4GMXB

Crystal structure of kpt185 in complex with crm1-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
TMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibitors of nuclear export show that CRM1/XPO1 is a target in chronic lymphocytic leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
molecule keywords GTP-binding nuclear protein Ran
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gmxB00
2J0MA 2K2JA 3ODOA 4EKUA 1NU2A 1EAZA 1U5FA 2LOZA 2GCLA 1QQGA 3PP2A 2JP2A 2RUKB 2YSZA 2RVBB 1K5GB 3CXBB 3FM8C 2EJ8A 4CYEA 5JHHA 5HE0A 5KQ4A 2IYBA 4A6FB 1QC6A 1U27A 4BBKA 1XKEA 1U2BA 3DXCA 2ZPYA 5FI1A 3N7CA 1ISNA 2DKPA 3O96A 3KRXA 1KI1B 2P8VA 3OANA 4TKNA 4WSFA 2NMBA 1DYNA 4CHJA 2DX5A 2VKIA 2E2XA 3KRWA 2CY4A 3ZVRA 1DDMA 4Y94A 5GOWB 3PVWA 2D9ZA 2I1KA 4F7UP 2FJLA 1XR0B 1V5UA 4MK0A 1UNRA 3TW1A 2DYQA 4B6HA 4A6HA 2H7DA 5D3WA 1EF1A 3HQCA 4HAUB 1W1HA 3ML4A 4GN1A 1OY2A 2Z0QA 3TVVA 4HDQA 1Y5OA 5HE2A 3D8EA 2J0JA 2DHJA 1X11A 3DXEA 1DDWA 5D3YA 4A5KA 3ODWA 5D27A 3MDBC 1FGYA 1X1FA 1FHWA 1FAOA 2AEHA 1J19A 3HW2B 3SYXA 2YS1A 1UNQA 3NSUA 2GCJA 4KAXB 5JHGA 2K2UA 5HE3A 1N3HA 3TCAA 1MK9B 3VOQA 4KVGB 1TQZA 1Y19B 2COFA 3HK0A 4HAZB 5DIFB 1ZVRA 5C5BA 1IRSA 3P6AA 3T06A 4K17A 3KY9A 5C6RA 3LJUX 2G35A 1BTKA 3KSYA 1DROA 4DX90 3PZDA 3QWMA 4IOYX 3AU4A 4KHOA 4PNKA 3P7ZA 2L2IA 4F7GA 5LOPB 2RGNB 2EMTA 2DHIA 2RSGA 5C79A 3D8FA 1LW3A 2DTCA 3A98B 1V88A 1DDVA 4DX8A 1Z87A 1TJ6A 2VSZA 2DFKA 1ZSQA 2V76A 4Z2MB 3SV1A 4HB0B 1XODA 2Y8GA 4DXAB 5EFXA 2LULA 1ZC4B 5D3VA 2D10A 4HDOA 1PMSA 2DYNA 2J59M 2CY5A 2CODA 3TFMA 2RNRB 4DBBA 1WGUA 2DA0A 3SNHA 2Q13A 5J3TA 5D3XA 4HAYB 1WGQA 1Q67A 1BTNA 2NZ8B 1AWEA 2COCA 1SGHA 2EC1A 4YONA 3X23A 2HE7A 3DXDA 3M1IB 1W1DA 3WA0A 4HAVB 1M7EA 2D9WA 2KGXB 2IFSA 1UEFA 1GG3A 4HHVA 3IVFA 1B55A 3BINA 2I5CA 1MIZB 2MWNB 2OTXA 2YT1A 4HAWB 4ZRIA 3PEGA 3SO6A 1U5GA 3BJIA 1MKEA 1U5DA 4K2OA 1K5DB 2Z0OA 1OQNA 2CAYA 2GS0A 2Y7BA 1FB8A 3QBVB 2AL6A 3TO1A 2HTHB 5L81A 5C16A 4F7HA 1FHOA 1UNPA 2M14A 3ZDTA 3ULBA 1NTVA 4GPTB 4K2PA 2YS5A 1WI1A 1MPHA 2YF0A 3V5WA 1MK7B 5JP4A 1MIXA 1EVHA 4GMXB 2H7EA 2DN6A 2ELAA 2UZSA 5DHFB 2ROZB 1J0WA 4EJNA 5LONB 2KUPA 2LYDA 2W2XD 2YRYA 2CRFA 1I2HA 3D8DA 1H4RA 3MPXA 4WJ7A 1V89A 2R0DA 1PLSA 1X1GA 3GYPA 3FSSA 2I1JA 2P0HA 2LOXA 2QKLA 2LKOA 2D2QA 2ROVA 1X86A 4IAPA 1P6SA 1ZC3B 4EMOA 3KZ1A 2QKMA 3F0WA 5HE1A 1FOEA 1V5PA 2RLOA 2X18A 4MT7A 4K81A 2VRWB 4HAXB 2D4QA 2D9VA 2N0YA 2P0FA 4A6FA 2D11A 1FHXA 5KCVA 1XX0A 4GXBA 2YT0A 3PSCA 2I5FA 2GJYA 2Y8FA 2KCJA 4H8SA 1BAKA 4Z2NA 3ODXA 1UPRA 1RRPB 1BWNA 1SHCA 2MDXA 2UVMA 4KHAA 3UZTA 2Z0PA 2DX1A 2OQBA 1WVHA 4GZUA 4NY0A 1MAIA 2EMSA 1GC6A 2W2WA 3VIAA 4HB3B 1P3RA 3AJ4A 1NI2A 2LG1A 4YL8A 2K00A 1WJ1A 1WJMA 3GYOA 1RJ2A 5FI0A 4KHBB 5CLLB 2ELBA 3RCPA 2J0KA 3PVUA 4WVFB 4L6EA 1W1GA 5C5BB 1TXDA 1E5WA 4A6KA 2DLWA 4GMVA 2BCJA 4NSWA 3AU5A 1V5MA 1U29A 4HB2B 3U7DA 1NTYA 1OMWA 3PVLA 1KZGA 2YS3A 1DBHA 1H10A 2W2XC 3G9WA 1KZ7A 2XQNM 1U5EA 1X05A 3FEHA 4PQ0A 5JLJB 1FGZA 2MFQA 1GC7A 5DI9B 3WYFB 4CHMA 1EGXA 1P5TA 2COAA 3A8PA 1UPQA 2YVCA 4TYZA 1LB1A 1M7RA 1XCGA 4XWXA 1PFJA 2L1CA 1ZM0A 1WG7A 2DKQA 2D9XA 3SUZA 4ZRJA 3QIJA 3F5RA 2P0DA 2PZ1A 2R09A 5CLQB 1V61A 2M38A 2ADZA 1AQCA 4IFSA 5DH9B 5J3QA 2MKRA 4HB4B 1XD4A 4C0AA 5KQ1A 3A8QA 5DHAB 4HATB 2DHKA 2D9YA 4MY6A 5J3YA 3U8ZA 3ULCA 1I7AA 2UZRA 4P7IA 2N23A 4ZRKA 3CIKA 4D0NB 3PG7A
chains in the Genus database with same CATH superfamily
2J0MA 2K2JA 3ODOA 4EKUA 1NU2A 5I2MA 1EAZA 1U5FA 2LOZA 2GCLA 1QQGA 2Z4DA 2JP2A 3PP2A 2RUKB 2YSZA 4D6WA 2RVBB 1K5GB 3CXBB 3FM8C 2EJ8A 4CYEA 5JHHA 5HE0A 5KQ4A 2IYBA 4A6FB 1QC6A 1U27A 4BBKA 1XKEA 1U2BA 3DXCA 2Z13A 2ZPYA 5FI1A 4GOUA 3N7CA 1ISNA 2DKPA 3O96A 3KRXA 1KI1B 2P8VA 3OANA 4TKNA 4WSFA 2NMBA 1DYNA 4CHJA 2DX5A 2VKIA 2E2XA 3KRWA 2CY4A 3ZVRA 1DDMA 2KUQA 4Y94A 5GOWB 3PVWA 2D9ZA 2I1KA 4F7UP 2FJLA 1XR0B 1V5UA 4MK0A 5IRSA 1UNRA 3TW1A 2DYQA 4B6HA 4A6HA 2H7DA 5D3WA 1EF1A 3HQCA 4HAUB 1W1HA 4QXAB 3ML4A 4GN1A 1OY2A 2Z0QA 3TVVA 4HDQA 1Y5OA 5HE2A 4L1RA 3D8EA 2J0JA 2DHJA 1X11A 3DXEA 1DDWA 5D3YA 4A5KA 3ODWA 5D27A 3MDBC 1FGYA 1X1FA 1FHWA 1FAOA 2AEHA 1J19A 3HW2B 3SYXA 2YS1A 1UNQA 3NSUA 2GCJA 3HIEA 4KAXB 5JHGA 2K2UA 5HE3A 1N3HA 3TCAA 1MK9B 3VOQA 4KVGB 1TQZA 1Y19B 2COFA 3HK0A 4HAZB 5DIFB 1ZVRA 5C5BA 1IRSA 3P6AA 3T06A 4K17A 3KY9A 5C6RA 3LJUX 2G35A 1BTKA 3KSYA 1DROA 4DX90 3PZDA 3QWMA 4IOYX 2FJUB 3AU4A 4KHOA 4PNKA 3P7ZA 2L2IA 4F7GA 5LOPB 2RGNB 2EMTA 2DHIA 2RSGA 5C79A 3D8FA 1LW3A 2DTCA 3A98B 1V88A 1DDVA 2Z59A 4DX8A 1Z87A 1TJ6A 2VSZA 2DFKA 1ZSQA 2V76A 4Z2MB 3SV1A 4HB0B 1XODA 2Y8GA 4DXAB 4GNKB 5EFXA 2LULA 1ZC4B 1ZYIA 5D3VA 2D10A 4HDOA 1PMSA 2DYNA 2J59M 2CY5A 2CODA 3TFMA 2RNRB 4DBBA 1WGUA 2DA0A 3SNHA 2Q13A 5J3TA 5D3XA 4HAYB 1WGQA 1Q67A 1BTNA 2NZ8B 1AWEA 2KIEA 2COCA 1SGHA 2EC1A 4YONA 3X23A 2HE7A 3DXDA 3M1IB 1W1DA 3WA0A 4HAVB 1M7EA 2D9WA 2KGXB 2IFSA 1UEFA 1GG3A 4HHVA 3IVFA 1B55A 3BINA 2I5CA 3NW8A 1MIZB 2MWNB 4CSQA 2OTXA 2YT1A 4HAWB 4ZRIA 3PEGA 3SO6A 1U5GA 3BJIA 1MKEA 1U5DA 4K2OA 1K5DB 3A58A 2Z0OA 1OQNA 2CAYA 2GS0A 2Y7BA 1FB8A 3QBVB 2AL6A 3TO1A 2HTHB 5L81A 5C16A 4F7HA 2K49A 1FHOA 1UNPA 2M14A 3ZDTA 3ULBA 1NTVA 2KIGA 4GPTB 4K2PA 2YS5A 1WI1A 3FVCA 1MPHA 2Z14A 2YF0A 3V5WA 1MK7B 5JP4A 1MIXA 1EVHA 4GMXB 2H7EA 2DN6A 2ELAA 2UZSA 5DHFB 2ROZB 1J0WA 4EJNA 5LONB 2KUPA 2LYDA 2W2XD 2YRYA 2CRFA 1I2HA 3D8DA 4QJ3B 1H4RA 3MPXA 4WJ7A 1V89A 2R0DA 1PLSA 1X1GA 3GYPA 3FSSA 2I1JA 2P0HA 2LOXA 3NWAA 2QKLA 2LKOA 3B77A 3OHMB 2D2QA 2ROVA 1X86A 4IAPA 1P6SA 1ZC3B 4EMOA 3KZ1A 2QKMA 3F0WA 3NWDA 5HE1A 1FOEA 1V5PA 2RLOA 2X18A 4MT7A 3NWFA 4K81A 2VRWB 4HAXB 2D4QA 2D9VA 2N0YA 2P0FA 4A6FA 2D11A 1FHXA 5KCVA 1XX0A 4GXBA 2YT0A 3PSCA 2I5FA 2GJYA 2Y8FA 2KCJA 4H8SA 5LG4B 1BAKA 4Z2NA 3ODXA 1UPRA 1RRPB 1BWNA 1SHCA 2MDXA 2UVMA 4KHAA 3UZTA 2Z0PA 2DX1A 2OQBA 4QJ4B 4HSIA 1WVHA 4GZUA 4NY0A 1MAIA 3DCXA 2EMSA 1GC6A 2W2WA 3VIAA 4HB3B 1P3RA 3AJ4A 4OT1A 1NI2A 1T77A 3U12A 2LG1A 4YL8A 2K00A 1WJ1A 1WJMA 3GYOA 1RJ2A 5FI0A 4KHBB 5CLLB 2ELBA 2R2YA 3RCPA 2J0KA 3PVUA 4WVFB 4L6EA 1W1GA 5C5BB 4DIXA 1TXDA 1E5WA 4A6KA 2DLWA 4GMVA 2BCJA 4NSWA 5M4YB 3AU5A 1V5MA 1U29A 4HB2B 3U7DA 1NTYA 1OMWA 3PVLA 1KZGA 2KR0A 2YS3A 2ZKMX 1DBHA 4OSNA 1H10A 2W2XC 3G9WA 1KZ7A 2XQNM 1U5EA 1X05A 3FEHA 4PQ0A 5JLJB 1FGZA 2MFQA 1GC7A 5DI9B 3WYFB 4CHMA 1EGXA 1P5TA 2COAA 3A8PA 1UPQA 1MI1A 2YVCA 4TYZA 1LB1A 1M7RA 1XCGA 2RRFA 4XWXA 2GUMA 1PFJA 2YT2A 2L1CA 1ZM0A 1WG7A 5I2SA 2DKQA 2D9XA 3SUZA 4KHBA 4ZRJA 3QIJA 3F5RA 2P0DA 2PZ1A 2R09A 5CLQB 1V61A 2M38A 2ADZA 1AQCA 4IFSA 5DH9B 3HSAA 5J3QA 2MKRA 4HB4B 1XD4A 4C0AA 5KQ1A 3A8QA 5DHAB 2K8EA 4HATB 2DHKA 2D9YA 4MY6A 5J3YA 3U8ZA 3ULCA 4QJ5B 1I7AA 2UZRA 2NBVA 4P7IA 2N23A 4ZRKA 3CIKA 4D0NB 3PG7A
chains in the Genus database with same CATH topology
2J0MA 2K2JA 3ODOA 4EKUA 1NU2A 1EAZA 1U5FA 2LOZA 2GCLA 1QQGA 3PP2A 2JP2A 2RUKB 2YSZA 2RVBB 1K5GB 3CXBB 3FM8C 2EJ8A 4CYEA 5JHHA 5HE0A 5KQ4A 2IYBA 4A6FB 1QC6A 1U27A 4BBKA 1XKEA 1U2BA 3DXCA 2ZPYA 5FI1A 3N7CA 1ISNA 2DKPA 3O96A 3KRXA 1KI1B 2P8VA 3OANA 4TKNA 4WSFA 2NMBA 1DYNA 4CHJA 2DX5A 2VKIA 2E2XA 3KRWA 2CY4A 3ZVRA 1DDMA 4Y94A 5GOWB 3PVWA 2D9ZA 2I1KA 4F7UP 2FJLA 1XR0B 1V5UA 4MK0A 1UNRA 3TW1A 2DYQA 4B6HA 4A6HA 2H7DA 5D3WA 1EF1A 3HQCA 4HAUB 1W1HA 3ML4A 4GN1A 1OY2A 2Z0QA 3TVVA 4HDQA 1Y5OA 5HE2A 3D8EA 2J0JA 2DHJA 1X11A 3DXEA 1DDWA 5D3YA 4A5KA 3ODWA 5D27A 3MDBC 1FGYA 1X1FA 1FHWA 1FAOA 2AEHA 1J19A 3HW2B 3SYXA 2YS1A 1UNQA 3NSUA 2GCJA 4KAXB 5JHGA 2K2UA 5HE3A 1N3HA 3TCAA 1MK9B 3VOQA 4KVGB 1TQZA 1Y19B 2COFA 3HK0A 4HAZB 5DIFB 1ZVRA 5C5BA 1IRSA 3P6AA 3T06A 4K17A 3KY9A 5C6RA 3LJUX 2G35A 1BTKA 3KSYA 1DROA 4DX90 3PZDA 3QWMA 4IOYX 3AU4A 4KHOA 4PNKA 3P7ZA 2L2IA 4F7GA 5LOPB 2RGNB 2EMTA 2DHIA 2RSGA 5C79A 3D8FA 1LW3A 2DTCA 3A98B 1V88A 1DDVA 4DX8A 1Z87A 1TJ6A 2VSZA 2DFKA 1ZSQA 2V76A 4Z2MB 3SV1A 4HB0B 1XODA 2Y8GA 4DXAB 5EFXA 2LULA 1ZC4B 5D3VA 2D10A 4HDOA 1PMSA 2DYNA 2J59M 2CY5A 2CODA 3TFMA 2RNRB 4DBBA 1WGUA 2DA0A 3SNHA 2Q13A 5J3TA 5D3XA 4HAYB 1WGQA 1Q67A 1BTNA 2NZ8B 1AWEA 2COCA 1SGHA 2EC1A 4YONA 3X23A 2HE7A 3DXDA 3M1IB 1W1DA 3WA0A 4HAVB 1M7EA 2D9WA 2KGXB 2IFSA 1UEFA 1GG3A 4HHVA 3IVFA 1B55A 3BINA 2I5CA 1MIZB 2MWNB 2OTXA 2YT1A 4HAWB 4ZRIA 3PEGA 3SO6A 1U5GA 3BJIA 1MKEA 1U5DA 4K2OA 1K5DB 2Z0OA 1OQNA 2CAYA 2GS0A 2Y7BA 1FB8A 3QBVB 2AL6A 3TO1A 2HTHB 5L81A 5C16A 4F7HA 1FHOA 1UNPA 2M14A 3ZDTA 3ULBA 1NTVA 4GPTB 4K2PA 2YS5A 1WI1A 1MPHA 2YF0A 3V5WA 1MK7B 5JP4A 1MIXA 1EVHA 4GMXB 2H7EA 2DN6A 2ELAA 2UZSA 5DHFB 2ROZB 1J0WA 4EJNA 5LONB 2KUPA 2LYDA 2W2XD 2YRYA 2CRFA 1I2HA 3D8DA 1H4RA 3MPXA 4WJ7A 1V89A 2R0DA 1PLSA 1X1GA 3GYPA 3FSSA 2I1JA 2P0HA 2LOXA 2QKLA 2LKOA 2D2QA 2ROVA 1X86A 4IAPA 1P6SA 1ZC3B 4EMOA 3KZ1A 2QKMA 3F0WA 5HE1A 1FOEA 1V5PA 2RLOA 2X18A 4MT7A 4K81A 2VRWB 4HAXB 2D4QA 2D9VA 2N0YA 2P0FA 4A6FA 2D11A 1FHXA 5KCVA 1XX0A 4GXBA 2YT0A 3PSCA 2I5FA 2GJYA 2Y8FA 2KCJA 4H8SA 1BAKA 4Z2NA 3ODXA 1UPRA 1RRPB 1BWNA 1SHCA 2MDXA 2UVMA 4KHAA 3UZTA 2Z0PA 2DX1A 2OQBA 1WVHA 4GZUA 4NY0A 1MAIA 2EMSA 1GC6A 2W2WA 3VIAA 4HB3B 1P3RA 3AJ4A 1NI2A 2LG1A 4YL8A 2K00A 1WJ1A 1WJMA 3GYOA 1RJ2A 5FI0A 4KHBB 5CLLB 2ELBA 3RCPA 2J0KA 3PVUA 4WVFB 4L6EA 1W1GA 5C5BB 1TXDA 1E5WA 4A6KA 2DLWA 4GMVA 2BCJA 4NSWA 3AU5A 1V5MA 1U29A 4HB2B 3U7DA 1NTYA 1OMWA 3PVLA 1KZGA 2YS3A 1DBHA 1H10A 2W2XC 3G9WA 1KZ7A 2XQNM 1U5EA 1X05A 3FEHA 4PQ0A 5JLJB 1FGZA 2MFQA 1GC7A 5DI9B 3WYFB 4CHMA 1EGXA 1P5TA 2COAA 3A8PA 1UPQA 2YVCA 4TYZA 1LB1A 1M7RA 1XCGA 4XWXA 1PFJA 2L1CA 1ZM0A 1WG7A 2DKQA 2D9XA 3SUZA 4ZRJA 3QIJA 3F5RA 2P0DA 2PZ1A 2R09A 5CLQB 1V61A 2M38A 2ADZA 1AQCA 4IFSA 5DH9B 5J3QA 2MKRA 4HB4B 1XD4A 4C0AA 5KQ1A 3A8QA 5DHAB 4HATB 2DHKA 2D9YA 4MY6A 5J3YA 3U8ZA 3ULCA 1I7AA 2UZRA 4P7IA 2N23A 4ZRKA 3CIKA 4D0NB 3PG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0M A;  2K2J A;  3ODO A;  4EKU A;  1NU2 A;  1EAZ A;  1U5F A;  2LOZ A;  2GCL A;  1QQG A;  3PP2 A;  2JP2 A;  2RUK B;  2YSZ A;  2RVB B;  1K5G B;  3CXB B;  3FM8 C;  2EJ8 A;  4CYE A;  5JHH A;  5HE0 A;  5KQ4 A;  2IYB A;  4A6F B;  1QC6 A;  1U27 A;  4BBK A;  1XKE A;  1U2B A;  3DXC A;  2ZPY A;  5FI1 A;  3N7C A;  1ISN A;  2DKP A;  3O96 A;  3KRX A;  1KI1 B;  2P8V A;  3OAN A;  4TKN A;  4WSF A;  2NMB A;  1DYN A;  4CHJ A;  2DX5 A;  2VKI A;  2E2X A;  3KRW A;  2CY4 A;  3ZVR A;  1DDM A;  4Y94 A;  5GOW B;  3PVW A;  2D9Z A;  2I1K A;  4F7U P;  2FJL A;  1XR0 B;  1V5U A;  4MK0 A;  1UNR A;  3TW1 A;  2DYQ A;  4B6H A;  4A6H A;  2H7D A;  5D3W A;  1EF1 A;  3HQC A;  4HAU B;  1W1H A;  3ML4 A;  4GN1 A;  1OY2 A;  2Z0Q A;  3TVV A;  4HDQ A;  1Y5O A;  5HE2 A;  3D8E A;  2J0J A;  2DHJ A;  1X11 A;  3DXE A;  1DDW A;  5D3Y A;  4A5K A;  3ODW A;  5D27 A;  3MDB C;  1FGY A;  1X1F A;  1FHW A;  1FAO A;  2AEH A;  1J19 A;  3HW2 B;  3SYX A;  2YS1 A;  1UNQ A;  3NSU A;  2GCJ A;  4KAX B;  5JHG A;  2K2U A;  5HE3 A;  1N3H A;  3TCA A;  1MK9 B;  3VOQ A;  4KVG B;  1TQZ A;  1Y19 B;  2COF A;  3HK0 A;  4HAZ B;  5DIF B;  1ZVR A;  5C5B A;  1IRS A;  3P6A A;  3T06 A;  4K17 A;  3KY9 A;  5C6R A;  3LJU X;  2G35 A;  1BTK A;  3KSY A;  1DRO A;  4DX9 0;  3PZD A;  3QWM A;  4IOY X;  3AU4 A;  4KHO A;  4PNK A;  3P7Z A;  2L2I A;  4F7G A;  5LOP B;  2RGN B;  2EMT A;  2DHI A;  2RSG A;  5C79 A;  3D8F A;  1LW3 A;  2DTC A;  3A98 B;  1V88 A;  1DDV A;  4DX8 A;  1Z87 A;  1TJ6 A;  2VSZ A;  2DFK A;  1ZSQ A;  2V76 A;  4Z2M B;  3SV1 A;  4HB0 B;  1XOD A;  2Y8G A;  4DXA B;  5EFX A;  2LUL A;  1ZC4 B;  5D3V A;  2D10 A;  4HDO A;  1PMS A;  2DYN A;  2J59 M;  2CY5 A;  2COD A;  3TFM A;  2RNR B;  4DBB A;  1WGU A;  2DA0 A;  3SNH A;  2Q13 A;  5J3T A;  5D3X A;  4HAY B;  1WGQ A;  1Q67 A;  1BTN A;  2NZ8 B;  1AWE A;  2COC A;  1SGH A;  2EC1 A;  4YON A;  3X23 A;  2HE7 A;  3DXD A;  3M1I B;  1W1D A;  3WA0 A;  4HAV B;  1M7E A;  2D9W A;  2KGX B;  2IFS A;  1UEF A;  1GG3 A;  4HHV A;  3IVF A;  1B55 A;  3BIN A;  2I5C A;  1MIZ B;  2MWN B;  2OTX A;  2YT1 A;  4HAW B;  4ZRI A;  3PEG A;  3SO6 A;  1U5G A;  3BJI A;  1MKE A;  1U5D A;  4K2O A;  1K5D B;  2Z0O A;  1OQN A;  2CAY A;  2GS0 A;  2Y7B A;  1FB8 A;  3QBV B;  2AL6 A;  3TO1 A;  2HTH B;  5L81 A;  5C16 A;  4F7H A;  1FHO A;  1UNP A;  2M14 A;  3ZDT A;  3ULB A;  1NTV A;  4GPT B;  4K2P A;  2YS5 A;  1WI1 A;  1MPH A;  2YF0 A;  3V5W A;  1MK7 B;  5JP4 A;  1MIX A;  1EVH A;  4GMX B;  2H7E A;  2DN6 A;  2ELA A;  2UZS A;  5DHF B;  2ROZ B;  1J0W A;  4EJN A;  5LON B;  2KUP A;  2LYD A;  2W2X D;  2YRY A;  2CRF A;  1I2H A;  3D8D A;  1H4R A;  3MPX A;  4WJ7 A;  1V89 A;  2R0D A;  1PLS A;  1X1G A;  3GYP A;  3FSS A;  2I1J A;  2P0H A;  2LOX A;  2QKL A;  2LKO A;  2D2Q A;  2ROV A;  1X86 A;  4IAP A;  1P6S A;  1ZC3 B;  4EMO A;  3KZ1 A;  2QKM A;  3F0W A;  5HE1 A;  1FOE A;  1V5P A;  2RLO A;  2X18 A;  4MT7 A;  4K81 A;  2VRW B;  4HAX B;  2D4Q A;  2D9V A;  2N0Y A;  2P0F A;  4A6F A;  2D11 A;  1FHX A;  5KCV A;  1XX0 A;  4GXB A;  2YT0 A;  3PSC A;  2I5F A;  2GJY A;  2Y8F A;  2KCJ A;  4H8S A;  1BAK A;  4Z2N A;  3ODX A;  1UPR A;  1RRP B;  1BWN A;  1SHC A;  2MDX A;  2UVM A;  4KHA A;  3UZT A;  2Z0P A;  2DX1 A;  2OQB A;  1WVH A;  4GZU A;  4NY0 A;  1MAI A;  2EMS A;  1GC6 A;  2W2W A;  3VIA A;  4HB3 B;  1P3R A;  3AJ4 A;  1NI2 A;  2LG1 A;  4YL8 A;  2K00 A;  1WJ1 A;  1WJM A;  3GYO A;  1RJ2 A;  5FI0 A;  4KHB B;  5CLL B;  2ELB A;  3RCP A;  2J0K A;  3PVU A;  4WVF B;  4L6E A;  1W1G A;  5C5B B;  1TXD A;  1E5W A;  4A6K A;  2DLW A;  4GMV A;  2BCJ A;  4NSW A;  3AU5 A;  1V5M A;  1U29 A;  4HB2 B;  3U7D A;  1NTY A;  1OMW A;  3PVL A;  1KZG A;  2YS3 A;  1DBH A;  1H10 A;  2W2X C;  3G9W A;  1KZ7 A;  2XQN M;  1U5E A;  1X05 A;  3FEH A;  4PQ0 A;  5JLJ B;  1FGZ A;  2MFQ A;  1GC7 A;  5DI9 B;  3WYF B;  4CHM A;  1EGX A;  1P5T A;  2COA A;  3A8P A;  1UPQ A;  2YVC A;  4TYZ A;  1LB1 A;  1M7R A;  1XCG A;  4XWX A;  1PFJ A;  2L1C A;  1ZM0 A;  1WG7 A;  2DKQ A;  2D9X A;  3SUZ A;  4ZRJ A;  3QIJ A;  3F5R A;  2P0D A;  2PZ1 A;  2R09 A;  5CLQ B;  1V61 A;  2M38 A;  2ADZ A;  1AQC A;  4IFS A;  5DH9 B;  5J3Q A;  2MKR A;  4HB4 B;  1XD4 A;  4C0A A;  5KQ1 A;  3A8Q A;  5DHA B;  4HAT B;  2DHK A;  2D9Y A;  4MY6 A;  5J3Y A;  3U8Z A;  3ULC A;  1I7A A;  2UZR A;  4P7I A;  2N23 A;  4ZRK A;  3CIK A;  4D0N B;  3PG7 A; 
#chains in the Genus database with same CATH topology
 2J0M A;  2K2J A;  3ODO A;  4EKU A;  1NU2 A;  5I2M A;  1EAZ A;  1U5F A;  2LOZ A;  2GCL A;  1QQG A;  2Z4D A;  2JP2 A;  3PP2 A;  2RUK B;  2YSZ A;  4D6W A;  2RVB B;  1K5G B;  3CXB B;  3FM8 C;  2EJ8 A;  4CYE A;  5JHH A;  5HE0 A;  5KQ4 A;  2IYB A;  4A6F B;  1QC6 A;  1U27 A;  4BBK A;  1XKE A;  1U2B A;  3DXC A;  2Z13 A;  2ZPY A;  5FI1 A;  4GOU A;  3N7C A;  1ISN A;  2DKP A;  3O96 A;  3KRX A;  1KI1 B;  2P8V A;  3OAN A;  4TKN A;  4WSF A;  2NMB A;  1DYN A;  4CHJ A;  2DX5 A;  2VKI A;  2E2X A;  3KRW A;  2CY4 A;  3ZVR A;  1DDM A;  2KUQ A;  4Y94 A;  5GOW B;  3PVW A;  2D9Z A;  2I1K A;  4F7U P;  2FJL A;  1XR0 B;  1V5U A;  4MK0 A;  5IRS A;  1UNR A;  3TW1 A;  2DYQ A;  4B6H A;  4A6H A;  2H7D A;  5D3W A;  1EF1 A;  3HQC A;  4HAU B;  1W1H A;  4QXA B;  3ML4 A;  4GN1 A;  1OY2 A;  2Z0Q A;  3TVV A;  4HDQ A;  1Y5O A;  5HE2 A;  4L1R A;  3D8E A;  2J0J A;  2DHJ A;  1X11 A;  3DXE A;  1DDW A;  5D3Y A;  4A5K A;  3ODW A;  5D27 A;  3MDB C;  1FGY A;  1X1F A;  1FHW A;  1FAO A;  2AEH A;  1J19 A;  3HW2 B;  3SYX A;  2YS1 A;  1UNQ A;  3NSU A;  2GCJ A;  3HIE A;  4KAX B;  5JHG A;  2K2U A;  5HE3 A;  1N3H A;  3TCA A;  1MK9 B;  3VOQ A;  4KVG B;  1TQZ A;  1Y19 B;  2COF A;  3HK0 A;  4HAZ B;  5DIF B;  1ZVR A;  5C5B A;  1IRS A;  3P6A A;  3T06 A;  4K17 A;  3KY9 A;  5C6R A;  3LJU X;  2G35 A;  1BTK A;  3KSY A;  1DRO A;  4DX9 0;  3PZD A;  3QWM A;  4IOY X;  2FJU B;  3AU4 A;  4KHO A;  4PNK A;  3P7Z A;  2L2I A;  4F7G A;  5LOP B;  2RGN B;  2EMT A;  2DHI A;  2RSG A;  5C79 A;  3D8F A;  1LW3 A;  2DTC A;  3A98 B;  1V88 A;  1DDV A;  2Z59 A;  4DX8 A;  1Z87 A;  1TJ6 A;  2VSZ A;  2DFK A;  1ZSQ A;  2V76 A;  4Z2M B;  3SV1 A;  4HB0 B;  1XOD A;  2Y8G A;  4DXA B;  4GNK B;  5EFX A;  2LUL A;  1ZC4 B;  1ZYI A;  5D3V A;  2D10 A;  4HDO A;  1PMS A;  2DYN A;  2J59 M;  2CY5 A;  2COD A;  3TFM A;  2RNR B;  4DBB A;  1WGU A;  2DA0 A;  3SNH A;  2Q13 A;  5J3T A;  5D3X A;  4HAY B;  1WGQ A;  1Q67 A;  1BTN A;  2NZ8 B;  1AWE A;  2KIE A;  2COC A;  1SGH A;  2EC1 A;  4YON A;  3X23 A;  2HE7 A;  3DXD A;  3M1I B;  1W1D A;  3WA0 A;  4HAV B;  1M7E A;  2D9W A;  2KGX B;  2IFS A;  1UEF A;  1GG3 A;  4HHV A;  3IVF A;  1B55 A;  3BIN A;  2I5C A;  3NW8 A;  1MIZ B;  2MWN B;  4CSQ A;  2OTX A;  2YT1 A;  4HAW B;  4ZRI A;  3PEG A;  3SO6 A;  1U5G A;  3BJI A;  1MKE A;  1U5D A;  4K2O A;  1K5D B;  3A58 A;  2Z0O A;  1OQN A;  2CAY A;  2GS0 A;  2Y7B A;  1FB8 A;  3QBV B;  2AL6 A;  3TO1 A;  2HTH B;  5L81 A;  5C16 A;  4F7H A;  2K49 A;  1FHO A;  1UNP A;  2M14 A;  3ZDT A;  3ULB A;  1NTV A;  2KIG A;  4GPT B;  4K2P A;  2YS5 A;  1WI1 A;  3FVC A;  1MPH A;  2Z14 A;  2YF0 A;  3V5W A;  1MK7 B;  5JP4 A;  1MIX A;  1EVH A;  4GMX B;  2H7E A;  2DN6 A;  2ELA A;  2UZS A;  5DHF B;  2ROZ B;  1J0W A;  4EJN A;  5LON B;  2KUP A;  2LYD A;  2W2X D;  2YRY A;  2CRF A;  1I2H A;  3D8D A;  4QJ3 B;  1H4R A;  3MPX A;  4WJ7 A;  1V89 A;  2R0D A;  1PLS A;  1X1G A;  3GYP A;  3FSS A;  2I1J A;  2P0H A;  2LOX A;  3NWA A;  2QKL A;  2LKO A;  3B77 A;  3OHM B;  2D2Q A;  2ROV A;  1X86 A;  4IAP A;  1P6S A;  1ZC3 B;  4EMO A;  3KZ1 A;  2QKM A;  3F0W A;  3NWD A;  5HE1 A;  1FOE A;  1V5P A;  2RLO A;  2X18 A;  4MT7 A;  3NWF A;  4K81 A;  2VRW B;  4HAX B;  2D4Q A;  2D9V A;  2N0Y A;  2P0F A;  4A6F A;  2D11 A;  1FHX A;  5KCV A;  1XX0 A;  4GXB A;  2YT0 A;  3PSC A;  2I5F A;  2GJY A;  2Y8F A;  2KCJ A;  4H8S A;  5LG4 B;  1BAK A;  4Z2N A;  3ODX A;  1UPR A;  1RRP B;  1BWN A;  1SHC A;  2MDX A;  2UVM A;  4KHA A;  3UZT A;  2Z0P A;  2DX1 A;  2OQB A;  4QJ4 B;  4HSI A;  1WVH A;  4GZU A;  4NY0 A;  1MAI A;  3DCX A;  2EMS A;  1GC6 A;  2W2W A;  3VIA A;  4HB3 B;  1P3R A;  3AJ4 A;  4OT1 A;  1NI2 A;  1T77 A;  3U12 A;  2LG1 A;  4YL8 A;  2K00 A;  1WJ1 A;  1WJM A;  3GYO A;  1RJ2 A;  5FI0 A;  4KHB B;  5CLL B;  2ELB A;  2R2Y A;  3RCP A;  2J0K A;  3PVU A;  4WVF B;  4L6E A;  1W1G A;  5C5B B;  4DIX A;  1TXD A;  1E5W A;  4A6K A;  2DLW A;  4GMV A;  2BCJ A;  4NSW A;  5M4Y B;  3AU5 A;  1V5M A;  1U29 A;  4HB2 B;  3U7D A;  1NTY A;  1OMW A;  3PVL A;  1KZG A;  2KR0 A;  2YS3 A;  2ZKM X;  1DBH A;  4OSN A;  1H10 A;  2W2X C;  3G9W A;  1KZ7 A;  2XQN M;  1U5E A;  1X05 A;  3FEH A;  4PQ0 A;  5JLJ B;  1FGZ A;  2MFQ A;  1GC7 A;  5DI9 B;  3WYF B;  4CHM A;  1EGX A;  1P5T A;  2COA A;  3A8P A;  1UPQ A;  1MI1 A;  2YVC A;  4TYZ A;  1LB1 A;  1M7R A;  1XCG A;  2RRF A;  4XWX A;  2GUM A;  1PFJ A;  2YT2 A;  2L1C A;  1ZM0 A;  1WG7 A;  5I2S A;  2DKQ A;  2D9X A;  3SUZ A;  4KHB A;  4ZRJ A;  3QIJ A;  3F5R A;  2P0D A;  2PZ1 A;  2R09 A;  5CLQ B;  1V61 A;  2M38 A;  2ADZ A;  1AQC A;  4IFS A;  5DH9 B;  3HSA A;  5J3Q A;  2MKR A;  4HB4 B;  1XD4 A;  4C0A A;  5KQ1 A;  3A8Q A;  5DHA B;  2K8E A;  4HAT B;  2DHK A;  2D9Y A;  4MY6 A;  5J3Y A;  3U8Z A;  3ULC A;  4QJ5 B;  1I7A A;  2UZR A;  2NBV A;  4P7I A;  2N23 A;  4ZRK A;  3CIK A;  4D0N B;  3PG7 A; 
#chains in the Genus database with same CATH homology
 2J0M A;  2K2J A;  3ODO A;  4EKU A;  1NU2 A;  1EAZ A;  1U5F A;  2LOZ A;  2GCL A;  1QQG A;  3PP2 A;  2JP2 A;  2RUK B;  2YSZ A;  2RVB B;  1K5G B;  3CXB B;  3FM8 C;  2EJ8 A;  4CYE A;  5JHH A;  5HE0 A;  5KQ4 A;  2IYB A;  4A6F B;  1QC6 A;  1U27 A;  4BBK A;  1XKE A;  1U2B A;  3DXC A;  2ZPY A;  5FI1 A;  3N7C A;  1ISN A;  2DKP A;  3O96 A;  3KRX A;  1KI1 B;  2P8V A;  3OAN A;  4TKN A;  4WSF A;  2NMB A;  1DYN A;  4CHJ A;  2DX5 A;  2VKI A;  2E2X A;  3KRW A;  2CY4 A;  3ZVR A;  1DDM A;  4Y94 A;  5GOW B;  3PVW A;  2D9Z A;  2I1K A;  4F7U P;  2FJL A;  1XR0 B;  1V5U A;  4MK0 A;  1UNR A;  3TW1 A;  2DYQ A;  4B6H A;  4A6H A;  2H7D A;  5D3W A;  1EF1 A;  3HQC A;  4HAU B;  1W1H A;  3ML4 A;  4GN1 A;  1OY2 A;  2Z0Q A;  3TVV A;  4HDQ A;  1Y5O A;  5HE2 A;  3D8E A;  2J0J A;  2DHJ A;  1X11 A;  3DXE A;  1DDW A;  5D3Y A;  4A5K A;  3ODW A;  5D27 A;  3MDB C;  1FGY A;  1X1F A;  1FHW A;  1FAO A;  2AEH A;  1J19 A;  3HW2 B;  3SYX A;  2YS1 A;  1UNQ A;  3NSU A;  2GCJ A;  4KAX B;  5JHG A;  2K2U A;  5HE3 A;  1N3H A;  3TCA A;  1MK9 B;  3VOQ A;  4KVG B;  1TQZ A;  1Y19 B;  2COF A;  3HK0 A;  4HAZ B;  5DIF B;  1ZVR A;  5C5B A;  1IRS A;  3P6A A;  3T06 A;  4K17 A;  3KY9 A;  5C6R A;  3LJU X;  2G35 A;  1BTK A;  3KSY A;  1DRO A;  4DX9 0;  3PZD A;  3QWM A;  4IOY X;  3AU4 A;  4KHO A;  4PNK A;  3P7Z A;  2L2I A;  4F7G A;  5LOP B;  2RGN B;  2EMT A;  2DHI A;  2RSG A;  5C79 A;  3D8F A;  1LW3 A;  2DTC A;  3A98 B;  1V88 A;  1DDV A;  4DX8 A;  1Z87 A;  1TJ6 A;  2VSZ A;  2DFK A;  1ZSQ A;  2V76 A;  4Z2M B;  3SV1 A;  4HB0 B;  1XOD A;  2Y8G A;  4DXA B;  5EFX A;  2LUL A;  1ZC4 B;  5D3V A;  2D10 A;  4HDO A;  1PMS A;  2DYN A;  2J59 M;  2CY5 A;  2COD A;  3TFM A;  2RNR B;  4DBB A;  1WGU A;  2DA0 A;  3SNH A;  2Q13 A;  5J3T A;  5D3X A;  4HAY B;  1WGQ A;  1Q67 A;  1BTN A;  2NZ8 B;  1AWE A;  2COC A;  1SGH A;  2EC1 A;  4YON A;  3X23 A;  2HE7 A;  3DXD A;  3M1I B;  1W1D A;  3WA0 A;  4HAV B;  1M7E A;  2D9W A;  2KGX B;  2IFS A;  1UEF A;  1GG3 A;  4HHV A;  3IVF A;  1B55 A;  3BIN A;  2I5C A;  1MIZ B;  2MWN B;  2OTX A;  2YT1 A;  4HAW B;  4ZRI A;  3PEG A;  3SO6 A;  1U5G A;  3BJI A;  1MKE A;  1U5D A;  4K2O A;  1K5D B;  2Z0O A;  1OQN A;  2CAY A;  2GS0 A;  2Y7B A;  1FB8 A;  3QBV B;  2AL6 A;  3TO1 A;  2HTH B;  5L81 A;  5C16 A;  4F7H A;  1FHO A;  1UNP A;  2M14 A;  3ZDT A;  3ULB A;  1NTV A;  4GPT B;  4K2P A;  2YS5 A;  1WI1 A;  1MPH A;  2YF0 A;  3V5W A;  1MK7 B;  5JP4 A;  1MIX A;  1EVH A;  4GMX B;  2H7E A;  2DN6 A;  2ELA A;  2UZS A;  5DHF B;  2ROZ B;  1J0W A;  4EJN A;  5LON B;  2KUP A;  2LYD A;  2W2X D;  2YRY A;  2CRF A;  1I2H A;  3D8D A;  1H4R A;  3MPX A;  4WJ7 A;  1V89 A;  2R0D A;  1PLS A;  1X1G A;  3GYP A;  3FSS A;  2I1J A;  2P0H A;  2LOX A;  2QKL A;  2LKO A;  2D2Q A;  2ROV A;  1X86 A;  4IAP A;  1P6S A;  1ZC3 B;  4EMO A;  3KZ1 A;  2QKM A;  3F0W A;  5HE1 A;  1FOE A;  1V5P A;  2RLO A;  2X18 A;  4MT7 A;  4K81 A;  2VRW B;  4HAX B;  2D4Q A;  2D9V A;  2N0Y A;  2P0F A;  4A6F A;  2D11 A;  1FHX A;  5KCV A;  1XX0 A;  4GXB A;  2YT0 A;  3PSC A;  2I5F A;  2GJY A;  2Y8F A;  2KCJ A;  4H8S A;  1BAK A;  4Z2N A;  3ODX A;  1UPR A;  1RRP B;  1BWN A;  1SHC A;  2MDX A;  2UVM A;  4KHA A;  3UZT A;  2Z0P A;  2DX1 A;  2OQB A;  1WVH A;  4GZU A;  4NY0 A;  1MAI A;  2EMS A;  1GC6 A;  2W2W A;  3VIA A;  4HB3 B;  1P3R A;  3AJ4 A;  1NI2 A;  2LG1 A;  4YL8 A;  2K00 A;  1WJ1 A;  1WJM A;  3GYO A;  1RJ2 A;  5FI0 A;  4KHB B;  5CLL B;  2ELB A;  3RCP A;  2J0K A;  3PVU A;  4WVF B;  4L6E A;  1W1G A;  5C5B B;  1TXD A;  1E5W A;  4A6K A;  2DLW A;  4GMV A;  2BCJ A;  4NSW A;  3AU5 A;  1V5M A;  1U29 A;  4HB2 B;  3U7D A;  1NTY A;  1OMW A;  3PVL A;  1KZG A;  2YS3 A;  1DBH A;  1H10 A;  2W2X C;  3G9W A;  1KZ7 A;  2XQN M;  1U5E A;  1X05 A;  3FEH A;  4PQ0 A;  5JLJ B;  1FGZ A;  2MFQ A;  1GC7 A;  5DI9 B;  3WYF B;  4CHM A;  1EGX A;  1P5T A;  2COA A;  3A8P A;  1UPQ A;  2YVC A;  4TYZ A;  1LB1 A;  1M7R A;  1XCG A;  4XWX A;  1PFJ A;  2L1C A;  1ZM0 A;  1WG7 A;  2DKQ A;  2D9X A;  3SUZ A;  4ZRJ A;  3QIJ A;  3F5R A;  2P0D A;  2PZ1 A;  2R09 A;  5CLQ B;  1V61 A;  2M38 A;  2ADZ A;  1AQC A;  4IFS A;  5DH9 B;  5J3Q A;  2MKR A;  4HB4 B;  1XD4 A;  4C0A A;  5KQ1 A;  3A8Q A;  5DHA B;  4HAT B;  2DHK A;  2D9Y A;  4MY6 A;  5J3Y A;  3U8Z A;  3ULC A;  1I7A A;  2UZR A;  4P7I A;  2N23 A;  4ZRK A;  3CIK A;  4D0N B;  3PG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...