4GMXB

Crystal structure of kpt185 in complex with crm1-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
TMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibitors of nuclear export show that CRM1/XPO1 is a target in chronic lymphocytic leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
molecule keywords GTP-binding nuclear protein Ran
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gmxB00
2W2XC 1J19A 3A8PA 1E5WA 1FGZA 1UNQA 1XKEA 2Z0OA 3KRWA 2N23A 1V88A 1EGXA 1SHCA 2DKQA 2YT1A 1I2HA 3DXCA 1FHOA 1U29A 4Z2NA 4A6FA 4DXAB 3DXEA 4C0AA 1KZ7A 1QC6A 4H8SA 4K17A 2D10A 5HE2A 4B6HA 1AWEA 2MDXA 5CLQB 3ODOA 4L6EA 4A5KA 1ZC3B 1ZSQA 2COCA 1UNRA 1U5EA 3CXBB 2YRYA 1EVHA 3D8DA 3F5RA 4GMVA 2FJLA 4XWXA 1FHWA 1NTYA 1U5DA 2RUKB 5D3WA 3PEGA 2I1KA 3UZTA 1X05A 4HDQA 3ML4A 2RSGA 3X23A 1Z87A 2H7EA 2DLWA 4HB0B 2EC1A 1BTNA 1TQZA 1ISNA 3GYPA 3F0WA 2EMSA 4HB4B 1ZVRA 3OANA 1H4RA 3GYOA 3N7CA 3KSYA 2OTXA 5DI9B 5HE1A 1DDVA 5LOPB 1LW3A 4MY6A 3KRXA 2DYNA 2RGNB 3PVLA 4PNKA 5D3VA 1QQGA 2I5FA 4WSFA 2DYQA 2RVBB 2YSZA 3NSUA 5KQ4A 1DDMA 2AEHA 2W2WA 2CRFA 2GCJA 2UZSA 4KVGB 3SV1A 5JP4A 3AU5A 4HAXB 2GCLA 4EKUA 2MFQA 1XX0A 1UEFA 4WJ7A 2LOZA 3AU4A 3IVFA 2KCJA 1DYNA 3QIJA 4GXBA 3PVUA 2Z0PA 4HB2B 2N0YA 1MPHA 4HDOA 2OQBA 3U8ZA 1GG3A 4IFSA 2BCJA 3KZ1A 2MWNB 2UZRA 2V76A 2YS3A 1IRSA 4GMXB 5DHAB 4CHMA 5FI1A 5C16A 1X11A 2LULA 2PZ1A 1BAKA 1KZGA 4KHOA 2UVMA 1EF1A 1V61A 4A6FB 4ZRIA 3WA0A 2P0DA 3LJUX 3PSCA 2J59M 1H10A 1P3RA 1U5FA 2D2QA 4DX8A 1X1GA 3A98B 2J0MA 1XCGA 5L81A 4Z2MB 4HAUB 1P5TA 1MAIA 2G35A 1WGQA 3P6AA 1MIZB 2D9XA 1DDWA 3D8EA 1Y19B 2D9ZA 2L2IA 1NU2A 1DBHA 1BWNA 1WGUA 3FM8C 3ULBA 4GN1A 2HE7A 3ULCA 3SUZA 1U2BA 2CAYA 3ZVRA 2LG1A 1TXDA 5KCVA 2J0KA 3FEHA 2ZPYA 3FSSA 1W1HA 5J3QA 1ZM0A 1P6SA 3TCAA 1U5GA 3O96A 2QKLA 2P0HA 5DIFB 2DN6A 4CHJA 2GS0A 2LKOA 2Z0QA 4F7GA 5J3YA 1GC6A 4NY0A 5HE0A 5CLLB 3MPXA 1OMWA 5JHGA 4KHBB 1MK7B 1Y5OA 1Q67A 4K81A 4BBKA 5JHHA 5DHFB 1W1GA 2DTCA 2M14A 3V5WA 3ZDTA 5HE3A 2Q13A 2LYDA 1K5DB 3U7DA 5FI0A 2P0FA 3A8QA 1V5PA 2IYBA 2RLOA 2ROVA 4CYEA 2DA0A 3TFMA 4PQ0A 2QKMA 1DROA 2EMTA 1X1FA 1KI1B 4WVFB 2L1CA 1MK9B 2D4QA 2Y8GA 2DHIA 2LOXA 2XQNM 1AQCA 2Y7BA 2KUPA 3PZDA 5D3XA 3G9WA 2YVCA 2ELBA 5C6RA 2JP2A 1OQNA 4NSWA 1XODA 2HTHB 2DX1A 3MDBC 1FHXA 4A6KA 1U27A 3HW2B 4K2OA 1V89A 4HAVB 1B55A 4P7IA 1RJ2A 4DX90 3AJ4A 1I7AA 1MKEA 1BTKA 1FB8A 2I1JA 3RCPA 2CODA 4HAYB 4IOYX 2VRWB 1PFJA 5C5BA 1WVHA 1X86A 3ODXA 5DH9B 4HB3B 5LONB 1GC7A 2GJYA 2D9VA 4YONA 1FOEA 4KHAA 5GOWB 1UPRA 3SO6A 5C5BB 2R09A 2P8VA 3DXDA 2VKIA 2CY4A 2YS5A 2K2JA 1PMSA 4Y94A 3VIAA 4EMOA 4DBBA 2COFA 3BINA 1M7RA 4HAWB 4F7UP 2YT0A 2KGXB 5KQ1A 1W1DA 4GZUA 2NZ8B 4MK0A 3D8FA 3TVVA 5D3YA 2ELAA 1FAOA 4A6HA 2D11A 2X18A 5JLJB 4IAPA 1J0WA 2YF0A 2IFSA 4ZRJA 2DHKA 2YS1A 2D9YA 1PLSA 1V5UA 2DFKA 3TO1A 1MIXA 2VSZA 3P7ZA 2K2UA 1N3HA 1WJ1A 2K00A 4K2PA 2DHJA 3QWMA 3T06A 3PG7A 1UPQA 4TYZA 2DKPA 2ADZA 2H7DA 4MT7A 5J3TA 1RRPB 5C79A 1M7EA 1K5GB 3BJIA 3ODWA 2CY5A 1WJMA 4HATB 3PVWA 1EAZA 2RNRB 2Y8FA 1WI1A 4HHVA 3PP2A 1XR0B 2J0JA 4D0NB 4GPTB 1SGHA 1NTVA 1WG7A 3HK0A 3SNHA 2W2XD 5EFXA 3CIKA 2NMBA 3QBVB 3KY9A 4YL8A 1OY2A 1ZC4B 3TW1A 4HAZB 3HQCA 1UNPA 1XD4A 2ROZB 2I5CA 2M38A 2D9WA 1FGYA 2AL6A 1V5MA 3M1IB 5D27A 2E2XA 4F7HA 1TJ6A 3WYFB 2R0DA 4KAXB 4ZRKA 2COAA 1NI2A 2MKRA 4TKNA 3SYXA 1LB1A 4EJNA 2EJ8A 2DX5A 3VOQA
chains in the Genus database with same CATH superfamily
4D6WA 5I2MA 2W2XC 1J19A 3A8PA 1E5WA 1FGZA 1UNQA 1XKEA 2Z0OA 3KRWA 2N23A 1V88A 1EGXA 1SHCA 2DKQA 2YT1A 1I2HA 3DXCA 1FHOA 1T77A 1U29A 4Z2NA 4A6FA 4DXAB 3DXEA 4C0AA 1KZ7A 1QC6A 4H8SA 4K17A 2D10A 5HE2A 4B6HA 1AWEA 2MDXA 4QXAB 5CLQB 3ODOA 4L6EA 4A5KA 1ZC3B 1ZSQA 2COCA 1UNRA 1U5EA 3CXBB 2YRYA 1EVHA 3D8DA 3F5RA 3NW8A 4GMVA 2FJLA 4XWXA 1FHWA 1NTYA 1U5DA 2RUKB 4GNKB 5D3WA 3PEGA 2I1KA 3UZTA 1X05A 4HDQA 3ML4A 2RSGA 3X23A 1Z87A 2H7EA 2DLWA 2EC1A 4HB0B 1BTNA 1TQZA 1ISNA 3GYPA 3F0WA 2EMSA 1ZVRA 3OANA 4HB4B 1H4RA 2Z13A 3GYOA 3N7CA 3KSYA 5IRSA 2OTXA 5DI9B 5HE1A 1DDVA 5LOPB 1LW3A 4MY6A 2FJUB 3KRXA 2DYNA 2RGNB 3PVLA 4PNKA 5D3VA 1QQGA 2I5FA 4WSFA 2DYQA 2RVBB 2YSZA 3NSUA 5KQ4A 1DDMA 2AEHA 2W2WA 2CRFA 2GCJA 2UZSA 4KVGB 3SV1A 5JP4A 3AU5A 4GOUA 4HAXB 2GCLA 4CSQA 4EKUA 2MFQA 3A58A 1XX0A 1UEFA 4WJ7A 2LOZA 3AU4A 3IVFA 2KCJA 1DYNA 3QIJA 4GXBA 3PVUA 2Z0PA 3U12A 4HB2B 2N0YA 1MPHA 4QJ3B 4HDOA 2OQBA 2R2YA 3U8ZA 1GG3A 4IFSA 2BCJA 3KZ1A 2MWNB 2UZRA 2V76A 2YS3A 1IRSA 4GMXB 5DHAB 4CHMA 5FI1A 5C16A 1X11A 2LULA 2PZ1A 1BAKA 1KZGA 4KHOA 2UVMA 1EF1A 1V61A 4A6FB 4ZRIA 3WA0A 4L1RA 2P0DA 3LJUX 3PSCA 1ZYIA 2J59M 3NWAA 1H10A 1P3RA 1U5FA 2D2QA 4DX8A 1X1GA 3A98B 2J0MA 1XCGA 5L81A 4Z2MB 4HAUB 1P5TA 1MAIA 2G35A 1WGQA 3P6AA 1MIZB 2D9XA 1DDWA 3D8EA 1Y19B 2D9ZA 2L2IA 1NU2A 1DBHA 1BWNA 2GUMA 1WGUA 3NWFA 3FM8C 3ULBA 4GN1A 2HE7A 3ULCA 4OT1A 3SUZA 1U2BA 2CAYA 3ZVRA 2LG1A 1TXDA 5KCVA 2J0KA 3FEHA 2ZPYA 3FSSA 1W1HA 1MI1A 5J3QA 1ZM0A 1P6SA 3TCAA 1U5GA 3O96A 2QKLA 2P0HA 5DIFB 2DN6A 4CHJA 2GS0A 2LKOA 2Z0QA 4F7GA 5J3YA 1GC6A 4NY0A 5HE0A 5CLLB 3MPXA 1OMWA 5JHGA 4KHBB 1MK7B 1Y5OA 1Q67A 4K81A 4BBKA 5JHHA 5DHFB 1W1GA 2DTCA 2M14A 3V5WA 3ZDTA 5HE3A 2Q13A 2NBVA 2LYDA 1K5DB 3U7DA 5FI0A 2P0FA 3A8QA 1V5PA 2IYBA 2RLOA 2ROVA 2YT2A 4CYEA 2DA0A 3TFMA 4PQ0A 2QKMA 1DROA 3HSAA 2EMTA 1X1FA 1KI1B 4WVFB 2L1CA 1MK9B 2D4QA 3HIEA 2Y8GA 2K49A 2DHIA 2LOXA 2XQNM 5I2SA 1AQCA 2Y7BA 2KUPA 3PZDA 5D3XA 3G9WA 2YVCA 2ELBA 5C6RA 2JP2A 1OQNA 4NSWA 3NWDA 1XODA 2HTHB 2DX1A 3MDBC 1FHXA 4A6KA 2ZKMX 1U27A 3HW2B 4K2OA 1V89A 4HAVB 1B55A 4P7IA 1RJ2A 4HSIA 4DX90 3AJ4A 1I7AA 1MKEA 1BTKA 1FB8A 2I1JA 3RCPA 2CODA 4HAYB 4IOYX 2VRWB 1PFJA 5C5BA 1WVHA 1X86A 3ODXA 5DH9B 4HB3B 5LONB 1GC7A 2GJYA 2KIGA 2D9VA 2KIEA 4YONA 1FOEA 4KHAA 5GOWB 1UPRA 3SO6A 5C5BB 2R09A 2P8VA 3DXDA 2VKIA 2CY4A 2YS5A 2K2JA 1PMSA 4Y94A 3VIAA 4EMOA 2RRFA 4DBBA 2COFA 3BINA 1M7RA 4HAWB 4F7UP 2YT0A 2KGXB 5KQ1A 4DIXA 1W1DA 4GZUA 2NZ8B 4MK0A 3D8FA 3TVVA 5D3YA 2Z4DA 2ELAA 1FAOA 2K8EA 4A6HA 2D11A 2X18A 5JLJB 4IAPA 1J0WA 2YF0A 2IFSA 4ZRJA 2DHKA 2KUQA 2YS1A 2D9YA 1PLSA 1V5UA 2DFKA 3TO1A 1MIXA 3B77A 5LG4B 5M4YB 2VSZA 3P7ZA 2K2UA 1N3HA 1WJ1A 2K00A 4K2PA 2DHJA 3QWMA 3T06A 3PG7A 1UPQA 2Z59A 2KR0A 4TYZA 2DKPA 2ADZA 2H7DA 3OHMB 4MT7A 5J3TA 1RRPB 5C79A 1M7EA 1K5GB 3BJIA 3ODWA 2CY5A 1WJMA 4HATB 3PVWA 1EAZA 2RNRB 2Y8FA 1WI1A 4HHVA 3PP2A 1XR0B 2J0JA 2Z14A 4D0NB 4GPTB 1SGHA 1NTVA 1WG7A 3HK0A 3SNHA 2W2XD 3FVCA 5EFXA 3CIKA 2NMBA 3QBVB 3KY9A 4YL8A 1OY2A 1ZC4B 3DCXA 3TW1A 4HAZB 3HQCA 1UNPA 1XD4A 2ROZB 4QJ4B 2I5CA 2M38A 2D9WA 4KHBA 1FGYA 2AL6A 1V5MA 3M1IB 5D27A 2E2XA 4F7HA 4QJ5B 4OSNA 1TJ6A 3WYFB 2R0DA 4KAXB 4ZRKA 2COAA 1NI2A 2MKRA 4TKNA 3SYXA 1LB1A 4EJNA 2EJ8A 2DX5A 3VOQA
chains in the Genus database with same CATH topology
2W2XC 1J19A 3A8PA 1E5WA 1FGZA 1UNQA 1XKEA 2Z0OA 3KRWA 2N23A 1V88A 1EGXA 1SHCA 2DKQA 2YT1A 1I2HA 3DXCA 1FHOA 1U29A 4Z2NA 4A6FA 4DXAB 3DXEA 4C0AA 1KZ7A 1QC6A 4H8SA 4K17A 2D10A 5HE2A 4B6HA 1AWEA 2MDXA 5CLQB 3ODOA 4L6EA 4A5KA 1ZC3B 1ZSQA 2COCA 1UNRA 1U5EA 3CXBB 2YRYA 1EVHA 3D8DA 3F5RA 4GMVA 2FJLA 4XWXA 1FHWA 1NTYA 1U5DA 2RUKB 5D3WA 3PEGA 2I1KA 3UZTA 1X05A 4HDQA 3ML4A 2RSGA 3X23A 1Z87A 2H7EA 2DLWA 4HB0B 2EC1A 1BTNA 1TQZA 1ISNA 3GYPA 3F0WA 2EMSA 4HB4B 1ZVRA 3OANA 1H4RA 3GYOA 3N7CA 3KSYA 2OTXA 5DI9B 5HE1A 1DDVA 5LOPB 1LW3A 4MY6A 3KRXA 2DYNA 2RGNB 3PVLA 4PNKA 5D3VA 1QQGA 2I5FA 4WSFA 2DYQA 2RVBB 2YSZA 3NSUA 5KQ4A 1DDMA 2AEHA 2W2WA 2CRFA 2GCJA 2UZSA 4KVGB 3SV1A 5JP4A 3AU5A 4HAXB 2GCLA 4EKUA 2MFQA 1XX0A 1UEFA 4WJ7A 2LOZA 3AU4A 3IVFA 2KCJA 1DYNA 3QIJA 4GXBA 3PVUA 2Z0PA 4HB2B 2N0YA 1MPHA 4HDOA 2OQBA 3U8ZA 1GG3A 4IFSA 2BCJA 3KZ1A 2MWNB 2UZRA 2V76A 2YS3A 1IRSA 4GMXB 5DHAB 4CHMA 5FI1A 5C16A 1X11A 2LULA 2PZ1A 1BAKA 1KZGA 4KHOA 2UVMA 1EF1A 1V61A 4A6FB 4ZRIA 3WA0A 2P0DA 3LJUX 3PSCA 2J59M 1H10A 1P3RA 1U5FA 2D2QA 4DX8A 1X1GA 3A98B 2J0MA 1XCGA 5L81A 4Z2MB 4HAUB 1P5TA 1MAIA 2G35A 1WGQA 3P6AA 1MIZB 2D9XA 1DDWA 3D8EA 1Y19B 2D9ZA 2L2IA 1NU2A 1DBHA 1BWNA 1WGUA 3FM8C 3ULBA 4GN1A 2HE7A 3ULCA 3SUZA 1U2BA 2CAYA 3ZVRA 2LG1A 1TXDA 5KCVA 2J0KA 3FEHA 2ZPYA 3FSSA 1W1HA 5J3QA 1ZM0A 1P6SA 3TCAA 1U5GA 3O96A 2QKLA 2P0HA 5DIFB 2DN6A 4CHJA 2GS0A 2LKOA 2Z0QA 4F7GA 5J3YA 1GC6A 4NY0A 5HE0A 5CLLB 3MPXA 1OMWA 5JHGA 4KHBB 1MK7B 1Y5OA 1Q67A 4K81A 4BBKA 5JHHA 5DHFB 1W1GA 2DTCA 2M14A 3V5WA 3ZDTA 5HE3A 2Q13A 2LYDA 1K5DB 3U7DA 5FI0A 2P0FA 3A8QA 1V5PA 2IYBA 2RLOA 2ROVA 4CYEA 2DA0A 3TFMA 4PQ0A 2QKMA 1DROA 2EMTA 1X1FA 1KI1B 4WVFB 2L1CA 1MK9B 2D4QA 2Y8GA 2DHIA 2LOXA 2XQNM 1AQCA 2Y7BA 2KUPA 3PZDA 5D3XA 3G9WA 2YVCA 2ELBA 5C6RA 2JP2A 1OQNA 4NSWA 1XODA 2HTHB 2DX1A 3MDBC 1FHXA 4A6KA 1U27A 3HW2B 4K2OA 1V89A 4HAVB 1B55A 4P7IA 1RJ2A 4DX90 3AJ4A 1I7AA 1MKEA 1BTKA 1FB8A 2I1JA 3RCPA 2CODA 4HAYB 4IOYX 2VRWB 1PFJA 5C5BA 1WVHA 1X86A 3ODXA 5DH9B 4HB3B 5LONB 1GC7A 2GJYA 2D9VA 4YONA 1FOEA 4KHAA 5GOWB 1UPRA 3SO6A 5C5BB 2R09A 2P8VA 3DXDA 2VKIA 2CY4A 2YS5A 2K2JA 1PMSA 4Y94A 3VIAA 4EMOA 4DBBA 2COFA 3BINA 1M7RA 4HAWB 4F7UP 2YT0A 2KGXB 5KQ1A 1W1DA 4GZUA 2NZ8B 4MK0A 3D8FA 3TVVA 5D3YA 2ELAA 1FAOA 4A6HA 2D11A 2X18A 5JLJB 4IAPA 1J0WA 2YF0A 2IFSA 4ZRJA 2DHKA 2YS1A 2D9YA 1PLSA 1V5UA 2DFKA 3TO1A 1MIXA 2VSZA 3P7ZA 2K2UA 1N3HA 1WJ1A 2K00A 4K2PA 2DHJA 3QWMA 3T06A 3PG7A 1UPQA 4TYZA 2DKPA 2ADZA 2H7DA 4MT7A 5J3TA 1RRPB 5C79A 1M7EA 1K5GB 3BJIA 3ODWA 2CY5A 1WJMA 4HATB 3PVWA 1EAZA 2RNRB 2Y8FA 1WI1A 4HHVA 3PP2A 1XR0B 2J0JA 4D0NB 4GPTB 1SGHA 1NTVA 1WG7A 3HK0A 3SNHA 2W2XD 5EFXA 3CIKA 2NMBA 3QBVB 3KY9A 4YL8A 1OY2A 1ZC4B 3TW1A 4HAZB 3HQCA 1UNPA 1XD4A 2ROZB 2I5CA 2M38A 2D9WA 1FGYA 2AL6A 1V5MA 3M1IB 5D27A 2E2XA 4F7HA 1TJ6A 3WYFB 2R0DA 4KAXB 4ZRKA 2COAA 1NI2A 2MKRA 4TKNA 3SYXA 1LB1A 4EJNA 2EJ8A 2DX5A 3VOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2X C;  1J19 A;  3A8P A;  1E5W A;  1FGZ A;  1UNQ A;  1XKE A;  2Z0O A;  3KRW A;  2N23 A;  1V88 A;  1EGX A;  1SHC A;  2DKQ A;  2YT1 A;  1I2H A;  3DXC A;  1FHO A;  1U29 A;  4Z2N A;  4A6F A;  4DXA B;  3DXE A;  4C0A A;  1KZ7 A;  1QC6 A;  4H8S A;  4K17 A;  2D10 A;  5HE2 A;  4B6H A;  1AWE A;  2MDX A;  5CLQ B;  3ODO A;  4L6E A;  4A5K A;  1ZC3 B;  1ZSQ A;  2COC A;  1UNR A;  1U5E A;  3CXB B;  2YRY A;  1EVH A;  3D8D A;  3F5R A;  4GMV A;  2FJL A;  4XWX A;  1FHW A;  1NTY A;  1U5D A;  2RUK B;  5D3W A;  3PEG A;  2I1K A;  3UZT A;  1X05 A;  4HDQ A;  3ML4 A;  2RSG A;  3X23 A;  1Z87 A;  2H7E A;  2DLW A;  4HB0 B;  2EC1 A;  1BTN A;  1TQZ A;  1ISN A;  3GYP A;  3F0W A;  2EMS A;  4HB4 B;  1ZVR A;  3OAN A;  1H4R A;  3GYO A;  3N7C A;  3KSY A;  2OTX A;  5DI9 B;  5HE1 A;  1DDV A;  5LOP B;  1LW3 A;  4MY6 A;  3KRX A;  2DYN A;  2RGN B;  3PVL A;  4PNK A;  5D3V A;  1QQG A;  2I5F A;  4WSF A;  2DYQ A;  2RVB B;  2YSZ A;  3NSU A;  5KQ4 A;  1DDM A;  2AEH A;  2W2W A;  2CRF A;  2GCJ A;  2UZS A;  4KVG B;  3SV1 A;  5JP4 A;  3AU5 A;  4HAX B;  2GCL A;  4EKU A;  2MFQ A;  1XX0 A;  1UEF A;  4WJ7 A;  2LOZ A;  3AU4 A;  3IVF A;  2KCJ A;  1DYN A;  3QIJ A;  4GXB A;  3PVU A;  2Z0P A;  4HB2 B;  2N0Y A;  1MPH A;  4HDO A;  2OQB A;  3U8Z A;  1GG3 A;  4IFS A;  2BCJ A;  3KZ1 A;  2MWN B;  2UZR A;  2V76 A;  2YS3 A;  1IRS A;  4GMX B;  5DHA B;  4CHM A;  5FI1 A;  5C16 A;  1X11 A;  2LUL A;  2PZ1 A;  1BAK A;  1KZG A;  4KHO A;  2UVM A;  1EF1 A;  1V61 A;  4A6F B;  4ZRI A;  3WA0 A;  2P0D A;  3LJU X;  3PSC A;  2J59 M;  1H10 A;  1P3R A;  1U5F A;  2D2Q A;  4DX8 A;  1X1G A;  3A98 B;  2J0M A;  1XCG A;  5L81 A;  4Z2M B;  4HAU B;  1P5T A;  1MAI A;  2G35 A;  1WGQ A;  3P6A A;  1MIZ B;  2D9X A;  1DDW A;  3D8E A;  1Y19 B;  2D9Z A;  2L2I A;  1NU2 A;  1DBH A;  1BWN A;  1WGU A;  3FM8 C;  3ULB A;  4GN1 A;  2HE7 A;  3ULC A;  3SUZ A;  1U2B A;  2CAY A;  3ZVR A;  2LG1 A;  1TXD A;  5KCV A;  2J0K A;  3FEH A;  2ZPY A;  3FSS A;  1W1H A;  5J3Q A;  1ZM0 A;  1P6S A;  3TCA A;  1U5G A;  3O96 A;  2QKL A;  2P0H A;  5DIF B;  2DN6 A;  4CHJ A;  2GS0 A;  2LKO A;  2Z0Q A;  4F7G A;  5J3Y A;  1GC6 A;  4NY0 A;  5HE0 A;  5CLL B;  3MPX A;  1OMW A;  5JHG A;  4KHB B;  1MK7 B;  1Y5O A;  1Q67 A;  4K81 A;  4BBK A;  5JHH A;  5DHF B;  1W1G A;  2DTC A;  2M14 A;  3V5W A;  3ZDT A;  5HE3 A;  2Q13 A;  2LYD A;  1K5D B;  3U7D A;  5FI0 A;  2P0F A;  3A8Q A;  1V5P A;  2IYB A;  2RLO A;  2ROV A;  4CYE A;  2DA0 A;  3TFM A;  4PQ0 A;  2QKM A;  1DRO A;  2EMT A;  1X1F A;  1KI1 B;  4WVF B;  2L1C A;  1MK9 B;  2D4Q A;  2Y8G A;  2DHI A;  2LOX A;  2XQN M;  1AQC A;  2Y7B A;  2KUP A;  3PZD A;  5D3X A;  3G9W A;  2YVC A;  2ELB A;  5C6R A;  2JP2 A;  1OQN A;  4NSW A;  1XOD A;  2HTH B;  2DX1 A;  3MDB C;  1FHX A;  4A6K A;  1U27 A;  3HW2 B;  4K2O A;  1V89 A;  4HAV B;  1B55 A;  4P7I A;  1RJ2 A;  4DX9 0;  3AJ4 A;  1I7A A;  1MKE A;  1BTK A;  1FB8 A;  2I1J A;  3RCP A;  2COD A;  4HAY B;  4IOY X;  2VRW B;  1PFJ A;  5C5B A;  1WVH A;  1X86 A;  3ODX A;  5DH9 B;  4HB3 B;  5LON B;  1GC7 A;  2GJY A;  2D9V A;  4YON A;  1FOE A;  4KHA A;  5GOW B;  1UPR A;  3SO6 A;  5C5B B;  2R09 A;  2P8V A;  3DXD A;  2VKI A;  2CY4 A;  2YS5 A;  2K2J A;  1PMS A;  4Y94 A;  3VIA A;  4EMO A;  4DBB A;  2COF A;  3BIN A;  1M7R A;  4HAW B;  4F7U P;  2YT0 A;  2KGX B;  5KQ1 A;  1W1D A;  4GZU A;  2NZ8 B;  4MK0 A;  3D8F A;  3TVV A;  5D3Y A;  2ELA A;  1FAO A;  4A6H A;  2D11 A;  2X18 A;  5JLJ B;  4IAP A;  1J0W A;  2YF0 A;  2IFS A;  4ZRJ A;  2DHK A;  2YS1 A;  2D9Y A;  1PLS A;  1V5U A;  2DFK A;  3TO1 A;  1MIX A;  2VSZ A;  3P7Z A;  2K2U A;  1N3H A;  1WJ1 A;  2K00 A;  4K2P A;  2DHJ A;  3QWM A;  3T06 A;  3PG7 A;  1UPQ A;  4TYZ A;  2DKP A;  2ADZ A;  2H7D A;  4MT7 A;  5J3T A;  1RRP B;  5C79 A;  1M7E A;  1K5G B;  3BJI A;  3ODW A;  2CY5 A;  1WJM A;  4HAT B;  3PVW A;  1EAZ A;  2RNR B;  2Y8F A;  1WI1 A;  4HHV A;  3PP2 A;  1XR0 B;  2J0J A;  4D0N B;  4GPT B;  1SGH A;  1NTV A;  1WG7 A;  3HK0 A;  3SNH A;  2W2X D;  5EFX A;  3CIK A;  2NMB A;  3QBV B;  3KY9 A;  4YL8 A;  1OY2 A;  1ZC4 B;  3TW1 A;  4HAZ B;  3HQC A;  1UNP A;  1XD4 A;  2ROZ B;  2I5C A;  2M38 A;  2D9W A;  1FGY A;  2AL6 A;  1V5M A;  3M1I B;  5D27 A;  2E2X A;  4F7H A;  1TJ6 A;  3WYF B;  2R0D A;  4KAX B;  4ZRK A;  2COA A;  1NI2 A;  2MKR A;  4TKN A;  3SYX A;  1LB1 A;  4EJN A;  2EJ8 A;  2DX5 A;  3VOQ A; 
#chains in the Genus database with same CATH topology
 4D6W A;  5I2M A;  2W2X C;  1J19 A;  3A8P A;  1E5W A;  1FGZ A;  1UNQ A;  1XKE A;  2Z0O A;  3KRW A;  2N23 A;  1V88 A;  1EGX A;  1SHC A;  2DKQ A;  2YT1 A;  1I2H A;  3DXC A;  1FHO A;  1T77 A;  1U29 A;  4Z2N A;  4A6F A;  4DXA B;  3DXE A;  4C0A A;  1KZ7 A;  1QC6 A;  4H8S A;  4K17 A;  2D10 A;  5HE2 A;  4B6H A;  1AWE A;  2MDX A;  4QXA B;  5CLQ B;  3ODO A;  4L6E A;  4A5K A;  1ZC3 B;  1ZSQ A;  2COC A;  1UNR A;  1U5E A;  3CXB B;  2YRY A;  1EVH A;  3D8D A;  3F5R A;  3NW8 A;  4GMV A;  2FJL A;  4XWX A;  1FHW A;  1NTY A;  1U5D A;  2RUK B;  4GNK B;  5D3W A;  3PEG A;  2I1K A;  3UZT A;  1X05 A;  4HDQ A;  3ML4 A;  2RSG A;  3X23 A;  1Z87 A;  2H7E A;  2DLW A;  2EC1 A;  4HB0 B;  1BTN A;  1TQZ A;  1ISN A;  3GYP A;  3F0W A;  2EMS A;  1ZVR A;  3OAN A;  4HB4 B;  1H4R A;  2Z13 A;  3GYO A;  3N7C A;  3KSY A;  5IRS A;  2OTX A;  5DI9 B;  5HE1 A;  1DDV A;  5LOP B;  1LW3 A;  4MY6 A;  2FJU B;  3KRX A;  2DYN A;  2RGN B;  3PVL A;  4PNK A;  5D3V A;  1QQG A;  2I5F A;  4WSF A;  2DYQ A;  2RVB B;  2YSZ A;  3NSU A;  5KQ4 A;  1DDM A;  2AEH A;  2W2W A;  2CRF A;  2GCJ A;  2UZS A;  4KVG B;  3SV1 A;  5JP4 A;  3AU5 A;  4GOU A;  4HAX B;  2GCL A;  4CSQ A;  4EKU A;  2MFQ A;  3A58 A;  1XX0 A;  1UEF A;  4WJ7 A;  2LOZ A;  3AU4 A;  3IVF A;  2KCJ A;  1DYN A;  3QIJ A;  4GXB A;  3PVU A;  2Z0P A;  3U12 A;  4HB2 B;  2N0Y A;  1MPH A;  4QJ3 B;  4HDO A;  2OQB A;  2R2Y A;  3U8Z A;  1GG3 A;  4IFS A;  2BCJ A;  3KZ1 A;  2MWN B;  2UZR A;  2V76 A;  2YS3 A;  1IRS A;  4GMX B;  5DHA B;  4CHM A;  5FI1 A;  5C16 A;  1X11 A;  2LUL A;  2PZ1 A;  1BAK A;  1KZG A;  4KHO A;  2UVM A;  1EF1 A;  1V61 A;  4A6F B;  4ZRI A;  3WA0 A;  4L1R A;  2P0D A;  3LJU X;  3PSC A;  1ZYI A;  2J59 M;  3NWA A;  1H10 A;  1P3R A;  1U5F A;  2D2Q A;  4DX8 A;  1X1G A;  3A98 B;  2J0M A;  1XCG A;  5L81 A;  4Z2M B;  4HAU B;  1P5T A;  1MAI A;  2G35 A;  1WGQ A;  3P6A A;  1MIZ B;  2D9X A;  1DDW A;  3D8E A;  1Y19 B;  2D9Z A;  2L2I A;  1NU2 A;  1DBH A;  1BWN A;  2GUM A;  1WGU A;  3NWF A;  3FM8 C;  3ULB A;  4GN1 A;  2HE7 A;  3ULC A;  4OT1 A;  3SUZ A;  1U2B A;  2CAY A;  3ZVR A;  2LG1 A;  1TXD A;  5KCV A;  2J0K A;  3FEH A;  2ZPY A;  3FSS A;  1W1H A;  1MI1 A;  5J3Q A;  1ZM0 A;  1P6S A;  3TCA A;  1U5G A;  3O96 A;  2QKL A;  2P0H A;  5DIF B;  2DN6 A;  4CHJ A;  2GS0 A;  2LKO A;  2Z0Q A;  4F7G A;  5J3Y A;  1GC6 A;  4NY0 A;  5HE0 A;  5CLL B;  3MPX A;  1OMW A;  5JHG A;  4KHB B;  1MK7 B;  1Y5O A;  1Q67 A;  4K81 A;  4BBK A;  5JHH A;  5DHF B;  1W1G A;  2DTC A;  2M14 A;  3V5W A;  3ZDT A;  5HE3 A;  2Q13 A;  2NBV A;  2LYD A;  1K5D B;  3U7D A;  5FI0 A;  2P0F A;  3A8Q A;  1V5P A;  2IYB A;  2RLO A;  2ROV A;  2YT2 A;  4CYE A;  2DA0 A;  3TFM A;  4PQ0 A;  2QKM A;  1DRO A;  3HSA A;  2EMT A;  1X1F A;  1KI1 B;  4WVF B;  2L1C A;  1MK9 B;  2D4Q A;  3HIE A;  2Y8G A;  2K49 A;  2DHI A;  2LOX A;  2XQN M;  5I2S A;  1AQC A;  2Y7B A;  2KUP A;  3PZD A;  5D3X A;  3G9W A;  2YVC A;  2ELB A;  5C6R A;  2JP2 A;  1OQN A;  4NSW A;  3NWD A;  1XOD A;  2HTH B;  2DX1 A;  3MDB C;  1FHX A;  4A6K A;  2ZKM X;  1U27 A;  3HW2 B;  4K2O A;  1V89 A;  4HAV B;  1B55 A;  4P7I A;  1RJ2 A;  4HSI A;  4DX9 0;  3AJ4 A;  1I7A A;  1MKE A;  1BTK A;  1FB8 A;  2I1J A;  3RCP A;  2COD A;  4HAY B;  4IOY X;  2VRW B;  1PFJ A;  5C5B A;  1WVH A;  1X86 A;  3ODX A;  5DH9 B;  4HB3 B;  5LON B;  1GC7 A;  2GJY A;  2KIG A;  2D9V A;  2KIE A;  4YON A;  1FOE A;  4KHA A;  5GOW B;  1UPR A;  3SO6 A;  5C5B B;  2R09 A;  2P8V A;  3DXD A;  2VKI A;  2CY4 A;  2YS5 A;  2K2J A;  1PMS A;  4Y94 A;  3VIA A;  4EMO A;  2RRF A;  4DBB A;  2COF A;  3BIN A;  1M7R A;  4HAW B;  4F7U P;  2YT0 A;  2KGX B;  5KQ1 A;  4DIX A;  1W1D A;  4GZU A;  2NZ8 B;  4MK0 A;  3D8F A;  3TVV A;  5D3Y A;  2Z4D A;  2ELA A;  1FAO A;  2K8E A;  4A6H A;  2D11 A;  2X18 A;  5JLJ B;  4IAP A;  1J0W A;  2YF0 A;  2IFS A;  4ZRJ A;  2DHK A;  2KUQ A;  2YS1 A;  2D9Y A;  1PLS A;  1V5U A;  2DFK A;  3TO1 A;  1MIX A;  3B77 A;  5LG4 B;  5M4Y B;  2VSZ A;  3P7Z A;  2K2U A;  1N3H A;  1WJ1 A;  2K00 A;  4K2P A;  2DHJ A;  3QWM A;  3T06 A;  3PG7 A;  1UPQ A;  2Z59 A;  2KR0 A;  4TYZ A;  2DKP A;  2ADZ A;  2H7D A;  3OHM B;  4MT7 A;  5J3T A;  1RRP B;  5C79 A;  1M7E A;  1K5G B;  3BJI A;  3ODW A;  2CY5 A;  1WJM A;  4HAT B;  3PVW A;  1EAZ A;  2RNR B;  2Y8F A;  1WI1 A;  4HHV A;  3PP2 A;  1XR0 B;  2J0J A;  2Z14 A;  4D0N B;  4GPT B;  1SGH A;  1NTV A;  1WG7 A;  3HK0 A;  3SNH A;  2W2X D;  3FVC A;  5EFX A;  3CIK A;  2NMB A;  3QBV B;  3KY9 A;  4YL8 A;  1OY2 A;  1ZC4 B;  3DCX A;  3TW1 A;  4HAZ B;  3HQC A;  1UNP A;  1XD4 A;  2ROZ B;  4QJ4 B;  2I5C A;  2M38 A;  2D9W A;  4KHB A;  1FGY A;  2AL6 A;  1V5M A;  3M1I B;  5D27 A;  2E2X A;  4F7H A;  4QJ5 B;  4OSN A;  1TJ6 A;  3WYF B;  2R0D A;  4KAX B;  4ZRK A;  2COA A;  1NI2 A;  2MKR A;  4TKN A;  3SYX A;  1LB1 A;  4EJN A;  2EJ8 A;  2DX5 A;  3VOQ A; 
#chains in the Genus database with same CATH homology
 2W2X C;  1J19 A;  3A8P A;  1E5W A;  1FGZ A;  1UNQ A;  1XKE A;  2Z0O A;  3KRW A;  2N23 A;  1V88 A;  1EGX A;  1SHC A;  2DKQ A;  2YT1 A;  1I2H A;  3DXC A;  1FHO A;  1U29 A;  4Z2N A;  4A6F A;  4DXA B;  3DXE A;  4C0A A;  1KZ7 A;  1QC6 A;  4H8S A;  4K17 A;  2D10 A;  5HE2 A;  4B6H A;  1AWE A;  2MDX A;  5CLQ B;  3ODO A;  4L6E A;  4A5K A;  1ZC3 B;  1ZSQ A;  2COC A;  1UNR A;  1U5E A;  3CXB B;  2YRY A;  1EVH A;  3D8D A;  3F5R A;  4GMV A;  2FJL A;  4XWX A;  1FHW A;  1NTY A;  1U5D A;  2RUK B;  5D3W A;  3PEG A;  2I1K A;  3UZT A;  1X05 A;  4HDQ A;  3ML4 A;  2RSG A;  3X23 A;  1Z87 A;  2H7E A;  2DLW A;  4HB0 B;  2EC1 A;  1BTN A;  1TQZ A;  1ISN A;  3GYP A;  3F0W A;  2EMS A;  4HB4 B;  1ZVR A;  3OAN A;  1H4R A;  3GYO A;  3N7C A;  3KSY A;  2OTX A;  5DI9 B;  5HE1 A;  1DDV A;  5LOP B;  1LW3 A;  4MY6 A;  3KRX A;  2DYN A;  2RGN B;  3PVL A;  4PNK A;  5D3V A;  1QQG A;  2I5F A;  4WSF A;  2DYQ A;  2RVB B;  2YSZ A;  3NSU A;  5KQ4 A;  1DDM A;  2AEH A;  2W2W A;  2CRF A;  2GCJ A;  2UZS A;  4KVG B;  3SV1 A;  5JP4 A;  3AU5 A;  4HAX B;  2GCL A;  4EKU A;  2MFQ A;  1XX0 A;  1UEF A;  4WJ7 A;  2LOZ A;  3AU4 A;  3IVF A;  2KCJ A;  1DYN A;  3QIJ A;  4GXB A;  3PVU A;  2Z0P A;  4HB2 B;  2N0Y A;  1MPH A;  4HDO A;  2OQB A;  3U8Z A;  1GG3 A;  4IFS A;  2BCJ A;  3KZ1 A;  2MWN B;  2UZR A;  2V76 A;  2YS3 A;  1IRS A;  4GMX B;  5DHA B;  4CHM A;  5FI1 A;  5C16 A;  1X11 A;  2LUL A;  2PZ1 A;  1BAK A;  1KZG A;  4KHO A;  2UVM A;  1EF1 A;  1V61 A;  4A6F B;  4ZRI A;  3WA0 A;  2P0D A;  3LJU X;  3PSC A;  2J59 M;  1H10 A;  1P3R A;  1U5F A;  2D2Q A;  4DX8 A;  1X1G A;  3A98 B;  2J0M A;  1XCG A;  5L81 A;  4Z2M B;  4HAU B;  1P5T A;  1MAI A;  2G35 A;  1WGQ A;  3P6A A;  1MIZ B;  2D9X A;  1DDW A;  3D8E A;  1Y19 B;  2D9Z A;  2L2I A;  1NU2 A;  1DBH A;  1BWN A;  1WGU A;  3FM8 C;  3ULB A;  4GN1 A;  2HE7 A;  3ULC A;  3SUZ A;  1U2B A;  2CAY A;  3ZVR A;  2LG1 A;  1TXD A;  5KCV A;  2J0K A;  3FEH A;  2ZPY A;  3FSS A;  1W1H A;  5J3Q A;  1ZM0 A;  1P6S A;  3TCA A;  1U5G A;  3O96 A;  2QKL A;  2P0H A;  5DIF B;  2DN6 A;  4CHJ A;  2GS0 A;  2LKO A;  2Z0Q A;  4F7G A;  5J3Y A;  1GC6 A;  4NY0 A;  5HE0 A;  5CLL B;  3MPX A;  1OMW A;  5JHG A;  4KHB B;  1MK7 B;  1Y5O A;  1Q67 A;  4K81 A;  4BBK A;  5JHH A;  5DHF B;  1W1G A;  2DTC A;  2M14 A;  3V5W A;  3ZDT A;  5HE3 A;  2Q13 A;  2LYD A;  1K5D B;  3U7D A;  5FI0 A;  2P0F A;  3A8Q A;  1V5P A;  2IYB A;  2RLO A;  2ROV A;  4CYE A;  2DA0 A;  3TFM A;  4PQ0 A;  2QKM A;  1DRO A;  2EMT A;  1X1F A;  1KI1 B;  4WVF B;  2L1C A;  1MK9 B;  2D4Q A;  2Y8G A;  2DHI A;  2LOX A;  2XQN M;  1AQC A;  2Y7B A;  2KUP A;  3PZD A;  5D3X A;  3G9W A;  2YVC A;  2ELB A;  5C6R A;  2JP2 A;  1OQN A;  4NSW A;  1XOD A;  2HTH B;  2DX1 A;  3MDB C;  1FHX A;  4A6K A;  1U27 A;  3HW2 B;  4K2O A;  1V89 A;  4HAV B;  1B55 A;  4P7I A;  1RJ2 A;  4DX9 0;  3AJ4 A;  1I7A A;  1MKE A;  1BTK A;  1FB8 A;  2I1J A;  3RCP A;  2COD A;  4HAY B;  4IOY X;  2VRW B;  1PFJ A;  5C5B A;  1WVH A;  1X86 A;  3ODX A;  5DH9 B;  4HB3 B;  5LON B;  1GC7 A;  2GJY A;  2D9V A;  4YON A;  1FOE A;  4KHA A;  5GOW B;  1UPR A;  3SO6 A;  5C5B B;  2R09 A;  2P8V A;  3DXD A;  2VKI A;  2CY4 A;  2YS5 A;  2K2J A;  1PMS A;  4Y94 A;  3VIA A;  4EMO A;  4DBB A;  2COF A;  3BIN A;  1M7R A;  4HAW B;  4F7U P;  2YT0 A;  2KGX B;  5KQ1 A;  1W1D A;  4GZU A;  2NZ8 B;  4MK0 A;  3D8F A;  3TVV A;  5D3Y A;  2ELA A;  1FAO A;  4A6H A;  2D11 A;  2X18 A;  5JLJ B;  4IAP A;  1J0W A;  2YF0 A;  2IFS A;  4ZRJ A;  2DHK A;  2YS1 A;  2D9Y A;  1PLS A;  1V5U A;  2DFK A;  3TO1 A;  1MIX A;  2VSZ A;  3P7Z A;  2K2U A;  1N3H A;  1WJ1 A;  2K00 A;  4K2P A;  2DHJ A;  3QWM A;  3T06 A;  3PG7 A;  1UPQ A;  4TYZ A;  2DKP A;  2ADZ A;  2H7D A;  4MT7 A;  5J3T A;  1RRP B;  5C79 A;  1M7E A;  1K5G B;  3BJI A;  3ODW A;  2CY5 A;  1WJM A;  4HAT B;  3PVW A;  1EAZ A;  2RNR B;  2Y8F A;  1WI1 A;  4HHV A;  3PP2 A;  1XR0 B;  2J0J A;  4D0N B;  4GPT B;  1SGH A;  1NTV A;  1WG7 A;  3HK0 A;  3SNH A;  2W2X D;  5EFX A;  3CIK A;  2NMB A;  3QBV B;  3KY9 A;  4YL8 A;  1OY2 A;  1ZC4 B;  3TW1 A;  4HAZ B;  3HQC A;  1UNP A;  1XD4 A;  2ROZ B;  2I5C A;  2M38 A;  2D9W A;  1FGY A;  2AL6 A;  1V5M A;  3M1I B;  5D27 A;  2E2X A;  4F7H A;  1TJ6 A;  3WYF B;  2R0D A;  4KAX B;  4ZRK A;  2COA A;  1NI2 A;  2MKR A;  4TKN A;  3SYX A;  1LB1 A;  4EJN A;  2EJ8 A;  2DX5 A;  3VOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...