4GMXB

Crystal structure of kpt185 in complex with crm1-ran-ranbp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
b'TMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTNKVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGSKENADKFKEEFEKAQEINKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Selective inhibitors of nuclear export show that CRM1/XPO1 is a target in chronic lymphocytic leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00638 Ran_BP1 RanBP1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4gmxB00
3SNHA 3PZDA 4ZRJA 4GMXB 3IVFA 3PVWA 2YRYA 2E2XA 3AU5A 3GYOA 1ZC3B 1EGXA 2P0HA 2K00A 1WGQA 1KI1B 5D3VA 1WJMA 3AJ4A 1V89A 4HDOA 1N3HA 5FI1A 2D9YA 3ULCA 4YONA 5JP4A 2UZRA 1DYNA 4WVFB 1EAZA 2RNRB 3PSCA 4DX90 2YF0A 1KZGA 4GN1A 5J3TA 5KQ1A 5HE1A 2CY5A 4K81A 1M7EA 1U5FA 1UEFA 1MK9B 1W1DA 2RLOA 1UPQA 1W1GA 1AWEA 3ZVRA 2D2QA 2CAYA 2DHJA 3TCAA 2J0MA 4B6HA 3KY9A 3HQCA 1Y19B 2D10A 2VKIA 2Z0PA 2YSZA 2J0JA 1P3RA 2DKPA 1X1FA 2RVBB 2K2UA 3RCPA 3F0WA 4GXBA 4MT7A 1H4RA 5C5BA 1P5TA 5DI9B 4A6KA 2DHKA 4KHOA 4GZUA 1QC6A 1DDVA 4F7HA 1XD4A 3PEGA 2QKLA 4P7IA 3A8QA 1PFJA 3QBVB 1QQGA 2EJ8A 2G35A 4K2PA 4D0NB 5JLJB 4YL8A 1FHWA 3KZ1A 1MIXA 4ZRIA 5L81A 2GS0A 4C0AA 2YT0A 2ELBA 2ROVA 3BJIA 3ODWA 3PP2A 1BTKA 1LB1A 3FSSA 4HB3B 4HAYB 1BTNA 1AQCA 2YS3A 5CLLB 2I5FA 3CIKA 2H7DA 5JHGA 3M1IB 5CLQB 3TO1A 2DTCA 1J0WA 2LKOA 1UNRA 4MY6A 3NSUA 2MFQA 5HE2A 4DX8A 2ELAA 3WYFB 2Y8FA 1B55A 2DHIA 3TW1A 2DKQA 1U5GA 4Z2NA 2Y8GA 4GPTB 3QIJA 2EMSA 1UPRA 3KSYA 5LONB 1H10A 2X18A 4KAXB 2GCLA 3ODXA 3O96A 3DXDA 1UNQA 2CODA 2VSZA 4HHVA 4ZRKA 2KUPA 4A6FA 1Q67A 1V5UA 4A6HA 1LW3A 1X11A 3SV1A 2J0KA 5HE0A 2I1JA 5JHHA 3ML4A 3N7CA 2RSGA 2K2JA 1M7RA 5LOPB 1KZ7A 5KQ4A 2COCA 5KCVA 1X86A 4HATB 2D4QA 3FEHA 2YS1A 3ODOA 1OY2A 4KHAA 3WA0A 3MDBC 2Y7BA 1P6SA 2LULA 1V5PA 2D9WA 4TYZA 1FHOA 4Y94A 1W1HA 2DYNA 2ZPYA 4CYEA 2KGXB 3PVUA 1PLSA 2HTHB 2AL6A 4NSWA 1Y5OA 2D9VA 4K17A 1NTYA 2D9XA 1GC7A 2OQBA 5C5BB 3P6AA 2D11A 1WI1A 2M14A 1U5DA 2DX5A 1ZSQA 3SUZA 3A8PA 3DXCA 2AEHA 2R09A 2I1KA 3SYXA 3PG7A 2VRWB 1MK7B 4F7GA 2YT1A 4A5KA 2XQNM 1ZVRA 4NY0A 4DBBA 1FHXA 2MDXA 3VOQA 2EMTA 2MWNB 2RGNB 4KVGB 5DHFB 2L2IA 1RRPB 5DHAB 5DH9B 1U27A 1ZM0A 2PZ1A 3FM8C 3TVVA 2NMBA 3U8ZA 3A98B 4EKUA 1NTVA 1GG3A 2LYDA 2CRFA 4HAXB 3V5WA 2JP2A 3LJUX 1SHCA 4IFSA 1OMWA 4BBKA 1EF1A 5D3XA 2FJLA 3ULBA 4HAZB 5J3QA 1FB8A 1I2HA 2DN6A 1ZC4B 1WGUA 4WJ7A 3D8FA 1IRSA 4KHBB 2J59M 4PQ0A 5GOWB 2I5CA 2MKRA 2KCJA 2UVMA 2P8VA 1WJ1A 2BCJA 2YS5A 1DBHA 2P0DA 2N0YA 3HW2B 3T06A 1NI2A 1BAKA 3PVLA 4PNKA 1V88A 1V61A 4A6FB 1K5GB 5FI0A 2R0DA 4TKNA 3CXBB 1FGYA 1MKEA 1K5DB 1DROA 2P0FA 3X23A 3GYPA 4IOYX 2Q13A 1FAOA 2W2WA 4DXAB 2N23A 1Z87A 3D8EA 2LG1A 1ISNA 1TQZA 1NU2A 4HAWB 1V5MA 5HE3A 1DDMA 1U5EA 2ROZB 1PMSA 3HK0A 2UZSA 3OANA 1XCGA 4F7UP 1MAIA 1OQNA 3VIAA 4H8SA 2IYBA 2GJYA 2H7EA 3G9WA 4HB2B 1E5WA 5C79A 5D27A 3UZTA 2DFKA 3BINA 1DDWA 2EC1A 1RJ2A 4GMVA 4CHJA 3KRWA 3ZDTA 3U7DA 4Z2MB 2W2XC 1UNPA 4MK0A 2LOZA 1XX0A 3QWMA 5D3WA 2W2XD 1WG7A 3P7ZA 1TJ6A 2D9ZA 4HB0B 1SGHA 3TFMA 5D3YA 4XWXA 2RUKB 2OTXA 4EJNA 3F5RA 2DX1A 2M38A 2IFSA 2Z0QA 1TXDA 1XODA 1XR0B 2GCJA 3MPXA 4WSFA 1BWNA 1FGZA 2NZ8B 3D8DA 2ADZA 1FOEA 2COAA 1I7AA 1MIZB 5EFXA 1U29A 2YVCA 2Z0OA 3DXEA 2HE7A 2LOXA 2COFA 4HDQA 5C6RA 4IAPA 5DIFB 1EVHA 3KRXA 4EMOA 1XKEA 4L6EA 3AU4A 1MPHA 1GC6A 1U2BA 1J19A 3SO6A 1X1GA 2CY4A 2V76A 4HAVB 4HB4B 5C16A 4CHMA 2QKMA 2DA0A 4HAUB 5J3YA 1X05A 2DLWA 4K2OA 2L1CA 2DYQA 1WVHA
chains in the Genus database with same CATH superfamily
3SNHA 3PZDA 4ZRJA 3A58A 4GMXB 3IVFA 3PVWA 2YRYA 2E2XA 3AU5A 3GYOA 1ZC3B 1EGXA 2P0HA 2K00A 1WGQA 1KI1B 5D3VA 1WJMA 3AJ4A 1V89A 4HDOA 1N3HA 5FI1A 2D9YA 3ULCA 4YONA 5JP4A 5LG4B 2UZRA 4D6WA 1DYNA 4WVFB 1EAZA 2RNRB 3PSCA 4DX90 2YF0A 1KZGA 4GN1A 5J3TA 5KQ1A 5HE1A 2CY5A 4K81A 3NW8A 1M7EA 1U5FA 1UEFA 1MK9B 1W1DA 2RLOA 1UPQA 1W1GA 1AWEA 3ZVRA 2D2QA 2CAYA 2DHJA 3TCAA 2J0MA 4B6HA 3KY9A 3HQCA 1Y19B 2D10A 2VKIA 2Z0PA 2YSZA 2J0JA 1P3RA 2DKPA 2KIEA 1X1FA 2RVBB 4OT1A 2K2UA 3RCPA 3F0WA 4GXBA 4MT7A 1H4RA 2Z59A 5C5BA 1P5TA 5DI9B 4A6KA 2DHKA 4KHOA 4GZUA 1QC6A 1DDVA 4F7HA 1XD4A 3NWAA 3PEGA 2QKLA 4P7IA 3A8QA 1PFJA 3QBVB 1ZYIA 1QQGA 2EJ8A 2G35A 4K2PA 4D0NB 2YT2A 1T77A 5JLJB 4YL8A 1FHWA 3KZ1A 1MIXA 4ZRIA 5L81A 2GS0A 4C0AA 2YT0A 2ELBA 2ROVA 3BJIA 5IRSA 3ODWA 3PP2A 1BTKA 1LB1A 2GUMA 3FSSA 4HB3B 4HAYB 1BTNA 1AQCA 2YS3A 5CLLB 2I5FA 3CIKA 4QXAB 2H7DA 5JHGA 3M1IB 5CLQB 3TO1A 2DTCA 1J0WA 2LKOA 1UNRA 3DCXA 4MY6A 3NSUA 2MFQA 5HE2A 4DX8A 2ELAA 3WYFB 2Y8FA 1B55A 2DHIA 3TW1A 4KHBA 2DKQA 1U5GA 4Z2NA 2Y8GA 4GPTB 3QIJA 2EMSA 1UPRA 3KSYA 5LONB 1H10A 2X18A 4KAXB 2GCLA 3ODXA 3O96A 3DXDA 1UNQA 2CODA 2VSZA 4HHVA 4ZRKA 2KUPA 4A6FA 1Q67A 1V5UA 4A6HA 1LW3A 1X11A 3SV1A 2J0KA 5HE0A 2I1JA 5JHHA 2K49A 3ML4A 3N7CA 2RSGA 2K2JA 1M7RA 2ZKMX 2FJUB 5LOPB 1KZ7A 5KQ4A 2COCA 5KCVA 4QJ4B 3OHMB 1X86A 4HATB 2D4QA 2RRFA 3FEHA 2YS1A 3ODOA 1OY2A 4KHAA 3WA0A 3MDBC 2Y7BA 1P6SA 2LULA 1V5PA 2D9WA 4TYZA 1FHOA 4Y94A 1W1HA 2DYNA 2ZPYA 4CYEA 2KGXB 3PVUA 2R2YA 1PLSA 2HTHB 2AL6A 4NSWA 1Y5OA 2D9VA 4K17A 1NTYA 2D9XA 1GC7A 2NBVA 2OQBA 5C5BB 3P6AA 2D11A 1WI1A 2M14A 1U5DA 2DX5A 1ZSQA 2KUQA 3SUZA 3A8PA 3DXCA 2AEHA 2R09A 2I1KA 3SYXA 3PG7A 2VRWB 1MK7B 4F7GA 2YT1A 4A5KA 2XQNM 1ZVRA 4NY0A 4DBBA 1FHXA 2MDXA 3VOQA 2EMTA 2MWNB 2RGNB 3U12A 4KVGB 5DHFB 2L2IA 1RRPB 5DHAB 5DH9B 1U27A 1ZM0A 2PZ1A 3FM8C 3TVVA 2NMBA 3U8ZA 3A98B 4EKUA 1NTVA 1GG3A 2LYDA 2CRFA 4HAXB 3V5WA 2JP2A 3LJUX 1SHCA 4IFSA 1OMWA 4BBKA 1EF1A 5D3XA 2FJLA 3ULBA 4HAZB 5J3QA 1FB8A 1I2HA 2DN6A 1ZC4B 1WGUA 4WJ7A 3D8FA 1IRSA 4KHBB 2J59M 4PQ0A 5GOWB 2I5CA 2MKRA 2KCJA 2UVMA 2P8VA 4CSQA 1WJ1A 2BCJA 2YS5A 1DBHA 2P0DA 3HW2B 2N0YA 3T06A 1NI2A 1BAKA 4L1RA 3PVLA 5M4YB 4PNKA 1V88A 1V61A 4A6FB 1K5GB 5FI0A 2R0DA 4TKNA 3CXBB 1FGYA 1MKEA 1K5DB 1DROA 2P0FA 3X23A 3GYPA 5I2SA 3HIEA 4IOYX 2Q13A 1FAOA 2W2WA 4DXAB 2N23A 1Z87A 3HSAA 5I2MA 3D8EA 2LG1A 3FVCA 1ISNA 1TQZA 1NU2A 4HAWB 1V5MA 5HE3A 4QJ5B 1DDMA 1U5EA 2ROZB 1PMSA 3HK0A 2UZSA 3OANA 4GOUA 1XCGA 4F7UP 1MAIA 1OQNA 3VIAA 4H8SA 2KR0A 2IYBA 2GJYA 2H7EA 4GNKB 3G9WA 4HB2B 1E5WA 5C79A 5D27A 3UZTA 2DFKA 3BINA 1DDWA 2EC1A 1RJ2A 4GMVA 4CHJA 3KRWA 3ZDTA 3U7DA 4Z2MB 2W2XC 4HSIA 1UNPA 4MK0A 2LOZA 4QJ3B 1XX0A 3QWMA 5D3WA 3B77A 1MI1A 2W2XD 1WG7A 3P7ZA 3NWFA 1TJ6A 2D9ZA 4OSNA 4HB0B 1SGHA 3TFMA 2KIGA 2Z13A 5D3YA 4DIXA 4XWXA 2RUKB 2OTXA 4EJNA 3F5RA 2DX1A 2M38A 2IFSA 2Z0QA 1TXDA 1XODA 1XR0B 2GCJA 3MPXA 2Z14A 2Z4DA 4WSFA 1BWNA 1FGZA 2NZ8B 3D8DA 2ADZA 1FOEA 2COAA 1I7AA 1MIZB 5EFXA 1U29A 2YVCA 2Z0OA 3DXEA 2HE7A 2LOXA 2COFA 4HDQA 5C6RA 4IAPA 5DIFB 1EVHA 3KRXA 4EMOA 1XKEA 4L6EA 3AU4A 1MPHA 3NWDA 1GC6A 1U2BA 1J19A 3SO6A 1X1GA 2CY4A 2V76A 4HAVB 4HB4B 5C16A 4CHMA 2QKMA 2DA0A 4HAUB 5J3YA 1X05A 2DLWA 4K2OA 2L1CA 2K8EA 2DYQA 1WVHA
chains in the Genus database with same CATH topology
3SNHA 3PZDA 4ZRJA 4GMXB 3IVFA 3PVWA 2YRYA 2E2XA 3AU5A 3GYOA 1ZC3B 1EGXA 2P0HA 2K00A 1WGQA 1KI1B 5D3VA 1WJMA 3AJ4A 1V89A 4HDOA 1N3HA 5FI1A 2D9YA 3ULCA 4YONA 5JP4A 2UZRA 1DYNA 4WVFB 1EAZA 2RNRB 3PSCA 4DX90 2YF0A 1KZGA 4GN1A 5J3TA 5KQ1A 5HE1A 2CY5A 4K81A 1M7EA 1U5FA 1UEFA 1MK9B 1W1DA 2RLOA 1UPQA 1W1GA 1AWEA 3ZVRA 2D2QA 2CAYA 2DHJA 3TCAA 2J0MA 4B6HA 3KY9A 3HQCA 1Y19B 2D10A 2VKIA 2Z0PA 2YSZA 2J0JA 1P3RA 2DKPA 1X1FA 2RVBB 2K2UA 3RCPA 3F0WA 4GXBA 4MT7A 1H4RA 5C5BA 1P5TA 5DI9B 4A6KA 2DHKA 4KHOA 4GZUA 1QC6A 1DDVA 4F7HA 1XD4A 3PEGA 2QKLA 4P7IA 3A8QA 1PFJA 3QBVB 1QQGA 2EJ8A 2G35A 4K2PA 4D0NB 5JLJB 4YL8A 1FHWA 3KZ1A 1MIXA 4ZRIA 5L81A 2GS0A 4C0AA 2YT0A 2ELBA 2ROVA 3BJIA 3ODWA 3PP2A 1BTKA 1LB1A 3FSSA 4HB3B 4HAYB 1BTNA 1AQCA 2YS3A 5CLLB 2I5FA 3CIKA 2H7DA 5JHGA 3M1IB 5CLQB 3TO1A 2DTCA 1J0WA 2LKOA 1UNRA 4MY6A 3NSUA 2MFQA 5HE2A 4DX8A 2ELAA 3WYFB 2Y8FA 1B55A 2DHIA 3TW1A 2DKQA 1U5GA 4Z2NA 2Y8GA 4GPTB 3QIJA 2EMSA 1UPRA 3KSYA 5LONB 1H10A 2X18A 4KAXB 2GCLA 3ODXA 3O96A 3DXDA 1UNQA 2CODA 2VSZA 4HHVA 4ZRKA 2KUPA 4A6FA 1Q67A 1V5UA 4A6HA 1LW3A 1X11A 3SV1A 2J0KA 5HE0A 2I1JA 5JHHA 3ML4A 3N7CA 2RSGA 2K2JA 1M7RA 5LOPB 1KZ7A 5KQ4A 2COCA 5KCVA 1X86A 4HATB 2D4QA 3FEHA 2YS1A 3ODOA 1OY2A 4KHAA 3WA0A 3MDBC 2Y7BA 1P6SA 2LULA 1V5PA 2D9WA 4TYZA 1FHOA 4Y94A 1W1HA 2DYNA 2ZPYA 4CYEA 2KGXB 3PVUA 1PLSA 2HTHB 2AL6A 4NSWA 1Y5OA 2D9VA 4K17A 1NTYA 2D9XA 1GC7A 2OQBA 5C5BB 3P6AA 2D11A 1WI1A 2M14A 1U5DA 2DX5A 1ZSQA 3SUZA 3A8PA 3DXCA 2AEHA 2R09A 2I1KA 3SYXA 3PG7A 2VRWB 1MK7B 4F7GA 2YT1A 4A5KA 2XQNM 1ZVRA 4NY0A 4DBBA 1FHXA 2MDXA 3VOQA 2EMTA 2MWNB 2RGNB 4KVGB 5DHFB 2L2IA 1RRPB 5DHAB 5DH9B 1U27A 1ZM0A 2PZ1A 3FM8C 3TVVA 2NMBA 3U8ZA 3A98B 4EKUA 1NTVA 1GG3A 2LYDA 2CRFA 4HAXB 3V5WA 2JP2A 3LJUX 1SHCA 4IFSA 1OMWA 4BBKA 1EF1A 5D3XA 2FJLA 3ULBA 4HAZB 5J3QA 1FB8A 1I2HA 2DN6A 1ZC4B 1WGUA 4WJ7A 3D8FA 1IRSA 4KHBB 2J59M 4PQ0A 5GOWB 2I5CA 2MKRA 2KCJA 2UVMA 2P8VA 1WJ1A 2BCJA 2YS5A 1DBHA 2P0DA 2N0YA 3HW2B 3T06A 1NI2A 1BAKA 3PVLA 4PNKA 1V88A 1V61A 4A6FB 1K5GB 5FI0A 2R0DA 4TKNA 3CXBB 1FGYA 1MKEA 1K5DB 1DROA 2P0FA 3X23A 3GYPA 4IOYX 2Q13A 1FAOA 2W2WA 4DXAB 2N23A 1Z87A 3D8EA 2LG1A 1ISNA 1TQZA 1NU2A 4HAWB 1V5MA 5HE3A 1DDMA 1U5EA 2ROZB 1PMSA 3HK0A 2UZSA 3OANA 1XCGA 4F7UP 1MAIA 1OQNA 3VIAA 4H8SA 2IYBA 2GJYA 2H7EA 3G9WA 4HB2B 1E5WA 5C79A 5D27A 3UZTA 2DFKA 3BINA 1DDWA 2EC1A 1RJ2A 4GMVA 4CHJA 3KRWA 3ZDTA 3U7DA 4Z2MB 2W2XC 1UNPA 4MK0A 2LOZA 1XX0A 3QWMA 5D3WA 2W2XD 1WG7A 3P7ZA 1TJ6A 2D9ZA 4HB0B 1SGHA 3TFMA 5D3YA 4XWXA 2RUKB 2OTXA 4EJNA 3F5RA 2DX1A 2M38A 2IFSA 2Z0QA 1TXDA 1XODA 1XR0B 2GCJA 3MPXA 4WSFA 1BWNA 1FGZA 2NZ8B 3D8DA 2ADZA 1FOEA 2COAA 1I7AA 1MIZB 5EFXA 1U29A 2YVCA 2Z0OA 3DXEA 2HE7A 2LOXA 2COFA 4HDQA 5C6RA 4IAPA 5DIFB 1EVHA 3KRXA 4EMOA 1XKEA 4L6EA 3AU4A 1MPHA 1GC6A 1U2BA 1J19A 3SO6A 1X1GA 2CY4A 2V76A 4HAVB 4HB4B 5C16A 4CHMA 2QKMA 2DA0A 4HAUB 5J3YA 1X05A 2DLWA 4K2OA 2L1CA 2DYQA 1WVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SNH A;  3PZD A;  4ZRJ A;  4GMX B;  3IVF A;  3PVW A;  2YRY A;  2E2X A;  3AU5 A;  3GYO A;  1ZC3 B;  1EGX A;  2P0H A;  2K00 A;  1WGQ A;  1KI1 B;  5D3V A;  1WJM A;  3AJ4 A;  1V89 A;  4HDO A;  1N3H A;  5FI1 A;  2D9Y A;  3ULC A;  4YON A;  5JP4 A;  2UZR A;  1DYN A;  4WVF B;  1EAZ A;  2RNR B;  3PSC A;  4DX9 0;  2YF0 A;  1KZG A;  4GN1 A;  5J3T A;  5KQ1 A;  5HE1 A;  2CY5 A;  4K81 A;  1M7E A;  1U5F A;  1UEF A;  1MK9 B;  1W1D A;  2RLO A;  1UPQ A;  1W1G A;  1AWE A;  3ZVR A;  2D2Q A;  2CAY A;  2DHJ A;  3TCA A;  2J0M A;  4B6H A;  3KY9 A;  3HQC A;  1Y19 B;  2D10 A;  2VKI A;  2Z0P A;  2YSZ A;  2J0J A;  1P3R A;  2DKP A;  1X1F A;  2RVB B;  2K2U A;  3RCP A;  3F0W A;  4GXB A;  4MT7 A;  1H4R A;  5C5B A;  1P5T A;  5DI9 B;  4A6K A;  2DHK A;  4KHO A;  4GZU A;  1QC6 A;  1DDV A;  4F7H A;  1XD4 A;  3PEG A;  2QKL A;  4P7I A;  3A8Q A;  1PFJ A;  3QBV B;  1QQG A;  2EJ8 A;  2G35 A;  4K2P A;  4D0N B;  5JLJ B;  4YL8 A;  1FHW A;  3KZ1 A;  1MIX A;  4ZRI A;  5L81 A;  2GS0 A;  4C0A A;  2YT0 A;  2ELB A;  2ROV A;  3BJI A;  3ODW A;  3PP2 A;  1BTK A;  1LB1 A;  3FSS A;  4HB3 B;  4HAY B;  1BTN A;  1AQC A;  2YS3 A;  5CLL B;  2I5F A;  3CIK A;  2H7D A;  5JHG A;  3M1I B;  5CLQ B;  3TO1 A;  2DTC A;  1J0W A;  2LKO A;  1UNR A;  4MY6 A;  3NSU A;  2MFQ A;  5HE2 A;  4DX8 A;  2ELA A;  3WYF B;  2Y8F A;  1B55 A;  2DHI A;  3TW1 A;  2DKQ A;  1U5G A;  4Z2N A;  2Y8G A;  4GPT B;  3QIJ A;  2EMS A;  1UPR A;  3KSY A;  5LON B;  1H10 A;  2X18 A;  4KAX B;  2GCL A;  3ODX A;  3O96 A;  3DXD A;  1UNQ A;  2COD A;  2VSZ A;  4HHV A;  4ZRK A;  2KUP A;  4A6F A;  1Q67 A;  1V5U A;  4A6H A;  1LW3 A;  1X11 A;  3SV1 A;  2J0K A;  5HE0 A;  2I1J A;  5JHH A;  3ML4 A;  3N7C A;  2RSG A;  2K2J A;  1M7R A;  5LOP B;  1KZ7 A;  5KQ4 A;  2COC A;  5KCV A;  1X86 A;  4HAT B;  2D4Q A;  3FEH A;  2YS1 A;  3ODO A;  1OY2 A;  4KHA A;  3WA0 A;  3MDB C;  2Y7B A;  1P6S A;  2LUL A;  1V5P A;  2D9W A;  4TYZ A;  1FHO A;  4Y94 A;  1W1H A;  2DYN A;  2ZPY A;  4CYE A;  2KGX B;  3PVU A;  1PLS A;  2HTH B;  2AL6 A;  4NSW A;  1Y5O A;  2D9V A;  4K17 A;  1NTY A;  2D9X A;  1GC7 A;  2OQB A;  5C5B B;  3P6A A;  2D11 A;  1WI1 A;  2M14 A;  1U5D A;  2DX5 A;  1ZSQ A;  3SUZ A;  3A8P A;  3DXC A;  2AEH A;  2R09 A;  2I1K A;  3SYX A;  3PG7 A;  2VRW B;  1MK7 B;  4F7G A;  2YT1 A;  4A5K A;  2XQN M;  1ZVR A;  4NY0 A;  4DBB A;  1FHX A;  2MDX A;  3VOQ A;  2EMT A;  2MWN B;  2RGN B;  4KVG B;  5DHF B;  2L2I A;  1RRP B;  5DHA B;  5DH9 B;  1U27 A;  1ZM0 A;  2PZ1 A;  3FM8 C;  3TVV A;  2NMB A;  3U8Z A;  3A98 B;  4EKU A;  1NTV A;  1GG3 A;  2LYD A;  2CRF A;  4HAX B;  3V5W A;  2JP2 A;  3LJU X;  1SHC A;  4IFS A;  1OMW A;  4BBK A;  1EF1 A;  5D3X A;  2FJL A;  3ULB A;  4HAZ B;  5J3Q A;  1FB8 A;  1I2H A;  2DN6 A;  1ZC4 B;  1WGU A;  4WJ7 A;  3D8F A;  1IRS A;  4KHB B;  2J59 M;  4PQ0 A;  5GOW B;  2I5C A;  2MKR A;  2KCJ A;  2UVM A;  2P8V A;  1WJ1 A;  2BCJ A;  2YS5 A;  1DBH A;  2P0D A;  2N0Y A;  3HW2 B;  3T06 A;  1NI2 A;  1BAK A;  3PVL A;  4PNK A;  1V88 A;  1V61 A;  4A6F B;  1K5G B;  5FI0 A;  2R0D A;  4TKN A;  3CXB B;  1FGY A;  1MKE A;  1K5D B;  1DRO A;  2P0F A;  3X23 A;  3GYP A;  4IOY X;  2Q13 A;  1FAO A;  2W2W A;  4DXA B;  2N23 A;  1Z87 A;  3D8E A;  2LG1 A;  1ISN A;  1TQZ A;  1NU2 A;  4HAW B;  1V5M A;  5HE3 A;  1DDM A;  1U5E A;  2ROZ B;  1PMS A;  3HK0 A;  2UZS A;  3OAN A;  1XCG A;  4F7U P;  1MAI A;  1OQN A;  3VIA A;  4H8S A;  2IYB A;  2GJY A;  2H7E A;  3G9W A;  4HB2 B;  1E5W A;  5C79 A;  5D27 A;  3UZT A;  2DFK A;  3BIN A;  1DDW A;  2EC1 A;  1RJ2 A;  4GMV A;  4CHJ A;  3KRW A;  3ZDT A;  3U7D A;  4Z2M B;  2W2X C;  1UNP A;  4MK0 A;  2LOZ A;  1XX0 A;  3QWM A;  5D3W A;  2W2X D;  1WG7 A;  3P7Z A;  1TJ6 A;  2D9Z A;  4HB0 B;  1SGH A;  3TFM A;  5D3Y A;  4XWX A;  2RUK B;  2OTX A;  4EJN A;  3F5R A;  2DX1 A;  2M38 A;  2IFS A;  2Z0Q A;  1TXD A;  1XOD A;  1XR0 B;  2GCJ A;  3MPX A;  4WSF A;  1BWN A;  1FGZ A;  2NZ8 B;  3D8D A;  2ADZ A;  1FOE A;  2COA A;  1I7A A;  1MIZ B;  5EFX A;  1U29 A;  2YVC A;  2Z0O A;  3DXE A;  2HE7 A;  2LOX A;  2COF A;  4HDQ A;  5C6R A;  4IAP A;  5DIF B;  1EVH A;  3KRX A;  4EMO A;  1XKE A;  4L6E A;  3AU4 A;  1MPH A;  1GC6 A;  1U2B A;  1J19 A;  3SO6 A;  1X1G A;  2CY4 A;  2V76 A;  4HAV B;  4HB4 B;  5C16 A;  4CHM A;  2QKM A;  2DA0 A;  4HAU B;  5J3Y A;  1X05 A;  2DLW A;  4K2O A;  2L1C A;  2DYQ A;  1WVH A; 
#chains in the Genus database with same CATH topology
 3SNH A;  3PZD A;  4ZRJ A;  3A58 A;  4GMX B;  3IVF A;  3PVW A;  2YRY A;  2E2X A;  3AU5 A;  3GYO A;  1ZC3 B;  1EGX A;  2P0H A;  2K00 A;  1WGQ A;  1KI1 B;  5D3V A;  1WJM A;  3AJ4 A;  1V89 A;  4HDO A;  1N3H A;  5FI1 A;  2D9Y A;  3ULC A;  4YON A;  5JP4 A;  5LG4 B;  2UZR A;  4D6W A;  1DYN A;  4WVF B;  1EAZ A;  2RNR B;  3PSC A;  4DX9 0;  2YF0 A;  1KZG A;  4GN1 A;  5J3T A;  5KQ1 A;  5HE1 A;  2CY5 A;  4K81 A;  3NW8 A;  1M7E A;  1U5F A;  1UEF A;  1MK9 B;  1W1D A;  2RLO A;  1UPQ A;  1W1G A;  1AWE A;  3ZVR A;  2D2Q A;  2CAY A;  2DHJ A;  3TCA A;  2J0M A;  4B6H A;  3KY9 A;  3HQC A;  1Y19 B;  2D10 A;  2VKI A;  2Z0P A;  2YSZ A;  2J0J A;  1P3R A;  2DKP A;  2KIE A;  1X1F A;  2RVB B;  4OT1 A;  2K2U A;  3RCP A;  3F0W A;  4GXB A;  4MT7 A;  1H4R A;  2Z59 A;  5C5B A;  1P5T A;  5DI9 B;  4A6K A;  2DHK A;  4KHO A;  4GZU A;  1QC6 A;  1DDV A;  4F7H A;  1XD4 A;  3NWA A;  3PEG A;  2QKL A;  4P7I A;  3A8Q A;  1PFJ A;  3QBV B;  1ZYI A;  1QQG A;  2EJ8 A;  2G35 A;  4K2P A;  4D0N B;  2YT2 A;  1T77 A;  5JLJ B;  4YL8 A;  1FHW A;  3KZ1 A;  1MIX A;  4ZRI A;  5L81 A;  2GS0 A;  4C0A A;  2YT0 A;  2ELB A;  2ROV A;  3BJI A;  5IRS A;  3ODW A;  3PP2 A;  1BTK A;  1LB1 A;  2GUM A;  3FSS A;  4HB3 B;  4HAY B;  1BTN A;  1AQC A;  2YS3 A;  5CLL B;  2I5F A;  3CIK A;  4QXA B;  2H7D A;  5JHG A;  3M1I B;  5CLQ B;  3TO1 A;  2DTC A;  1J0W A;  2LKO A;  1UNR A;  3DCX A;  4MY6 A;  3NSU A;  2MFQ A;  5HE2 A;  4DX8 A;  2ELA A;  3WYF B;  2Y8F A;  1B55 A;  2DHI A;  3TW1 A;  4KHB A;  2DKQ A;  1U5G A;  4Z2N A;  2Y8G A;  4GPT B;  3QIJ A;  2EMS A;  1UPR A;  3KSY A;  5LON B;  1H10 A;  2X18 A;  4KAX B;  2GCL A;  3ODX A;  3O96 A;  3DXD A;  1UNQ A;  2COD A;  2VSZ A;  4HHV A;  4ZRK A;  2KUP A;  4A6F A;  1Q67 A;  1V5U A;  4A6H A;  1LW3 A;  1X11 A;  3SV1 A;  2J0K A;  5HE0 A;  2I1J A;  5JHH A;  2K49 A;  3ML4 A;  3N7C A;  2RSG A;  2K2J A;  1M7R A;  2ZKM X;  2FJU B;  5LOP B;  1KZ7 A;  5KQ4 A;  2COC A;  5KCV A;  4QJ4 B;  3OHM B;  1X86 A;  4HAT B;  2D4Q A;  2RRF A;  3FEH A;  2YS1 A;  3ODO A;  1OY2 A;  4KHA A;  3WA0 A;  3MDB C;  2Y7B A;  1P6S A;  2LUL A;  1V5P A;  2D9W A;  4TYZ A;  1FHO A;  4Y94 A;  1W1H A;  2DYN A;  2ZPY A;  4CYE A;  2KGX B;  3PVU A;  2R2Y A;  1PLS A;  2HTH B;  2AL6 A;  4NSW A;  1Y5O A;  2D9V A;  4K17 A;  1NTY A;  2D9X A;  1GC7 A;  2NBV A;  2OQB A;  5C5B B;  3P6A A;  2D11 A;  1WI1 A;  2M14 A;  1U5D A;  2DX5 A;  1ZSQ A;  2KUQ A;  3SUZ A;  3A8P A;  3DXC A;  2AEH A;  2R09 A;  2I1K A;  3SYX A;  3PG7 A;  2VRW B;  1MK7 B;  4F7G A;  2YT1 A;  4A5K A;  2XQN M;  1ZVR A;  4NY0 A;  4DBB A;  1FHX A;  2MDX A;  3VOQ A;  2EMT A;  2MWN B;  2RGN B;  3U12 A;  4KVG B;  5DHF B;  2L2I A;  1RRP B;  5DHA B;  5DH9 B;  1U27 A;  1ZM0 A;  2PZ1 A;  3FM8 C;  3TVV A;  2NMB A;  3U8Z A;  3A98 B;  4EKU A;  1NTV A;  1GG3 A;  2LYD A;  2CRF A;  4HAX B;  3V5W A;  2JP2 A;  3LJU X;  1SHC A;  4IFS A;  1OMW A;  4BBK A;  1EF1 A;  5D3X A;  2FJL A;  3ULB A;  4HAZ B;  5J3Q A;  1FB8 A;  1I2H A;  2DN6 A;  1ZC4 B;  1WGU A;  4WJ7 A;  3D8F A;  1IRS A;  4KHB B;  2J59 M;  4PQ0 A;  5GOW B;  2I5C A;  2MKR A;  2KCJ A;  2UVM A;  2P8V A;  4CSQ A;  1WJ1 A;  2BCJ A;  2YS5 A;  1DBH A;  2P0D A;  3HW2 B;  2N0Y A;  3T06 A;  1NI2 A;  1BAK A;  4L1R A;  3PVL A;  5M4Y B;  4PNK A;  1V88 A;  1V61 A;  4A6F B;  1K5G B;  5FI0 A;  2R0D A;  4TKN A;  3CXB B;  1FGY A;  1MKE A;  1K5D B;  1DRO A;  2P0F A;  3X23 A;  3GYP A;  5I2S A;  3HIE A;  4IOY X;  2Q13 A;  1FAO A;  2W2W A;  4DXA B;  2N23 A;  1Z87 A;  3HSA A;  5I2M A;  3D8E A;  2LG1 A;  3FVC A;  1ISN A;  1TQZ A;  1NU2 A;  4HAW B;  1V5M A;  5HE3 A;  4QJ5 B;  1DDM A;  1U5E A;  2ROZ B;  1PMS A;  3HK0 A;  2UZS A;  3OAN A;  4GOU A;  1XCG A;  4F7U P;  1MAI A;  1OQN A;  3VIA A;  4H8S A;  2KR0 A;  2IYB A;  2GJY A;  2H7E A;  4GNK B;  3G9W A;  4HB2 B;  1E5W A;  5C79 A;  5D27 A;  3UZT A;  2DFK A;  3BIN A;  1DDW A;  2EC1 A;  1RJ2 A;  4GMV A;  4CHJ A;  3KRW A;  3ZDT A;  3U7D A;  4Z2M B;  2W2X C;  4HSI A;  1UNP A;  4MK0 A;  2LOZ A;  4QJ3 B;  1XX0 A;  3QWM A;  5D3W A;  3B77 A;  1MI1 A;  2W2X D;  1WG7 A;  3P7Z A;  3NWF A;  1TJ6 A;  2D9Z A;  4OSN A;  4HB0 B;  1SGH A;  3TFM A;  2KIG A;  2Z13 A;  5D3Y A;  4DIX A;  4XWX A;  2RUK B;  2OTX A;  4EJN A;  3F5R A;  2DX1 A;  2M38 A;  2IFS A;  2Z0Q A;  1TXD A;  1XOD A;  1XR0 B;  2GCJ A;  3MPX A;  2Z14 A;  2Z4D A;  4WSF A;  1BWN A;  1FGZ A;  2NZ8 B;  3D8D A;  2ADZ A;  1FOE A;  2COA A;  1I7A A;  1MIZ B;  5EFX A;  1U29 A;  2YVC A;  2Z0O A;  3DXE A;  2HE7 A;  2LOX A;  2COF A;  4HDQ A;  5C6R A;  4IAP A;  5DIF B;  1EVH A;  3KRX A;  4EMO A;  1XKE A;  4L6E A;  3AU4 A;  1MPH A;  3NWD A;  1GC6 A;  1U2B A;  1J19 A;  3SO6 A;  1X1G A;  2CY4 A;  2V76 A;  4HAV B;  4HB4 B;  5C16 A;  4CHM A;  2QKM A;  2DA0 A;  4HAU B;  5J3Y A;  1X05 A;  2DLW A;  4K2O A;  2L1C A;  2K8E A;  2DYQ A;  1WVH A; 
#chains in the Genus database with same CATH homology
 3SNH A;  3PZD A;  4ZRJ A;  4GMX B;  3IVF A;  3PVW A;  2YRY A;  2E2X A;  3AU5 A;  3GYO A;  1ZC3 B;  1EGX A;  2P0H A;  2K00 A;  1WGQ A;  1KI1 B;  5D3V A;  1WJM A;  3AJ4 A;  1V89 A;  4HDO A;  1N3H A;  5FI1 A;  2D9Y A;  3ULC A;  4YON A;  5JP4 A;  2UZR A;  1DYN A;  4WVF B;  1EAZ A;  2RNR B;  3PSC A;  4DX9 0;  2YF0 A;  1KZG A;  4GN1 A;  5J3T A;  5KQ1 A;  5HE1 A;  2CY5 A;  4K81 A;  1M7E A;  1U5F A;  1UEF A;  1MK9 B;  1W1D A;  2RLO A;  1UPQ A;  1W1G A;  1AWE A;  3ZVR A;  2D2Q A;  2CAY A;  2DHJ A;  3TCA A;  2J0M A;  4B6H A;  3KY9 A;  3HQC A;  1Y19 B;  2D10 A;  2VKI A;  2Z0P A;  2YSZ A;  2J0J A;  1P3R A;  2DKP A;  1X1F A;  2RVB B;  2K2U A;  3RCP A;  3F0W A;  4GXB A;  4MT7 A;  1H4R A;  5C5B A;  1P5T A;  5DI9 B;  4A6K A;  2DHK A;  4KHO A;  4GZU A;  1QC6 A;  1DDV A;  4F7H A;  1XD4 A;  3PEG A;  2QKL A;  4P7I A;  3A8Q A;  1PFJ A;  3QBV B;  1QQG A;  2EJ8 A;  2G35 A;  4K2P A;  4D0N B;  5JLJ B;  4YL8 A;  1FHW A;  3KZ1 A;  1MIX A;  4ZRI A;  5L81 A;  2GS0 A;  4C0A A;  2YT0 A;  2ELB A;  2ROV A;  3BJI A;  3ODW A;  3PP2 A;  1BTK A;  1LB1 A;  3FSS A;  4HB3 B;  4HAY B;  1BTN A;  1AQC A;  2YS3 A;  5CLL B;  2I5F A;  3CIK A;  2H7D A;  5JHG A;  3M1I B;  5CLQ B;  3TO1 A;  2DTC A;  1J0W A;  2LKO A;  1UNR A;  4MY6 A;  3NSU A;  2MFQ A;  5HE2 A;  4DX8 A;  2ELA A;  3WYF B;  2Y8F A;  1B55 A;  2DHI A;  3TW1 A;  2DKQ A;  1U5G A;  4Z2N A;  2Y8G A;  4GPT B;  3QIJ A;  2EMS A;  1UPR A;  3KSY A;  5LON B;  1H10 A;  2X18 A;  4KAX B;  2GCL A;  3ODX A;  3O96 A;  3DXD A;  1UNQ A;  2COD A;  2VSZ A;  4HHV A;  4ZRK A;  2KUP A;  4A6F A;  1Q67 A;  1V5U A;  4A6H A;  1LW3 A;  1X11 A;  3SV1 A;  2J0K A;  5HE0 A;  2I1J A;  5JHH A;  3ML4 A;  3N7C A;  2RSG A;  2K2J A;  1M7R A;  5LOP B;  1KZ7 A;  5KQ4 A;  2COC A;  5KCV A;  1X86 A;  4HAT B;  2D4Q A;  3FEH A;  2YS1 A;  3ODO A;  1OY2 A;  4KHA A;  3WA0 A;  3MDB C;  2Y7B A;  1P6S A;  2LUL A;  1V5P A;  2D9W A;  4TYZ A;  1FHO A;  4Y94 A;  1W1H A;  2DYN A;  2ZPY A;  4CYE A;  2KGX B;  3PVU A;  1PLS A;  2HTH B;  2AL6 A;  4NSW A;  1Y5O A;  2D9V A;  4K17 A;  1NTY A;  2D9X A;  1GC7 A;  2OQB A;  5C5B B;  3P6A A;  2D11 A;  1WI1 A;  2M14 A;  1U5D A;  2DX5 A;  1ZSQ A;  3SUZ A;  3A8P A;  3DXC A;  2AEH A;  2R09 A;  2I1K A;  3SYX A;  3PG7 A;  2VRW B;  1MK7 B;  4F7G A;  2YT1 A;  4A5K A;  2XQN M;  1ZVR A;  4NY0 A;  4DBB A;  1FHX A;  2MDX A;  3VOQ A;  2EMT A;  2MWN B;  2RGN B;  4KVG B;  5DHF B;  2L2I A;  1RRP B;  5DHA B;  5DH9 B;  1U27 A;  1ZM0 A;  2PZ1 A;  3FM8 C;  3TVV A;  2NMB A;  3U8Z A;  3A98 B;  4EKU A;  1NTV A;  1GG3 A;  2LYD A;  2CRF A;  4HAX B;  3V5W A;  2JP2 A;  3LJU X;  1SHC A;  4IFS A;  1OMW A;  4BBK A;  1EF1 A;  5D3X A;  2FJL A;  3ULB A;  4HAZ B;  5J3Q A;  1FB8 A;  1I2H A;  2DN6 A;  1ZC4 B;  1WGU A;  4WJ7 A;  3D8F A;  1IRS A;  4KHB B;  2J59 M;  4PQ0 A;  5GOW B;  2I5C A;  2MKR A;  2KCJ A;  2UVM A;  2P8V A;  1WJ1 A;  2BCJ A;  2YS5 A;  1DBH A;  2P0D A;  2N0Y A;  3HW2 B;  3T06 A;  1NI2 A;  1BAK A;  3PVL A;  4PNK A;  1V88 A;  1V61 A;  4A6F B;  1K5G B;  5FI0 A;  2R0D A;  4TKN A;  3CXB B;  1FGY A;  1MKE A;  1K5D B;  1DRO A;  2P0F A;  3X23 A;  3GYP A;  4IOY X;  2Q13 A;  1FAO A;  2W2W A;  4DXA B;  2N23 A;  1Z87 A;  3D8E A;  2LG1 A;  1ISN A;  1TQZ A;  1NU2 A;  4HAW B;  1V5M A;  5HE3 A;  1DDM A;  1U5E A;  2ROZ B;  1PMS A;  3HK0 A;  2UZS A;  3OAN A;  1XCG A;  4F7U P;  1MAI A;  1OQN A;  3VIA A;  4H8S A;  2IYB A;  2GJY A;  2H7E A;  3G9W A;  4HB2 B;  1E5W A;  5C79 A;  5D27 A;  3UZT A;  2DFK A;  3BIN A;  1DDW A;  2EC1 A;  1RJ2 A;  4GMV A;  4CHJ A;  3KRW A;  3ZDT A;  3U7D A;  4Z2M B;  2W2X C;  1UNP A;  4MK0 A;  2LOZ A;  1XX0 A;  3QWM A;  5D3W A;  2W2X D;  1WG7 A;  3P7Z A;  1TJ6 A;  2D9Z A;  4HB0 B;  1SGH A;  3TFM A;  5D3Y A;  4XWX A;  2RUK B;  2OTX A;  4EJN A;  3F5R A;  2DX1 A;  2M38 A;  2IFS A;  2Z0Q A;  1TXD A;  1XOD A;  1XR0 B;  2GCJ A;  3MPX A;  4WSF A;  1BWN A;  1FGZ A;  2NZ8 B;  3D8D A;  2ADZ A;  1FOE A;  2COA A;  1I7A A;  1MIZ B;  5EFX A;  1U29 A;  2YVC A;  2Z0O A;  3DXE A;  2HE7 A;  2LOX A;  2COF A;  4HDQ A;  5C6R A;  4IAP A;  5DIF B;  1EVH A;  3KRX A;  4EMO A;  1XKE A;  4L6E A;  3AU4 A;  1MPH A;  1GC6 A;  1U2B A;  1J19 A;  3SO6 A;  1X1G A;  2CY4 A;  2V76 A;  4HAV B;  4HB4 B;  5C16 A;  4CHM A;  2QKM A;  2DA0 A;  4HAU B;  5J3Y A;  1X05 A;  2DLW A;  4K2O A;  2L1C A;  2DYQ A;  1WVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...