4GMXB

Crystal structure of kpt185 in complex with crm1-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
TMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Selective inhibitors of nuclear export show that CRM1/XPO1 is a target in chronic lymphocytic leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gmxB00
5HE3A 5LONB 2CRFA 1M7RA 3DXCA 4A6FB 4HAWB 2I1KA 2Z0OA 4KHBB 3V5WA 1PMSA 3AU4A 1U29A 1SGHA 3QWMA 1RJ2A 1I2HA 5C5BB 2ELAA 1WJ1A 3QBVB 3GYPA 3WA0A 3FEHA 1UPQA 4IAPA 3FM8C 2D9VA 4ZRIA 1V88A 5HE1A 2AEHA 3SUZA 2YT1A 3ULCA 1Y5OA 1XODA 1NI2A 2DHJA 1U5DA 1LW3A 4F7HA 3VOQA 2UZSA 2CY4A 1PLSA 2ZPYA 3ML4A 1Y19B 2DHKA 2D11A 2L2IA 2UZRA 1UPRA 4HAXB 2AL6A 1KZ7A 1DROA 2GJYA 2CAYA 1DBHA 2G35A 2J0MA 1Q67A 1AQCA 4HAZB 3ODOA 3IVFA 5HE0A 1X86A 3RCPA 4HB3B 2QKMA 4K81A 4KAXB 2VKIA 4GZUA 3AU5A 2ROZB 3CXBB 1EF1A 4MY6A 5CLLB 1ZC4B 1FB8A 1PFJA 4CYEA 2P8VA 1FHOA 1OMWA 2PZ1A 3KZ1A 4F7UP 2D9WA 3DXDA 2D4QA 2RVBB 1ZM0A 3QIJA 2YS3A 2K00A 3PZDA 2YVCA 1I7AA 1W1GA 1U5FA 5J3YA 4WVFB 2DN6A 3KRWA 2QKLA 4HAYB 1V61A 4HB2B 2DX1A 1NTYA 1V5MA 4EKUA 1ZSQA 4DX90 4EMOA 2H7EA 3VIAA 1H10A 1MAIA 2DX5A 2GS0A 2NZ8B 4YL8A 2DKQA 2KGXB 1X1GA 2HE7A 4A5KA 1X05A 2LKOA 2ELBA 3UZTA 4KHOA 3TW1A 2W2WA 3A98B 4DX8A 2LOXA 4P7IA 4K2OA 3NSUA 5JHGA 1TQZA 1WI1A 5KQ4A 1W1HA 4HHVA 3ULBA 2Y8GA 2X18A 5HE2A 2K2UA 4XWXA 3SO6A 2E2XA 1ZC3B 2J0KA 4GN1A 1TJ6A 2MKRA 3TCAA 5JHHA 2LG1A 4Z2NA 3N7CA 1J19A 3FSSA 3HK0A 1FOEA 1LB1A 3A8PA 5D27A 3LJUX 1MPHA 5CLQB 4GMXB 1SHCA 2KCJA 5KCVA 4IFSA 2D9ZA 1EVHA 4YONA 2MWNB 1XD4A 2EC1A 2YRYA 1ZVRA 2ADZA 2CODA 2I1JA 5KQ1A 5D3XA 3WYFB 3MDBC 3MPXA 2ROVA 5JLJB 4HAUB 2HTHB 1XKEA 2DHIA 2LOZA 2D2QA 1MIZB 1DDWA 3TVVA 3PVLA 1BWNA 1BTNA 1Z87A 4HATB 2GCJA 4MK0A 4H8SA 2IFSA 1H4RA 1DDVA 3A8QA 2EMTA 3O96A 4A6KA 3HW2B 1WG7A 1UNPA 1M7EA 2R09A 2P0FA 2YS5A 3PVWA 3T06A 2V76A 2MFQA 3D8EA 2Z0QA 3SV1A 1U2BA 2Y8FA 3SNHA 2XQNM 4WSFA 4IOYX 1MK9B 2IYBA 2OTXA 3PP2A 2D9YA 2FJLA 4HAVB 2Z0PA 3ZDTA 2RGNB 3PEGA 3TFMA 3F5RA 3U8ZA 3KY9A 4DXAB 2DLWA 2DTCA 2N0YA 5DIFB 5L81A 5DHFB 2N23A 2R0DA 5D3YA 1U5EA 4HDQA 2LYDA 1UNRA 5D3VA 1UEFA 4TKNA 4PNKA 1MK7B 4HB0B 3SYXA 4CHMA 2RLOA 1N3HA 2YF0A 2YS1A 1QC6A 4BBKA 4KHAA 3U7DA 5FI1A 1NU2A 3G9WA 1XCGA 5DH9B 4D0NB 5FI0A 2JP2A 3X23A 3P6AA 4KVGB 4GXBA 2DKPA 3AJ4A 1FHXA 3PVUA 1AWEA 1E5WA 2J0JA 1V89A 4CHJA 2KUPA 4B6HA 1FGYA 1EAZA 2P0DA 5GOWB 4A6HA 1WJMA 1P3RA 5D3WA 5DHAB 1V5PA 1TXDA 1FAOA 2COFA 3KRXA 3D8FA 4MT7A 1U5GA 5J3QA 4K17A 1NTVA 3CIKA 2CY5A 3P7ZA 1DDMA 4F7GA 1FHWA 1DYNA 5C6RA 4WJ7A 2UVMA 1J0WA 3D8DA 4GMVA 2OQBA 3ZVRA 2H7DA 2RSGA 4ZRJA 2Y7BA 1OY2A 2VRWB 1XR0B 2DYQA 2YT0A 3BJIA 2I5FA 2W2XC 4DBBA 1OQNA 1P5TA 1KI1B 3F0WA 1U27A 3DXEA 2EMSA 2K2JA 3ODXA 5C79A 2COCA 2EJ8A 3HQCA 4NSWA 2Q13A 2COAA 2I5CA 2NMBA 1V5UA 4GPTB 3BINA 2RNRB 1ISNA 5J3TA 1P6SA 4ZRKA 3TO1A 1GC6A 1MIXA 4PQ0A 4A6FA 5DI9B 1EGXA 4K2PA 2YSZA 1WVHA 2BCJA 4Y94A 1QQGA 1B55A 5EFXA 5JP4A 2W2XD 1RRPB 2D9XA 2LULA 3ODWA 3PSCA 5LOPB 2DFKA 2MDXA 1UNQA 1MKEA 4C0AA 5C5BA 1FGZA 2P0HA 4HDOA 1KZGA 3M1IB 1XX0A 5C16A 1K5DB 1X11A 4Z2MB 1K5GB 2GCLA 1WGUA 3KSYA 1BAKA 4L6EA 4EJNA 1X1FA 2DA0A 3OANA 2VSZA 1W1DA 1GG3A 1IRSA 1GC7A 2D10A 2M38A 2J59M 2L1CA 4TYZA 3PG7A 1WGQA 1BTKA 2RUKB 3GYOA 4HB4B 2DYNA 4NY0A 2M14A
chains in the Genus database with same CATH superfamily
5M4YB 5HE3A 5LONB 2CRFA 1M7RA 3U12A 2K49A 3DXCA 4A6FB 4HAWB 2I1KA 2Z0OA 4KHBB 3V5WA 1PMSA 3AU4A 1U29A 1SGHA 3QWMA 1RJ2A 1I2HA 5C5BB 2ELAA 1WJ1A 3QBVB 3GYPA 3WA0A 3FEHA 1UPQA 4IAPA 3FM8C 2D9VA 4ZRIA 1V88A 5HE1A 2AEHA 3SUZA 2YT1A 3ULCA 1Y5OA 1XODA 1NI2A 2DHJA 1U5DA 1LW3A 4F7HA 3VOQA 2UZSA 2CY4A 1PLSA 2ZPYA 3ML4A 1Y19B 2DHKA 2D11A 2L2IA 2UZRA 1UPRA 4HAXB 2AL6A 1MI1A 1KZ7A 1DROA 2RRFA 2GJYA 2CAYA 1DBHA 2G35A 2J0MA 1Q67A 1AQCA 2R2YA 4HAZB 3ODOA 3IVFA 5HE0A 1X86A 3RCPA 4HB3B 2QKMA 4K81A 4KAXB 2VKIA 4GZUA 3AU5A 2ROZB 3CXBB 1EF1A 4MY6A 5CLLB 1ZC4B 1FB8A 1PFJA 4CYEA 2P8VA 2Z59A 1FHOA 1OMWA 2PZ1A 3KZ1A 4F7UP 2D9WA 3DXDA 2D4QA 2RVBB 1ZM0A 3QIJA 2YS3A 2KR0A 4QJ3B 4OSNA 2KIEA 2K00A 3PZDA 2YVCA 1I7AA 1W1GA 1U5FA 5J3YA 4WVFB 2DN6A 3KRWA 2QKLA 4GOUA 4HAYB 1V61A 4HB2B 2DX1A 1NTYA 1V5MA 4EKUA 1ZSQA 4DX90 4EMOA 2H7EA 3VIAA 1H10A 1MAIA 2DX5A 2GS0A 2NZ8B 4YL8A 2DKQA 4QXAB 4L1RA 2KGXB 1X1GA 2HE7A 4A5KA 1X05A 2LKOA 2ELBA 4QJ5B 3UZTA 4KHOA 3TW1A 2W2WA 3A98B 4DX8A 2LOXA 4P7IA 4K2OA 2KUQA 3NSUA 5JHGA 1TQZA 2NBVA 1WI1A 5KQ4A 1W1HA 4HHVA 3ULBA 2Y8GA 2X18A 5HE2A 2K2UA 4XWXA 3SO6A 2E2XA 1ZC3B 2J0KA 4GN1A 1TJ6A 2MKRA 3TCAA 5JHHA 2LG1A 5LG4B 4Z2NA 3N7CA 1J19A 3FSSA 3HK0A 1FOEA 1LB1A 3A8PA 5D27A 3LJUX 1MPHA 5CLQB 4GMXB 1SHCA 2KCJA 5KCVA 4IFSA 2D9ZA 1EVHA 4YONA 2MWNB 1XD4A 2EC1A 2YRYA 1ZVRA 2ADZA 2CODA 2I1JA 5KQ1A 5D3XA 3WYFB 2Z14A 2YT2A 3MDBC 3MPXA 2ROVA 5JLJB 4HAUB 2HTHB 1XKEA 2DHIA 2LOZA 2D2QA 1MIZB 1DDWA 3TVVA 3PVLA 1BWNA 1BTNA 1Z87A 4HATB 2GCJA 4MK0A 4H8SA 2IFSA 1H4RA 1DDVA 3A8QA 2EMTA 3O96A 4A6KA 3HW2B 3OHMB 1WG7A 1UNPA 1M7EA 2R09A 2P0FA 2YS5A 3PVWA 3T06A 2V76A 5IRSA 2MFQA 3D8EA 2Z0QA 3SV1A 1ZYIA 1U2BA 2Y8FA 3SNHA 2XQNM 4QJ4B 4WSFA 3NW8A 4IOYX 1MK9B 2IYBA 2OTXA 3PP2A 2D9YA 2FJLA 4HAVB 2Z0PA 3ZDTA 2RGNB 4GNKB 3NWDA 3PEGA 3TFMA 3F5RA 3U8ZA 4HSIA 3KY9A 2KIGA 4DIXA 4DXAB 2DLWA 2DTCA 2N0YA 5DIFB 5L81A 5DHFB 2N23A 2R0DA 5D3YA 1U5EA 4HDQA 2ZKMX 2LYDA 1UNRA 5D3VA 1UEFA 4TKNA 4PNKA 1MK7B 4HB0B 3FVCA 3SYXA 4OT1A 4CHMA 2RLOA 1N3HA 2YF0A 2YS1A 1QC6A 4BBKA 4KHAA 3U7DA 5FI1A 1NU2A 3G9WA 1XCGA 5DH9B 4D0NB 5FI0A 2JP2A 3X23A 3P6AA 4KVGB 4GXBA 2DKPA 3AJ4A 1FHXA 3A58A 5I2SA 3PVUA 1AWEA 1E5WA 2J0JA 1V89A 4CHJA 2K8EA 2KUPA 4B6HA 1FGYA 1EAZA 2P0DA 5GOWB 4A6HA 1WJMA 1P3RA 3B77A 3HIEA 5D3WA 5DHAB 1V5PA 1TXDA 1FAOA 2COFA 3KRXA 3D8FA 4MT7A 1U5GA 5J3QA 4K17A 1NTVA 3CIKA 2CY5A 3P7ZA 1DDMA 4F7GA 1FHWA 1DYNA 5C6RA 4WJ7A 2UVMA 1J0WA 3DCXA 3D8DA 4GMVA 2OQBA 3ZVRA 2H7DA 2RSGA 4ZRJA 2Y7BA 2Z13A 1OY2A 2VRWB 1XR0B 2DYQA 2YT0A 3BJIA 2I5FA 2W2XC 4DBBA 1OQNA 1P5TA 1KI1B 4CSQA 3F0WA 1U27A 3DXEA 2EMSA 2K2JA 3ODXA 5C79A 2COCA 2EJ8A 5I2MA 3HQCA 4NSWA 2Q13A 2COAA 2I5CA 2NMBA 1V5UA 4GPTB 3BINA 2RNRB 1ISNA 5J3TA 2GUMA 1P6SA 4ZRKA 3TO1A 1GC6A 3NWAA 1T77A 1MIXA 4PQ0A 4A6FA 5DI9B 1EGXA 4K2PA 2YSZA 1WVHA 2BCJA 4Y94A 1QQGA 4KHBA 1B55A 5EFXA 4D6WA 5JP4A 2W2XD 1RRPB 2D9XA 2LULA 3ODWA 3PSCA 5LOPB 2DFKA 2MDXA 1UNQA 1MKEA 4C0AA 5C5BA 1FGZA 2P0HA 4HDOA 1KZGA 3M1IB 1XX0A 5C16A 1K5DB 1X11A 4Z2MB 1K5GB 2GCLA 1WGUA 3KSYA 1BAKA 4L6EA 4EJNA 1X1FA 2DA0A 3OANA 2VSZA 3HSAA 1W1DA 1GG3A 1IRSA 2Z4DA 1GC7A 2D10A 2M38A 2J59M 2FJUB 2L1CA 4TYZA 3PG7A 1WGQA 1BTKA 2RUKB 3GYOA 4HB4B 2DYNA 3NWFA 4NY0A 2M14A
chains in the Genus database with same CATH topology
5HE3A 5LONB 2CRFA 1M7RA 3DXCA 4A6FB 4HAWB 2I1KA 2Z0OA 4KHBB 3V5WA 1PMSA 3AU4A 1U29A 1SGHA 3QWMA 1RJ2A 1I2HA 5C5BB 2ELAA 1WJ1A 3QBVB 3GYPA 3WA0A 3FEHA 1UPQA 4IAPA 3FM8C 2D9VA 4ZRIA 1V88A 5HE1A 2AEHA 3SUZA 2YT1A 3ULCA 1Y5OA 1XODA 1NI2A 2DHJA 1U5DA 1LW3A 4F7HA 3VOQA 2UZSA 2CY4A 1PLSA 2ZPYA 3ML4A 1Y19B 2DHKA 2D11A 2L2IA 2UZRA 1UPRA 4HAXB 2AL6A 1KZ7A 1DROA 2GJYA 2CAYA 1DBHA 2G35A 2J0MA 1Q67A 1AQCA 4HAZB 3ODOA 3IVFA 5HE0A 1X86A 3RCPA 4HB3B 2QKMA 4K81A 4KAXB 2VKIA 4GZUA 3AU5A 2ROZB 3CXBB 1EF1A 4MY6A 5CLLB 1ZC4B 1FB8A 1PFJA 4CYEA 2P8VA 1FHOA 1OMWA 2PZ1A 3KZ1A 4F7UP 2D9WA 3DXDA 2D4QA 2RVBB 1ZM0A 3QIJA 2YS3A 2K00A 3PZDA 2YVCA 1I7AA 1W1GA 1U5FA 5J3YA 4WVFB 2DN6A 3KRWA 2QKLA 4HAYB 1V61A 4HB2B 2DX1A 1NTYA 1V5MA 4EKUA 1ZSQA 4DX90 4EMOA 2H7EA 3VIAA 1H10A 1MAIA 2DX5A 2GS0A 2NZ8B 4YL8A 2DKQA 2KGXB 1X1GA 2HE7A 4A5KA 1X05A 2LKOA 2ELBA 3UZTA 4KHOA 3TW1A 2W2WA 3A98B 4DX8A 2LOXA 4P7IA 4K2OA 3NSUA 5JHGA 1TQZA 1WI1A 5KQ4A 1W1HA 4HHVA 3ULBA 2Y8GA 2X18A 5HE2A 2K2UA 4XWXA 3SO6A 2E2XA 1ZC3B 2J0KA 4GN1A 1TJ6A 2MKRA 3TCAA 5JHHA 2LG1A 4Z2NA 3N7CA 1J19A 3FSSA 3HK0A 1FOEA 1LB1A 3A8PA 5D27A 3LJUX 1MPHA 5CLQB 4GMXB 1SHCA 2KCJA 5KCVA 4IFSA 2D9ZA 1EVHA 4YONA 2MWNB 1XD4A 2EC1A 2YRYA 1ZVRA 2ADZA 2CODA 2I1JA 5KQ1A 5D3XA 3WYFB 3MDBC 3MPXA 2ROVA 5JLJB 4HAUB 2HTHB 1XKEA 2DHIA 2LOZA 2D2QA 1MIZB 1DDWA 3TVVA 3PVLA 1BWNA 1BTNA 1Z87A 4HATB 2GCJA 4MK0A 4H8SA 2IFSA 1H4RA 1DDVA 3A8QA 2EMTA 3O96A 4A6KA 3HW2B 1WG7A 1UNPA 1M7EA 2R09A 2P0FA 2YS5A 3PVWA 3T06A 2V76A 2MFQA 3D8EA 2Z0QA 3SV1A 1U2BA 2Y8FA 3SNHA 2XQNM 4WSFA 4IOYX 1MK9B 2IYBA 2OTXA 3PP2A 2D9YA 2FJLA 4HAVB 2Z0PA 3ZDTA 2RGNB 3PEGA 3TFMA 3F5RA 3U8ZA 3KY9A 4DXAB 2DLWA 2DTCA 2N0YA 5DIFB 5L81A 5DHFB 2N23A 2R0DA 5D3YA 1U5EA 4HDQA 2LYDA 1UNRA 5D3VA 1UEFA 4TKNA 4PNKA 1MK7B 4HB0B 3SYXA 4CHMA 2RLOA 1N3HA 2YF0A 2YS1A 1QC6A 4BBKA 4KHAA 3U7DA 5FI1A 1NU2A 3G9WA 1XCGA 5DH9B 4D0NB 5FI0A 2JP2A 3X23A 3P6AA 4KVGB 4GXBA 2DKPA 3AJ4A 1FHXA 3PVUA 1AWEA 1E5WA 2J0JA 1V89A 4CHJA 2KUPA 4B6HA 1FGYA 1EAZA 2P0DA 5GOWB 4A6HA 1WJMA 1P3RA 5D3WA 5DHAB 1V5PA 1TXDA 1FAOA 2COFA 3KRXA 3D8FA 4MT7A 1U5GA 5J3QA 4K17A 1NTVA 3CIKA 2CY5A 3P7ZA 1DDMA 4F7GA 1FHWA 1DYNA 5C6RA 4WJ7A 2UVMA 1J0WA 3D8DA 4GMVA 2OQBA 3ZVRA 2H7DA 2RSGA 4ZRJA 2Y7BA 1OY2A 2VRWB 1XR0B 2DYQA 2YT0A 3BJIA 2I5FA 2W2XC 4DBBA 1OQNA 1P5TA 1KI1B 3F0WA 1U27A 3DXEA 2EMSA 2K2JA 3ODXA 5C79A 2COCA 2EJ8A 3HQCA 4NSWA 2Q13A 2COAA 2I5CA 2NMBA 1V5UA 4GPTB 3BINA 2RNRB 1ISNA 5J3TA 1P6SA 4ZRKA 3TO1A 1GC6A 1MIXA 4PQ0A 4A6FA 5DI9B 1EGXA 4K2PA 2YSZA 1WVHA 2BCJA 4Y94A 1QQGA 1B55A 5EFXA 5JP4A 2W2XD 1RRPB 2D9XA 2LULA 3ODWA 3PSCA 5LOPB 2DFKA 2MDXA 1UNQA 1MKEA 4C0AA 5C5BA 1FGZA 2P0HA 4HDOA 1KZGA 3M1IB 1XX0A 5C16A 1K5DB 1X11A 4Z2MB 1K5GB 2GCLA 1WGUA 3KSYA 1BAKA 4L6EA 4EJNA 1X1FA 2DA0A 3OANA 2VSZA 1W1DA 1GG3A 1IRSA 1GC7A 2D10A 2M38A 2J59M 2L1CA 4TYZA 3PG7A 1WGQA 1BTKA 2RUKB 3GYOA 4HB4B 2DYNA 4NY0A 2M14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE3 A;  5LON B;  2CRF A;  1M7R A;  3DXC A;  4A6F B;  4HAW B;  2I1K A;  2Z0O A;  4KHB B;  3V5W A;  1PMS A;  3AU4 A;  1U29 A;  1SGH A;  3QWM A;  1RJ2 A;  1I2H A;  5C5B B;  2ELA A;  1WJ1 A;  3QBV B;  3GYP A;  3WA0 A;  3FEH A;  1UPQ A;  4IAP A;  3FM8 C;  2D9V A;  4ZRI A;  1V88 A;  5HE1 A;  2AEH A;  3SUZ A;  2YT1 A;  3ULC A;  1Y5O A;  1XOD A;  1NI2 A;  2DHJ A;  1U5D A;  1LW3 A;  4F7H A;  3VOQ A;  2UZS A;  2CY4 A;  1PLS A;  2ZPY A;  3ML4 A;  1Y19 B;  2DHK A;  2D11 A;  2L2I A;  2UZR A;  1UPR A;  4HAX B;  2AL6 A;  1KZ7 A;  1DRO A;  2GJY A;  2CAY A;  1DBH A;  2G35 A;  2J0M A;  1Q67 A;  1AQC A;  4HAZ B;  3ODO A;  3IVF A;  5HE0 A;  1X86 A;  3RCP A;  4HB3 B;  2QKM A;  4K81 A;  4KAX B;  2VKI A;  4GZU A;  3AU5 A;  2ROZ B;  3CXB B;  1EF1 A;  4MY6 A;  5CLL B;  1ZC4 B;  1FB8 A;  1PFJ A;  4CYE A;  2P8V A;  1FHO A;  1OMW A;  2PZ1 A;  3KZ1 A;  4F7U P;  2D9W A;  3DXD A;  2D4Q A;  2RVB B;  1ZM0 A;  3QIJ A;  2YS3 A;  2K00 A;  3PZD A;  2YVC A;  1I7A A;  1W1G A;  1U5F A;  5J3Y A;  4WVF B;  2DN6 A;  3KRW A;  2QKL A;  4HAY B;  1V61 A;  4HB2 B;  2DX1 A;  1NTY A;  1V5M A;  4EKU A;  1ZSQ A;  4DX9 0;  4EMO A;  2H7E A;  3VIA A;  1H10 A;  1MAI A;  2DX5 A;  2GS0 A;  2NZ8 B;  4YL8 A;  2DKQ A;  2KGX B;  1X1G A;  2HE7 A;  4A5K A;  1X05 A;  2LKO A;  2ELB A;  3UZT A;  4KHO A;  3TW1 A;  2W2W A;  3A98 B;  4DX8 A;  2LOX A;  4P7I A;  4K2O A;  3NSU A;  5JHG A;  1TQZ A;  1WI1 A;  5KQ4 A;  1W1H A;  4HHV A;  3ULB A;  2Y8G A;  2X18 A;  5HE2 A;  2K2U A;  4XWX A;  3SO6 A;  2E2X A;  1ZC3 B;  2J0K A;  4GN1 A;  1TJ6 A;  2MKR A;  3TCA A;  5JHH A;  2LG1 A;  4Z2N A;  3N7C A;  1J19 A;  3FSS A;  3HK0 A;  1FOE A;  1LB1 A;  3A8P A;  5D27 A;  3LJU X;  1MPH A;  5CLQ B;  4GMX B;  1SHC A;  2KCJ A;  5KCV A;  4IFS A;  2D9Z A;  1EVH A;  4YON A;  2MWN B;  1XD4 A;  2EC1 A;  2YRY A;  1ZVR A;  2ADZ A;  2COD A;  2I1J A;  5KQ1 A;  5D3X A;  3WYF B;  3MDB C;  3MPX A;  2ROV A;  5JLJ B;  4HAU B;  2HTH B;  1XKE A;  2DHI A;  2LOZ A;  2D2Q A;  1MIZ B;  1DDW A;  3TVV A;  3PVL A;  1BWN A;  1BTN A;  1Z87 A;  4HAT B;  2GCJ A;  4MK0 A;  4H8S A;  2IFS A;  1H4R A;  1DDV A;  3A8Q A;  2EMT A;  3O96 A;  4A6K A;  3HW2 B;  1WG7 A;  1UNP A;  1M7E A;  2R09 A;  2P0F A;  2YS5 A;  3PVW A;  3T06 A;  2V76 A;  2MFQ A;  3D8E A;  2Z0Q A;  3SV1 A;  1U2B A;  2Y8F A;  3SNH A;  2XQN M;  4WSF A;  4IOY X;  1MK9 B;  2IYB A;  2OTX A;  3PP2 A;  2D9Y A;  2FJL A;  4HAV B;  2Z0P A;  3ZDT A;  2RGN B;  3PEG A;  3TFM A;  3F5R A;  3U8Z A;  3KY9 A;  4DXA B;  2DLW A;  2DTC A;  2N0Y A;  5DIF B;  5L81 A;  5DHF B;  2N23 A;  2R0D A;  5D3Y A;  1U5E A;  4HDQ A;  2LYD A;  1UNR A;  5D3V A;  1UEF A;  4TKN A;  4PNK A;  1MK7 B;  4HB0 B;  3SYX A;  4CHM A;  2RLO A;  1N3H A;  2YF0 A;  2YS1 A;  1QC6 A;  4BBK A;  4KHA A;  3U7D A;  5FI1 A;  1NU2 A;  3G9W A;  1XCG A;  5DH9 B;  4D0N B;  5FI0 A;  2JP2 A;  3X23 A;  3P6A A;  4KVG B;  4GXB A;  2DKP A;  3AJ4 A;  1FHX A;  3PVU A;  1AWE A;  1E5W A;  2J0J A;  1V89 A;  4CHJ A;  2KUP A;  4B6H A;  1FGY A;  1EAZ A;  2P0D A;  5GOW B;  4A6H A;  1WJM A;  1P3R A;  5D3W A;  5DHA B;  1V5P A;  1TXD A;  1FAO A;  2COF A;  3KRX A;  3D8F A;  4MT7 A;  1U5G A;  5J3Q A;  4K17 A;  1NTV A;  3CIK A;  2CY5 A;  3P7Z A;  1DDM A;  4F7G A;  1FHW A;  1DYN A;  5C6R A;  4WJ7 A;  2UVM A;  1J0W A;  3D8D A;  4GMV A;  2OQB A;  3ZVR A;  2H7D A;  2RSG A;  4ZRJ A;  2Y7B A;  1OY2 A;  2VRW B;  1XR0 B;  2DYQ A;  2YT0 A;  3BJI A;  2I5F A;  2W2X C;  4DBB A;  1OQN A;  1P5T A;  1KI1 B;  3F0W A;  1U27 A;  3DXE A;  2EMS A;  2K2J A;  3ODX A;  5C79 A;  2COC A;  2EJ8 A;  3HQC A;  4NSW A;  2Q13 A;  2COA A;  2I5C A;  2NMB A;  1V5U A;  4GPT B;  3BIN A;  2RNR B;  1ISN A;  5J3T A;  1P6S A;  4ZRK A;  3TO1 A;  1GC6 A;  1MIX A;  4PQ0 A;  4A6F A;  5DI9 B;  1EGX A;  4K2P A;  2YSZ A;  1WVH A;  2BCJ A;  4Y94 A;  1QQG A;  1B55 A;  5EFX A;  5JP4 A;  2W2X D;  1RRP B;  2D9X A;  2LUL A;  3ODW A;  3PSC A;  5LOP B;  2DFK A;  2MDX A;  1UNQ A;  1MKE A;  4C0A A;  5C5B A;  1FGZ A;  2P0H A;  4HDO A;  1KZG A;  3M1I B;  1XX0 A;  5C16 A;  1K5D B;  1X11 A;  4Z2M B;  1K5G B;  2GCL A;  1WGU A;  3KSY A;  1BAK A;  4L6E A;  4EJN A;  1X1F A;  2DA0 A;  3OAN A;  2VSZ A;  1W1D A;  1GG3 A;  1IRS A;  1GC7 A;  2D10 A;  2M38 A;  2J59 M;  2L1C A;  4TYZ A;  3PG7 A;  1WGQ A;  1BTK A;  2RUK B;  3GYO A;  4HB4 B;  2DYN A;  4NY0 A;  2M14 A; 
#chains in the Genus database with same CATH topology
 5M4Y B;  5HE3 A;  5LON B;  2CRF A;  1M7R A;  3U12 A;  2K49 A;  3DXC A;  4A6F B;  4HAW B;  2I1K A;  2Z0O A;  4KHB B;  3V5W A;  1PMS A;  3AU4 A;  1U29 A;  1SGH A;  3QWM A;  1RJ2 A;  1I2H A;  5C5B B;  2ELA A;  1WJ1 A;  3QBV B;  3GYP A;  3WA0 A;  3FEH A;  1UPQ A;  4IAP A;  3FM8 C;  2D9V A;  4ZRI A;  1V88 A;  5HE1 A;  2AEH A;  3SUZ A;  2YT1 A;  3ULC A;  1Y5O A;  1XOD A;  1NI2 A;  2DHJ A;  1U5D A;  1LW3 A;  4F7H A;  3VOQ A;  2UZS A;  2CY4 A;  1PLS A;  2ZPY A;  3ML4 A;  1Y19 B;  2DHK A;  2D11 A;  2L2I A;  2UZR A;  1UPR A;  4HAX B;  2AL6 A;  1MI1 A;  1KZ7 A;  1DRO A;  2RRF A;  2GJY A;  2CAY A;  1DBH A;  2G35 A;  2J0M A;  1Q67 A;  1AQC A;  2R2Y A;  4HAZ B;  3ODO A;  3IVF A;  5HE0 A;  1X86 A;  3RCP A;  4HB3 B;  2QKM A;  4K81 A;  4KAX B;  2VKI A;  4GZU A;  3AU5 A;  2ROZ B;  3CXB B;  1EF1 A;  4MY6 A;  5CLL B;  1ZC4 B;  1FB8 A;  1PFJ A;  4CYE A;  2P8V A;  2Z59 A;  1FHO A;  1OMW A;  2PZ1 A;  3KZ1 A;  4F7U P;  2D9W A;  3DXD A;  2D4Q A;  2RVB B;  1ZM0 A;  3QIJ A;  2YS3 A;  2KR0 A;  4QJ3 B;  4OSN A;  2KIE A;  2K00 A;  3PZD A;  2YVC A;  1I7A A;  1W1G A;  1U5F A;  5J3Y A;  4WVF B;  2DN6 A;  3KRW A;  2QKL A;  4GOU A;  4HAY B;  1V61 A;  4HB2 B;  2DX1 A;  1NTY A;  1V5M A;  4EKU A;  1ZSQ A;  4DX9 0;  4EMO A;  2H7E A;  3VIA A;  1H10 A;  1MAI A;  2DX5 A;  2GS0 A;  2NZ8 B;  4YL8 A;  2DKQ A;  4QXA B;  4L1R A;  2KGX B;  1X1G A;  2HE7 A;  4A5K A;  1X05 A;  2LKO A;  2ELB A;  4QJ5 B;  3UZT A;  4KHO A;  3TW1 A;  2W2W A;  3A98 B;  4DX8 A;  2LOX A;  4P7I A;  4K2O A;  2KUQ A;  3NSU A;  5JHG A;  1TQZ A;  2NBV A;  1WI1 A;  5KQ4 A;  1W1H A;  4HHV A;  3ULB A;  2Y8G A;  2X18 A;  5HE2 A;  2K2U A;  4XWX A;  3SO6 A;  2E2X A;  1ZC3 B;  2J0K A;  4GN1 A;  1TJ6 A;  2MKR A;  3TCA A;  5JHH A;  2LG1 A;  5LG4 B;  4Z2N A;  3N7C A;  1J19 A;  3FSS A;  3HK0 A;  1FOE A;  1LB1 A;  3A8P A;  5D27 A;  3LJU X;  1MPH A;  5CLQ B;  4GMX B;  1SHC A;  2KCJ A;  5KCV A;  4IFS A;  2D9Z A;  1EVH A;  4YON A;  2MWN B;  1XD4 A;  2EC1 A;  2YRY A;  1ZVR A;  2ADZ A;  2COD A;  2I1J A;  5KQ1 A;  5D3X A;  3WYF B;  2Z14 A;  2YT2 A;  3MDB C;  3MPX A;  2ROV A;  5JLJ B;  4HAU B;  2HTH B;  1XKE A;  2DHI A;  2LOZ A;  2D2Q A;  1MIZ B;  1DDW A;  3TVV A;  3PVL A;  1BWN A;  1BTN A;  1Z87 A;  4HAT B;  2GCJ A;  4MK0 A;  4H8S A;  2IFS A;  1H4R A;  1DDV A;  3A8Q A;  2EMT A;  3O96 A;  4A6K A;  3HW2 B;  3OHM B;  1WG7 A;  1UNP A;  1M7E A;  2R09 A;  2P0F A;  2YS5 A;  3PVW A;  3T06 A;  2V76 A;  5IRS A;  2MFQ A;  3D8E A;  2Z0Q A;  3SV1 A;  1ZYI A;  1U2B A;  2Y8F A;  3SNH A;  2XQN M;  4QJ4 B;  4WSF A;  3NW8 A;  4IOY X;  1MK9 B;  2IYB A;  2OTX A;  3PP2 A;  2D9Y A;  2FJL A;  4HAV B;  2Z0P A;  3ZDT A;  2RGN B;  4GNK B;  3NWD A;  3PEG A;  3TFM A;  3F5R A;  3U8Z A;  4HSI A;  3KY9 A;  2KIG A;  4DIX A;  4DXA B;  2DLW A;  2DTC A;  2N0Y A;  5DIF B;  5L81 A;  5DHF B;  2N23 A;  2R0D A;  5D3Y A;  1U5E A;  4HDQ A;  2ZKM X;  2LYD A;  1UNR A;  5D3V A;  1UEF A;  4TKN A;  4PNK A;  1MK7 B;  4HB0 B;  3FVC A;  3SYX A;  4OT1 A;  4CHM A;  2RLO A;  1N3H A;  2YF0 A;  2YS1 A;  1QC6 A;  4BBK A;  4KHA A;  3U7D A;  5FI1 A;  1NU2 A;  3G9W A;  1XCG A;  5DH9 B;  4D0N B;  5FI0 A;  2JP2 A;  3X23 A;  3P6A A;  4KVG B;  4GXB A;  2DKP A;  3AJ4 A;  1FHX A;  3A58 A;  5I2S A;  3PVU A;  1AWE A;  1E5W A;  2J0J A;  1V89 A;  4CHJ A;  2K8E A;  2KUP A;  4B6H A;  1FGY A;  1EAZ A;  2P0D A;  5GOW B;  4A6H A;  1WJM A;  1P3R A;  3B77 A;  3HIE A;  5D3W A;  5DHA B;  1V5P A;  1TXD A;  1FAO A;  2COF A;  3KRX A;  3D8F A;  4MT7 A;  1U5G A;  5J3Q A;  4K17 A;  1NTV A;  3CIK A;  2CY5 A;  3P7Z A;  1DDM A;  4F7G A;  1FHW A;  1DYN A;  5C6R A;  4WJ7 A;  2UVM A;  1J0W A;  3DCX A;  3D8D A;  4GMV A;  2OQB A;  3ZVR A;  2H7D A;  2RSG A;  4ZRJ A;  2Y7B A;  2Z13 A;  1OY2 A;  2VRW B;  1XR0 B;  2DYQ A;  2YT0 A;  3BJI A;  2I5F A;  2W2X C;  4DBB A;  1OQN A;  1P5T A;  1KI1 B;  4CSQ A;  3F0W A;  1U27 A;  3DXE A;  2EMS A;  2K2J A;  3ODX A;  5C79 A;  2COC A;  2EJ8 A;  5I2M A;  3HQC A;  4NSW A;  2Q13 A;  2COA A;  2I5C A;  2NMB A;  1V5U A;  4GPT B;  3BIN A;  2RNR B;  1ISN A;  5J3T A;  2GUM A;  1P6S A;  4ZRK A;  3TO1 A;  1GC6 A;  3NWA A;  1T77 A;  1MIX A;  4PQ0 A;  4A6F A;  5DI9 B;  1EGX A;  4K2P A;  2YSZ A;  1WVH A;  2BCJ A;  4Y94 A;  1QQG A;  4KHB A;  1B55 A;  5EFX A;  4D6W A;  5JP4 A;  2W2X D;  1RRP B;  2D9X A;  2LUL A;  3ODW A;  3PSC A;  5LOP B;  2DFK A;  2MDX A;  1UNQ A;  1MKE A;  4C0A A;  5C5B A;  1FGZ A;  2P0H A;  4HDO A;  1KZG A;  3M1I B;  1XX0 A;  5C16 A;  1K5D B;  1X11 A;  4Z2M B;  1K5G B;  2GCL A;  1WGU A;  3KSY A;  1BAK A;  4L6E A;  4EJN A;  1X1F A;  2DA0 A;  3OAN A;  2VSZ A;  3HSA A;  1W1D A;  1GG3 A;  1IRS A;  2Z4D A;  1GC7 A;  2D10 A;  2M38 A;  2J59 M;  2FJU B;  2L1C A;  4TYZ A;  3PG7 A;  1WGQ A;  1BTK A;  2RUK B;  3GYO A;  4HB4 B;  2DYN A;  3NWF A;  4NY0 A;  2M14 A; 
#chains in the Genus database with same CATH homology
 5HE3 A;  5LON B;  2CRF A;  1M7R A;  3DXC A;  4A6F B;  4HAW B;  2I1K A;  2Z0O A;  4KHB B;  3V5W A;  1PMS A;  3AU4 A;  1U29 A;  1SGH A;  3QWM A;  1RJ2 A;  1I2H A;  5C5B B;  2ELA A;  1WJ1 A;  3QBV B;  3GYP A;  3WA0 A;  3FEH A;  1UPQ A;  4IAP A;  3FM8 C;  2D9V A;  4ZRI A;  1V88 A;  5HE1 A;  2AEH A;  3SUZ A;  2YT1 A;  3ULC A;  1Y5O A;  1XOD A;  1NI2 A;  2DHJ A;  1U5D A;  1LW3 A;  4F7H A;  3VOQ A;  2UZS A;  2CY4 A;  1PLS A;  2ZPY A;  3ML4 A;  1Y19 B;  2DHK A;  2D11 A;  2L2I A;  2UZR A;  1UPR A;  4HAX B;  2AL6 A;  1KZ7 A;  1DRO A;  2GJY A;  2CAY A;  1DBH A;  2G35 A;  2J0M A;  1Q67 A;  1AQC A;  4HAZ B;  3ODO A;  3IVF A;  5HE0 A;  1X86 A;  3RCP A;  4HB3 B;  2QKM A;  4K81 A;  4KAX B;  2VKI A;  4GZU A;  3AU5 A;  2ROZ B;  3CXB B;  1EF1 A;  4MY6 A;  5CLL B;  1ZC4 B;  1FB8 A;  1PFJ A;  4CYE A;  2P8V A;  1FHO A;  1OMW A;  2PZ1 A;  3KZ1 A;  4F7U P;  2D9W A;  3DXD A;  2D4Q A;  2RVB B;  1ZM0 A;  3QIJ A;  2YS3 A;  2K00 A;  3PZD A;  2YVC A;  1I7A A;  1W1G A;  1U5F A;  5J3Y A;  4WVF B;  2DN6 A;  3KRW A;  2QKL A;  4HAY B;  1V61 A;  4HB2 B;  2DX1 A;  1NTY A;  1V5M A;  4EKU A;  1ZSQ A;  4DX9 0;  4EMO A;  2H7E A;  3VIA A;  1H10 A;  1MAI A;  2DX5 A;  2GS0 A;  2NZ8 B;  4YL8 A;  2DKQ A;  2KGX B;  1X1G A;  2HE7 A;  4A5K A;  1X05 A;  2LKO A;  2ELB A;  3UZT A;  4KHO A;  3TW1 A;  2W2W A;  3A98 B;  4DX8 A;  2LOX A;  4P7I A;  4K2O A;  3NSU A;  5JHG A;  1TQZ A;  1WI1 A;  5KQ4 A;  1W1H A;  4HHV A;  3ULB A;  2Y8G A;  2X18 A;  5HE2 A;  2K2U A;  4XWX A;  3SO6 A;  2E2X A;  1ZC3 B;  2J0K A;  4GN1 A;  1TJ6 A;  2MKR A;  3TCA A;  5JHH A;  2LG1 A;  4Z2N A;  3N7C A;  1J19 A;  3FSS A;  3HK0 A;  1FOE A;  1LB1 A;  3A8P A;  5D27 A;  3LJU X;  1MPH A;  5CLQ B;  4GMX B;  1SHC A;  2KCJ A;  5KCV A;  4IFS A;  2D9Z A;  1EVH A;  4YON A;  2MWN B;  1XD4 A;  2EC1 A;  2YRY A;  1ZVR A;  2ADZ A;  2COD A;  2I1J A;  5KQ1 A;  5D3X A;  3WYF B;  3MDB C;  3MPX A;  2ROV A;  5JLJ B;  4HAU B;  2HTH B;  1XKE A;  2DHI A;  2LOZ A;  2D2Q A;  1MIZ B;  1DDW A;  3TVV A;  3PVL A;  1BWN A;  1BTN A;  1Z87 A;  4HAT B;  2GCJ A;  4MK0 A;  4H8S A;  2IFS A;  1H4R A;  1DDV A;  3A8Q A;  2EMT A;  3O96 A;  4A6K A;  3HW2 B;  1WG7 A;  1UNP A;  1M7E A;  2R09 A;  2P0F A;  2YS5 A;  3PVW A;  3T06 A;  2V76 A;  2MFQ A;  3D8E A;  2Z0Q A;  3SV1 A;  1U2B A;  2Y8F A;  3SNH A;  2XQN M;  4WSF A;  4IOY X;  1MK9 B;  2IYB A;  2OTX A;  3PP2 A;  2D9Y A;  2FJL A;  4HAV B;  2Z0P A;  3ZDT A;  2RGN B;  3PEG A;  3TFM A;  3F5R A;  3U8Z A;  3KY9 A;  4DXA B;  2DLW A;  2DTC A;  2N0Y A;  5DIF B;  5L81 A;  5DHF B;  2N23 A;  2R0D A;  5D3Y A;  1U5E A;  4HDQ A;  2LYD A;  1UNR A;  5D3V A;  1UEF A;  4TKN A;  4PNK A;  1MK7 B;  4HB0 B;  3SYX A;  4CHM A;  2RLO A;  1N3H A;  2YF0 A;  2YS1 A;  1QC6 A;  4BBK A;  4KHA A;  3U7D A;  5FI1 A;  1NU2 A;  3G9W A;  1XCG A;  5DH9 B;  4D0N B;  5FI0 A;  2JP2 A;  3X23 A;  3P6A A;  4KVG B;  4GXB A;  2DKP A;  3AJ4 A;  1FHX A;  3PVU A;  1AWE A;  1E5W A;  2J0J A;  1V89 A;  4CHJ A;  2KUP A;  4B6H A;  1FGY A;  1EAZ A;  2P0D A;  5GOW B;  4A6H A;  1WJM A;  1P3R A;  5D3W A;  5DHA B;  1V5P A;  1TXD A;  1FAO A;  2COF A;  3KRX A;  3D8F A;  4MT7 A;  1U5G A;  5J3Q A;  4K17 A;  1NTV A;  3CIK A;  2CY5 A;  3P7Z A;  1DDM A;  4F7G A;  1FHW A;  1DYN A;  5C6R A;  4WJ7 A;  2UVM A;  1J0W A;  3D8D A;  4GMV A;  2OQB A;  3ZVR A;  2H7D A;  2RSG A;  4ZRJ A;  2Y7B A;  1OY2 A;  2VRW B;  1XR0 B;  2DYQ A;  2YT0 A;  3BJI A;  2I5F A;  2W2X C;  4DBB A;  1OQN A;  1P5T A;  1KI1 B;  3F0W A;  1U27 A;  3DXE A;  2EMS A;  2K2J A;  3ODX A;  5C79 A;  2COC A;  2EJ8 A;  3HQC A;  4NSW A;  2Q13 A;  2COA A;  2I5C A;  2NMB A;  1V5U A;  4GPT B;  3BIN A;  2RNR B;  1ISN A;  5J3T A;  1P6S A;  4ZRK A;  3TO1 A;  1GC6 A;  1MIX A;  4PQ0 A;  4A6F A;  5DI9 B;  1EGX A;  4K2P A;  2YSZ A;  1WVH A;  2BCJ A;  4Y94 A;  1QQG A;  1B55 A;  5EFX A;  5JP4 A;  2W2X D;  1RRP B;  2D9X A;  2LUL A;  3ODW A;  3PSC A;  5LOP B;  2DFK A;  2MDX A;  1UNQ A;  1MKE A;  4C0A A;  5C5B A;  1FGZ A;  2P0H A;  4HDO A;  1KZG A;  3M1I B;  1XX0 A;  5C16 A;  1K5D B;  1X11 A;  4Z2M B;  1K5G B;  2GCL A;  1WGU A;  3KSY A;  1BAK A;  4L6E A;  4EJN A;  1X1F A;  2DA0 A;  3OAN A;  2VSZ A;  1W1D A;  1GG3 A;  1IRS A;  1GC7 A;  2D10 A;  2M38 A;  2J59 M;  2L1C A;  4TYZ A;  3PG7 A;  1WGQ A;  1BTK A;  2RUK B;  3GYO A;  4HB4 B;  2DYN A;  4NY0 A;  2M14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...