SGHA 3A9JB 3PLUA 1W1HA 2J0MA 2ZNVB 1PQSA 2HJ8A 1NI2A 4BVUC 3O65B 3PZDA 2MSED 4ICVA 3MHSD 4JL9A 1GG3A 2AL3A 1UEFA 3SU8X 2Y5BB 1U5GA 2O2VA 2YT1A 3H6NA 3V61A 1TGZB 4CHJA 2FCSA 4Y94A 3PRZA 2NPTB 4IM2A 4E3CA 2CAYA 2KZRA 2DYBA 3P2BA 4HDOA 5HE0A 1FXTB 2Z0EB 2DZKA 1TQZA 2DZJA 1WXMA 4B95A 3SUZA 3WAOA 4HWIB 2XBBC 2MQJA 1GNUA 2OQBA 1WGUA 4W9DA 4NPNA 4KSLC 2FCMA 2YT0A 2LRWA 4HDQA 2KOXA 5J2RA 2XEWA 3SHQA 1U5FA 1WGDA 2KDFB 4ZRKA 3PLVA 2BWFA 4XX5A 1Z5SB 4MT7A 2RSGA 2GCJA 4E74A 2VRWB 5J17A 5EDSA 4LCDE 2K2JA 2R09A 3D8DA 2ZPNA 3LJ3A 2NR2A 3VFKA 3PRMB 2G4SA 3PREA 2R2OA 2O6VD 5FR6A 2P0DA 4HB0B 1OEYJ 4K7WA 1MK9B 1DROA 3VUWA 4TKNA 1J8CA 1KI1B 3TVVA 2LD9A 5GMVA 2DAFA 2MCNB 2BWES 2M0XA 1WY8A 3QQ8B 2REXA 2Y7BA 3ZW3A 2CKHB 2JT4B 4PS3A 1XKEA 3R3MA 2V4LA 4EUTA 2GOWA 4HAZB 5G55A 3ULBA 3ZLZA 2NCNA 1OY2A 3KUDB 2ZCBA 3U30A 3AULA 4HB4B 2PE6B 3GOEA 1SIFA 4HAWB 3N32A 4FADA 4WWNA 2IO3B 1W1GA 2D9ZA 3ZUNA 1XT9B 4HATB 5BO4B 3DCGA 1V81A 1WJNA 4HB3B 1NBFC 2JZ3B 2JVCA 3A1QA 3V60A 5C1ZA 3PG7A 4F7GA 2LKOA 2EC1A 2P0HA 2KX3A 5LLIA 5D2MB 1W1DA 4ASWC 4LDTB 1CMXB 1X1MA 1YD8U 2IO1B 2KANA 1D3ZA 1X86A 5KHOA 2KMCA 4MSQB 2GBRA 3R66C 4YONA 2D3GA 3M95A 4PQ0A 2BKRB 3RT3B 1L7YA 3A1QB 1WX7A 3ZRCA 3MJWA 4FJYA 3HW2B 4EOYA 4WSFA 4PNKA 1WX8A 3APFA 3HIZA 2JXXA 3ODXA 1U27A 4JGHB 3ZNZB
chains in the Genus database with same CATH superfamily
3PEGA 2JF5A 2KUQA 2L1CA 1UF0A 3NJTA 2J42A 2JUOA 4XWTA 2R0DA 3QJZA 1Y5OA 2BTEA 2LMCA 4Z2MB 1EUVB 3N20C 2LHDA 3O96A 1C4AA 2X38A 3KSYA 2K8BA 1QQRA 2D2QA 3W1YA 5CHWA 2L1AA 1Q1OA 1MFWA 1TKYA 2KGXB 3M1IB 3U7ZA 3KUCB 3D8FA 4HPPA 2R2YA 4RGTA 1MVKA 1WI0A 2EJ8A 3AEFB 4OVVA 2IO0B 2RR9A 1Q10A 2VZKD 4TSSA 4EMOA 4M02A 3QK0A 3B08A 3SFEB 1ZC3B 3EA6A 5D27A 2DHZA 3FKYA 1A70A 4GSWA 2BT6A 3W5UB 4ZHOA 4LDTD 3M63B 3AN1A 1GOZA 1DBHA 1XD4A 4IFSA 4F7HA 1FNWA 3W1SA 4F7ZA 4GLSC 3GZNB 3OANA 5HKHA 2LXAA 1I7AA 1WJ6A 2K49A 1UNSA 3EUB2 2H7DA 2YRYA 4FN2A 3TEZA 4N58A 1RRPB 2L05A 2KN5A 4NZLB 3UINB 2QCZA 2V1YA 3TEYA 4JWUC 2JQRB 2KJ6A 4AOFA 1MG4A 3GZNI 2KDBA 3PPAA 2BW2A 3VTWA 2JU6X 1V5MA 2PTLA 5L81A 3U7DA 4A6KA 4S0RA 2KDMA 4K1RB 2WLBA 4W9LA 4II3B 3PS6A 3BK2A 3KVFB 1L0YB 1QZEA 1Y8RC 5GOWB 3RUIB 2CY5A 1L0VB 3DVNV 4MH8A 5FI0A 4J6IA 2H89B 1ZKHA 2W82A 3TL5A 2K6QA 1R4MB 3DHGC 3AE5B 4AP4C 1J0GA 1L4ZB 3Q3JA 2GRIA 1WI1A 4JX1C 5L95C 4WQMA 2WS3B 2LUMA 1Z2MA 1K5DB 1F0ZA 3M62B 5KQ1A 4MJSA 3IFWB 4GDLA 2MJDA 1R4MI 3N3KB 3NHEB 1N5WA 3OG5A 5AZHA 4H2AA 2DLWA 1SE2A 1MI1A 3OJ3A 1HTOA 3RNCC 4WJ7A 3F0WA 2KTRA 5DPRA 1FB8A 1SBBB 4C7ZA 2WHIA 4P7IA 4IOYX 3DVGX 4M0WA 5JHHA 5D3YA 1J7CA 2A4ZA 1YX6B 5DCNA 2J7QB 5C2TB 2G4DB 4K81A 3PRPB 3U52E 3ZXRA 3GE3C 3JW0X 2PVOD 2BQQA 4MJSB 5MPOA 2N9LA 4GDLB 4YSZB 2W2XC 4OVUA 2LGDA 1QOGA 1ZPSA 3L08A 4A90A 1F1HA 4ZYNA 5D94A 4HVBA 3UI3A 2NS5A 1BAKA 2WP9B 3SV1A 2IBIB 4YXDB 1C1YB 4IM3A 1WJ4A 2SAKA 3I57A 1TZOA 3MTNB 2Y3AA 4K7SA 4FBJB 4DBGA 1AQCA 2DFKA 3TMPB 4B6WA 3CSTA 1QILA 3RN9C 2QSDA 2YLMA 3EGRA 2YS3A 1UNQA 5DPTA 2HDEA 3ECIA 1J7AA 1D6EC 2IJ0A 4K2OA 1MKEA 2E3TA 2K3UA 4AUQC 5FR3A 1JRPA 1WGKA 1C9FA 4PK1A 2DBYA 3J9CA 3R7RA 2Z0DB 4WURA 3ML9A 2K8EA 5DPWA 3AXCA 4MELA 1HE8A 2AX5A 2ROZB 3A8QA 1KJTA 1XQQA 2UVMA 3N9YC 2KC1A 3KYCD 4LTUA 3VRBB 3ZKJC 2MH7A 1ENFA 3QCAA 1PLSA 2IZVB 3Q3NC 4WJNA 2NTTA 2MEKA 3DHHC 5LOPB 1R4NB 5E6NA 1CZPA 3CF6E 2DHKA 1MHHE 3NRZA 4FHJA 3AJ4A 1P5TA 2AQ2B 1ZOYB 3KW5B 2CR5A 2FNJB 1UGMA 1LM8B 4IW0A 2WNMA 4DK5A 1N3HA 4A3OA 5G2NA 4TYZA 1T6BX 2D9VA 1R4NI 3NS1A 2Z0OA 5AUIA 2J0KA 4MGKE 4MEMA 1N5XA 2BYFA 3WALA 4DIXA 2R61A 1SE3A 2WXFA 1DDWA 3W9CB 1ESFA 3VQIA 2WWZA 2X18A 2KHWB 1XR0B 1J7BA 1DOYA 2O6VA 2MBHA 3V05A 1D4BA 2MWNB 4ANUA 1JWSD 3AEDB 2WXKA 3BYTB 4DHJD 2LGXA 1VZ7A 3BWUD 2KK8A 4RF0A 4ANWA 3UQBA 4RGMA 5HHDG 3ENEA 1FAOA 1ZP0B 4CQNA 3BYYB 3PHXB 1OQNA 4DBBA 2ELAA 1KLUD 2IYBA 1FM0D 4I6LB 3QARA 1ET9A 1UZXB 4OVZA 3ULCA 3NVWA 3JVZX 2PLPA 4ACFA 2ON8A 2WXIA 2JWUA 3Q8EA 4JLCA 3HRDD 2W3SA 3Q8BA 1VLBA 4GZUA 2LASA 2O6VB 2BGFA 2PZ1A 2HTHA 2CHXA 1E8YA 1E9MA 4C7YA 2OJWA 2I1KA 3AH7A 2CRFA 4HHVA 1TZ1A 1N61A 4ZRJA 1WZ3A 2J4XA 3H8HA 1JWMD 3DPDA 4MH0E 1FXIA 1IPGA 4RH6A 1I4XA 1PFDA 3P4RB 2JYEA 4OHJA 3AEEB 3B0AA 2P0FA 4GIVA 4LNKA 1DYQA 2JRHA 1Y19B 4B0EA 1WM2A 2YEPF 2FJLA 1V88A 3QC8B 2KJRA 3MP9A 2LHEA 4ANXA 2LULA 2L8JA 2C5LC 1ZUD2 3DXEA 1TJ6A 1H8CA 2TSSA 2NVUI 1HEZE 3NY5A 3ZNGC 5HI1A 4CHMA 1UBQA 2N9EB 3C8YA 2HTHB 4NAWA 1KLVA 3AV8A 3I5JC 2N9XA 2O2VB 4I6NB 5AZFA 1E10A 2FUHB 4CHKA 3EHVA 2WQYB 3DBRB 4KHAA 2GCLA 3H7SA 1E7VA 2XQNM 2EKIA 1MIZB 4RMAA 3KH0A 4KIKA 4W9CA 5CLQB 1I35A 2W54A 1V49A 3Q69A 1WZ0A 4KKIA 1V97A 1V5UA 4BZAA 2QJLA 2Z4DA 2PKOA 3H9DA 2SEBD 3HM3A 4MACA 2WXPA 2Y8FA 4M01A 2GB1A 3KYDD 3L0WB 5D7GA 3EFUA 4DXAB 4CYEA 2RD0A 3CXBB 2CHZA 2DHJA 1ET6A 1M94A 1OGWA 1K5GB 1N63A 2G35A 2NBWB 1AWEA 4JWSC 4KHOA 1OTRB 1CK1A 5J3QA 3S2AA 4C0AA 3A33B 4WVFB 2MHJA 1NTYA 4NY0A 1SE9A 3BY4B 2UZRA 4PYZA 3ZNID 4NSWA 2ZW1A 1Q0WB 1V2YA 1EF1A 3P4PB 4PS7A 3B9JA 1AYFA 4QJ5B 2ZVNA 1ZGUB 1VCBA 3QBVB 1WGQA 4F1SA 2BS4B 4JQWC 4YL8A 2WYQA 3NSUA 1WR6E 4YSYB 5J3TA 4A6QA 2LVPA 3IAS1 1RFAA 2ZW0A 1U29A 1VZ6A 1QKZA 2LRUA 1AWDA 1V5PA 1XF5L 3DBHB 2DZMA 4BKGA 1K51A 4GNKB 1S1QB 4F7UP 2KMAA 3TSSA 3KRWA 3ML4A 5LG4B 5C6RA 3UQAA 1XD3B 1NTVA 1H10A 3BJIA 2Z0QA 2BYVE 1LB1A 3WA0A 1BMLC 2PIAA 1V80A 1XLQA 1FRRA 2K1FA 4YT0B 1BTKA 3PV1A 2IPKD 1V6EA 4MGIE 5DHAB 3A8PA 1VZ8A 2K2UA 2W3RA 3KWLA 1SHCA 3DXCA 1OQRA 3UIOB 2EMSA 2GBJA 3X0WA 4ZDVA 1NYQA 5EE3A 5IAAC 2OOBB 3RD2A 2ASQA 3R7QA 1FMAD 3RFZB 1NVID 2KDEB 1BT0A 5BMGA 3RNGC 2EELA 1JQ4A 4WH4A 1PUTA 2COFA 1WXSA 1X1FA 2WU5B 5G5GA 1GB4A 4C56C 2NBVB 2KLCA 4XZ4A 2MWSB 2AQ1B 3BK1A 3BVZA 3TEXA 1AARA 1WRDB 2CHWA 1OFFA 3VH4B 3ML8A 2L83A 3DBSA 2VZKB 3DHIC 2MP2A 5E6JA 2ONQA 5EE9A 3QIJA 2DYOA 2G45B 4RGNA 1V9JA 1LW3A 4DX8A 4HJGE 3PVWA 1YIWA 4BKTA 3MC8A 1P98A 4H8SA 2BB6A 3DVNU 1PYWD 4N9F4 1Q5WB 2DKQA 2VH2A 3FILA 2BF8B 1JROA 1HZ6A 2GLSA 4W9KA 2IDYA 4ANVA 1UD7A 3URYA 4EFOA 4C80A 1QQGA 2P8VA 2JY6A 2ZEQA 2BVCA 4GB9A 3AM9A 3VIAA 1YNTE 4DXFA 1P3QU 1QOBA 3A58A 4XDCA 2N4FA 1C4CA 3U2SC 2PEAA 2BS3B 1SF0A 1XO3A 2N23A 4G11A 4ZRQA 4GDKA 1WR1A 1FCLA 3E56A 4IG7B 3CIRB 5BMIA 4L1RA 2C7HA 3IVFA 2HTME 4RGOS 3W2DA 2M4NA 4RM9A 2MJEA 1D5XC 2INNE 1E8ZA 5C23A 1BUIC 2B3AA 3H1UA 2KIGA 1IP9A 2NMBA 2AQ3B 3FILB 3ONSA 1VRAB 1UELA 3FM8C 2IYDB 3WANA 1CJEA 4ZYSA 2DN6A 5JP4A 1BTNA 3LJUX 3Q6BA 2KKCA 2AEHA 2KLGA 3OHMB 4HAUB 3WCQA 3X23A 4JE3B 5D3IB 1IGDA 3DQVA 5JHBA 1Y56A 4GDKB 4KHBA 4KGSA 1OQYA 3APDA 3L54A 5J3YA 3AB5A 2M0AA 2D3BA 4P6VF 3OLMD 1U2BA 1JMLA 4IC7B 4MGZE 4ZOHC 3Q3MC 3EFCA 4IWPA 4IWOA 4MK0A 4G3XB 3MPXA 4RM8A 2LG1A 1KRHA 1GPXA 2D9YA 3HHMA 3VVWB 2V76A 1WVHA 5CLLB 1FHOA 1UUPA 4YTPB 3ZVRA 4HPMB 1ROEA 1UNPA 3N1ZC 1LFDA 2DNFA 2XK5A 3VHTC 4K17A 1X1GA 4BFRA 4XWXA 1SJHD 3TCAA 4A6FA 3KLSX 4KHBB 3RCPA 1T0YA 2JX5A 1RLFA 1J0WA 4GN1A 3KWVA 2PE9A 1P6SA 3TO1A 4KZ0A 3L13A 2YF0A 2EKEC 1FNVA 4B0MA 4AS1A 4BBNF 1K50A 2WXQA 1T5XD 3NVVA 2EMTA 1L6VA 1SE4A 2N1VA 3ZGZA 2LJIA 1YQBA 3AMZA 3BIID 2B76B 1YN5A 5H8YE 2XK5B 2DX5A 1ZXIA 5FKAC 1E8XA 1C4PA 4A6FB 1V8CA 4WWOA 1UPQA 2CJNA 3ZDTA 1MHXA 2JXTA 1DYNA 5L83A 3SNHA 4PT5A 2YS5A 2M8SA 2MA9B 1K53A 2IO2B 5J18A 4W9GA 2CJOA 1LO5D 2N1WA 2K9XA 3EC8A 3G9WA 2KFJA 1WH3A 5HE2A 3SYXA 3MC0B 2QKLA 2D07B 2KAJA 1KH0A 4EEWA 1IYFA 2V0GA 2RMMA 5HG2A 2RDGA 2IY0B 1U5DA 1T77A 2FAZA 3ZQ4A 5LONB 1UWXA 1NU2A 1PFJA 2N9KA 2DZIA 5BYQA 3PTFC 2FCNA 2DX5B 4O1NA 3NZ3A 4C4VA 1Z87A 2YT2A 2V3SA 2IGDA 3ZTDA 1I4RA 1AN8A 2LOXA 3JSVA 4URKA 3UZTA 1P3RA 3NWDA 1UPRA 4KDLB 4US9A 4DX90 3AE9B 3VAWA 2RRFA 4P16A 5I4DA 4HAVB 1MPEA 1KZGA 4AWJA 4EZKA 2RDBC 4DHJB 1B55A 1F2RI 2GMIC 3H7PA 2KTRB 3HVZA 2L52A 1DOIA 4TQ1A 3F5RA 4IM0A 2KDIA 2LGYA 2C9WB 4M0WB 1UGJA 2QMTA 4JIOU 5KQ4A 1JWUD 3E9SA 2W9NA 2RGNB 3UIPB 4C4VB 2VSZA 1E90A 3P63A 4P1BC 2WDQB 5C79A 2MKRA 1PGXA 3JSVB 2LEKA 3QAQA 2KD0A 1WJUA 1C76A 3SDLC 4WJQA 4W9HA 2LJ5A 2C60A 3HQCA 2M1MA 4PYUA 1I7HA 4W9IA 3R8BA 2UYZB 3K9PB 3ZYYX 3Q3FA 5IKCM 2K5PA 1L2NA 4JPSA 1ZE3D 3CWIA 4DDGD 2KR0A 3NVZA 2MX2A 2K8HA 2COCA 3CIKA 3KZ1A 2NTSA 4IOIE 1OMWA 2RUKB 2ELBA 2DYQA 2G9HD 2BYTA 3RULA 3TFMA 1JALA 3HVDA 5TSSA 4YSXB 1N6ZA 3NS8A 4M8MA 3KUZA 1J19A 1I2HA 3BVGA 4IDIA 2N9PC 1EVHA 2RGFA 2ZNVC 3LB8C 1NEKB 1EO6A 3P4SB 3T3OA 4HCPB 3GP7A 1P0RA 3L4PA 1MK7B 4ICUA 3BINA 2GBNA 2DTCA 2K22A 4FLHA 2RNRB 2DENB 1RJ2A 3SFDB 3NG0A 3IHPC 3FEHA 5DIFB 2M14A 2DYNA 2KACA 1BWNA 3CSFA 1WGGA 2KVRA 4IWQA 4K7UA 5AZGA 1EM7A 1M4VA 4EE2A 5EE1A 3AE8B 4N6EB 4OW0A 4ZRPA 1GUAB 3L17A 2J59M 4X57B 2H7EA 2MFQA 3ZDMC 2BPSA 4KV2A 3MDBC 4PS8A 1FHXA 1WE7A 4AJYB 2L2IA 2GJYA 3ODOA 3WAMA 5D3WA 1F77A 3IT6B 2KTFA 4MM3A 4FXCA 4A55A 4ARCA 2KO3A 3PT2B 2D4QA 2MBQA 3SEBA 1VJKA 2DX1A 2G3QB 4HLEA 2LVQA 3ETRA 2LXCA 2WXGA 1JCKB 4OZBA 5CTRC 4DWFA 4HKZE 2LFIA 5DH9B 2K39A 3A9KA 1LGRA 1I4PA 2HJ1A 2W2XD 2FUG1 2MW5A 3CMMB 4KZCA 5BYSA 1TTNA 3AEAB 2LWPA 5HE1A 1XLOA 3HUIA 4HAXB 3TJPA 4A9AA 2BYEA 1EWCA 4MM3B 1H4RA 2CU1A 1KLGD 1TS3A 5JLJB 3FSSA 2E6XA 2FIFA 4GPTB 2I5CA 1A5RA 1QT9A 2BS2B 1N60A 2PJHA 2MLBA 2A5UA 1YMHE 2PVGC 4XDDA 5KHQA 1DDVA 2LGSA 2KNBA 4L1BA 3A9KB 4BAXA 3VOQA 2INDC 4WIPA 2KWUB 3NZSA 1KM7A 4NJ7A 4XWWA 2PMVA 1U4AA 2L7RA 1M7EA 3DBRI 2Q13A 1KFYB 3FVCA 1VDVA 1Q67A 2LI5A 4GXBA 1SIJA 1SEBD 3PVLA 2KIEA 5TR5A 4NAWB 2L0TA 3U8ZA 3GS2A 3IAM1 4HPLB 4HXDA 4KGRA 4XE0A 2JP2A 3SD5A 2N0YA 5FI1A 1P1AA 4RNAA 4KIKB 2V4IB 3O13A 2WXRA 2KVZA 2ZCCA 4DHZB 1X11A 1FCCC 2VKIA 3AE3B 4NJ6A 1F52A 3L16A 3GYOA 4GMVA 5AEKB 3ODWA 2N7DA 2MBOA 1C77A 1V61A 1IBXA 1WXVA 3P42A 4B6HA 2HE7A 2DWQA 2JRIB 1RAXA 2M19A 1WF9A 2WDTB 4GGQA 1ZDXA 1EAZA 2KYWA 4HJKA 3PHWB 4E71A 1NENB 1T3QA 1FHWA 3B2GA 3A98B 5EFXA 1YOVB 3B1LX 4CO7A 1KZ7A 4LNNA 3V5WA 1L0XB 2KX0A 1UWMA 3SO6A 1RYJA 1WE6A 3V62A 3LDZE 4HRSA 4W9FA 1QOFA 1I42A 2D3AA 3TUOA 2BCJA 3RZWC 2H88B 2GBKA 2RVBB 1TY0A 2CY4A 3NWAA 5DI9B 3I63C 3ZJVA 2Z0PA 1VD2A 2FE8A 3DBHI 1XODA 1MIXA 1X05A 2Y5PA 1IBXB 4DDID 1ZM0A 1YN3A 1T0QC 2COAA 1UNRA 3UGBB 3NW8A 2QHOA 4II2B 1WGHA 1IRSA 3RPFC 5C5BA 3Q2AC 2VRRB 1WYWB 4WWPA 1I4QA 2NZ8B 5JHGA 1FEHA 4IKGA 3W5VB 2D9WA 5IP4D 3N7CA 2D3CA 2KJHB 1FRDA 5I2SA 2QKMA 1ZDVA 3RZFA 1V1PA 3LYYA 1YX5B 2DA0A 4L23A 4OSNA 4XGAB 2Z13A 4FULA 5BMHA 1TXDA 2OJRA 1WXQA 2YVCA 1GB1A 3PSEB 3VUYA 3VTUA 2RPVA 3N1YC 2BB5A 1WFYA 1XX0A 4FHKA 4A6HA 2UWQA 2Y8GA 1WG7A 1M7RA 2Z8LA 5CHVC 2M17A 2WXOA 1TIFA 2C7NB 2DKPA 3DXDA 2L00B 4KAXB 3IBEA 4WAFA 1STEA 3RNBC 3RYTA 1F9JA 5C5BB 1B9RA 1V89A 3K9OB 1ZVRA 2JWZA 1E8WA 3QX1A 4Z2NA 1E0ZA 4L6EA 2CS4A 1V1PB 4B9KA 4KDIC 1I4HA 3OAWA 4FJZA 2KFKA 4IUMB 2LUEA 1OEYA 2DYMA 3RNFC 5D6JB 2ZVOA 2MP2B 2JPHA 3OWEB 1LQBA 2K8CA 4QAYA 3D32A 2INCC 2N0SB 2KWDA 4EKUA 4MDKE 1GAQB 3MC9A 2W55A 2YS1A 3FAHA 3ZNHB 1YJ1A 3BZDB 1YN4A 1LXDA 1E7UA 4DHZE 2K6DB 2KXJA 1GC7A 1L6UA 3ZTCA 1ISNA 2WX1A 3OJ4B 1RRBA 1EU4A 2MRPA 4GU2A 3RMKC 3KY9A 1WJMA 1EWYC 1EF5A 5I2MA 2I2YA 2KFKB 1P7EA 1S3SG 1FNUA 3QA8A 2RDHA 4HB2B 5EE0A 5JXVA 1FGYA 4OT1A 2FBWB 1U5EA 2N7JA 3HK0A 3ZO5B 1QF6A 2Z59A 3B2FA 3RCZA 3TBLD 4LNOA 2CU3A 3JYUA 2OHFA 4TMAB 3WIMA 1P9DU 1V1OA 4EZLA 3AI5A 2WX0A 3P6AA 1WM3A 3RNAC 4EZJA 4D0NB 2W2WA 1JW9D 3APCA 3M3JA 2KT7A 2E2XA 4N59A 2LZ6A 1JWAD 2WXLA 1WRIA 2MBEA 3ALBA 4HROA 3W1SC 2PPHA 2ADZA 3B77A 1HQRD 2KQ4X 3DBLB 4OZAA 3VUXA 3KRXA 1SXTA 1K8RB 4RFBA 5JHAA 5LNK1 1KOTA 4M00A 2WDRB 3VTVA 3VH3B 2Z59B 4KSKC 3A4RA 3V6EB 3HM6X 4US8A 4FJVB 3DBLI 4LNIA 1JRUA 3AE6B 1ZC4B 4LJOB 4KKJA 3QWMA 3P7ZA 1PGBA 1WGRA 2WXHA 4GOCA 4TUUA 5M4YB 4K2PA 4ZHPA 3PVUA 2L3ZA 2N7EA 2D10A 3VR8B 2OTXA 1MAIA 4IAPA 3PP2A 3V6CB 4KVGB 4EJNA 1BXTA 3DWGC 3N1XC 4HCNB 4REZA 1GJZA 3VRAB 1G6JA 4A5KA 5IO9A 3PGEA 1WSPA 3P4QB 1V5TA 2BKFA 3ZVVA 1F2RC 1EGXA 4FA6A 1MPHA 1CQVA 2ZJDA 1UBIA 5CX3A 4W9EA 5D3VA 3DVGY 1C3TA 5LXIB 3RI7C 5E6PA 5DHFB 3HIEA 2LYDA 2IGGA 1C78A 2FCQA 4WAAA 3TIXA 3N30A 2UZSA 2AWTA 1WXAA 4NQKE 1FFVA 2KN4A 3ZJUA 4HKQA 3EECA 2GUMA 3WYFB 2M38A 2ACZB 4MSMB 3T9LA 1WWTA 1FO4A 4BKSA 1D5ZC 2WDVB 1TKGA 2LVOA 3QHTA 2L76A 2K00A 5C3JB 3C0RB 5CHFA 4W9JA 3PZ7A 4WWMA 2QILA 1UH6A 4BOZB 1K52A 1KF6B 3T8MA 1IGCA 2KWCA 4BBKA 2KQ7A 2VH1A 4J3OD 4MGYE 3VR9B 5D3XA 2ICIA 5E6OA 1WJ1A 4HSIA 2HD5B 1TKEA 2KMMA 3Q8AA 5AUKA 2ZZPB 1DDMA 3T06A 4NNJB 3I3TB 4NJCA 2RLOA 5H92C 1QC6A 3GYPA 5BYRA 2RPQA 5IA7A 1V86A 2IGHA 2QEJC 2IY1B 2LOZA 1XLPA 3DOWA 1TS5A 1TJEA 1N62A 1XXGA 1E6EB 3NWFA 2MJ3A 5JH5C 3L10B 4A8XC 3WAPA 4LJPB 2DHIA 5HFYA 2ZKMX 5DPSA 1MG8A 2AYOB 3Q8FA 1WGYA 3TW1A 3R2TA 1FGZA 2C7MB 4TV3A 3UF8A 4BBNC 1PGAA 3VDZA 5T8IA 1TBEA 2WXJA 2KCJA 3AECB 2KC2A 2DAJA 5JZEB 3H7PB 1V5OA 4I6PA 4RF1A 3ZIMA 1XCTL 3VXWA 4NQLB 3A4SC 2QIEB 2KQSA 2G1EA 2CODA 3D8EA 1WX9A 1XCGA 4ZRIA 4CSQA 1WMHA 3DDCB 1NDDA 5IRSA 3ABVB 2MBBB 2KWVB 3NZUA 1TY2A 4NAMA 2D9XA 2GS0A 3PSCA 1AW7A 1RFKA 2D5GA 2K25A 4G0NB 1E5WA 1RWSA 3SR6A 5C16A 5HE3A 3Q3OC 2JSVX 1I4GA 2I1JA 3AU4A 4M8NA 4MY6A 1WIAA 1C79A 3AE2B 2RSUA 1KTKA 5LXHA 2MDXA 3AU5A 2KUPA 2L0FA 1FOEA 2M56B 1ZXHA 3A9JA 3QWZB 3NOBA 4AJWA 5FK9C 1QOAA 4DQOC 4R3DA 4YTNB 3C19A 3AEGB 2IFSA 1P7FA 2YSZA 1JWBD 2ROVA 3NVYA 2AL6A 2FIDA 1ZSQA 4A20A 4LLGM 1WMHB 2JZZA 1ZW7A 1YQ3B 3IG3A 1PMSA 1SJED 4G50A 2ZPYA 4WJPA 2WU2B 2J0JA 2NBUA 2FJUB 2R2QA 4HAYB 4S17A 2Z14A 2GBMA 4TQ0A 4XC2A 3MFGA 4WQOB 4WJOA 4BOSC 2D11A 3ZRFA 4BKSD 1YJJA 4A3PA 2I5FA 4GMXB 5KCVA 4HK2A 3HSAA 1HZ5A 2OEDA 1GC6A 2NPTA 4F8CB 1SGHA 3A9JB 2K0PA 1ACCA 2V3NA 3PLUA 1W1HA 1L4DB 2J0MA 2WXMA 2ZNVB 1PQSA 2QDFA 4GOUA 2HJ8A 1NI2A 4BVUC 1HA5A 4RCOA 1NYRA 3O65B 4P1CC 1DOXA 3PZDA 2MSED 4USAA 4ICVA 1B1ZA 1FXAA 3IXSA 3MHSD 3U4EG 4JL9A 1GG3A 1YQ4B 3FC4A 1IUEA 1PDXA 2AL3A 1UEFA 3SU8X 4HEA1 3GE8C 3Q14C 2Y5BB 1U5GA 2J52A 2O2VA 2YT1A 3H6NA 3V61A 1TGZB 4CHJA 2FCSA 4Y94A 3PRZA 3AE1B 2NPTB 4KGTA 4LNFA 4IM2A 2JYTA 3DWMA 2INPE 4E3CA 2CAYA 2KZRA 2DYBA 3MJ5A 3P2BA 4HDOA 5HE0A 3AE4B 3PO0A 3P1MA 1FXTB 4L2YA 2Z0EB 1SB3C 2DZKA 1TQZA 2WGSA 2DZJA 1WXMA 4K3BA 4B95A 1OQQA 1FD6A 3SUZA 3WAOA 4HWIB 2XBBC 2XNAC 2MQJA 4C00A 1GNUA 2OQBA 1WGUA 4W9DA 4NPNA 4KSLC 2FCMA 2BBCA 2YT0A 2LRWA 4HDQA 2KOXA 5J2RA 2XEWA 2L32A 3SHQA 1U5FA 1WGDA 2KDFB 4ZRKA 3PLVA 5D3DA 2BWFA 1XCQL 4XX5A 3RNEC 1Z5SB 4MT7A 2RSGA 4Q2JA 2X8XX 2GCJA 1T0RC 1HTQA 4E74A 2VRWB 2JZPA 5J17A 5EDSA 1YJIA 1RM6C 4LCDE 2K2JA 3LXFA 3MHZA 2R09A 3D8DA 2ZPNA 3LJ3A 1FFUA 2NR2A 1FPYA 1SSNA 4D2KA 4YTMB 3VFKA 3PRMB 2G4SA 3PREA 2R2OA 2O6VD 5FR6A 2P0DA 5IOIA 4HB0B 1FIQA 2V3PA 1OEYJ 4K7WA 1MK9B 1DROA 3NUHB 3VUWA 4LK0M 3ZXVA 4TKNA 3I9V1 1J8CA 3U12A 1KI1B 3TVVA 1MI0A 2LD9A 3AE7B 5GMVA 1WYGA 5IN7A 4DXGA 2DAFA 2J53A 2MCNB 2BWES 2M0XA 1L5PA 1WY8A 3QQ8B 2REXA 2Y7BA 3R2IA 3ZJTA 3Q8CA 4K3CA 3ZW3A 3T3NA 2CKHB 1T0SC 2JT4B 4PS3A 1XKEA 3R3MA 4YWGG 2V4LA 4EUTA 2GOWA 4HAZB 5G55A 4AQ7A 2NBVA 2V9HA 3ULBA 3ZLZA 2PW9A 2NCNA 1OY2A 3KUDB 3AEBB 4D6WA 1R7SA 1XEEA 2ZCBA 3U30A 3AULA 4HB4B 2PE6B 4QJ4B 5G5HA 4ITKA 3GOEA 1SIFA 1E7PB 4HAWB 3N32A 4FADA 4WWNA 4QJ3B 2IO3B 1W1GA 1VR9A 2D9ZA 3TEWA 3IT4B 4QXAB 2XN9C 3V3XA 4KX6B 3GB1A 1XLNA 3ZUNA 1XT9B 4HATB 5BO4B 4UDUC 3DCGA 1V81A 2Q5WD 1NI3A 1WJNA 4HB3B 3KQ4A 1NBFC 2JZ3B 2JVCA 2YEPB 3A1QA 3V60A 5C1ZA 3PG7A 4F7GA 2LKOA 2EC1A 2P0HA 2KX3A 5LLIA 1DGJA 3BVMA 5D2MB 2DLBA 1W1DA 4ASWC 4LDTB 4XYCA 1TT5B 2WXNA 1CMXB 1X1MA 2NMQA 1ZYIA 2QC8A 2I38A 1YD8U 2IO1B 1EU3A 2Y5CA 2KANA 1D3ZA 1X86A 5KHOA 1MJDA 2KMCA 4MSQB 2GBRA 4ARIA 1HXYD 2LGIA 3R66C 3DCXA 4YONA 4OZCA 4MT5A 2D3GA 1TS2A 4PQ0A 3M95A 2BKRB 3RT3B 1L7YA 2UU7A 3A1QB 1WX7A 1TS4A 1TYGB 3ZRCA 1D5MC 2GI9A 3MJWA 3PZ8A 4FJYA 5GXGB 3HW2B 4EOYA 4WSFA 4PNKA 1WX8A 3APFA 3HIZA 2JXXA 3ODXA 1U27A 4JGHB 3ZNZB 1QLBB
chains in the Genus database with same CATH topology
3PEGA 2JF5A 2L1CA 2JUOA 2R0DA 3QJZA 1Y5OA 4Z2MB 1EUVB 3O96A 3KSYA 2K8BA 2D2QA 3W1YA 5CHWA 1Q1OA 2KGXB 3M1IB 3KUCB 3D8FA 1WI0A 2EJ8A 4OVVA 2IO0B 2RR9A 4EMOA 3QK0A 3B08A 1ZC3B 5D27A 2DHZA 4GSWA 4LDTD 3M63B 1DBHA 1XD4A 4IFSA 4F7HA 3W1SA 4F7ZA 3OANA 5HKHA 2LXAA 1I7AA 1WJ6A 2H7DA 2YRYA 4FN2A 1RRPB 2L05A 2KN5A 3UINB 2V1YA 2KJ6A 4AOFA 3GZNI 2KDBA 3PPAA 3VTWA 1V5MA 5L81A 3U7DA 4A6KA 4K1RB 4W9LA 4II3B 3PS6A 3KVFB 1QZEA 1Y8RC 5GOWB 3RUIB 2CY5A 3DVNV 5FI0A 4J6IA 1ZKHA 3TL5A 2K6QA 4AP4C 1J0GA 3Q3JA 1WI1A 5L95C 1Z2MA 1K5DB 3M62B 5KQ1A 4MJSA 3IFWB 4GDLA 1R4MI 3N3KB 3NHEB 5AZHA 2DLWA 3OJ3A 4WJ7A 3F0WA 2KTRA 5DPRA 1FB8A 4P7IA 4IOYX 3DVGX 5JHHA 5D3YA 2A4ZA 1YX6B 5DCNA 2J7QB 2G4DB 4K81A 3PRPB 3JW0X 4MJSB 4GDLB 2W2XC 4OVUA 2LGDA 3L08A 4ZYNA 5D94A 4HVBA 2NS5A 1BAKA 3SV1A 2IBIB 1C1YB 4IM3A 1WJ4A 3MTNB 4K7SA 4FBJB 4DBGA 1AQCA 2DFKA 3TMPB 4B6WA 3CSTA 2YLMA 2YS3A 1UNQA 5DPTA 3ECIA 4K2OA 1MKEA 4AUQC 3R7RA 2Z0DB 3ML9A 5DPWA 3AXCA 4MELA 1HE8A 2ROZB 3A8QA 1KJTA 1XQQA 2UVMA 2KC1A 3KYCD 3ZKJC 3QCAA 1PLSA 2IZVB 4WJNA 5LOPB 5E6NA 3CF6E 2DHKA 4FHJA 3AJ4A 1P5TA 3KW5B 2CR5A 2FNJB 1UGMA 1LM8B 4IW0A 4DK5A 1N3HA 4A3OA 5G2NA 4TYZA 2D9VA 1R4NI 2Z0OA 2J0KA 4MGKE 4MEMA 2BYFA 3WALA 1DDWA 3VQIA 2WWZA 2X18A 2KHWB 1XR0B 2O6VA 2MBHA 2MWNB 4ANUA 4DHJD 2LGXA 2KK8A 4ANWA 3UQBA 3ENEA 1FAOA 3PHXB 1OQNA 4DBBA 2ELAA 2IYBA 4I6LB 3QARA 1UZXB 3ULCA 3JVZX 4JLCA 4GZUA 2LASA 2O6VB 2BGFA 2PZ1A 2HTHA 2CHXA 1E8YA 2I1KA 2CRFA 4HHVA 1TZ1A 4ZRJA 1WZ3A 3DPDA 4MH0E 1IPGA 3B0AA 2P0FA 4GIVA 2JRHA 1Y19B 1WM2A 2FJLA 1V88A 3QC8B 2KJRA 4ANXA 2LULA 2L8JA 2C5LC 3DXEA 1TJ6A 1H8CA 2NVUI 3NY5A 3ZNGC 4CHMA 1UBQA 2N9EB 4NAWA 2HTHB 1KLVA 2N9XA 2O2VB 4I6NB 5AZFA 2FUHB 4CHKA 3EHVA 4KHAA 2GCLA 3H7SA 1E7VA 2XQNM 4RMAA 1MIZB 4W9CA 3KH0A 4KIKA 1I35A 5CLQB 1V49A 1WZ0A 1V5UA 3H9DA 3HM3A 2Y8FA 3KYDD 3L0WB 5D7GA 3EFUA 4DXAB 4CYEA 2RD0A 3CXBB 2CHZA 2DHJA 1M94A 1OGWA 1K5GB 2G35A 2NBWB 1AWEA 4KHOA 1OTRB 5J3QA 3S2AA 4C0AA 3A33B 4WVFB 1NTYA 4NY0A 1SE9A 3BY4B 2UZRA 4PYZA 3ZNID 4NSWA 1Q0WB 1V2YA 1EF1A 4PS7A 2ZVNA 1ZGUB 1VCBA 3QBVB 1WGQA 4F1SA 4JQWC 4YL8A 2WYQA 3NSUA 1WR6E 5J3TA 2LVPA 1RFAA 1U29A 2LRUA 1V5PA 2DZMA 4BKGA 1S1QB 4F7UP 2KMAA 3KRWA 3ML4A 5C6RA 3UQAA 1XD3B 1NTVA 1H10A 3BJIA 2Z0QA 2BYVE 1LB1A 3WA0A 1V80A 2K1FA 1BTKA 3PV1A 1V6EA 4MGIE 5DHAB 3A8PA 2K2UA 1SHCA 3DXCA 3UIOB 2EMSA 2GBJA 3X0WA 4ZDVA 5IAAC 2OOBB 3RD2A 2ASQA 3R7QA 2KDEB 1BT0A 2COFA 1WXSA 1X1FA 2NBVB 2KLCA 4XZ4A 2MWSB 1AARA 1WRDB 2CHWA 3VH4B 3ML8A 3DBSA 2MP2A 3QIJA 2DYOA 2G45B 1V9JA 1LW3A 4DX8A 3PVWA 1YIWA 4BKTA 1P98A 4H8SA 3DVNU 4N9F4 1Q5WB 2DKQA 2BF8B 4W9KA 4ANVA 1UD7A 4EFOA 1QQGA 2P8VA 2JY6A 2ZEQA 4GB9A 3VIAA 1P3QU 2N4FA 2PEAA 2N23A 4G11A 4GDKA 1WR1A 4IG7B 2C7HA 3IVFA 2M4NA 4RM9A 1E8ZA 5C23A 2B3AA 3H1UA 1IP9A 2NMBA 3ONSA 1UELA 3FM8C 2IYDB 3WANA 2DN6A 5JP4A 1BTNA 3LJUX 2KKCA 2AEHA 2KLGA 4HAUB 3X23A 3DQVA 5JHBA 4GDKB 1OQYA 3APDA 3L54A 5J3YA 3OLMD 1U2BA 4IC7B 4MGZE 4IWPA 4IWOA 4MK0A 4G3XB 3MPXA 4RM8A 2LG1A 2D9YA 3HHMA 3VVWB 2V76A 1WVHA 5CLLB 1FHOA 3ZVRA 4HPMB 1UNPA 1LFDA 2XK5A 3VHTC 4K17A 1X1GA 4BFRA 4XWXA 3TCAA 4A6FA 4KHBB 3RCPA 1T0YA 1RLFA 1J0WA 4GN1A 2PE9A 1P6SA 3TO1A 4KZ0A 3L13A 2YF0A 2EKEC 4BBNF 2EMTA 2N1VA 1YQBA 2XK5B 2DX5A 1E8XA 4A6FB 4WWOA 1UPQA 3ZDTA 1DYNA 5L83A 3SNHA 2YS5A 2M8SA 2MA9B 2IO2B 5J18A 4W9GA 2N1WA 3EC8A 3G9WA 2KFJA 1WH3A 5HE2A 3SYXA 2QKLA 2D07B 4EEWA 1IYFA 2IY0B 1U5DA 2FAZA 5LONB 1NU2A 1PFJA 2DZIA 3PTFC 2FCNA 2DX5B 1Z87A 2V3SA 3ZTDA 2LOXA 3JSVA 4URKA 3UZTA 1P3RA 1UPRA 4KDLB 4DX90 3VAWA 4HAVB 1KZGA 4AWJA 4EZKA 4DHJB 1B55A 2GMIC 3H7PA 2KTRB 4TQ1A 3F5RA 4IM0A 2KDIA 2LGYA 2C9WB 4M0WB 4JIOU 5KQ4A 2W9NA 2RGNB 3UIPB 2VSZA 1E90A 5C79A 2MKRA 3JSVB 3QAQA 2KD0A 1WJUA 3SDLC 4WJQA 4W9HA 2LJ5A 2C60A 3HQCA 2M1MA 4PYUA 4W9IA 2UYZB 3K9PB 3Q3FA 1L2NA 4DDGD 2MX2A 2K8HA 2COCA 3CIKA 3KZ1A 1OMWA 2RUKB 2ELBA 2DYQA 3RULA 3TFMA 3NS8A 4M8MA 3KUZA 1J19A 1I2HA 2N9PC 1EVHA 2RGFA 2ZNVC 1EO6A 4HCPB 1P0RA 1MK7B 4ICUA 3BINA 2GBNA 2DTCA 4FLHA 2RNRB 2DENB 1RJ2A 3IHPC 3FEHA 5DIFB 2M14A 2DYNA 1BWNA 3CSFA 1WGGA 2KVRA 4IWQA 4K7UA 5AZGA 1GUAB 3L17A 2J59M 4X57B 2H7EA 2MFQA 3ZDMC 2BPSA 4KV2A 3MDBC 4PS8A 1FHXA 1WE7A 4AJYB 2L2IA 2GJYA 3ODOA 3WAMA 5D3WA 2KTFA 4MM3A 2KO3A 3PT2B 2D4QA 2MBQA 2DX1A 2G3QB 4HLEA 2LVQA 2LXCA 5CTRC 4DWFA 5DH9B 2K39A 3A9KA 2W2XD 2MW5A 3CMMB 4KZCA 1TTNA 2LWPA 5HE1A 3TJPA 4HAXB 2BYEA 1H4RA 2CU1A 5JLJB 3FSSA 2FIFA 4GPTB 2I5CA 1A5RA 2PJHA 2MLBA 2A5UA 5KHQA 1DDVA 2KNBA 3A9KB 3VOQA 2KWUB 3NZSA 1KM7A 4NJ7A 1U4AA 2L7RA 1M7EA 3DBRI 2Q13A 1Q67A 2LI5A 4GXBA 3PVLA 5TR5A 4NAWB 2L0TA 3U8ZA 4HPLB 4HXDA 2JP2A 3SD5A 2N0YA 5FI1A 1P1AA 4KIKB 2ZCCA 4DHZB 1X11A 2VKIA 4NJ6A 3L16A 3GYOA 4GMVA 5AEKB 3ODWA 2N7DA 2MBOA 1V61A 1WXVA 4B6HA 2HE7A 2JRIB 1RAXA 1WF9A 2WDTB 4GGQA 1EAZA 4HJKA 3PHWB 4E71A 1FHWA 3A98B 5EFXA 3B1LX 4CO7A 1KZ7A 3V5WA 2KX0A 3SO6A 1WE6A 3V62A 3LDZE 4W9FA 1I42A 2BCJA 3RZWC 2GBKA 2RVBB 2CY4A 5DI9B 2Z0PA 1VD2A 3DBHI 1XODA 1MIXA 1X05A 4DDID 1ZM0A 2COAA 1UNRA 3UGBB 2QHOA 4II2B 1WGHA 1IRSA 5C5BA 2VRRB 1WYWB 4WWPA 2NZ8B 5JHGA 2D9WA 3N7CA 2KJHB 2QKMA 3RZFA 1YX5B 2DA0A 4FULA 1TXDA 2OJRA 2YVCA 3PSEB 3VUYA 3VTUA 1WFYA 1XX0A 4FHKA 4A6HA 2UWQA 2Y8GA 1WG7A 1M7RA 5CHVC 2M17A 2C7NB 2DKPA 3DXDA 2L00B 4KAXB 3IBEA 3RYTA 1F9JA 5C5BB 1V89A 3K9OB 1ZVRA 2JWZA 1E8WA 3QX1A 4Z2NA 4L6EA 2CS4A 4B9KA 4KDIC 3OAWA 4FJZA 2KFKA 4IUMB 2LUEA 1OEYA 2DYMA 5D6JB 2ZVOA 2MP2B 2JPHA 1LQBA 2K8CA 3D32A 4EKUA 4MDKE 2YS1A 3ZNHB 1YJ1A 1LXDA 1E7UA 4DHZE 2K6DB 2KXJA 1GC7A 3ZTCA 1ISNA 2WX1A 3OJ4B 1RRBA 2MRPA 4GU2A 3KY9A 1WJMA 1EF5A 2KFKB 1S3SG 3QA8A 4HB2B 1FGYA 1U5EA 3HK0A 3ZO5B 3RCZA 3TBLD 3JYUA 3WIMA 1P9DU 4EZLA 3AI5A 2WX0A 3P6AA 1WM3A 4EZJA 4D0NB 2W2WA 3APCA 3M3JA 2E2XA 2LZ6A 2MBEA 3ALBA 3W1SC 2PPHA 2ADZA 3VUXA 3KRXA 1K8RB 5JHAA 1KOTA 3VTVA 3VH3B 2Z59B 4KSKC 3A4RA 3V6EB 3HM6X 4FJVB 3DBLI 1JRUA 1ZC4B 4LJOB 3QWMA 3P7ZA 1WGRA 4GOCA 4TUUA 4K2PA 3PVUA 2L3ZA 2N7EA 2D10A 2OTXA 1MAIA 4IAPA 3PP2A 3V6CB 4KVGB 4EJNA 4HCNB 1GJZA 1G6JA 4A5KA 3PGEA 1V5TA 2BKFA 3ZVVA 1EGXA 4FA6A 1MPHA 2ZJDA 1UBIA 5CX3A 4W9EA 5D3VA 3DVGY 1C3TA 5LXIB 5E6PA 5DHFB 2LYDA 2FCQA 4WAAA 3TIXA 3N30A 2UZSA 2AWTA 1WXAA 4NQKE 3EECA 3WYFB 2M38A 4MSMB 3T9LA 4BKSA 3QHTA 2LVOA 2L76A 2K00A 3C0RB 5CHFA 4W9JA 1UH6A 4BOZB 3T8MA 2KWCA 4BBKA 2KQ7A 4MGYE 5D3XA 5E6OA 1WJ1A 2HD5B 2ZZPB 1DDMA 3T06A 4NNJB 3I3TB 2RLOA 1QC6A 3GYPA 2RPQA 5IA7A 1V86A 2IY1B 2LOZA 3DOWA 5JH5C 3L10B 3WAPA 4LJPB 2DHIA 5DPSA 1MG8A 2AYOB 1WGYA 3TW1A 1FGZA 2C7MB 4TV3A 3UF8A 4BBNC 3VDZA 1TBEA 2KCJA 2KC2A 2DAJA 5JZEB 3H7PB 1V5OA 4I6PA 3ZIMA 3VXWA 4NQLB 3A4SC 2KQSA 2CODA 3D8EA 1WX9A 1XCGA 4ZRIA 1WMHA 3DDCB 1NDDA 2MBBB 2KWVB 3NZUA 2D9XA 2GS0A 3PSCA 2K25A 4G0NB 1E5WA 5C16A 5HE3A 2I1JA 3AU4A 4M8NA 4MY6A 1WIAA 2RSUA 5LXHA 2MDXA 3AU5A 2KUPA 2L0FA 1FOEA 3A9JA 3QWZB 4AJWA 3NOBA 2IFSA 2YSZA 2ROVA 2AL6A 2FIDA 1ZSQA 4A20A 1WMHB 2JZZA 1ZW7A 3IG3A 1PMSA 4G50A 2ZPYA 4WJPA 2J0JA 2NBUA 2R2QA 4HAYB 2GBMA 4TQ0A 4XC2A 4WQOB 4WJOA 4BOSC 2D11A 3ZRFA 4BKSD 4A3PA 2I5FA 4GMXB 5KCVA 4HK2A 1GC6A 2NPTA 4F8CB 1SGHA 3A9JB 3PLUA 1W1HA 2J0MA 2ZNVB 1PQSA 2HJ8A 1NI2A 4BVUC 3O65B 3PZDA 2MSED 4ICVA 3MHSD 4JL9A 1GG3A 2AL3A 1UEFA 3SU8X 2Y5BB 1U5GA 2O2VA 2YT1A 3H6NA 3V61A 1TGZB 4CHJA 2FCSA 4Y94A 3PRZA 2NPTB 4IM2A 4E3CA 2CAYA 2KZRA 2DYBA 3P2BA 4HDOA 5HE0A 1FXTB 2Z0EB 2DZKA 1TQZA 2DZJA 1WXMA 4B95A 3SUZA 3WAOA 4HWIB 2XBBC 2MQJA 1GNUA 2OQBA 1WGUA 4W9DA 4NPNA 4KSLC 2FCMA 2YT0A 2LRWA 4HDQA 2KOXA 5J2RA 2XEWA 3SHQA 1U5FA 1WGDA 2KDFB 4ZRKA 3PLVA 2BWFA 4XX5A 1Z5SB 4MT7A 2RSGA 2GCJA 4E74A 2VRWB 5J17A 5EDSA 4LCDE 2K2JA 2R09A 3D8DA 2ZPNA 3LJ3A 2NR2A 3VFKA 3PRMB 2G4SA 3PREA 2R2OA 2O6VD 5FR6A 2P0DA 4HB0B 1OEYJ 4K7WA 1MK9B 1DROA 3VUWA 4TKNA 1J8CA 1KI1B 3TVVA 2LD9A 5GMVA 2DAFA 2MCNB 2BWES 2M0XA 1WY8A 3QQ8B 2REXA 2Y7BA 3ZW3A 2CKHB 2JT4B 4PS3A 1XKEA 3R3MA 2V4LA 4EUTA 2GOWA 4HAZB 5G55A 3ULBA 3ZLZA 2NCNA 1OY2A 3KUDB 2ZCBA 3U30A 3AULA 4HB4B 2PE6B 3GOEA 1SIFA 4HAWB 3N32A 4FADA 4WWNA 2IO3B 1W1GA 2D9ZA 3ZUNA 1XT9B 4HATB 5BO4B 3DCGA 1V81A 1WJNA 4HB3B 1NBFC 2JZ3B 2JVCA 3A1QA 3V60A 5C1ZA 3PG7A 4F7GA 2LKOA 2EC1A 2P0HA 2KX3A 5LLIA 5D2MB 1W1DA 4ASWC 4LDTB 1CMXB 1X1MA 1YD8U 2IO1B 2KANA 1D3ZA 1X86A 5KHOA 2KMCA 4MSQB 2GBRA 3R66C 4YONA 2D3GA 3M95A 4PQ0A 2BKRB 3RT3B 1L7YA 3A1QB 1WX7A 3ZRCA 3MJWA 4FJYA 3HW2B 4EOYA 4WSFA 4PNKA 1WX8A 3APFA 3HIZA 2JXXA 3ODXA 1U27A 4JGHB 3ZNZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEG A;  2JF5 A;  2L1C A;  2JUO A;  2R0D A;  3QJZ A;  1Y5O A;  4Z2M B;  1EUV B;  3O96 A;  3KSY A;  2K8B A;  2D2Q A;  3W1Y A;  5CHW A;  1Q1O A;  2KGX B;  3M1I B;  3KUC B;  3D8F A;  1WI0 A;  2EJ8 A;  4OVV A;  2IO0 B;  2RR9 A;  4EMO A;  3QK0 A;  3B08 A;  1ZC3 B;  5D27 A;  2DHZ A;  4GSW A;  4LDT D;  3M63 B;  1DBH A;  1XD4 A;  4IFS A;  4F7H A;  3W1S A;  4F7Z A;  3OAN A;  5HKH A;  2LXA A;  1I7A A;  1WJ6 A;  2H7D A;  2YRY A;  4FN2 A;  1RRP B;  2L05 A;  2KN5 A;  3UIN B;  2V1Y A;  2KJ6 A;  4AOF A;  3GZN I;  2KDB A;  3PPA A;  3VTW A;  1V5M A;  5L81 A;  3U7D A;  4A6K A;  4K1R B;  4W9L A;  4II3 B;  3PS6 A;  3KVF B;  1QZE A;  1Y8R C;  5GOW B;  3RUI B;  2CY5 A;  3DVN V;  5FI0 A;  4J6I A;  1ZKH A;  3TL5 A;  2K6Q A;  4AP4 C;  1J0G A;  3Q3J A;  1WI1 A;  5L95 C;  1Z2M A;  1K5D B;  3M62 B;  5KQ1 A;  4MJS A;  3IFW B;  4GDL A;  1R4M I;  3N3K B;  3NHE B;  5AZH A;  2DLW A;  3OJ3 A;  4WJ7 A;  3F0W A;  2KTR A;  5DPR A;  1FB8 A;  4P7I A;  4IOY X;  3DVG X;  5JHH A;  5D3Y A;  2A4Z A;  1YX6 B;  5DCN A;  2J7Q B;  2G4D B;  4K81 A;  3PRP B;  3JW0 X;  4MJS B;  4GDL B;  2W2X C;  4OVU A;  2LGD A;  3L08 A;  4ZYN A;  5D94 A;  4HVB A;  2NS5 A;  1BAK A;  3SV1 A;  2IBI B;  1C1Y B;  4IM3 A;  1WJ4 A;  3MTN B;  4K7S A;  4FBJ B;  4DBG A;  1AQC A;  2DFK A;  3TMP B;  4B6W A;  3CST A;  2YLM A;  2YS3 A;  1UNQ A;  5DPT A;  3ECI A;  4K2O A;  1MKE A;  4AUQ C;  3R7R A;  2Z0D B;  3ML9 A;  5DPW A;  3AXC A;  4MEL A;  1HE8 A;  2ROZ B;  3A8Q A;  1KJT A;  1XQQ A;  2UVM A;  2KC1 A;  3KYC D;  3ZKJ C;  3QCA A;  1PLS A;  2IZV B;  4WJN A;  5LOP B;  5E6N A;  3CF6 E;  2DHK A;  4FHJ A;  3AJ4 A;  1P5T A;  3KW5 B;  2CR5 A;  2FNJ B;  1UGM A;  1LM8 B;  4IW0 A;  4DK5 A;  1N3H A;  4A3O A;  5G2N A;  4TYZ A;  2D9V A;  1R4N I;  2Z0O A;  2J0K A;  4MGK E;  4MEM A;  2BYF A;  3WAL A;  1DDW A;  3VQI A;  2WWZ A;  2X18 A;  2KHW B;  1XR0 B;  2O6V A;  2MBH A;  2MWN B;  4ANU A;  4DHJ D;  2LGX A;  2KK8 A;  4ANW A;  3UQB A;  3ENE A;  1FAO A;  3PHX B;  1OQN A;  4DBB A;  2ELA A;  2IYB A;  4I6L B;  3QAR A;  1UZX B;  3ULC A;  3JVZ X;  4JLC A;  4GZU A;  2LAS A;  2O6V B;  2BGF A;  2PZ1 A;  2HTH A;  2CHX A;  1E8Y A;  2I1K A;  2CRF A;  4HHV A;  1TZ1 A;  4ZRJ A;  1WZ3 A;  3DPD A;  4MH0 E;  1IPG A;  3B0A A;  2P0F A;  4GIV A;  2JRH A;  1Y19 B;  1WM2 A;  2FJL A;  1V88 A;  3QC8 B;  2KJR A;  4ANX A;  2LUL A;  2L8J A;  2C5L C;  3DXE A;  1TJ6 A;  1H8C A;  2NVU I;  3NY5 A;  3ZNG C;  4CHM A;  1UBQ A;  2N9E B;  4NAW A;  2HTH B;  1KLV A;  2N9X A;  2O2V B;  4I6N B;  5AZF A;  2FUH B;  4CHK A;  3EHV A;  4KHA A;  2GCL A;  3H7S A;  1E7V A;  2XQN M;  4RMA A;  1MIZ B;  4W9C A;  3KH0 A;  4KIK A;  1I35 A;  5CLQ B;  1V49 A;  1WZ0 A;  1V5U A;  3H9D A;  3HM3 A;  2Y8F A;  3KYD D;  3L0W B;  5D7G A;  3EFU A;  4DXA B;  4CYE A;  2RD0 A;  3CXB B;  2CHZ A;  2DHJ A;  1M94 A;  1OGW A;  1K5G B;  2G35 A;  2NBW B;  1AWE A;  4KHO A;  1OTR B;  5J3Q A;  3S2A A;  4C0A A;  3A33 B;  4WVF B;  1NTY A;  4NY0 A;  1SE9 A;  3BY4 B;  2UZR A;  4PYZ A;  3ZNI D;  4NSW A;  1Q0W B;  1V2Y A;  1EF1 A;  4PS7 A;  2ZVN A;  1ZGU B;  1VCB A;  3QBV B;  1WGQ A;  4F1S A;  4JQW C;  4YL8 A;  2WYQ A;  3NSU A;  1WR6 E;  5J3T A;  2LVP A;  1RFA A;  1U29 A;  2LRU A;  1V5P A;  2DZM A;  4BKG A;  1S1Q B;  4F7U P;  2KMA A;  3KRW A;  3ML4 A;  5C6R A;  3UQA A;  1XD3 B;  1NTV A;  1H10 A;  3BJI A;  2Z0Q A;  2BYV E;  1LB1 A;  3WA0 A;  1V80 A;  2K1F A;  1BTK A;  3PV1 A;  1V6E A;  4MGI E;  5DHA B;  3A8P A;  2K2U A;  1SHC A;  3DXC A;  3UIO B;  2EMS A;  2GBJ A;  3X0W A;  4ZDV A;  5IAA C;  2OOB B;  3RD2 A;  2ASQ A;  3R7Q A;  2KDE B;  1BT0 A;  2COF A;  1WXS A;  1X1F A;  2NBV B;  2KLC A;  4XZ4 A;  2MWS B;  1AAR A;  1WRD B;  2CHW A;  3VH4 B;  3ML8 A;  3DBS A;  2MP2 A;  3QIJ A;  2DYO A;  2G45 B;  1V9J A;  1LW3 A;  4DX8 A;  3PVW A;  1YIW A;  4BKT A;  1P98 A;  4H8S A;  3DVN U;  4N9F 4;  1Q5W B;  2DKQ A;  2BF8 B;  4W9K A;  4ANV A;  1UD7 A;  4EFO A;  1QQG A;  2P8V A;  2JY6 A;  2ZEQ A;  4GB9 A;  3VIA A;  1P3Q U;  2N4F A;  2PEA A;  2N23 A;  4G11 A;  4GDK A;  1WR1 A;  4IG7 B;  2C7H A;  3IVF A;  2M4N A;  4RM9 A;  1E8Z A;  5C23 A;  2B3A A;  3H1U A;  1IP9 A;  2NMB A;  3ONS A;  1UEL A;  3FM8 C;  2IYD B;  3WAN A;  2DN6 A;  5JP4 A;  1BTN A;  3LJU X;  2KKC A;  2AEH A;  2KLG A;  4HAU B;  3X23 A;  3DQV A;  5JHB A;  4GDK B;  1OQY A;  3APD A;  3L54 A;  5J3Y A;  3OLM D;  1U2B A;  4IC7 B;  4MGZ E;  4IWP A;  4IWO A;  4MK0 A;  4G3X B;  3MPX A;  4RM8 A;  2LG1 A;  2D9Y A;  3HHM A;  3VVW B;  2V76 A;  1WVH A;  5CLL B;  1FHO A;  3ZVR A;  4HPM B;  1UNP A;  1LFD A;  2XK5 A;  3VHT C;  4K17 A;  1X1G A;  4BFR A;  4XWX A;  3TCA A;  4A6F A;  4KHB B;  3RCP A;  1T0Y A;  1RLF A;  1J0W A;  4GN1 A;  2PE9 A;  1P6S A;  3TO1 A;  4KZ0 A;  3L13 A;  2YF0 A;  2EKE C;  4BBN F;  2EMT A;  2N1V A;  1YQB A;  2XK5 B;  2DX5 A;  1E8X A;  4A6F B;  4WWO A;  1UPQ A;  3ZDT A;  1DYN A;  5L83 A;  3SNH A;  2YS5 A;  2M8S A;  2MA9 B;  2IO2 B;  5J18 A;  4W9G A;  2N1W A;  3EC8 A;  3G9W A;  2KFJ A;  1WH3 A;  5HE2 A;  3SYX A;  2QKL A;  2D07 B;  4EEW A;  1IYF A;  2IY0 B;  1U5D A;  2FAZ A;  5LON B;  1NU2 A;  1PFJ A;  2DZI A;  3PTF C;  2FCN A;  2DX5 B;  1Z87 A;  2V3S A;  3ZTD A;  2LOX A;  3JSV A;  4URK A;  3UZT A;  1P3R A;  1UPR A;  4KDL B;  4DX9 0;  3VAW A;  4HAV B;  1KZG A;  4AWJ A;  4EZK A;  4DHJ B;  1B55 A;  2GMI C;  3H7P A;  2KTR B;  4TQ1 A;  3F5R A;  4IM0 A;  2KDI A;  2LGY A;  2C9W B;  4M0W B;  4JIO U;  5KQ4 A;  2W9N A;  2RGN B;  3UIP B;  2VSZ A;  1E90 A;  5C79 A;  2MKR A;  3JSV B;  3QAQ A;  2KD0 A;  1WJU A;  3SDL C;  4WJQ A;  4W9H A;  2LJ5 A;  2C60 A;  3HQC A;  2M1M A;  4PYU A;  4W9I A;  2UYZ B;  3K9P B;  3Q3F A;  1L2N A;  4DDG D;  2MX2 A;  2K8H A;  2COC A;  3CIK A;  3KZ1 A;  1OMW A;  2RUK B;  2ELB A;  2DYQ A;  3RUL A;  3TFM A;  3NS8 A;  4M8M A;  3KUZ A;  1J19 A;  1I2H A;  2N9P C;  1EVH A;  2RGF A;  2ZNV C;  1EO6 A;  4HCP B;  1P0R A;  1MK7 B;  4ICU A;  3BIN A;  2GBN A;  2DTC A;  4FLH A;  2RNR B;  2DEN B;  1RJ2 A;  3IHP C;  3FEH A;  5DIF B;  2M14 A;  2DYN A;  1BWN A;  3CSF A;  1WGG A;  2KVR A;  4IWQ A;  4K7U A;  5AZG A;  1GUA B;  3L17 A;  2J59 M;  4X57 B;  2H7E A;  2MFQ A;  3ZDM C;  2BPS A;  4KV2 A;  3MDB C;  4PS8 A;  1FHX A;  1WE7 A;  4AJY B;  2L2I A;  2GJY A;  3ODO A;  3WAM A;  5D3W A;  2KTF A;  4MM3 A;  2KO3 A;  3PT2 B;  2D4Q A;  2MBQ A;  2DX1 A;  2G3Q B;  4HLE A;  2LVQ A;  2LXC A;  5CTR C;  4DWF A;  5DH9 B;  2K39 A;  3A9K A;  2W2X D;  2MW5 A;  3CMM B;  4KZC A;  1TTN A;  2LWP A;  5HE1 A;  3TJP A;  4HAX B;  2BYE A;  1H4R A;  2CU1 A;  5JLJ B;  3FSS A;  2FIF A;  4GPT B;  2I5C A;  1A5R A;  2PJH A;  2MLB A;  2A5U A;  5KHQ A;  1DDV A;  2KNB A;  3A9K B;  3VOQ A;  2KWU B;  3NZS A;  1KM7 A;  4NJ7 A;  1U4A A;  2L7R A;  1M7E A;  3DBR I;  2Q13 A;  1Q67 A;  2LI5 A;  4GXB A;  3PVL A;  5TR5 A;  4NAW B;  2L0T A;  3U8Z A;  4HPL B;  4HXD A;  2JP2 A;  3SD5 A;  2N0Y A;  5FI1 A;  1P1A A;  4KIK B;  2ZCC A;  4DHZ B;  1X11 A;  2VKI A;  4NJ6 A;  3L16 A;  3GYO A;  4GMV A;  5AEK B;  3ODW A;  2N7D A;  2MBO A;  1V61 A;  1WXV A;  4B6H A;  2HE7 A;  2JRI B;  1RAX A;  1WF9 A;  2WDT B;  4GGQ A;  1EAZ A;  4HJK A;  3PHW B;  4E71 A;  1FHW A;  3A98 B;  5EFX A;  3B1L X;  4CO7 A;  1KZ7 A;  3V5W A;  2KX0 A;  3SO6 A;  1WE6 A;  3V62 A;  3LDZ E;  4W9F A;  1I42 A;  2BCJ A;  3RZW C;  2GBK A;  2RVB B;  2CY4 A;  5DI9 B;  2Z0P A;  1VD2 A;  3DBH I;  1XOD A;  1MIX A;  1X05 A;  4DDI D;  1ZM0 A;  2COA A;  1UNR A;  3UGB B;  2QHO A;  4II2 B;  1WGH A;  1IRS A;  5C5B A;  2VRR B;  1WYW B;  4WWP A;  2NZ8 B;  5JHG A;  2D9W A;  3N7C A;  2KJH B;  2QKM A;  3RZF A;  1YX5 B;  2DA0 A;  4FUL A;  1TXD A;  2OJR A;  2YVC A;  3PSE B;  3VUY A;  3VTU A;  1WFY A;  1XX0 A;  4FHK A;  4A6H A;  2UWQ A;  2Y8G A;  1WG7 A;  1M7R A;  5CHV C;  2M17 A;  2C7N B;  2DKP A;  3DXD A;  2L00 B;  4KAX B;  3IBE A;  3RYT A;  1F9J A;  5C5B B;  1V89 A;  3K9O B;  1ZVR A;  2JWZ A;  1E8W A;  3QX1 A;  4Z2N A;  4L6E A;  2CS4 A;  4B9K A;  4KDI C;  3OAW A;  4FJZ A;  2KFK A;  4IUM B;  2LUE A;  1OEY A;  2DYM A;  5D6J B;  2ZVO A;  2MP2 B;  2JPH A;  1LQB A;  2K8C A;  3D32 A;  4EKU A;  4MDK E;  2YS1 A;  3ZNH B;  1YJ1 A;  1LXD A;  1E7U A;  4DHZ E;  2K6D B;  2KXJ A;  1GC7 A;  3ZTC A;  1ISN A;  2WX1 A;  3OJ4 B;  1RRB A;  2MRP A;  4GU2 A;  3KY9 A;  1WJM A;  1EF5 A;  2KFK B;  1S3S G;  3QA8 A;  4HB2 B;  1FGY A;  1U5E A;  3HK0 A;  3ZO5 B;  3RCZ A;  3TBL D;  3JYU A;  3WIM A;  1P9D U;  4EZL A;  3AI5 A;  2WX0 A;  3P6A A;  1WM3 A;  4EZJ A;  4D0N B;  2W2W A;  3APC A;  3M3J A;  2E2X A;  2LZ6 A;  2MBE A;  3ALB A;  3W1S C;  2PPH A;  2ADZ A;  3VUX A;  3KRX A;  1K8R B;  5JHA A;  1KOT A;  3VTV A;  3VH3 B;  2Z59 B;  4KSK C;  3A4R A;  3V6E B;  3HM6 X;  4FJV B;  3DBL I;  1JRU A;  1ZC4 B;  4LJO B;  3QWM A;  3P7Z A;  1WGR A;  4GOC A;  4TUU A;  4K2P A;  3PVU A;  2L3Z A;  2N7E A;  2D10 A;  2OTX A;  1MAI A;  4IAP A;  3PP2 A;  3V6C B;  4KVG B;  4EJN A;  4HCN B;  1GJZ A;  1G6J A;  4A5K A;  3PGE A;  1V5T A;  2BKF A;  3ZVV A;  1EGX A;  4FA6 A;  1MPH A;  2ZJD A;  1UBI A;  5CX3 A;  4W9E A;  5D3V A;  3DVG Y;  1C3T A;  5LXI B;  5E6P A;  5DHF B;  2LYD A;  2FCQ A;  4WAA A;  3TIX A;  3N30 A;  2UZS A;  2AWT A;  1WXA A;  4NQK E;  3EEC A;  3WYF B;  2M38 A;  4MSM B;  3T9L A;  4BKS A;  3QHT A;  2LVO A;  2L76 A;  2K00 A;  3C0R B;  5CHF A;  4W9J A;  1UH6 A;  4BOZ B;  3T8M A;  2KWC A;  4BBK A;  2KQ7 A;  4MGY E;  5D3X A;  5E6O A;  1WJ1 A;  2HD5 B;  2ZZP B;  1DDM A;  3T06 A;  4NNJ B;  3I3T B;  2RLO A;  1QC6 A;  3GYP A;  2RPQ A;  5IA7 A;  1V86 A;  2IY1 B;  2LOZ A;  3DOW A;  5JH5 C;  3L10 B;  3WAP A;  4LJP B;  2DHI A;  5DPS A;  1MG8 A;  2AYO B;  1WGY A;  3TW1 A;  1FGZ A;  2C7M B;  4TV3 A;  3UF8 A;  4BBN C;  3VDZ A;  1TBE A;  2KCJ A;  2KC2 A;  2DAJ A;  5JZE B;  3H7P B;  1V5O A;  4I6P A;  3ZIM A;  3VXW A;  4NQL B;  3A4S C;  2KQS A;  2COD A;  3D8E A;  1WX9 A;  1XCG A;  4ZRI A;  1WMH A;  3DDC B;  1NDD A;  2MBB B;  2KWV B;  3NZU A;  2D9X A;  2GS0 A;  3PSC A;  2K25 A;  4G0N B;  1E5W A;  5C16 A;  5HE3 A;  2I1J A;  3AU4 A;  4M8N A;  4MY6 A;  1WIA A;  2RSU A;  5LXH A;  2MDX A;  3AU5 A;  2KUP A;  2L0F A;  1FOE A;  3A9J A;  3QWZ B;  4AJW A;  3NOB A;  2IFS A;  2YSZ A;  2ROV A;  2AL6 A;  2FID A;  1ZSQ A;  4A20 A;  1WMH B;  2JZZ A;  1ZW7 A;  3IG3 A;  1PMS A;  4G50 A;  2ZPY A;  4WJP A;  2J0J A;  2NBU A;  2R2Q A;  4HAY B;  2GBM A;  4TQ0 A;  4XC2 A;  4WQO B;  4WJO A;  4BOS C;  2D11 A;  3ZRF A;  4BKS D;  4A3P A;  2I5F A;  4GMX B;  5KCV A;  4HK2 A;  1GC6 A;  2NPT A;  4F8C B;  1SGH A;  3A9J B;  3PLU A;  1W1H A;  2J0M A;  2ZNV B;  1PQS A;  2HJ8 A;  1NI2 A;  4BVU C;  3O65 B;  3PZD A;  2MSE D;  4ICV A;  3MHS D;  4JL9 A;  1GG3 A;  2AL3 A;  1UEF A;  3SU8 X;  2Y5B B;  1U5G A;  2O2V A;  2YT1 A;  3H6N A;  3V61 A;  1TGZ B;  4CHJ A;  2FCS A;  4Y94 A;  3PRZ A;  2NPT B;  4IM2 A;  4E3C A;  2CAY A;  2KZR A;  2DYB A;  3P2B A;  4HDO A;  5HE0 A;  1FXT B;  2Z0E B;  2DZK A;  1TQZ A;  2DZJ A;  1WXM A;  4B95 A;  3SUZ A;  3WAO A;  4HWI B;  2XBB C;  2MQJ A;  1GNU A;  2OQB A;  1WGU A;  4W9D A;  4NPN A;  4KSL C;  2FCM A;  2YT0 A;  2LRW A;  4HDQ A;  2KOX A;  5J2R A;  2XEW A;  3SHQ A;  1U5F A;  1WGD A;  2KDF B;  4ZRK A;  3PLV A;  2BWF A;  4XX5 A;  1Z5S B;  4MT7 A;  2RSG A;  2GCJ A;  4E74 A;  2VRW B;  5J17 A;  5EDS A;  4LCD E;  2K2J A;  2R09 A;  3D8D A;  2ZPN A;  3LJ3 A;  2NR2 A;  3VFK A;  3PRM B;  2G4S A;  3PRE A;  2R2O A;  2O6V D;  5FR6 A;  2P0D A;  4HB0 B;  1OEY J;  4K7W A;  1MK9 B;  1DRO A;  3VUW A;  4TKN A;  1J8C A;  1KI1 B;  3TVV A;  2LD9 A;  5GMV A;  2DAF A;  2MCN B;  2BWE S;  2M0X A;  1WY8 A;  3QQ8 B;  2REX A;  2Y7B A;  3ZW3 A;  2CKH B;  2JT4 B;  4PS3 A;  1XKE A;  3R3M A;  2V4L A;  4EUT A;  2GOW A;  4HAZ B;  5G55 A;  3ULB A;  3ZLZ A;  2NCN A;  1OY2 A;  3KUD B;  2ZCB A;  3U30 A;  3AUL A;  4HB4 B;  2PE6 B;  3GOE A;  1SIF A;  4HAW B;  3N32 A;  4FAD A;  4WWN A;  2IO3 B;  1W1G A;  2D9Z A;  3ZUN A;  1XT9 B;  4HAT B;  5BO4 B;  3DCG A;  1V81 A;  1WJN A;  4HB3 B;  1NBF C;  2JZ3 B;  2JVC A;  3A1Q A;  3V60 A;  5C1Z A;  3PG7 A;  4F7G A;  2LKO A;  2EC1 A;  2P0H A;  2KX3 A;  5LLI A;  5D2M B;  1W1D A;  4ASW C;  4LDT B;  1CMX B;  1X1M A;  1YD8 U;  2IO1 B;  2KAN A;  1D3Z A;  1X86 A;  5KHO A;  2KMC A;  4MSQ B;  2GBR A;  3R66 C;  4YON A;  2D3G A;  3M95 A;  4PQ0 A;  2BKR B;  3RT3 B;  1L7Y A;  3A1Q B;  1WX7 A;  3ZRC A;  3MJW A;  4FJY A;  3HW2 B;  4EOY A;  4WSF A;  4PNK A;  1WX8 A;  3APF A;  3HIZ A;  2JXX A;  3ODX A;  1U27 A;  4JGH B;  3ZNZ B; 
#chains in the Genus database with same CATH topology
 3PEG A;  2JF5 A;  2KUQ A;  2L1C A;  1UF0 A;  3NJT A;  2J42 A;  2JUO A;  4XWT A;  2R0D A;  3QJZ A;  1Y5O A;  2BTE A;  2LMC A;  4Z2M B;  1EUV B;  3N20 C;  2LHD A;  3O96 A;  1C4A A;  2X38 A;  3KSY A;  2K8B A;  1QQR A;  2D2Q A;  3W1Y A;  5CHW A;  2L1A A;  1Q1O A;  1MFW A;  1TKY A;  2KGX B;  3M1I B;  3U7Z A;  3KUC B;  3D8F A;  4HPP A;  2R2Y A;  4RGT A;  1MVK A;  1WI0 A;  2EJ8 A;  3AEF B;  4OVV A;  2IO0 B;  2RR9 A;  1Q10 A;  2VZK D;  4TSS A;  4EMO A;  4M02 A;  3QK0 A;  3B08 A;  3SFE B;  1ZC3 B;  3EA6 A;  5D27 A;  2DHZ A;  3FKY A;  1A70 A;  4GSW A;  2BT6 A;  3W5U B;  4ZHO A;  4LDT D;  3M63 B;  3AN1 A;  1GOZ A;  1DBH A;  1XD4 A;  4IFS A;  4F7H A;  1FNW A;  3W1S A;  4F7Z A;  4GLS C;  3GZN B;  3OAN A;  5HKH A;  2LXA A;  1I7A A;  1WJ6 A;  2K49 A;  1UNS A;  3EUB 2;  2H7D A;  2YRY A;  4FN2 A;  3TEZ A;  4N58 A;  1RRP B;  2L05 A;  2KN5 A;  4NZL B;  3UIN B;  2QCZ A;  2V1Y A;  3TEY A;  4JWU C;  2JQR B;  2KJ6 A;  4AOF A;  1MG4 A;  3GZN I;  2KDB A;  3PPA A;  2BW2 A;  3VTW A;  2JU6 X;  1V5M A;  2PTL A;  5L81 A;  3U7D A;  4A6K A;  4S0R A;  2KDM A;  4K1R B;  2WLB A;  4W9L A;  4II3 B;  3PS6 A;  3BK2 A;  3KVF B;  1L0Y B;  1QZE A;  1Y8R C;  5GOW B;  3RUI B;  2CY5 A;  1L0V B;  3DVN V;  4MH8 A;  5FI0 A;  4J6I A;  2H89 B;  1ZKH A;  2W82 A;  3TL5 A;  2K6Q A;  1R4M B;  3DHG C;  3AE5 B;  4AP4 C;  1J0G A;  1L4Z B;  3Q3J A;  2GRI A;  1WI1 A;  4JX1 C;  5L95 C;  4WQM A;  2WS3 B;  2LUM A;  1Z2M A;  1K5D B;  1F0Z A;  3M62 B;  5KQ1 A;  4MJS A;  3IFW B;  4GDL A;  2MJD A;  1R4M I;  3N3K B;  3NHE B;  1N5W A;  3OG5 A;  5AZH A;  4H2A A;  2DLW A;  1SE2 A;  1MI1 A;  3OJ3 A;  1HTO A;  3RNC C;  4WJ7 A;  3F0W A;  2KTR A;  5DPR A;  1FB8 A;  1SBB B;  4C7Z A;  2WHI A;  4P7I A;  4IOY X;  3DVG X;  4M0W A;  5JHH A;  5D3Y A;  1J7C A;  2A4Z A;  1YX6 B;  5DCN A;  2J7Q B;  5C2T B;  2G4D B;  4K81 A;  3PRP B;  3U52 E;  3ZXR A;  3GE3 C;  3JW0 X;  2PVO D;  2BQQ A;  4MJS B;  5MPO A;  2N9L A;  4GDL B;  4YSZ B;  2W2X C;  4OVU A;  2LGD A;  1QOG A;  1ZPS A;  3L08 A;  4A90 A;  1F1H A;  4ZYN A;  5D94 A;  4HVB A;  3UI3 A;  2NS5 A;  1BAK A;  2WP9 B;  3SV1 A;  2IBI B;  4YXD B;  1C1Y B;  4IM3 A;  1WJ4 A;  2SAK A;  3I57 A;  1TZO A;  3MTN B;  2Y3A A;  4K7S A;  4FBJ B;  4DBG A;  1AQC A;  2DFK A;  3TMP B;  4B6W A;  3CST A;  1QIL A;  3RN9 C;  2QSD A;  2YLM A;  3EGR A;  2YS3 A;  1UNQ A;  5DPT A;  2HDE A;  3ECI A;  1J7A A;  1D6E C;  2IJ0 A;  4K2O A;  1MKE A;  2E3T A;  2K3U A;  4AUQ C;  5FR3 A;  1JRP A;  1WGK A;  1C9F A;  4PK1 A;  2DBY A;  3J9C A;  3R7R A;  2Z0D B;  4WUR A;  3ML9 A;  2K8E A;  5DPW A;  3AXC A;  4MEL A;  1HE8 A;  2AX5 A;  2ROZ B;  3A8Q A;  1KJT A;  1XQQ A;  2UVM A;  3N9Y C;  2KC1 A;  3KYC D;  4LTU A;  3VRB B;  3ZKJ C;  2MH7 A;  1ENF A;  3QCA A;  1PLS A;  2IZV B;  3Q3N C;  4WJN A;  2NTT A;  2MEK A;  3DHH C;  5LOP B;  1R4N B;  5E6N A;  1CZP A;  3CF6 E;  2DHK A;  1MHH E;  3NRZ A;  4FHJ A;  3AJ4 A;  1P5T A;  2AQ2 B;  1ZOY B;  3KW5 B;  2CR5 A;  2FNJ B;  1UGM A;  1LM8 B;  4IW0 A;  2WNM A;  4DK5 A;  1N3H A;  4A3O A;  5G2N A;  4TYZ A;  1T6B X;  2D9V A;  1R4N I;  3NS1 A;  2Z0O A;  5AUI A;  2J0K A;  4MGK E;  4MEM A;  1N5X A;  2BYF A;  3WAL A;  4DIX A;  2R61 A;  1SE3 A;  2WXF A;  1DDW A;  3W9C B;  1ESF A;  3VQI A;  2WWZ A;  2X18 A;  2KHW B;  1XR0 B;  1J7B A;  1DOY A;  2O6V A;  2MBH A;  3V05 A;  1D4B A;  2MWN B;  4ANU A;  1JWS D;  3AED B;  2WXK A;  3BYT B;  4DHJ D;  2LGX A;  1VZ7 A;  3BWU D;  2KK8 A;  4RF0 A;  4ANW A;  3UQB A;  4RGM A;  5HHD G;  3ENE A;  1FAO A;  1ZP0 B;  4CQN A;  3BYY B;  3PHX B;  1OQN A;  4DBB A;  2ELA A;  1KLU D;  2IYB A;  1FM0 D;  4I6L B;  3QAR A;  1ET9 A;  1UZX B;  4OVZ A;  3ULC A;  3NVW A;  3JVZ X;  2PLP A;  4ACF A;  2ON8 A;  2WXI A;  2JWU A;  3Q8E A;  4JLC A;  3HRD D;  2W3S A;  3Q8B A;  1VLB A;  4GZU A;  2LAS A;  2O6V B;  2BGF A;  2PZ1 A;  2HTH A;  2CHX A;  1E8Y A;  1E9M A;  4C7Y A;  2OJW A;  2I1K A;  3AH7 A;  2CRF A;  4HHV A;  1TZ1 A;  1N61 A;  4ZRJ A;  1WZ3 A;  2J4X A;  3H8H A;  1JWM D;  3DPD A;  4MH0 E;  1FXI A;  1IPG A;  4RH6 A;  1I4X A;  1PFD A;  3P4R B;  2JYE A;  4OHJ A;  3AEE B;  3B0A A;  2P0F A;  4GIV A;  4LNK A;  1DYQ A;  2JRH A;  1Y19 B;  4B0E A;  1WM2 A;  2YEP F;  2FJL A;  1V88 A;  3QC8 B;  2KJR A;  3MP9 A;  2LHE A;  4ANX A;  2LUL A;  2L8J A;  2C5L C;  1ZUD 2;  3DXE A;  1TJ6 A;  1H8C A;  2TSS A;  2NVU I;  1HEZ E;  3NY5 A;  3ZNG C;  5HI1 A;  4CHM A;  1UBQ A;  2N9E B;  3C8Y A;  2HTH B;  4NAW A;  1KLV A;  3AV8 A;  3I5J C;  2N9X A;  2O2V B;  4I6N B;  5AZF A;  1E10 A;  2FUH B;  4CHK A;  3EHV A;  2WQY B;  3DBR B;  4KHA A;  2GCL A;  3H7S A;  1E7V A;  2XQN M;  2EKI A;  1MIZ B;  4RMA A;  3KH0 A;  4KIK A;  4W9C A;  5CLQ B;  1I35 A;  2W54 A;  1V49 A;  3Q69 A;  1WZ0 A;  4KKI A;  1V97 A;  1V5U A;  4BZA A;  2QJL A;  2Z4D A;  2PKO A;  3H9D A;  2SEB D;  3HM3 A;  4MAC A;  2WXP A;  2Y8F A;  4M01 A;  2GB1 A;  3KYD D;  3L0W B;  5D7G A;  3EFU A;  4DXA B;  4CYE A;  2RD0 A;  3CXB B;  2CHZ A;  2DHJ A;  1ET6 A;  1M94 A;  1OGW A;  1K5G B;  1N63 A;  2G35 A;  2NBW B;  1AWE A;  4JWS C;  4KHO A;  1OTR B;  1CK1 A;  5J3Q A;  3S2A A;  4C0A A;  3A33 B;  4WVF B;  2MHJ A;  1NTY A;  4NY0 A;  1SE9 A;  3BY4 B;  2UZR A;  4PYZ A;  3ZNI D;  4NSW A;  2ZW1 A;  1Q0W B;  1V2Y A;  1EF1 A;  3P4P B;  4PS7 A;  3B9J A;  1AYF A;  4QJ5 B;  2ZVN A;  1ZGU B;  1VCB A;  3QBV B;  1WGQ A;  4F1S A;  2BS4 B;  4JQW C;  4YL8 A;  2WYQ A;  3NSU A;  1WR6 E;  4YSY B;  5J3T A;  4A6Q A;  2LVP A;  3IAS 1;  1RFA A;  2ZW0 A;  1U29 A;  1VZ6 A;  1QKZ A;  2LRU A;  1AWD A;  1V5P A;  1XF5 L;  3DBH B;  2DZM A;  4BKG A;  1K51 A;  4GNK B;  1S1Q B;  4F7U P;  2KMA A;  3TSS A;  3KRW A;  3ML4 A;  5LG4 B;  5C6R A;  3UQA A;  1XD3 B;  1NTV A;  1H10 A;  3BJI A;  2Z0Q A;  2BYV E;  1LB1 A;  3WA0 A;  1BML C;  2PIA A;  1V80 A;  1XLQ A;  1FRR A;  2K1F A;  4YT0 B;  1BTK A;  3PV1 A;  2IPK D;  1V6E A;  4MGI E;  5DHA B;  3A8P A;  1VZ8 A;  2K2U A;  2W3R A;  3KWL A;  1SHC A;  3DXC A;  1OQR A;  3UIO B;  2EMS A;  2GBJ A;  3X0W A;  4ZDV A;  1NYQ A;  5EE3 A;  5IAA C;  2OOB B;  3RD2 A;  2ASQ A;  3R7Q A;  1FMA D;  3RFZ B;  1NVI D;  2KDE B;  1BT0 A;  5BMG A;  3RNG C;  2EEL A;  1JQ4 A;  4WH4 A;  1PUT A;  2COF A;  1WXS A;  1X1F A;  2WU5 B;  5G5G A;  1GB4 A;  4C56 C;  2NBV B;  2KLC A;  4XZ4 A;  2MWS B;  2AQ1 B;  3BK1 A;  3BVZ A;  3TEX A;  1AAR A;  1WRD B;  2CHW A;  1OFF A;  3VH4 B;  3ML8 A;  2L83 A;  3DBS A;  2VZK B;  3DHI C;  2MP2 A;  5E6J A;  2ONQ A;  5EE9 A;  3QIJ A;  2DYO A;  2G45 B;  4RGN A;  1V9J A;  1LW3 A;  4DX8 A;  4HJG E;  3PVW A;  1YIW A;  4BKT A;  3MC8 A;  1P98 A;  4H8S A;  2BB6 A;  3DVN U;  1PYW D;  4N9F 4;  1Q5W B;  2DKQ A;  2VH2 A;  3FIL A;  2BF8 B;  1JRO A;  1HZ6 A;  2GLS A;  4W9K A;  2IDY A;  4ANV A;  1UD7 A;  3URY A;  4EFO A;  4C80 A;  1QQG A;  2P8V A;  2JY6 A;  2ZEQ A;  2BVC A;  4GB9 A;  3AM9 A;  3VIA A;  1YNT E;  4DXF A;  1P3Q U;  1QOB A;  3A58 A;  4XDC A;  2N4F A;  1C4C A;  3U2S C;  2PEA A;  2BS3 B;  1SF0 A;  1XO3 A;  2N23 A;  4G11 A;  4ZRQ A;  4GDK A;  1WR1 A;  1FCL A;  3E56 A;  4IG7 B;  3CIR B;  5BMI A;  4L1R A;  2C7H A;  3IVF A;  2HTM E;  4RGO S;  3W2D A;  2M4N A;  4RM9 A;  2MJE A;  1D5X C;  2INN E;  1E8Z A;  5C23 A;  1BUI C;  2B3A A;  3H1U A;  2KIG A;  1IP9 A;  2NMB A;  2AQ3 B;  3FIL B;  3ONS A;  1VRA B;  1UEL A;  3FM8 C;  2IYD B;  3WAN A;  1CJE A;  4ZYS A;  2DN6 A;  5JP4 A;  1BTN A;  3LJU X;  3Q6B A;  2KKC A;  2AEH A;  2KLG A;  3OHM B;  4HAU B;  3WCQ A;  3X23 A;  4JE3 B;  5D3I B;  1IGD A;  3DQV A;  5JHB A;  1Y56 A;  4GDK B;  4KHB A;  4KGS A;  1OQY A;  3APD A;  3L54 A;  5J3Y A;  3AB5 A;  2M0A A;  2D3B A;  4P6V F;  3OLM D;  1U2B A;  1JML A;  4IC7 B;  4MGZ E;  4ZOH C;  3Q3M C;  3EFC A;  4IWP A;  4IWO A;  4MK0 A;  4G3X B;  3MPX A;  4RM8 A;  2LG1 A;  1KRH A;  1GPX A;  2D9Y A;  3HHM A;  3VVW B;  2V76 A;  1WVH A;  5CLL B;  1FHO A;  1UUP A;  4YTP B;  3ZVR A;  4HPM B;  1ROE A;  1UNP A;  3N1Z C;  1LFD A;  2DNF A;  2XK5 A;  3VHT C;  4K17 A;  1X1G A;  4BFR A;  4XWX A;  1SJH D;  3TCA A;  4A6F A;  3KLS X;  4KHB B;  3RCP A;  1T0Y A;  2JX5 A;  1RLF A;  1J0W A;  4GN1 A;  3KWV A;  2PE9 A;  1P6S A;  3TO1 A;  4KZ0 A;  3L13 A;  2YF0 A;  2EKE C;  1FNV A;  4B0M A;  4AS1 A;  4BBN F;  1K50 A;  2WXQ A;  1T5X D;  3NVV A;  2EMT A;  1L6V A;  1SE4 A;  2N1V A;  3ZGZ A;  2LJI A;  1YQB A;  3AMZ A;  3BII D;  2B76 B;  1YN5 A;  5H8Y E;  2XK5 B;  2DX5 A;  1ZXI A;  5FKA C;  1E8X A;  1C4P A;  4A6F B;  1V8C A;  4WWO A;  1UPQ A;  2CJN A;  3ZDT A;  1MHX A;  2JXT A;  1DYN A;  5L83 A;  3SNH A;  4PT5 A;  2YS5 A;  2M8S A;  2MA9 B;  1K53 A;  2IO2 B;  5J18 A;  4W9G A;  2CJO A;  1LO5 D;  2N1W A;  2K9X A;  3EC8 A;  3G9W A;  2KFJ A;  1WH3 A;  5HE2 A;  3SYX A;  3MC0 B;  2QKL A;  2D07 B;  2KAJ A;  1KH0 A;  4EEW A;  1IYF A;  2V0G A;  2RMM A;  5HG2 A;  2RDG A;  2IY0 B;  1U5D A;  1T77 A;  2FAZ A;  3ZQ4 A;  5LON B;  1UWX A;  1NU2 A;  1PFJ A;  2N9K A;  2DZI A;  5BYQ A;  3PTF C;  2FCN A;  2DX5 B;  4O1N A;  3NZ3 A;  4C4V A;  1Z87 A;  2YT2 A;  2V3S A;  2IGD A;  3ZTD A;  1I4R A;  1AN8 A;  2LOX A;  3JSV A;  4URK A;  3UZT A;  1P3R A;  3NWD A;  1UPR A;  4KDL B;  4US9 A;  4DX9 0;  3AE9 B;  3VAW A;  2RRF A;  4P16 A;  5I4D A;  4HAV B;  1MPE A;  1KZG A;  4AWJ A;  4EZK A;  2RDB C;  4DHJ B;  1B55 A;  1F2R I;  2GMI C;  3H7P A;  2KTR B;  3HVZ A;  2L52 A;  1DOI A;  4TQ1 A;  3F5R A;  4IM0 A;  2KDI A;  2LGY A;  2C9W B;  4M0W B;  1UGJ A;  2QMT A;  4JIO U;  5KQ4 A;  1JWU D;  3E9S A;  2W9N A;  2RGN B;  3UIP B;  4C4V B;  2VSZ A;  1E90 A;  3P63 A;  4P1B C;  2WDQ B;  5C79 A;  2MKR A;  1PGX A;  3JSV B;  2LEK A;  3QAQ A;  2KD0 A;  1WJU A;  1C76 A;  3SDL C;  4WJQ A;  4W9H A;  2LJ5 A;  2C60 A;  3HQC A;  2M1M A;  4PYU A;  1I7H A;  4W9I A;  3R8B A;  2UYZ B;  3K9P B;  3ZYY X;  3Q3F A;  5IKC M;  2K5P A;  1L2N A;  4JPS A;  1ZE3 D;  3CWI A;  4DDG D;  2KR0 A;  3NVZ A;  2MX2 A;  2K8H A;  2COC A;  3CIK A;  3KZ1 A;  2NTS A;  4IOI E;  1OMW A;  2RUK B;  2ELB A;  2DYQ A;  2G9H D;  2BYT A;  3RUL A;  3TFM A;  1JAL A;  3HVD A;  5TSS A;  4YSX B;  1N6Z A;  3NS8 A;  4M8M A;  3KUZ A;  1J19 A;  1I2H A;  3BVG A;  4IDI A;  2N9P C;  1EVH A;  2RGF A;  2ZNV C;  3LB8 C;  1NEK B;  1EO6 A;  3P4S B;  3T3O A;  4HCP B;  3GP7 A;  1P0R A;  3L4P A;  1MK7 B;  4ICU A;  3BIN A;  2GBN A;  2DTC A;  2K22 A;  4FLH A;  2RNR B;  2DEN B;  1RJ2 A;  3SFD B;  3NG0 A;  3IHP C;  3FEH A;  5DIF B;  2M14 A;  2DYN A;  2KAC A;  1BWN A;  3CSF A;  1WGG A;  2KVR A;  4IWQ A;  4K7U A;  5AZG A;  1EM7 A;  1M4V A;  4EE2 A;  5EE1 A;  3AE8 B;  4N6E B;  4OW0 A;  4ZRP A;  1GUA B;  3L17 A;  2J59 M;  4X57 B;  2H7E A;  2MFQ A;  3ZDM C;  2BPS A;  4KV2 A;  3MDB C;  4PS8 A;  1FHX A;  1WE7 A;  4AJY B;  2L2I A;  2GJY A;  3ODO A;  3WAM A;  5D3W A;  1F77 A;  3IT6 B;  2KTF A;  4MM3 A;  4FXC A;  4A55 A;  4ARC A;  2KO3 A;  3PT2 B;  2D4Q A;  2MBQ A;  3SEB A;  1VJK A;  2DX1 A;  2G3Q B;  4HLE A;  2LVQ A;  3ETR A;  2LXC A;  2WXG A;  1JCK B;  4OZB A;  5CTR C;  4DWF A;  4HKZ E;  2LFI A;  5DH9 B;  2K39 A;  3A9K A;  1LGR A;  1I4P A;  2HJ1 A;  2W2X D;  2FUG 1;  2MW5 A;  3CMM B;  4KZC A;  5BYS A;  1TTN A;  3AEA B;  2LWP A;  5HE1 A;  1XLO A;  3HUI A;  4HAX B;  3TJP A;  4A9A A;  2BYE A;  1EWC A;  4MM3 B;  1H4R A;  2CU1 A;  1KLG D;  1TS3 A;  5JLJ B;  3FSS A;  2E6X A;  2FIF A;  4GPT B;  2I5C A;  1A5R A;  1QT9 A;  2BS2 B;  1N60 A;  2PJH A;  2MLB A;  2A5U A;  1YMH E;  2PVG C;  4XDD A;  5KHQ A;  1DDV A;  2LGS A;  2KNB A;  4L1B A;  3A9K B;  4BAX A;  3VOQ A;  2IND C;  4WIP A;  2KWU B;  3NZS A;  1KM7 A;  4NJ7 A;  4XWW A;  2PMV A;  1U4A A;  2L7R A;  1M7E A;  3DBR I;  2Q13 A;  1KFY B;  3FVC A;  1VDV A;  1Q67 A;  2LI5 A;  4GXB A;  1SIJ A;  1SEB D;  3PVL A;  2KIE A;  5TR5 A;  4NAW B;  2L0T A;  3U8Z A;  3GS2 A;  3IAM 1;  4HPL B;  4HXD A;  4KGR A;  4XE0 A;  2JP2 A;  3SD5 A;  2N0Y A;  5FI1 A;  1P1A A;  4RNA A;  4KIK B;  2V4I B;  3O13 A;  2WXR A;  2KVZ A;  2ZCC A;  4DHZ B;  1X11 A;  1FCC C;  2VKI A;  3AE3 B;  4NJ6 A;  1F52 A;  3L16 A;  3GYO A;  4GMV A;  5AEK B;  3ODW A;  2N7D A;  2MBO A;  1C77 A;  1V61 A;  1IBX A;  1WXV A;  3P42 A;  4B6H A;  2HE7 A;  2DWQ A;  2JRI B;  1RAX A;  2M19 A;  1WF9 A;  2WDT B;  4GGQ A;  1ZDX A;  1EAZ A;  2KYW A;  4HJK A;  3PHW B;  4E71 A;  1NEN B;  1T3Q A;  1FHW A;  3B2G A;  3A98 B;  5EFX A;  1YOV B;  3B1L X;  4CO7 A;  1KZ7 A;  4LNN A;  3V5W A;  1L0X B;  2KX0 A;  1UWM A;  3SO6 A;  1RYJ A;  1WE6 A;  3V62 A;  3LDZ E;  4HRS A;  4W9F A;  1QOF A;  1I42 A;  2D3A A;  3TUO A;  2BCJ A;  3RZW C;  2H88 B;  2GBK A;  2RVB B;  1TY0 A;  2CY4 A;  3NWA A;  5DI9 B;  3I63 C;  3ZJV A;  2Z0P A;  1VD2 A;  2FE8 A;  3DBH I;  1XOD A;  1MIX A;  1X05 A;  2Y5P A;  1IBX B;  4DDI D;  1ZM0 A;  1YN3 A;  1T0Q C;  2COA A;  1UNR A;  3UGB B;  3NW8 A;  2QHO A;  4II2 B;  1WGH A;  1IRS A;  3RPF C;  5C5B A;  3Q2A C;  2VRR B;  1WYW B;  4WWP A;  1I4Q A;  2NZ8 B;  5JHG A;  1FEH A;  4IKG A;  3W5V B;  2D9W A;  5IP4 D;  3N7C A;  2D3C A;  2KJH B;  1FRD A;  5I2S A;  2QKM A;  1ZDV A;  3RZF A;  1V1P A;  3LYY A;  1YX5 B;  2DA0 A;  4L23 A;  4OSN A;  4XGA B;  2Z13 A;  4FUL A;  5BMH A;  1TXD A;  2OJR A;  1WXQ A;  2YVC A;  1GB1 A;  3PSE B;  3VUY A;  3VTU A;  2RPV A;  3N1Y C;  2BB5 A;  1WFY A;  1XX0 A;  4FHK A;  4A6H A;  2UWQ A;  2Y8G A;  1WG7 A;  1M7R A;  2Z8L A;  5CHV C;  2M17 A;  2WXO A;  1TIF A;  2C7N B;  2DKP A;  3DXD A;  2L00 B;  4KAX B;  3IBE A;  4WAF A;  1STE A;  3RNB C;  3RYT A;  1F9J A;  5C5B B;  1B9R A;  1V89 A;  3K9O B;  1ZVR A;  2JWZ A;  1E8W A;  3QX1 A;  4Z2N A;  1E0Z A;  4L6E A;  2CS4 A;  1V1P B;  4B9K A;  4KDI C;  1I4H A;  3OAW A;  4FJZ A;  2KFK A;  4IUM B;  2LUE A;  1OEY A;  2DYM A;  3RNF C;  5D6J B;  2ZVO A;  2MP2 B;  2JPH A;  3OWE B;  1LQB A;  2K8C A;  4QAY A;  3D32 A;  2INC C;  2N0S B;  2KWD A;  4EKU A;  4MDK E;  1GAQ B;  3MC9 A;  2W55 A;  2YS1 A;  3FAH A;  3ZNH B;  1YJ1 A;  3BZD B;  1YN4 A;  1LXD A;  1E7U A;  4DHZ E;  2K6D B;  2KXJ A;  1GC7 A;  1L6U A;  3ZTC A;  1ISN A;  2WX1 A;  3OJ4 B;  1RRB A;  1EU4 A;  2MRP A;  4GU2 A;  3RMK C;  3KY9 A;  1WJM A;  1EWY C;  1EF5 A;  5I2M A;  2I2Y A;  2KFK B;  1P7E A;  1S3S G;  1FNU A;  3QA8 A;  2RDH A;  4HB2 B;  5EE0 A;  5JXV A;  1FGY A;  4OT1 A;  2FBW B;  1U5E A;  2N7J A;  3HK0 A;  3ZO5 B;  1QF6 A;  2Z59 A;  3B2F A;  3RCZ A;  3TBL D;  4LNO A;  2CU3 A;  3JYU A;  2OHF A;  4TMA B;  3WIM A;  1P9D U;  1V1O A;  4EZL A;  3AI5 A;  2WX0 A;  3P6A A;  1WM3 A;  3RNA C;  4EZJ A;  4D0N B;  2W2W A;  1JW9 D;  3APC A;  3M3J A;  2KT7 A;  2E2X A;  4N59 A;  2LZ6 A;  1JWA D;  2WXL A;  1WRI A;  2MBE A;  3ALB A;  4HRO A;  3W1S C;  2PPH A;  2ADZ A;  3B77 A;  1HQR D;  2KQ4 X;  3DBL B;  4OZA A;  3VUX A;  3KRX A;  1SXT A;  1K8R B;  4RFB A;  5JHA A;  5LNK 1;  1KOT A;  4M00 A;  2WDR B;  3VTV A;  3VH3 B;  2Z59 B;  4KSK C;  3A4R A;  3V6E B;  3HM6 X;  4US8 A;  4FJV B;  3DBL I;  4LNI A;  1JRU A;  3AE6 B;  1ZC4 B;  4LJO B;  4KKJ A;  3QWM A;  3P7Z A;  1PGB A;  1WGR A;  2WXH A;  4GOC A;  4TUU A;  5M4Y B;  4K2P A;  4ZHP A;  3PVU A;  2L3Z A;  2N7E A;  2D10 A;  3VR8 B;  2OTX A;  1MAI A;  4IAP A;  3PP2 A;  3V6C B;  4KVG B;  4EJN A;  1BXT A;  3DWG C;  3N1X C;  4HCN B;  4REZ A;  1GJZ A;  3VRA B;  1G6J A;  4A5K A;  5IO9 A;  3PGE A;  1WSP A;  3P4Q B;  1V5T A;  2BKF A;  3ZVV A;  1F2R C;  1EGX A;  4FA6 A;  1MPH A;  1CQV A;  2ZJD A;  1UBI A;  5CX3 A;  4W9E A;  5D3V A;  3DVG Y;  1C3T A;  5LXI B;  3RI7 C;  5E6P A;  5DHF B;  3HIE A;  2LYD A;  2IGG A;  1C78 A;  2FCQ A;  4WAA A;  3TIX A;  3N30 A;  2UZS A;  2AWT A;  1WXA A;  4NQK E;  1FFV A;  2KN4 A;  3ZJU A;  4HKQ A;  3EEC A;  2GUM A;  3WYF B;  2M38 A;  2ACZ B;  4MSM B;  3T9L A;  1WWT A;  1FO4 A;  4BKS A;  1D5Z C;  2WDV B;  1TKG A;  2LVO A;  3QHT A;  2L76 A;  2K00 A;  5C3J B;  3C0R B;  5CHF A;  4W9J A;  3PZ7 A;  4WWM A;  2QIL A;  1UH6 A;  4BOZ B;  1K52 A;  1KF6 B;  3T8M A;  1IGC A;  2KWC A;  4BBK A;  2KQ7 A;  2VH1 A;  4J3O D;  4MGY E;  3VR9 B;  5D3X A;  2ICI A;  5E6O A;  1WJ1 A;  4HSI A;  2HD5 B;  1TKE A;  2KMM A;  3Q8A A;  5AUK A;  2ZZP B;  1DDM A;  3T06 A;  4NNJ B;  3I3T B;  4NJC A;  2RLO A;  5H92 C;  1QC6 A;  3GYP A;  5BYR A;  2RPQ A;  5IA7 A;  1V86 A;  2IGH A;  2QEJ C;  2IY1 B;  2LOZ A;  1XLP A;  3DOW A;  1TS5 A;  1TJE A;  1N62 A;  1XXG A;  1E6E B;  3NWF A;  2MJ3 A;  5JH5 C;  3L10 B;  4A8X C;  3WAP A;  4LJP B;  2DHI A;  5HFY A;  2ZKM X;  5DPS A;  1MG8 A;  2AYO B;  3Q8F A;  1WGY A;  3TW1 A;  3R2T A;  1FGZ A;  2C7M B;  4TV3 A;  3UF8 A;  4BBN C;  1PGA A;  3VDZ A;  5T8I A;  1TBE A;  2WXJ A;  2KCJ A;  3AEC B;  2KC2 A;  2DAJ A;  5JZE B;  3H7P B;  1V5O A;  4I6P A;  4RF1 A;  3ZIM A;  1XCT L;  3VXW A;  4NQL B;  3A4S C;  2QIE B;  2KQS A;  2G1E A;  2COD A;  3D8E A;  1WX9 A;  1XCG A;  4ZRI A;  4CSQ A;  1WMH A;  3DDC B;  1NDD A;  5IRS A;  3ABV B;  2MBB B;  2KWV B;  3NZU A;  1TY2 A;  4NAM A;  2D9X A;  2GS0 A;  3PSC A;  1AW7 A;  1RFK A;  2D5G A;  2K25 A;  4G0N B;  1E5W A;  1RWS A;  3SR6 A;  5C16 A;  5HE3 A;  3Q3O C;  2JSV X;  1I4G A;  2I1J A;  3AU4 A;  4M8N A;  4MY6 A;  1WIA A;  1C79 A;  3AE2 B;  2RSU A;  1KTK A;  5LXH A;  2MDX A;  3AU5 A;  2KUP A;  2L0F A;  1FOE A;  2M56 B;  1ZXH A;  3A9J A;  3QWZ B;  3NOB A;  4AJW A;  5FK9 C;  1QOA A;  4DQO C;  4R3D A;  4YTN B;  3C19 A;  3AEG B;  2IFS A;  1P7F A;  2YSZ A;  1JWB D;  2ROV A;  3NVY A;  2AL6 A;  2FID A;  1ZSQ A;  4A20 A;  4LLG M;  1WMH B;  2JZZ A;  1ZW7 A;  1YQ3 B;  3IG3 A;  1PMS A;  1SJE D;  4G50 A;  2ZPY A;  4WJP A;  2WU2 B;  2J0J A;  2NBU A;  2FJU B;  2R2Q A;  4HAY B;  4S17 A;  2Z14 A;  2GBM A;  4TQ0 A;  4XC2 A;  3MFG A;  4WQO B;  4WJO A;  4BOS C;  2D11 A;  3ZRF A;  4BKS D;  1YJJ A;  4A3P A;  2I5F A;  4GMX B;  5KCV A;  4HK2 A;  3HSA A;  1HZ5 A;  2OED A;  1GC6 A;  2NPT A;  4F8C B;  1SGH A;  3A9J B;  2K0P A;  1ACC A;  2V3N A;  3PLU A;  1W1H A;  1L4D B;  2J0M A;  2WXM A;  2ZNV B;  1PQS A;  2QDF A;  4GOU A;  2HJ8 A;  1NI2 A;  4BVU C;  1HA5 A;  4RCO A;  1NYR A;  3O65 B;  4P1C C;  1DOX A;  3PZD A;  2MSE D;  4USA A;  4ICV A;  1B1Z A;  1FXA A;  3IXS A;  3MHS D;  3U4E G;  4JL9 A;  1GG3 A;  1YQ4 B;  3FC4 A;  1IUE A;  1PDX A;  2AL3 A;  1UEF A;  3SU8 X;  4HEA 1;  3GE8 C;  3Q14 C;  2Y5B B;  1U5G A;  2J52 A;  2O2V A;  2YT1 A;  3H6N A;  3V61 A;  1TGZ B;  4CHJ A;  2FCS A;  4Y94 A;  3PRZ A;  3AE1 B;  2NPT B;  4KGT A;  4LNF A;  4IM2 A;  2JYT A;  3DWM A;  2INP E;  4E3C A;  2CAY A;  2KZR A;  2DYB A;  3MJ5 A;  3P2B A;  4HDO A;  5HE0 A;  3AE4 B;  3PO0 A;  3P1M A;  1FXT B;  4L2Y A;  2Z0E B;  1SB3 C;  2DZK A;  1TQZ A;  2WGS A;  2DZJ A;  1WXM A;  4K3B A;  4B95 A;  1OQQ A;  1FD6 A;  3SUZ A;  3WAO A;  4HWI B;  2XBB C;  2XNA C;  2MQJ A;  4C00 A;  1GNU A;  2OQB A;  1WGU A;  4W9D A;  4NPN A;  4KSL C;  2FCM A;  2BBC A;  2YT0 A;  2LRW A;  4HDQ A;  2KOX A;  5J2R A;  2XEW A;  2L32 A;  3SHQ A;  1U5F A;  1WGD A;  2KDF B;  4ZRK A;  3PLV A;  5D3D A;  2BWF A;  1XCQ L;  4XX5 A;  3RNE C;  1Z5S B;  4MT7 A;  2RSG A;  4Q2J A;  2X8X X;  2GCJ A;  1T0R C;  1HTQ A;  4E74 A;  2VRW B;  2JZP A;  5J17 A;  5EDS A;  1YJI A;  1RM6 C;  4LCD E;  2K2J A;  3LXF A;  3MHZ A;  2R09 A;  3D8D A;  2ZPN A;  3LJ3 A;  1FFU A;  2NR2 A;  1FPY A;  1SSN A;  4D2K A;  4YTM B;  3VFK A;  3PRM B;  2G4S A;  3PRE A;  2R2O A;  2O6V D;  5FR6 A;  2P0D A;  5IOI A;  4HB0 B;  1FIQ A;  2V3P A;  1OEY J;  4K7W A;  1MK9 B;  1DRO A;  3NUH B;  3VUW A;  4LK0 M;  3ZXV A;  4TKN A;  3I9V 1;  1J8C A;  3U12 A;  1KI1 B;  3TVV A;  1MI0 A;  2LD9 A;  3AE7 B;  5GMV A;  1WYG A;  5IN7 A;  4DXG A;  2DAF A;  2J53 A;  2MCN B;  2BWE S;  2M0X A;  1L5P A;  1WY8 A;  3QQ8 B;  2REX A;  2Y7B A;  3R2I A;  3ZJT A;  3Q8C A;  4K3C A;  3ZW3 A;  3T3N A;  2CKH B;  1T0S C;  2JT4 B;  4PS3 A;  1XKE A;  3R3M A;  4YWG G;  2V4L A;  4EUT A;  2GOW A;  4HAZ B;  5G55 A;  4AQ7 A;  2NBV A;  2V9H A;  3ULB A;  3ZLZ A;  2PW9 A;  2NCN A;  1OY2 A;  3KUD B;  3AEB B;  4D6W A;  1R7S A;  1XEE A;  2ZCB A;  3U30 A;  3AUL A;  4HB4 B;  2PE6 B;  4QJ4 B;  5G5H A;  4ITK A;  3GOE A;  1SIF A;  1E7P B;  4HAW B;  3N32 A;  4FAD A;  4WWN A;  4QJ3 B;  2IO3 B;  1W1G A;  1VR9 A;  2D9Z A;  3TEW A;  3IT4 B;  4QXA B;  2XN9 C;  3V3X A;  4KX6 B;  3GB1 A;  1XLN A;  3ZUN A;  1XT9 B;  4HAT B;  5BO4 B;  4UDU C;  3DCG A;  1V81 A;  2Q5W D;  1NI3 A;  1WJN A;  4HB3 B;  3KQ4 A;  1NBF C;  2JZ3 B;  2JVC A;  2YEP B;  3A1Q A;  3V60 A;  5C1Z A;  3PG7 A;  4F7G A;  2LKO A;  2EC1 A;  2P0H A;  2KX3 A;  5LLI A;  1DGJ A;  3BVM A;  5D2M B;  2DLB A;  1W1D A;  4ASW C;  4LDT B;  4XYC A;  1TT5 B;  2WXN A;  1CMX B;  1X1M A;  2NMQ A;  1ZYI A;  2QC8 A;  2I38 A;  1YD8 U;  2IO1 B;  1EU3 A;  2Y5C A;  2KAN A;  1D3Z A;  1X86 A;  5KHO A;  1MJD A;  2KMC A;  4MSQ B;  2GBR A;  4ARI A;  1HXY D;  2LGI A;  3R66 C;  3DCX A;  4YON A;  4OZC A;  4MT5 A;  2D3G A;  1TS2 A;  4PQ0 A;  3M95 A;  2BKR B;  3RT3 B;  1L7Y A;  2UU7 A;  3A1Q B;  1WX7 A;  1TS4 A;  1TYG B;  3ZRC A;  1D5M C;  2GI9 A;  3MJW A;  3PZ8 A;  4FJY A;  5GXG B;  3HW2 B;  4EOY A;  4WSF A;  4PNK A;  1WX8 A;  3APF A;  3HIZ A;  2JXX A;  3ODX A;  1U27 A;  4JGH B;  3ZNZ B;  1QLB B; 
#chains in the Genus database with same CATH homology
 3PEG A;  2JF5 A;  2L1C A;  2JUO A;  2R0D A;  3QJZ A;  1Y5O A;  4Z2M B;  1EUV B;  3O96 A;  3KSY A;  2K8B A;  2D2Q A;  3W1Y A;  5CHW A;  1Q1O A;  2KGX B;  3M1I B;  3KUC B;  3D8F A;  1WI0 A;  2EJ8 A;  4OVV A;  2IO0 B;  2RR9 A;  4EMO A;  3QK0 A;  3B08 A;  1ZC3 B;  5D27 A;  2DHZ A;  4GSW A;  4LDT D;  3M63 B;  1DBH A;  1XD4 A;  4IFS A;  4F7H A;  3W1S A;  4F7Z A;  3OAN A;  5HKH A;  2LXA A;  1I7A A;  1WJ6 A;  2H7D A;  2YRY A;  4FN2 A;  1RRP B;  2L05 A;  2KN5 A;  3UIN B;  2V1Y A;  2KJ6 A;  4AOF A;  3GZN I;  2KDB A;  3PPA A;  3VTW A;  1V5M A;  5L81 A;  3U7D A;  4A6K A;  4K1R B;  4W9L A;  4II3 B;  3PS6 A;  3KVF B;  1QZE A;  1Y8R C;  5GOW B;  3RUI B;  2CY5 A;  3DVN V;  5FI0 A;  4J6I A;  1ZKH A;  3TL5 A;  2K6Q A;  4AP4 C;  1J0G A;  3Q3J A;  1WI1 A;  5L95 C;  1Z2M A;  1K5D B;  3M62 B;  5KQ1 A;  4MJS A;  3IFW B;  4GDL A;  1R4M I;  3N3K B;  3NHE B;  5AZH A;  2DLW A;  3OJ3 A;  4WJ7 A;  3F0W A;  2KTR A;  5DPR A;  1FB8 A;  4P7I A;  4IOY X;  3DVG X;  5JHH A;  5D3Y A;  2A4Z A;  1YX6 B;  5DCN A;  2J7Q B;  2G4D B;  4K81 A;  3PRP B;  3JW0 X;  4MJS B;  4GDL B;  2W2X C;  4OVU A;  2LGD A;  3L08 A;  4ZYN A;  5D94 A;  4HVB A;  2NS5 A;  1BAK A;  3SV1 A;  2IBI B;  1C1Y B;  4IM3 A;  1WJ4 A;  3MTN B;  4K7S A;  4FBJ B;  4DBG A;  1AQC A;  2DFK A;  3TMP B;  4B6W A;  3CST A;  2YLM A;  2YS3 A;  1UNQ A;  5DPT A;  3ECI A;  4K2O A;  1MKE A;  4AUQ C;  3R7R A;  2Z0D B;  3ML9 A;  5DPW A;  3AXC A;  4MEL A;  1HE8 A;  2ROZ B;  3A8Q A;  1KJT A;  1XQQ A;  2UVM A;  2KC1 A;  3KYC D;  3ZKJ C;  3QCA A;  1PLS A;  2IZV B;  4WJN A;  5LOP B;  5E6N A;  3CF6 E;  2DHK A;  4FHJ A;  3AJ4 A;  1P5T A;  3KW5 B;  2CR5 A;  2FNJ B;  1UGM A;  1LM8 B;  4IW0 A;  4DK5 A;  1N3H A;  4A3O A;  5G2N A;  4TYZ A;  2D9V A;  1R4N I;  2Z0O A;  2J0K A;  4MGK E;  4MEM A;  2BYF A;  3WAL A;  1DDW A;  3VQI A;  2WWZ A;  2X18 A;  2KHW B;  1XR0 B;  2O6V A;  2MBH A;  2MWN B;  4ANU A;  4DHJ D;  2LGX A;  2KK8 A;  4ANW A;  3UQB A;  3ENE A;  1FAO A;  3PHX B;  1OQN A;  4DBB A;  2ELA A;  2IYB A;  4I6L B;  3QAR A;  1UZX B;  3ULC A;  3JVZ X;  4JLC A;  4GZU A;  2LAS A;  2O6V B;  2BGF A;  2PZ1 A;  2HTH A;  2CHX A;  1E8Y A;  2I1K A;  2CRF A;  4HHV A;  1TZ1 A;  4ZRJ A;  1WZ3 A;  3DPD A;  4MH0 E;  1IPG A;  3B0A A;  2P0F A;  4GIV A;  2JRH A;  1Y19 B;  1WM2 A;  2FJL A;  1V88 A;  3QC8 B;  2KJR A;  4ANX A;  2LUL A;  2L8J A;  2C5L C;  3DXE A;  1TJ6 A;  1H8C A;  2NVU I;  3NY5 A;  3ZNG C;  4CHM A;  1UBQ A;  2N9E B;  4NAW A;  2HTH B;  1KLV A;  2N9X A;  2O2V B;  4I6N B;  5AZF A;  2FUH B;  4CHK A;  3EHV A;  4KHA A;  2GCL A;  3H7S A;  1E7V A;  2XQN M;  4RMA A;  1MIZ B;  4W9C A;  3KH0 A;  4KIK A;  1I35 A;  5CLQ B;  1V49 A;  1WZ0 A;  1V5U A;  3H9D A;  3HM3 A;  2Y8F A;  3KYD D;  3L0W B;  5D7G A;  3EFU A;  4DXA B;  4CYE A;  2RD0 A;  3CXB B;  2CHZ A;  2DHJ A;  1M94 A;  1OGW A;  1K5G B;  2G35 A;  2NBW B;  1AWE A;  4KHO A;  1OTR B;  5J3Q A;  3S2A A;  4C0A A;  3A33 B;  4WVF B;  1NTY A;  4NY0 A;  1SE9 A;  3BY4 B;  2UZR A;  4PYZ A;  3ZNI D;  4NSW A;  1Q0W B;  1V2Y A;  1EF1 A;  4PS7 A;  2ZVN A;  1ZGU B;  1VCB A;  3QBV B;  1WGQ A;  4F1S A;  4JQW C;  4YL8 A;  2WYQ A;  3NSU A;  1WR6 E;  5J3T A;  2LVP A;  1RFA A;  1U29 A;  2LRU A;  1V5P A;  2DZM A;  4BKG A;  1S1Q B;  4F7U P;  2KMA A;  3KRW A;  3ML4 A;  5C6R A;  3UQA A;  1XD3 B;  1NTV A;  1H10 A;  3BJI A;  2Z0Q A;  2BYV E;  1LB1 A;  3WA0 A;  1V80 A;  2K1F A;  1BTK A;  3PV1 A;  1V6E A;  4MGI E;  5DHA B;  3A8P A;  2K2U A;  1SHC A;  3DXC A;  3UIO B;  2EMS A;  2GBJ A;  3X0W A;  4ZDV A;  5IAA C;  2OOB B;  3RD2 A;  2ASQ A;  3R7Q A;  2KDE B;  1BT0 A;  2COF A;  1WXS A;  1X1F A;  2NBV B;  2KLC A;  4XZ4 A;  2MWS B;  1AAR A;  1WRD B;  2CHW A;  3VH4 B;  3ML8 A;  3DBS A;  2MP2 A;  3QIJ A;  2DYO A;  2G45 B;  1V9J A;  1LW3 A;  4DX8 A;  3PVW A;  1YIW A;  4BKT A;  1P98 A;  4H8S A;  3DVN U;  4N9F 4;  1Q5W B;  2DKQ A;  2BF8 B;  4W9K A;  4ANV A;  1UD7 A;  4EFO A;  1QQG A;  2P8V A;  2JY6 A;  2ZEQ A;  4GB9 A;  3VIA A;  1P3Q U;  2N4F A;  2PEA A;  2N23 A;  4G11 A;  4GDK A;  1WR1 A;  4IG7 B;  2C7H A;  3IVF A;  2M4N A;  4RM9 A;  1E8Z A;  5C23 A;  2B3A A;  3H1U A;  1IP9 A;  2NMB A;  3ONS A;  1UEL A;  3FM8 C;  2IYD B;  3WAN A;  2DN6 A;  5JP4 A;  1BTN A;  3LJU X;  2KKC A;  2AEH A;  2KLG A;  4HAU B;  3X23 A;  3DQV A;  5JHB A;  4GDK B;  1OQY A;  3APD A;  3L54 A;  5J3Y A;  3OLM D;  1U2B A;  4IC7 B;  4MGZ E;  4IWP A;  4IWO A;  4MK0 A;  4G3X B;  3MPX A;  4RM8 A;  2LG1 A;  2D9Y A;  3HHM A;  3VVW B;  2V76 A;  1WVH A;  5CLL B;  1FHO A;  3ZVR A;  4HPM B;  1UNP A;  1LFD A;  2XK5 A;  3VHT C;  4K17 A;  1X1G A;  4BFR A;  4XWX A;  3TCA A;  4A6F A;  4KHB B;  3RCP A;  1T0Y A;  1RLF A;  1J0W A;  4GN1 A;  2PE9 A;  1P6S A;  3TO1 A;  4KZ0 A;  3L13 A;  2YF0 A;  2EKE C;  4BBN F;  2EMT A;  2N1V A;  1YQB A;  2XK5 B;  2DX5 A;  1E8X A;  4A6F B;  4WWO A;  1UPQ A;  3ZDT A;  1DYN A;  5L83 A;  3SNH A;  2YS5 A;  2M8S A;  2MA9 B;  2IO2 B;  5J18 A;  4W9G A;  2N1W A;  3EC8 A;  3G9W A;  2KFJ A;  1WH3 A;  5HE2 A;  3SYX A;  2QKL A;  2D07 B;  4EEW A;  1IYF A;  2IY0 B;  1U5D A;  2FAZ A;  5LON B;  1NU2 A;  1PFJ A;  2DZI A;  3PTF C;  2FCN A;  2DX5 B;  1Z87 A;  2V3S A;  3ZTD A;  2LOX A;  3JSV A;  4URK A;  3UZT A;  1P3R A;  1UPR A;  4KDL B;  4DX9 0;  3VAW A;  4HAV B;  1KZG A;  4AWJ A;  4EZK A;  4DHJ B;  1B55 A;  2GMI C;  3H7P A;  2KTR B;  4TQ1 A;  3F5R A;  4IM0 A;  2KDI A;  2LGY A;  2C9W B;  4M0W B;  4JIO U;  5KQ4 A;  2W9N A;  2RGN B;  3UIP B;  2VSZ A;  1E90 A;  5C79 A;  2MKR A;  3JSV B;  3QAQ A;  2KD0 A;  1WJU A;  3SDL C;  4WJQ A;  4W9H A;  2LJ5 A;  2C60 A;  3HQC A;  2M1M A;  4PYU A;  4W9I A;  2UYZ B;  3K9P B;  3Q3F A;  1L2N A;  4DDG D;  2MX2 A;  2K8H A;  2COC A;  3CIK A;  3KZ1 A;  1OMW A;  2RUK B;  2ELB A;  2DYQ A;  3RUL A;  3TFM A;  3NS8 A;  4M8M A;  3KUZ A;  1J19 A;  1I2H A;  2N9P C;  1EVH A;  2RGF A;  2ZNV C;  1EO6 A;  4HCP B;  1P0R A;  1MK7 B;  4ICU A;  3BIN A;  2GBN A;  2DTC A;  4FLH A;  2RNR B;  2DEN B;  1RJ2 A;  3IHP C;  3FEH A;  5DIF B;  2M14 A;  2DYN A;  1BWN A;  3CSF A;  1WGG A;  2KVR A;  4IWQ A;  4K7U A;  5AZG A;  1GUA B;  3L17 A;  2J59 M;  4X57 B;  2H7E A;  2MFQ A;  3ZDM C;  2BPS A;  4KV2 A;  3MDB C;  4PS8 A;  1FHX A;  1WE7 A;  4AJY B;  2L2I A;  2GJY A;  3ODO A;  3WAM A;  5D3W A;  2KTF A;  4MM3 A;  2KO3 A;  3PT2 B;  2D4Q A;  2MBQ A;  2DX1 A;  2G3Q B;  4HLE A;  2LVQ A;  2LXC A;  5CTR C;  4DWF A;  5DH9 B;  2K39 A;  3A9K A;  2W2X D;  2MW5 A;  3CMM B;  4KZC A;  1TTN A;  2LWP A;  5HE1 A;  3TJP A;  4HAX B;  2BYE A;  1H4R A;  2CU1 A;  5JLJ B;  3FSS A;  2FIF A;  4GPT B;  2I5C A;  1A5R A;  2PJH A;  2MLB A;  2A5U A;  5KHQ A;  1DDV A;  2KNB A;  3A9K B;  3VOQ A;  2KWU B;  3NZS A;  1KM7 A;  4NJ7 A;  1U4A A;  2L7R A;  1M7E A;  3DBR I;  2Q13 A;  1Q67 A;  2LI5 A;  4GXB A;  3PVL A;  5TR5 A;  4NAW B;  2L0T A;  3U8Z A;  4HPL B;  4HXD A;  2JP2 A;  3SD5 A;  2N0Y A;  5FI1 A;  1P1A A;  4KIK B;  2ZCC A;  4DHZ B;  1X11 A;  2VKI A;  4NJ6 A;  3L16 A;  3GYO A;  4GMV A;  5AEK B;  3ODW A;  2N7D A;  2MBO A;  1V61 A;  1WXV A;  4B6H A;  2HE7 A;  2JRI B;  1RAX A;  1WF9 A;  2WDT B;  4GGQ A;  1EAZ A;  4HJK A;  3PHW B;  4E71 A;  1FHW A;  3A98 B;  5EFX A;  3B1L X;  4CO7 A;  1KZ7 A;  3V5W A;  2KX0 A;  3SO6 A;  1WE6 A;  3V62 A;  3LDZ E;  4W9F A;  1I42 A;  2BCJ A;  3RZW C;  2GBK A;  2RVB B;  2CY4 A;  5DI9 B;  2Z0P A;  1VD2 A;  3DBH I;  1XOD A;  1MIX A;  1X05 A;  4DDI D;  1ZM0 A;  2COA A;  1UNR A;  3UGB B;  2QHO A;  4II2 B;  1WGH A;  1IRS A;  5C5B A;  2VRR B;  1WYW B;  4WWP A;  2NZ8 B;  5JHG A;  2D9W A;  3N7C A;  2KJH B;  2QKM A;  3RZF A;  1YX5 B;  2DA0 A;  4FUL A;  1TXD A;  2OJR A;  2YVC A;  3PSE B;  3VUY A;  3VTU A;  1WFY A;  1XX0 A;  4FHK A;  4A6H A;  2UWQ A;  2Y8G A;  1WG7 A;  1M7R A;  5CHV C;  2M17 A;  2C7N B;  2DKP A;  3DXD A;  2L00 B;  4KAX B;  3IBE A;  3RYT A;  1F9J A;  5C5B B;  1V89 A;  3K9O B;  1ZVR A;  2JWZ A;  1E8W A;  3QX1 A;  4Z2N A;  4L6E A;  2CS4 A;  4B9K A;  4KDI C;  3OAW A;  4FJZ A;  2KFK A;  4IUM B;  2LUE A;  1OEY A;  2DYM A;  5D6J B;  2ZVO A;  2MP2 B;  2JPH A;  1LQB A;  2K8C A;  3D32 A;  4EKU A;  4MDK E;  2YS1 A;  3ZNH B;  1YJ1 A;  1LXD A;  1E7U A;  4DHZ E;  2K6D B;  2KXJ A;  1GC7 A;  3ZTC A;  1ISN A;  2WX1 A;  3OJ4 B;  1RRB A;  2MRP A;  4GU2 A;  3KY9 A;  1WJM A;  1EF5 A;  2KFK B;  1S3S G;  3QA8 A;  4HB2 B;  1FGY A;  1U5E A;  3HK0 A;  3ZO5 B;  3RCZ A;  3TBL D;  3JYU A;  3WIM A;  1P9D U;  4EZL A;  3AI5 A;  2WX0 A;  3P6A A;  1WM3 A;  4EZJ A;  4D0N B;  2W2W A;  3APC A;  3M3J A;  2E2X A;  2LZ6 A;  2MBE A;  3ALB A;  3W1S C;  2PPH A;  2ADZ A;  3VUX A;  3KRX A;  1K8R B;  5JHA A;  1KOT A;  3VTV A;  3VH3 B;  2Z59 B;  4KSK C;  3A4R A;  3V6E B;  3HM6 X;  4FJV B;  3DBL I;  1JRU A;  1ZC4 B;  4LJO B;  3QWM A;  3P7Z A;  1WGR A;  4GOC A;  4TUU A;  4K2P A;  3PVU A;  2L3Z A;  2N7E A;  2D10 A;  2OTX A;  1MAI A;  4IAP A;  3PP2 A;  3V6C B;  4KVG B;  4EJN A;  4HCN B;  1GJZ A;  1G6J A;  4A5K A;  3PGE A;  1V5T A;  2BKF A;  3ZVV A;  1EGX A;  4FA6 A;  1MPH A;  2ZJD A;  1UBI A;  5CX3 A;  4W9E A;  5D3V A;  3DVG Y;  1C3T A;  5LXI B;  5E6P A;  5DHF B;  2LYD A;  2FCQ A;  4WAA A;  3TIX A;  3N30 A;  2UZS A;  2AWT A;  1WXA A;  4NQK E;  3EEC A;  3WYF B;  2M38 A;  4MSM B;  3T9L A;  4BKS A;  3QHT A;  2LVO A;  2L76 A;  2K00 A;  3C0R B;  5CHF A;  4W9J A;  1UH6 A;  4BOZ B;  3T8M A;  2KWC A;  4BBK A;  2KQ7 A;  4MGY E;  5D3X A;  5E6O A;  1WJ1 A;  2HD5 B;  2ZZP B;  1DDM A;  3T06 A;  4NNJ B;  3I3T B;  2RLO A;  1QC6 A;  3GYP A;  2RPQ A;  5IA7 A;  1V86 A;  2IY1 B;  2LOZ A;  3DOW A;  5JH5 C;  3L10 B;  3WAP A;  4LJP B;  2DHI A;  5DPS A;  1MG8 A;  2AYO B;  1WGY A;  3TW1 A;  1FGZ A;  2C7M B;  4TV3 A;  3UF8 A;  4BBN C;  3VDZ A;  1TBE A;  2KCJ A;  2KC2 A;  2DAJ A;  5JZE B;  3H7P B;  1V5O A;  4I6P A;  3ZIM A;  3VXW A;  4NQL B;  3A4S C;  2KQS A;  2COD A;  3D8E A;  1WX9 A;  1XCG A;  4ZRI A;  1WMH A;  3DDC B;  1NDD A;  2MBB B;  2KWV B;  3NZU A;  2D9X A;  2GS0 A;  3PSC A;  2K25 A;  4G0N B;  1E5W A;  5C16 A;  5HE3 A;  2I1J A;  3AU4 A;  4M8N A;  4MY6 A;  1WIA A;  2RSU A;  5LXH A;  2MDX A;  3AU5 A;  2KUP A;  2L0F A;  1FOE A;  3A9J A;  3QWZ B;  4AJW A;  3NOB A;  2IFS A;  2YSZ A;  2ROV A;  2AL6 A;  2FID A;  1ZSQ A;  4A20 A;  1WMH B;  2JZZ A;  1ZW7 A;  3IG3 A;  1PMS A;  4G50 A;  2ZPY A;  4WJP A;  2J0J A;  2NBU A;  2R2Q A;  4HAY B;  2GBM A;  4TQ0 A;  4XC2 A;  4WQO B;  4WJO A;  4BOS C;  2D11 A;  3ZRF A;  4BKS D;  4A3P A;  2I5F A;  4GMX B;  5KCV A;  4HK2 A;  1GC6 A;  2NPT A;  4F8C B;  1SGH A;  3A9J B;  3PLU A;  1W1H A;  2J0M A;  2ZNV B;  1PQS A;  2HJ8 A;  1NI2 A;  4BVU C;  3O65 B;  3PZD A;  2MSE D;  4ICV A;  3MHS D;  4JL9 A;  1GG3 A;  2AL3 A;  1UEF A;  3SU8 X;  2Y5B B;  1U5G A;  2O2V A;  2YT1 A;  3H6N A;  3V61 A;  1TGZ B;  4CHJ A;  2FCS A;  4Y94 A;  3PRZ A;  2NPT B;  4IM2 A;  4E3C A;  2CAY A;  2KZR A;  2DYB A;  3P2B A;  4HDO A;  5HE0 A;  1FXT B;  2Z0E B;  2DZK A;  1TQZ A;  2DZJ A;  1WXM A;  4B95 A;  3SUZ A;  3WAO A;  4HWI B;  2XBB C;  2MQJ A;  1GNU A;  2OQB A;  1WGU A;  4W9D A;  4NPN A;  4KSL C;  2FCM A;  2YT0 A;  2LRW A;  4HDQ A;  2KOX A;  5J2R A;  2XEW A;  3SHQ A;  1U5F A;  1WGD A;  2KDF B;  4ZRK A;  3PLV A;  2BWF A;  4XX5 A;  1Z5S B;  4MT7 A;  2RSG A;  2GCJ A;  4E74 A;  2VRW B;  5J17 A;  5EDS A;  4LCD E;  2K2J A;  2R09 A;  3D8D A;  2ZPN A;  3LJ3 A;  2NR2 A;  3VFK A;  3PRM B;  2G4S A;  3PRE A;  2R2O A;  2O6V D;  5FR6 A;  2P0D A;  4HB0 B;  1OEY J;  4K7W A;  1MK9 B;  1DRO A;  3VUW A;  4TKN A;  1J8C A;  1KI1 B;  3TVV A;  2LD9 A;  5GMV A;  2DAF A;  2MCN B;  2BWE S;  2M0X A;  1WY8 A;  3QQ8 B;  2REX A;  2Y7B A;  3ZW3 A;  2CKH B;  2JT4 B;  4PS3 A;  1XKE A;  3R3M A;  2V4L A;  4EUT A;  2GOW A;  4HAZ B;  5G55 A;  3ULB A;  3ZLZ A;  2NCN A;  1OY2 A;  3KUD B;  2ZCB A;  3U30 A;  3AUL A;  4HB4 B;  2PE6 B;  3GOE A;  1SIF A;  4HAW B;  3N32 A;  4FAD A;  4WWN A;  2IO3 B;  1W1G A;  2D9Z A;  3ZUN A;  1XT9 B;  4HAT B;  5BO4 B;  3DCG A;  1V81 A;  1WJN A;  4HB3 B;  1NBF C;  2JZ3 B;  2JVC A;  3A1Q A;  3V60 A;  5C1Z A;  3PG7 A;  4F7G A;  2LKO A;  2EC1 A;  2P0H A;  2KX3 A;  5LLI A;  5D2M B;  1W1D A;  4ASW C;  4LDT B;  1CMX B;  1X1M A;  1YD8 U;  2IO1 B;  2KAN A;  1D3Z A;  1X86 A;  5KHO A;  2KMC A;  4MSQ B;  2GBR A;  3R66 C;  4YON A;  2D3G A;  3M95 A;  4PQ0 A;  2BKR B;  3RT3 B;  1L7Y A;  3A1Q B;  1WX7 A;  3ZRC A;  3MJW A;  4FJY A;  3HW2 B;  4EOY A;  4WSF A;  4PNK A;  1WX8 A;  3APF A;  3HIZ A;  2JXX A;  3ODX A;  1U27 A;  4JGH B;  3ZNZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...