4GN2A

Crystal structure of oxa-45, a class d beta-lactamase with extended spectrum activity
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
239
Chain Sequence
MLECTLVADAASGQELYRKGACDKAFAPMSTFVPLAVMGYDAGILVDAHNPRWDYKPEFNGYAFQQKTTDPTIWEKDSIVWYSQQLTRKMGQKRFAAYVAGFGYGNGDISGEPGKSNGLTHSWLGSSLKISPEGQVRFVRDLLSAKLPASKDAQQMTVSILPHFAAGDWAVQGKTGTGSFIDARGAKAPLGWFIGWATHEERRVVFARMTAGGAAGAQPAGPAARDAFLKALPDLAKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxacillinase
publication title Structural and Kinetic Characterization of OXA-45, a Class D beta-Lactamase with Extended Spectrum activity
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 65
structure length 239
sequence length 240
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4gn2A00
5F1FA 3VP0A 1IYOA 1IEMA 5F83A 1TEMA 3DWZA 2IWDA 3C7UA 4OPQA 4N1HA 5G18A 2WKIA 2Y59A 2ZC7A 2HDUA 3UDXA 4KQQA 1TDLA 3MXSA 4BD0A 3EQVA 2Y2HA 3UE3A 3PAEA 1ONHA 4ZJ1A 1JWZA 3TOIA 2Y2QA 5FQJA 1KDWA 5CGSA 5E2FA 4BJPA 3OPPA 3PBOA 3G4PA 4OP8A 4DE2A 5GLCA 1IYPA 4GNUA 4MBKA 3BFEA 4OLDA 4Y0TA 1PWCA 3GVBA 4R3JA 4DKIA 5A91A 2J8YA 1FOFA 3CJMA 5EVID 2QMIA 1KDSA 4C75A 4IEDA 1XGIA 3DW0A 5FSRA 3BLSA 3MZEA 4HESA 5EOOA 3E2LA 1IYSA 5HFOA 1CI9A 3S22A 4Y7PA 4BD1A 1PIOA 1K4FA 4QY5A 1ALQA 4DE0A 4F94A 2BLSA 1OMEA 3NI9A 3OCLA 1KGGA 2IWCA 2QZ6A 5CEBA 1BTLA 2Y2PA 4UHUA 4EBPA 4ZDXA 1CI8A 2A49A 4OONA 3OPHA 4GOGA 3DTMA 1PW8A 2J9PA 5AQAA 3C5AA 3V3RA 3SS3A 5GL9A 4CJNA 1GHIA 1PI4A 4KZ5A 3MZDA 4MEZA 4GDNA 5JYOA 3HLDA 3PBQA 3ZG7B 5FAOA 4JPMA 3Q7VA 1MWRA 4HBTA 3TG9A 1HVBA 3RXWA 1JTDA 4WM9A 2WKHA 3UY6A 3ZG5A 4BL3A 1PWGA 3HLCA 3Q07A 3VFFA 2EX9A 3IF6A 5HX9A 3BFCA 1J9MA 4C6YA 2GDNA 4DXCA 4P6BA 3IF6C 5HAIA 4E3JA 4A5RA 2A3UA 4EQIA 1PI5A 4E3KA 3SH8A 4HBUA 2BG1A 4OP5A 3N8SA 4EBNA 2JE5A 4D2OA 3O86A 3UO9A 2HDRA 1FQGA 3IF5A 2WZXA 4OOLA 3UN7A 1FCMA 4BQMA 2WK0A 3ZG8B 5GHXA 3HL9A 2XDMA 4BENA 5E2EA 2ZQCA 1KGFA 1Z6FA 3VMAA 1ES3A 1HTZA 3M2KA 3W8KA 3HLEA 2EX2A 1G68A 3N4IA 3GTCA 4K0WA 3WS4A 3V3SA 1GHMA 3VP3A 4C3QA 3Q7VB 3RXXA 1YLZA 2H10A 4UAAA 5E2HA 3N8LA 4XXRA 2FFFB 4ZAMA 2EFUA 4OKPA 4KQRA 2JCHA 3IF6B 3A3FA 3BFDA 1MXOA 3UDIA 3WS1A 2Y4AA 1YLPA 4S2MA 1GA0A 3IH9A 3OPRA 3HUMA 4L0LA 3V39A 5L2FA 4K0XA 3HLGA 2H5SA 1FSWA 2Y55A 5FAQA 2HP5A 1YLTA 2PBYA 4WMCA 5D3OA 1K6SA 1EROA 4KG5A 5FQQA 3PAGA 4QY6A 4YINA 3LCEA 2XH9A 3PBRA 2CC1A 1QMEA 4S2NA 1I5QA 3ZVWA 1K6RA 4Y0UA 4U0XA 5GLBA 4DRTA 3VP2A 3ZG9B 5CGWA 4ZJ3A 4S2NC 4KZAA 4PMAA 1W7FA 3IXGA 2Y2LA 4K91A 1CEGA 3HLBA 2DNSA 1DJAA 1YMSA 2Q9NA 3O87A 3C4PA 1ZG4A 4KZ8A 2R9XA 4QU3A 4EV4A 1WYCA 4RVAA 4LCLA 3GRJA 3ITBA 4OQHA 4PM8A 4O7DA 2PU2A 2HP9A 2EX8A 5EVLA 4B88A 1K55A 4GN2A 4WEKA 5EUAA 1MWUA 2OSUA 2V1ZA 4EBLA 4RYEA 1NYMA 3Q82A 1K55C 1SDEA 4OQ0A 1K54A 4CPKA 3C7VA 5HL1A 2UWXA 2XLNA 1K54C 5A92A 3CMZA 4E6WA 3HBRA 4S2IA 1RCJA 5F1GA 2E8IA 1S0WA 2HDSA 4KENB 4X6TA 5EE8A 3G31A 1VQQA 5CHUA 2WGVA 1XP4A 1LI0A 3UPOA 1DJCA 4KZ7A 1W5DA 5EECA 2ZC6B 1XXMA 1VM1A 4FD8A 1LL9A 5AQBA 5CTMA 3GR2A 3GSGA 5IHVA 4E3OA 3LY3A 1NYYA 3MBZA 3D4FA 2ZM0A 4E3LA 1XPBA 5A90A 3Q81A 4X69A 2WGIA 2ZQAA 4OPRA 1E25A 4ZBEA 5FQMA 3ZCZA 4DDYA 4Q8IA 4OLGA 3WS0A 3BYDA 3V5MA 2DRWA 3LEZA 4E3IA 3FWLA 3HUOA 1GHPA 4H8RA 4FH4A 2XEPA 1ES2A 1FSYA 1AXBA 2C5WB 4Y0OA 1NZOA 5CHMA 2P74A 3WWXA 5FI2A 2ZC3B 1O07A 3HVFA 4U0TA 4HEFA 3IHBA 3BM6A 3IWOA 4IVIA 4JXWA 4DDSA 3S4XA 3GMWA 1IKGA 1ONGA 2JBFA 4GB7A 5DF7A 5HARA 1EI5A 1Y54A 2ZM2A 3ZVTA 1IKIA 1K56D 4FCFA 4JKTA 4ZTKA 4OOMA 1N9BA 2EXBA 3OZHA 2G2UA 3QNCA 3NC8A 5KMWA 3IWQA 3G30A 1CK3A 2WZZA 2XQZA 2B5RA 2Y2KA 3AGDA 3SH7A 3VP4A 1FR1A 2ZM8A 2WAFA 2H0TA 5AQ9A 4GD6A 4BL2A 5HW3A 3M2JA 5DTTA 3FKWA 5TR7A 1MY8A 3ZNTA 4EWFA 4KQOA 3N7WA 3IXDA 4KZBA 3PTEA 1L0GA 3NIAA 1YLJA 4OPYA 3W4OA 3G35A 3HLWA 4QD4A 1JWVA 4S2LA 5DF9A 1L2SA 5DTSA 3N8RA 4JBFA 4QB8A 1HZOA 4X56A 5EPHA 4JF4A 1N4OA 2OLVA 3CZDA 1ZKJA 3SOIA 5M19A 3NDGA 2HPBA 3BECA 3IHAA 3MKFA 3G2YA 2V2FF 4IBRA 1JTGA 4KZ4A 3UNWA 3OPLA 4R4RA 4S2KA 1RP5A 2XFSA 2Z2LB 4M3KA 3G32A 4P87A 5TGFA 1MBLA 1U60A 2Y2MA 4P0MA 2X02A 4E6XA 3G2ZA 3Q7ZA 1LI9A 3M6BA 1NY0A 5CECA 1BUEA 4KZ9A 2VGKA 3DWKA 5TFQA 4X53A 5GHZA 3VFHA 1SKFA 3WRTA 1W8YA 4JF6A 3O88A 5EVIA 1DJBA 3S1YA 2Y2JA 2J9OA 1BLCA 3MKEA 4OVDA 3IQAA 1PZPA 2H0YA 5KZHA 3A3DA 1ERMA 4NETA 4OH0A 2FFYA 2ZD8A 5EVIC 5CERA 4S2PA 3TSGA 3VSLA 1M6KA 4EUZA 1KE4A 3EQUA 5KSCA 1KVLA 4MBFA 4DF6A 2Y2OA 1K4EA 2ZLYA 4N9LA 5EOEA 1WE4A 2Q9MA 1O7EA 1K57A 1MPLA 3CG5A 4KG2A 2I72A 4DXBA 4JXVA 3SH9A 1H5XA 3FV7A 4GZBA 4OQIA 3OC2A 1K57C 5U47A 3OCNA 4U3TA 4X68A 4P85A 2ZJ9A 4R4SA 3HREA 1BZAA 4S2OA 1PYYA 3Q1FA 3ZGAB 3P09A 2XF3A 3GQZA 3BLMA 2OLUA 3PBNA 2X01A 3MFDA 4UA9A 5EVIB 3V50A 4WZ4A 2ZMAA 1NJ4A 3HUNA 3FZCA 4OPZA 4QHCA 1YQSA 1NRFA 5AQ7A 2XFTA 1YM1A 1FCOA 4JXSA 1KGEA 4XUZA 4LV0A 2ZQ8A 5FQKA 2HP6A 1Q2QA 1YLWA 3PBTA 4BLMA 2ZQDA 1NZUA 2Y2IA 2XR0A 4E3MA 4PM5A 5KSHA 2P9VA 5FQ9A 2WGWA 5FI7A 3UE0A 2EFXA 1LLBA 1RGZA 1E3UA 3A3IA 1SDNA 5E43A 1JWPA 3WS5A 4R23A 2ZQ9A 4UA7A 5CXWA 4N9KA 4WBGA 1GCEA 5JYPA 2WYXA 2XD5A 4ID4A 1S6RA 3I7JA 5GHYA 4B4ZA 3A3JA 1M40A 5FI6A 4QJGA 1W8QA 3JYIA 5FATA 2WUQA 3NBLA 2XGNA 2EXAA 3ZFZA 2JC7A 3VSKA 3IWIA 3ZNYA 2Y2GA 3NDEA 1H8ZA 4WELA 3W4QA 4JXGA 4WEJA 1ERQA 4RA7A 4WMCD 4KZ3A 4FSFA 4XUXA 1L0DA 2EX6A 2P9VB 4KZ6A 5DVAA 2WGWB 3IXHA 3BEBA 4GDBA 5BOHA 1K38A 2Z2MB 1FR6A 1C3BA 1MWSA 3BFGA 3M6HA 4RX2A 5DTKA 1L0FA 1NXYA 1PWDA 3BRMA 3IH8A 3WS2A 1W79A 1DY6A 3UE1A 4LV3A 3ZG0A 5A93A 4FH2A 2HDQA 4WYYA 2XD1A 2ZC4B 4UA6A 1ES4A 5CTNA 1XA7A 5FA7A 4LV2A 3VOYA 3VP1A 4Z9QA 3LY4A 4N1XA 4MLLA 1K25A 4JF5A 3UDFA 3IXBA 4NK3A 4PM9A 1KE3A 2PU4A 1HD8A 1LHYA 1XKZA 3NCKA 2Y91A 4WZ5A 1H8YA 5GLAA 1ZC2A 2IWBA 3MZFA 1ESIA 4LENA 4WZ5C 1BULA 2WADA 3W4PA 4GD8A 2DCFA 3GV9A 1KE0A 3UPPA 4S2JA 2C6WB 3MXRA 4KG6A 1WYBA 5FQIA 5CHJA 2Y2NA 3E2KA 5HAPA 1I2SA 1E4DA 4YFMA 5HAQA 4GKUA 2X71A 3LO7A 3A3EA 1BLSA 3AGEA 4R0QA 4X55A 1BLPA 1XGJA 3G34A 1E3UD 1KVMA 4B4XA 3QNBA 3O3VA 1YT4A 5CRFA 3SS5A 1LL5A 2OV5A 3C4OA 1XX2A 1G6AA 1ZG6A 3ITAA 3NY4A 3RJUA 2RL3A 4JLFA 1YMXA 1EWZA 2QPNA 3AGFA 3IT9A 1BT5A 5CGXA 5E2GA 3ZDJA 1SHVA 3B3XA 1BSGA 1FCNA 1GA9A 2WKEA 3FYZA 4OQGA 2ZQ7A 3FKVA 1QMFA 1PW1A 1CEFA 3ISGA 5DF8A 3HLFA 1ES5A 1MWTA 3N6IA 1YLYA 1TDGA 2G2WA 1MKIA 5I94A 4PM6A 2R9WA 1IYQA 3ZHHA 4RX3A 1XA1A 1I2WA 1L0EA 3QHYA 2XK1A 3UPNA 3P98A 5FDHA 4LCMA 1Q2PA 5GLDA 2ZC5B 1IELA 5J8XA 4N92A 4R1GA 5M18A 3PBSA 5CEDA 1TVFA 5M1AA 1K56A 4IBXA 1ESUA 4IVKA 1SCWA 3BFFA 4MBHA 3VOZA 5FAPA 1PZOA 3SS4A 2RCXA 4DE1A 4LV1A 4ZJ2A 2V20A 4PPRA 4R3BA 4OOYA 1RGYA 4DE3A 1BLHA 2J7VA 2VGJA 2WAEA 4PM7A 5FASA 5F82A 1JVJA 4MNRA 3WRZA 4E3NA
chains in the Genus database with same CATH superfamily
4BMWA 1TEMA 5IU1A 3KYEA 3T4QA 4G3WA 2Y59A 4KQQA 1LSXA 1TDLA 3UMDA 4ZJ1A 3F1NA 3TOIA 2Y2QA 1KDWA 3OPPA 3G4PA 1IYPA 4MBKA 4GW9A 1PWCA 3UMEA 3CJMA 3MZEA 4HESA 3E2LA 1IYSA 4O01A 3S22A 4X1MA 4BD1A 4QY5A 3NI9A 4BBTA 2PD8A 2Y2PA 4UHUA 4ZDXA 2A49A 3F1NB 3DTMA 2QWSA 2J9PA 2HZ5A 3S7QA 3SS3A 4KZ5A 4MEZA 3HLDA 3ZG7B 4JPMA 4HBTA 3UY6A 3HLCA 2EX9A 2HF6A 4FUWA 4C6YA 2GDNA 2IA2A 3A0VA 4EQIA 2BG1A 4I38A 4D2OA 1G5UA 2JKGA 1FQGA 3UN7A 1W63M 4BQMA 5GHXA 4NKPA 1AWIA 1ACFA 5E2EA 3VMAA 1S66L 1G68A 2GZAA 3GTCA 4K0WA 2W1RA 3RXXA 2K2NA 1SKOA 4KQRA 2JCHA 3UDIA 3IH9A 4L0LA 1FSWA 2Y55A 4R70A 2FH5A 2BTFP 1QMEA 1I5QA 2BASA 4ME4A 4DRTA 3ZG9B 5I5LA 4S2NC 5HSQA 1YMSA 2ZOIA 2R9XA 4GCZA 4OQHA 1SKOB 3T4JA 1UWNX 4WEKA 5EUAA 3MQQA 4EBLA 3Q82A 1K55C 1K54A 4CPKA 3CI6A 4G3VA 4Q0IA 1S4RA 2PR6A 4S2IA 3MF0A 3TE8A 5LBRA 5HWVA 4X6TA 2HDSA 3NULA 2WGVA 4HH3A 2W1TA 1VM1A 3GR2A 3P7NA 4E3OA 1NYYA 3L7HA 1XPBA 1MZUA 2WGIA 4OPRA 4ZBEA 1K0KA 3V5MA 2PR5A 2NUTC 4FH4A 2XEPA 1ES2A 1FSYA 4Y0OA 4Y3IA 4PHTA 5FI2A 2OAQ1 4IVIA 3IWOA 2W1TB 1IKGA 5DF7A 4EERA 2ZM2A 1IKIA 4FCFA 2KDKA 5KMWA 4HNBA 2Y2KA 3VP4A 3AGDA 2H0TA 5AQ9A 3ICYA 4KQOA 3N7WA 4IUHA 1YLJA 3W4OA 4QD4A 3N8RA 4QB8A 5EPHA 4X56A 2Z6DA 3CZDA 2HPBA 2V2FF 3O5YA 3KSIA 3CUEC 4P87A 3G32A 2X02A 5F68A 2MJ6A 3VV4A 3VFHA 5GHZA 1SKFA 4JF6A 3S1YA 4GHIA 1BLCA 3OLOA 5KZHA 3LR4A 4NETA 2ZD8A 4EUZA 3VE3A 4S2PA 1NRJA 3SZTA 4DJ3A 4MBFA 4DF6A 3T4KA 2QKPA 4DXBA 2E8JA 1K57C 3OCNA 2OAP1 4X68A 2ZJ9A 1BZAA 3ZGAB 3OBFA 4JGQA 2J3TC 2XF3A 3GQZA 4KUOA 2M7VA 3MFDA 4UA9A 4GHIB 4CLCC 2ZMAA 1NJ4A 3HUNA 4E04A 1X0OA 1NRFA 2XFTA 1FCOA 2ZQ8A 1Q2QA 4BLMA 1NZUA 1P0ZA 5FQ9A 2KOIA 2WGWA 1E3UA 3D72A 1SDNA 4I3JA 3DTEA 5E43A 4EXOA 4L9EA 3SW1A 2WYXA 4ARZA 5GHYA 3A3JA 1OTAA 3NBLA 2JC7A 5DKKA 3ZNYA 3W4QA 4JXGA 4RA7A 4XUXA 2EX6A 2WGWB 5DFYA 4GDBA 5BOHA 4P6ZS 3LI8A 4LPZA 2Z6CA 3BFGA 3M6HA 5DFXA 3IH8A 3ZG0A 4LV3A 4ARZB 2HDQA 1CF0A 2ZC4B 1ES4A 1GSXA 2J3WA 4Z9QA 3LY4A 4JF5A 2W3FA 5DJUA 4WZ5A 2H28A 1XKZA 3NCKA 2Y91A 1ZC2A 1ESIA 5J4EA 3LUQA 4K08A 2JKRM 2PAVP 5F5YA 2C6WB 1WYBA 5EM1A 1F2KA 2VX8A 3C2WA 1E4DA 2V9AA 1D06A 2ZMVA 1G28A 2X71A 1E3UD 1YT4A 5CRFA 2OV5A 3MMHA 3C4OA 4HJ6A 1XJ6A 4LLOB 4HJ3A 1SHVA 3B3XA 1FCNA 4OQGA 3FKVA 1QMFA 5DF8A 3N6IA 1TDGA 2G2WA 1MKIA 3ZHHA 3KYQA 4YOFA 1L0EA 2W3GA 3QHYA 3A0RA 3UB6A 1LSWA 3PBSA 1TVFA 5M1AA 4IBXA 5FAPA 4ZJ2A 4PPRA 4OOYA 5DKLA 2M7UA 3BY8A 2VGJA 1OT6A 2JKTM 4E3NA 5F1FA 1IYOA 3EWKA 3T1SA 3EEHA 2IWDA 4OPQA 5G18A 3MXSA 1T18A 4BD0A 3EQVA 2Y2HA 3KSHA 3UE3A 3PAEA 4EEUA 3S7PA 1JWZA 4BJPA 2J80A 5E2FA 4OP8A 4DE2A 3MQOA 1XJ4A 2P08A 2V8CA 1F5MA 4R3JA 4Y2FA 3CPTA 2HJEA 2J8YA 5A8BA 3KX0X 5EVID 4HI4A 4F3LA 4IEDA 5FSRA 1PNEA 3UE6A 3NOTC 1K4FA 1OMEA 4EBPA 3QP4A 1Y4OA 4NXBA 4L9GA 1S1YA 3NECA 5AQAA 1H0MA 3E4QA 3C5AA 3T4SA 1TF1A 3IX3A 4BWIA 3CPTB 1D1JA 4F3LB 2W3DA 2WKHA 3Q07A 5HX9A 3BFCA 3EGDC 2ZL1A 4E3JA 4A5RA 1PI5A 1W63Q 1T1CA 2PRFA 4HBUA 3N8SA 3UO9A 4WLAA 3IF5A 4OOLA 1TS8A 2WK0A 3MS6A 2VGLS 2ZQCA 3TJZC 1HTZA 3MJQA 2B18A 4C3QA 3VP3A 1YLZA 3N8LA 4XXRA 3UB7A 2FFFB 4ZAMA 2EFUA 3A3FA 3BFDA 2Y4AA 1YLPA 2ZL1B 2G7UA 3HUMA 3EEAA 5L2FA 4FOFA 1YLTA 2PBYA 4WMCA 4Q0HA 1EROA 4KG5A 4QY6A 2XH9A 4S2NA 2HJ9C 3ZVWA 4U0XA 4ZJ3A 2LB5A 4I5SA 3LR0A 4PMAA 1W7FA 5J7EA 1N9LA 1CEGA 5TBMA 4KZ8A 1DJAA 4EV4A 1WYCA 4RVAA 3GRJA 3ITBA 2PU2A 2HP9A 1KOUA 4B88A 1K55A 2JKFA 1EW0A 1N9NA 4HH2A 1MWUA 2V1ZA 4RYEA 1NYMA 1SDEA 4GLQA 2UWXA 2XLNA 3E4PA 2OWHA 3CMZA 3HBRA 2O9BA 5EE8A 3BQ8A 1VQQA 2FZ0A 5TBMB 3BWLA 5EECA 2ZC6B 1BYWA 4FD8A 2GNXA 1LL9A 3U4LP 5G4ZA 5CTMA 4ETZA 3TW8A 4EQ1A 3GSGA 5IHVA 3KO6A 3LY3A 2ZM0A 4X69A 1E25A 3K3CA 3ZCZA 4Q8IA 3LEZA 3FWLA 3HUOA 3EGXC 3PR6A 1AXBA 4HJ4A 3HVFA 1CQAA 3IHBA 3BM6A 4JXWA 4CLCE 3GMWA 1ONGA 3HCYA 1OTIA 3QNCA 3NC8A 1J3WA 3G30A 3JPUA 5AVEA 4GD6A 5DTTA 1VHMA 3ZNTA 4EWFA 2B02A 3IXDA 1L0GA 3NIAA 5TJJA 2DMWA 3G35A 4QPRA 5HDSA 4S2LA 5DF9A 4JF4A 2OLVA 3CUEA 5M19A 1ZHHB 3TRCA 1FIKA 3BECA 4IBRA 4S2KA 2YKHA 2ZBBA 1RP5A 5TGFA 4P0MA 3G2ZA 3M6BA 1BUEA 3F1OA 3DWKA 5TFQA 3DTKA 4IJGA 3T4LA 3A3DA 3LR3A 3TSGA 1DRMA 3QP5A 2V1BA 3CG5A 3R4KA 1K57A 1LT0A 4JXVA 1H5XA 4GZBA 1YPRA 1UWPX 1WA9A 1G6OA 4U3TA 2D02A 2OWJA 2QJ7A 3F1OB 4II7A 1GSVA 3HJKA 2OLUA 3QP8A 2X01A 2K31A 2NUPC 2WKQA 3FZCA 5AQ7A 1YM1A 4JXSA 3A0SA 4LV0A 1YLWA 3PBTA 4I3AA 2ZQDA 4NG2A 4E3MA 1GSWA 2VGLM 5FI7A 1RGZA 4H6JA 3UB5P 1JWPA 4UA7A 2KLIA 1XFNA 4YWZA 4WBGA 1GCEA 5JYPA 2XD5A 3IS2A 1S6RA 3I7JA 3EOIA 1M40A 3B47A 1W8QA 2AVXA 2XGNA 3G6OA 4LRZE 3IWIA 1DP8A 3NDEA 1H8ZA 1ERQA 5DVAA 3IXHA 4H6JB 1FR6A 1STZA 1OJ5A 4RX2A 1L0FA 5HDCA 4LRXC 3WS2A 3RTYA 1TS6A 2V0WA 4UA6A 2JN7A 5CTNA 1XA7A 5FA7A 1V9YA 4LV2A 3UDFA 3IXBA 4NK3A 1KE3A 5DJTA 1DP6A 3MZFA 2GX5A 1CJFA 1KE0A 1A0KA 1P97A 4S2JA 3MXRA 4KG6A 5CHJA 2Y2NA 4PAUA 4R6LA 4YFMA 3U2AA 3ZYTA 5EVEA 4X55A 1BLSA 4R0QA 1V9ZA 2Q0OA 4O0PA 3ZQ5A 1LL5A 1XX2A 1ZG6A 3ITAA 1XFQA 3RJUA 2O9AA 4JLFA 1YMXA 2QPNA 4EETB 1BT5A 5CGXA 4CQHA 1TS0A 2ZQ7A 1CEFA 5L10A 3LR5A 1YLYA 3C8CA 2R9WA 4RX3A 1XA1A 2XK1A 4JGOA 3P98A 4WL9A 5GLDA 3HJIA 2ZC5B 4O8GA 1H3QA 3QP1A 1K56A 4MN7A 1ESUA 4R3BA 5HWTA 2Y79A 2INWA 1BLHA 5FASA 5F82A 1JVJA 3WRZA 4FTXA 3KYZA 3QP6A 3T50A 2WKIA 2HDUA 3UDXA 5HDDA 2V8FA 5FQJA 5CGSA 3PBOA 3LFVA 4D60A 3BFEA 4OLDA 3GVBA 5A91A 1FOFA 2QMIA 1XGIA 3DW0A 3NHQA 2V1AA 5HFOA 1CI9A 4I3IA 1PIOA 4DE0A 4F94A 4G3KA 1KGGA 2IWCA 2QZ6A 1BTLA 2P04A 1PW8A 4R38A 3LGOA 2W0NA 3H7WA 4CJNA 1GHIA 2PT7A 4GDNA 2I9VA 3PBQA 1HVBA 1JTDA 4BL3A 4RQ9A 1PWGA 1T19A 4X25A 5L07A 1LL8A 4P6BA 3IF6C 4E3KA 3O86A 5HWWA 2WZXA 4Y13A 3HL9A 1YSQA 4BENA 3H7WB 4Z1WA 1Z6FA 3VOLA 3HLEA 3N4IA 3WS4A 1GHMA 3NOPC 3NJAA 5E2HA 5HD5A 1XJ2A 4OKPA 1MXOA 1GA0A 3OPRA 3V39A 4K0XA 3HLGA 2VJWA 5D3OA 2JHEA 5FQQA 2OOLA 3PAGA 4YINA 5GLBA 3VP2A 3MSHA 5CGWA 4KZAA 4JGRA 3IXGA 2Y2LA 4K91A 3HLBA 3UB9A 2Q9NA 3C4PA 4PKYG 4AFIA 4QU3A 4LCLA 3DTIA 2EX8A 5EVLA 4GN2A 2OSUA 2L1MA 1OJGA 3C7VA 5HL1A 4M4XA 2PYPA 4LFUA 1RCJA 4KENB 3G31A 5CHUA 1XP4A 1LI0A 3UPOA 3BJNA 1DJCA 4KZ7A 1XXMA 3T12B 1DP9A 1Z09A 5EFWA 4KUKA 4NXFA 2VV6A 3T1XA 2EA9A 4E3LA 3CLOA 3Q81A 2ZQAA 5FQMA 4OLGA 1ZTUA 3IX4A 3S7NA 2XSSA 4H8RA 3WWXA 5IS1A 2ZC3B 1O07A 3LIFA 4DDSA 2JBFA 4GB7A 3IBJA 1Y54A 3ZVTA 4OOMA 2EXBA 5FEFA 1OT9A 3OZHA 3T4OA 1CK3A 2WZZA 2XQZA 2B5RA 3D9YA 4NEED 1FR1A 5HW3A 4BL2A 3M2JA 3LIBA 3PTEA 2O99A 4MMNA 3HLWA 1SZVA 5CX7A 1JWVA 2PD7A 1L2SA 1HZOA 5C5KA 5G4YA 1ZKJA 3IHAA 3G2YA 3CAXA 1JTGA 3UNWA 4IUKA 3OPLA 3B42A 1YSPA 2Y2MA 3LIEA 1LI9A 4DJ2A 5CECA 3IBRA 2VGKA 3OOVA 4Y15A 3MR0A 2A24A 5HPIA 3MKEA 4OVDA 3IQAA 1PZPA 2O9CA 4OH0A 1ERMA 5EVIC 5CERA 1M6KA 5KSCA 3EQUA 1YKDA 2Y2OA 2ZLYA 4N9LA 5EOEA 1WE4A 1O7EA 1MPLA 4UQIM 3FV7A 4OQIA 3OC2A 2QHKA 4MN5A 1S67L 5L8MA 1PYYA 3PBNA 3C38A 2A24B 5EV0A 4QHCA 1ODVA 1YQSA 5AVFA 5FQKA 5MC7A 2XR0A 2P9VA 3KSGA 3CITA 4BBVA 3UE0A 2EFXA 1LLBA 3A3IA 4HIAA 3WS5A 2ZQ9A 4HQAA 1Y28A 4ID4A 2HV1A 4Y5FA 1D7EA 1OTDA 2P7JA 5FI6A 4QJGA 3JYIA 3T1RA 2EXAA 4NXEA 1TD5A 4WELA 2XA7M 4WEJA 4WMCD 4KZ3A 3LICA 4KZ6A 2P9VB 3W2ZA 3BEBA 1K38A 2Z2MB 5DTKA 1P9RA 1NXYA 5A93A 3LIDA 4FH2A 4WYYA 2XD1A 2W27A 3VOYA 1MC0A 1YAXA 4N1XA 4MLLA 3PXPA 2B95A 4PM9A 2PU4A 1HD8A 2IWBA 5GLAA 1H8YA 4LENA 2WADA 4GD8A 3B33A 3NOUC 3PYPA 3GV9A 4B9OA 3E2KA 5HAPA 1I2SA 2O0YA 3JVVA 1P9WA 3H82A 4HOIA 1BLPA 4BBUA 4WN5A 1F98A 1KVMA 4B4XA 3QNBA 3SS5A 5K5BA 2UV0E 2KX6A 1G6AA 5FL3A 2QYBA 2EWVA 4WF0A 3IT9A 1EWZA 3AGFA 3MQ0A 5E2GA 2HGVA 3K3DA 1BSGA 3FYZA 3FPVA 5F69A 1PW1A 1ES5A 1MWTA 4HHDA 4PM6A 3E0YA 3H82B 5F6AA 3MXQA 2Y8HA 2VEAA 3UPNA 2PBDP 5FDHA 4LCMA 1Q2PA 4CLCA 5HZHA 1IELA 5J8XA 4N92A 3L9KA 2XRNA 1VETA 4IVKA 3GDIA 3BFFA 2RCXA 4LV1A 2V20A 1HLUP 4DE3A 2J7VA 4PM7A 4MNRA 3VP0A 1IEMA 5F83A 1NLZA 3T4TA 3DWZA 4XT2A 4L9FA 3C7UA 4N1HA 3BY9A 3LI9A 2ZC7A 4CLCB 4EU0A 2VV8A 1ONHA 1VETB 5GLCA 4GNUA 4Y0TA 2W3EA 4DKIA 4EEPA 2VLGA 1KDSA 4C75A 4PKYA 1S4SA 3T1QB 3BLSA 5EOOA 3K2NA 4XT2B 1MKMA 4Y7PA 4GS9A 1ALQA 2BLSA 3OCLA 3E4OA 4MDZA 1T1AA 3GECA 3IS2B 4QWOA 5CEBA 1CI8A 4OONA 3OPHA 4GOGA 4KQDA 2J3TD 2CMNA 4HP9A 3V3RA 5GL9A 1PI4A 4CLCD 3ULFA 3MZDA 5JYOA 5FAOA 3Q7VA 1MWRA 3TG9A 3RXWA 1OTEA 4WM9A 1TS7A 3ZG5A 2LB9A 3VFFA 3IF6A 2VA0A 3S7OA 1J9MA 4MN6A 4GS9B 4DXCA 5HAIA 2A3UA 3SH8A 4OP5A 4EESA 4EBNA 2JE5A 2HDRA 1FCMA 3ZG8B 3CWFA 2XDMA 3QP2A 1KGFA 1ES3A 1NLYA 3M2KA 3W8KA 2PDRA 2EX2A 1N9OA 4X1LA 3V3SA 3CHWP 3Q7VB 1VEUA 2H10A 4UAAA 4ZRRA 3IF6B 2R78A 3WS1A 2W3HA 4S2MA 4LRYC 2H5SA 5FAQA 2HP5A 2JKRI 1K6SA 2D01A 3LCEA 3PBRA 2PHYA 2CC1A 3MFXA 1K6RA 4Y0UA 1JNUA 2DNSA 5HL6A 3O87A 5FDSA 1ZG4A 1VEUB 4ESPA 4EUVA 4PM8A 4EW7A 4O7DA 2ACGA 1UGUA 4NXGA 1XJ3A 4OQ0A 1K54C 5A92A 4E6WA 5F1GA 2E8IA 1S0WA 4DMZA 1W5DA 5AQBA 2K7SA 3MBZA 3D4FA 5A90A 2JKTI 4DDYA 3WS0A 3BYDA 2DRWA 2VK3A 4E3IA 4UQIS 1GHPA 3DBAA 3VE4A 2C5WB 5CHMA 1NZOA 2P74A 4U0TA 4HEFA 3BW6A 3S4XA 2WKPA 5HARA 1EI5A 1K56D 4JKTA 4ZTKA 5HPFA 1N9BA 5L09A 2G2UA 3IWQA 1S1ZA 3SH7A 2ZM8A 2WAFA 1T1BA 3RH8B 3FKWA 5TR7A 1MY8A 4KZBA 5AJGA 4OPYA 2GJ3A 5DTSA 4JBFA 4DN0A 1N4OA 3FG8A 3SOIA 3NDGA 3MKFA 3R7WA 5IT5A 5J3WA 4KZ4A 4R4RA 2XFSA 2Z2LB 4M3KA 4E6XA 1MBLA 1U60A 3V67A 3Q7ZA 1NY0A 4KZ9A 4X53A 3WRTA 1W8YA 3O88A 5EVIA 1DJBA 2Y2JA 2J9OA 4HY8A 2XA7S 2VKSA 2EWWA 2H0YA 2FFYA 3VSLA 2VZWA 1KE4A 1KVLA 2L0WA 4UEYA 1K4EA 2QJ5A 2A2LA 2Q9MA 4KG2A 3IX8A 2I72A 3R7WB 3SH9A 1OPXA 5U47A 5FEGA 4P85A 2XROA 4R4SA 3FC7A 2M1CA 4B93A 3HREA 4S2OA 3Q1FA 4MCWA 3P09A 3BLMA 4LGWA 5EVIB 3V50A 4WZ4A 4OPZA 3LEQA 1KGEA 4XUZA 1L3LA 2HP6A 2Y2IA 4PM5A 5KSHA 4GJ4A 3F1PA 3RFBA 3KSFA 1F9IA 4R23A 5CXWA 4N9KA 2YKFA 4R3AA 4B4ZA 5FATA 2WUQA 3ZFZA 3VSKA 4WUJA 2Y2GA 3JVUA 4I39A 3P01A 3FPWA 4FSFA 1L0DA 4HP4A 3F1PB 2VV7A 5HD3A 1C3BA 1MWSA 1PWDA 3BRMA 1W79A 1DY6A 3UE1A 1IOUA 3VP1A 3E98A 2L4RA 1K25A 3PHYA 4YNRA 4JGPA 3BQAA 1LHYA 3LYXA 1OTBA 1FILA 1PFLA 4ETXA 4WZ5C 1BULA 3W4PA 4IHQA 2DCFA 3UPPA 5FQIA 5HAQA 4GKUA 2ZMFA 3LO7A 2ZOHA 3A3EA 3AGEA 3G34A 1XGJA 3O3VA 5EM0A 3LIAA 3NY4A 2RL3A 3ZDJA 3DAVA 1H8MA 1GA9A 2WKEA 3ISGA 1IFQA 3HLFA 5I94A 2WKRA 1IYQA 4Y17A 5KIZA 1I2WA 3D3OA 4P6ZM 2PYRA 3UB8A 4Q0JA 1PRQA 4R1GA 5M18A 5CEDA 1NWZA 2V0UA 3H9WA 1SCWA 4MBHA 3VOZA 1PZOA 3SS4A 4DE1A 1LSVA 1RGYA 1VB6A 2WAEA 3C30A
chains in the Genus database with same CATH topology
5F1FA 3VP0A 1IYOA 1IEMA 5F83A 1TEMA 3DWZA 2IWDA 3C7UA 4OPQA 4N1HA 5G18A 2WKIA 2Y59A 2ZC7A 2HDUA 3UDXA 4KQQA 1TDLA 3MXSA 4BD0A 3EQVA 2Y2HA 3UE3A 3PAEA 1ONHA 4ZJ1A 1JWZA 3TOIA 2Y2QA 5FQJA 1KDWA 5CGSA 5E2FA 4BJPA 3OPPA 3PBOA 3G4PA 4OP8A 4DE2A 5GLCA 1IYPA 4GNUA 4MBKA 3BFEA 4OLDA 4Y0TA 1PWCA 3GVBA 4R3JA 4DKIA 5A91A 2J8YA 1FOFA 3CJMA 5EVID 2QMIA 1KDSA 4C75A 4IEDA 1XGIA 3DW0A 5FSRA 3BLSA 3MZEA 4HESA 5EOOA 3E2LA 1IYSA 5HFOA 1CI9A 3S22A 4Y7PA 4BD1A 1PIOA 1K4FA 4QY5A 1ALQA 4DE0A 4F94A 2BLSA 1OMEA 3NI9A 3OCLA 1KGGA 2IWCA 2QZ6A 5CEBA 1BTLA 2Y2PA 4UHUA 4EBPA 4ZDXA 1CI8A 2A49A 4OONA 3OPHA 4GOGA 3DTMA 1PW8A 2J9PA 5AQAA 3C5AA 3V3RA 3SS3A 5GL9A 4CJNA 1GHIA 1PI4A 4KZ5A 3MZDA 4MEZA 4GDNA 5JYOA 3HLDA 3PBQA 3ZG7B 5FAOA 4JPMA 3Q7VA 1MWRA 4HBTA 3TG9A 1HVBA 3RXWA 1JTDA 4WM9A 2WKHA 3UY6A 3ZG5A 4BL3A 1PWGA 3HLCA 3Q07A 3VFFA 2EX9A 3IF6A 5HX9A 3BFCA 1J9MA 4C6YA 2GDNA 4DXCA 4P6BA 3IF6C 5HAIA 4E3JA 4A5RA 2A3UA 4EQIA 1PI5A 4E3KA 3SH8A 4HBUA 2BG1A 4OP5A 3N8SA 4EBNA 2JE5A 4D2OA 3O86A 3UO9A 2HDRA 1FQGA 3IF5A 2WZXA 4OOLA 3UN7A 1FCMA 4BQMA 2WK0A 3ZG8B 5GHXA 3HL9A 2XDMA 4BENA 5E2EA 2ZQCA 1KGFA 1Z6FA 3VMAA 1ES3A 1HTZA 3M2KA 3W8KA 3HLEA 2EX2A 1G68A 3N4IA 3GTCA 4K0WA 3WS4A 3V3SA 1GHMA 3VP3A 4C3QA 3Q7VB 3RXXA 1YLZA 2H10A 4UAAA 5E2HA 3N8LA 4XXRA 2FFFB 4ZAMA 2EFUA 4OKPA 4KQRA 2JCHA 3IF6B 3A3FA 3BFDA 1MXOA 3UDIA 3WS1A 2Y4AA 1YLPA 4S2MA 1GA0A 3IH9A 3OPRA 3HUMA 4L0LA 3V39A 5L2FA 4K0XA 3HLGA 2H5SA 1FSWA 2Y55A 5FAQA 2HP5A 1YLTA 2PBYA 4WMCA 5D3OA 1K6SA 1EROA 4KG5A 5FQQA 3PAGA 4QY6A 4YINA 3LCEA 2XH9A 3PBRA 2CC1A 1QMEA 4S2NA 1I5QA 3ZVWA 1K6RA 4Y0UA 4U0XA 5GLBA 4DRTA 3VP2A 3ZG9B 5CGWA 4ZJ3A 4S2NC 4KZAA 4PMAA 1W7FA 3IXGA 2Y2LA 4K91A 1CEGA 3HLBA 2DNSA 1DJAA 1YMSA 2Q9NA 3O87A 3C4PA 1ZG4A 4KZ8A 2R9XA 4QU3A 4EV4A 1WYCA 4RVAA 4LCLA 3GRJA 3ITBA 4OQHA 4PM8A 4O7DA 2PU2A 2HP9A 2EX8A 5EVLA 4B88A 1K55A 4GN2A 4WEKA 5EUAA 1MWUA 2OSUA 2V1ZA 4EBLA 4RYEA 1NYMA 3Q82A 1K55C 1SDEA 4OQ0A 1K54A 4CPKA 3C7VA 5HL1A 2UWXA 2XLNA 1K54C 5A92A 3CMZA 4E6WA 3HBRA 4S2IA 1RCJA 5F1GA 2E8IA 1S0WA 2HDSA 4KENB 4X6TA 5EE8A 3G31A 1VQQA 5CHUA 2WGVA 1XP4A 1LI0A 3UPOA 1DJCA 4KZ7A 1W5DA 5EECA 2ZC6B 1XXMA 1VM1A 4FD8A 1LL9A 5AQBA 5CTMA 3GR2A 3GSGA 5IHVA 4E3OA 3LY3A 1NYYA 3MBZA 3D4FA 2ZM0A 4E3LA 1XPBA 5A90A 3Q81A 4X69A 2WGIA 2ZQAA 4OPRA 1E25A 4ZBEA 5FQMA 3ZCZA 4DDYA 4Q8IA 4OLGA 3WS0A 3BYDA 3V5MA 2DRWA 3LEZA 4E3IA 3FWLA 3HUOA 1GHPA 4H8RA 4FH4A 2XEPA 1ES2A 1FSYA 1AXBA 2C5WB 4Y0OA 1NZOA 5CHMA 2P74A 3WWXA 5FI2A 2ZC3B 1O07A 3HVFA 4U0TA 4HEFA 3IHBA 3BM6A 3IWOA 4IVIA 4JXWA 4DDSA 3S4XA 3GMWA 1IKGA 1ONGA 2JBFA 4GB7A 5DF7A 5HARA 1EI5A 1Y54A 2ZM2A 3ZVTA 1IKIA 1K56D 4FCFA 4JKTA 4ZTKA 4OOMA 1N9BA 2EXBA 3OZHA 2G2UA 3QNCA 3NC8A 5KMWA 3IWQA 3G30A 1CK3A 2WZZA 2XQZA 2B5RA 2Y2KA 3AGDA 3SH7A 3VP4A 1FR1A 2ZM8A 2WAFA 2H0TA 5AQ9A 4GD6A 4BL2A 5HW3A 3M2JA 5DTTA 3FKWA 5TR7A 1MY8A 3ZNTA 4EWFA 4KQOA 3N7WA 3IXDA 4KZBA 3PTEA 1L0GA 3NIAA 1YLJA 4OPYA 3W4OA 3G35A 3HLWA 4QD4A 1JWVA 4S2LA 5DF9A 1L2SA 5DTSA 3N8RA 4JBFA 4QB8A 1HZOA 4X56A 5EPHA 4JF4A 1N4OA 2OLVA 3CZDA 1ZKJA 3SOIA 5M19A 3NDGA 2HPBA 3BECA 3IHAA 3MKFA 3G2YA 2V2FF 4IBRA 1JTGA 4KZ4A 3UNWA 3OPLA 4R4RA 4S2KA 1RP5A 2XFSA 2Z2LB 4M3KA 3G32A 4P87A 5TGFA 1MBLA 1U60A 2Y2MA 4P0MA 2X02A 4E6XA 3G2ZA 3Q7ZA 1LI9A 3M6BA 1NY0A 5CECA 1BUEA 4KZ9A 2VGKA 3DWKA 5TFQA 4X53A 5GHZA 3VFHA 1SKFA 3WRTA 1W8YA 4JF6A 3O88A 5EVIA 1DJBA 3S1YA 2Y2JA 2J9OA 1BLCA 3MKEA 4OVDA 3IQAA 1PZPA 2H0YA 5KZHA 3A3DA 1ERMA 4NETA 4OH0A 2FFYA 2ZD8A 5EVIC 5CERA 4S2PA 3TSGA 3VSLA 1M6KA 4EUZA 1KE4A 3EQUA 5KSCA 1KVLA 4MBFA 4DF6A 2Y2OA 1K4EA 2ZLYA 4N9LA 5EOEA 1WE4A 2Q9MA 1O7EA 1K57A 1MPLA 3CG5A 4KG2A 2I72A 4DXBA 4JXVA 3SH9A 1H5XA 3FV7A 4GZBA 4OQIA 3OC2A 1K57C 5U47A 3OCNA 4U3TA 4X68A 4P85A 2ZJ9A 4R4SA 3HREA 1BZAA 4S2OA 1PYYA 3Q1FA 3ZGAB 3P09A 2XF3A 3GQZA 3BLMA 2OLUA 3PBNA 2X01A 3MFDA 4UA9A 5EVIB 3V50A 4WZ4A 2ZMAA 1NJ4A 3HUNA 3FZCA 4OPZA 4QHCA 1YQSA 1NRFA 5AQ7A 2XFTA 1YM1A 1FCOA 4JXSA 1KGEA 4XUZA 4LV0A 2ZQ8A 5FQKA 2HP6A 1Q2QA 1YLWA 3PBTA 4BLMA 2ZQDA 1NZUA 2Y2IA 2XR0A 4E3MA 4PM5A 5KSHA 2P9VA 5FQ9A 2WGWA 5FI7A 3UE0A 2EFXA 1LLBA 1RGZA 1E3UA 3A3IA 1SDNA 5E43A 1JWPA 3WS5A 4R23A 2ZQ9A 4UA7A 5CXWA 4N9KA 4WBGA 1GCEA 5JYPA 2WYXA 2XD5A 4ID4A 1S6RA 3I7JA 5GHYA 4B4ZA 3A3JA 1M40A 5FI6A 4QJGA 1W8QA 3JYIA 5FATA 2WUQA 3NBLA 2XGNA 2EXAA 3ZFZA 2JC7A 3VSKA 3IWIA 3ZNYA 2Y2GA 3NDEA 1H8ZA 4WELA 3W4QA 4JXGA 4WEJA 1ERQA 4RA7A 4WMCD 4KZ3A 4FSFA 4XUXA 1L0DA 2EX6A 2P9VB 4KZ6A 5DVAA 2WGWB 3IXHA 3BEBA 4GDBA 5BOHA 1K38A 2Z2MB 1FR6A 1C3BA 1MWSA 3BFGA 3M6HA 4RX2A 5DTKA 1L0FA 1NXYA 1PWDA 3BRMA 3IH8A 3WS2A 1W79A 1DY6A 3UE1A 4LV3A 3ZG0A 5A93A 4FH2A 2HDQA 4WYYA 2XD1A 2ZC4B 4UA6A 1ES4A 5CTNA 1XA7A 5FA7A 4LV2A 3VOYA 3VP1A 4Z9QA 3LY4A 4N1XA 4MLLA 1K25A 4JF5A 3UDFA 3IXBA 4NK3A 4PM9A 1KE3A 2PU4A 1HD8A 1LHYA 1XKZA 3NCKA 2Y91A 4WZ5A 1H8YA 5GLAA 1ZC2A 2IWBA 3MZFA 1ESIA 4LENA 4WZ5C 1BULA 2WADA 3W4PA 4GD8A 2DCFA 3GV9A 1KE0A 3UPPA 4S2JA 2C6WB 3MXRA 4KG6A 1WYBA 5FQIA 5CHJA 2Y2NA 3E2KA 5HAPA 1I2SA 1E4DA 4YFMA 5HAQA 4GKUA 2X71A 3LO7A 3A3EA 1BLSA 3AGEA 4R0QA 4X55A 1BLPA 1XGJA 3G34A 1E3UD 1KVMA 4B4XA 3QNBA 3O3VA 1YT4A 5CRFA 3SS5A 1LL5A 2OV5A 3C4OA 1XX2A 1G6AA 1ZG6A 3ITAA 3NY4A 3RJUA 2RL3A 4JLFA 1YMXA 1EWZA 2QPNA 3AGFA 3IT9A 1BT5A 5CGXA 5E2GA 3ZDJA 1SHVA 3B3XA 1BSGA 1FCNA 1GA9A 2WKEA 3FYZA 4OQGA 2ZQ7A 3FKVA 1QMFA 1PW1A 1CEFA 3ISGA 5DF8A 3HLFA 1ES5A 1MWTA 3N6IA 1YLYA 1TDGA 2G2WA 1MKIA 5I94A 4PM6A 2R9WA 1IYQA 3ZHHA 4RX3A 1XA1A 1I2WA 1L0EA 3QHYA 2XK1A 3UPNA 3P98A 5FDHA 4LCMA 1Q2PA 5GLDA 2ZC5B 1IELA 5J8XA 4N92A 4R1GA 5M18A 3PBSA 5CEDA 1TVFA 5M1AA 1K56A 4IBXA 1ESUA 4IVKA 1SCWA 3BFFA 4MBHA 3VOZA 5FAPA 1PZOA 3SS4A 2RCXA 4DE1A 4LV1A 4ZJ2A 2V20A 4PPRA 4R3BA 4OOYA 1RGYA 4DE3A 1BLHA 2J7VA 2VGJA 2WAEA 4PM7A 5FASA 5F82A 1JVJA 4MNRA 3WRZA 4E3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F1F A;  3VP0 A;  1IYO A;  1IEM A;  5F83 A;  1TEM A;  3DWZ A;  2IWD A;  3C7U A;  4OPQ A;  4N1H A;  5G18 A;  2WKI A;  2Y59 A;  2ZC7 A;  2HDU A;  3UDX A;  4KQQ A;  1TDL A;  3MXS A;  4BD0 A;  3EQV A;  2Y2H A;  3UE3 A;  3PAE A;  1ONH A;  4ZJ1 A;  1JWZ A;  3TOI A;  2Y2Q A;  5FQJ A;  1KDW A;  5CGS A;  5E2F A;  4BJP A;  3OPP A;  3PBO A;  3G4P A;  4OP8 A;  4DE2 A;  5GLC A;  1IYP A;  4GNU A;  4MBK A;  3BFE A;  4OLD A;  4Y0T A;  1PWC A;  3GVB A;  4R3J A;  4DKI A;  5A91 A;  2J8Y A;  1FOF A;  3CJM A;  5EVI D;  2QMI A;  1KDS A;  4C75 A;  4IED A;  1XGI A;  3DW0 A;  5FSR A;  3BLS A;  3MZE A;  4HES A;  5EOO A;  3E2L A;  1IYS A;  5HFO A;  1CI9 A;  3S22 A;  4Y7P A;  4BD1 A;  1PIO A;  1K4F A;  4QY5 A;  1ALQ A;  4DE0 A;  4F94 A;  2BLS A;  1OME A;  3NI9 A;  3OCL A;  1KGG A;  2IWC A;  2QZ6 A;  5CEB A;  1BTL A;  2Y2P A;  4UHU A;  4EBP A;  4ZDX A;  1CI8 A;  2A49 A;  4OON A;  3OPH A;  4GOG A;  3DTM A;  1PW8 A;  2J9P A;  5AQA A;  3C5A A;  3V3R A;  3SS3 A;  5GL9 A;  4CJN A;  1GHI A;  1PI4 A;  4KZ5 A;  3MZD A;  4MEZ A;  4GDN A;  5JYO A;  3HLD A;  3PBQ A;  3ZG7 B;  5FAO A;  4JPM A;  3Q7V A;  1MWR A;  4HBT A;  3TG9 A;  1HVB A;  3RXW A;  1JTD A;  4WM9 A;  2WKH A;  3UY6 A;  3ZG5 A;  4BL3 A;  1PWG A;  3HLC A;  3Q07 A;  3VFF A;  2EX9 A;  3IF6 A;  5HX9 A;  3BFC A;  1J9M A;  4C6Y A;  2GDN A;  4DXC A;  4P6B A;  3IF6 C;  5HAI A;  4E3J A;  4A5R A;  2A3U A;  4EQI A;  1PI5 A;  4E3K A;  3SH8 A;  4HBU A;  2BG1 A;  4OP5 A;  3N8S A;  4EBN A;  2JE5 A;  4D2O A;  3O86 A;  3UO9 A;  2HDR A;  1FQG A;  3IF5 A;  2WZX A;  4OOL A;  3UN7 A;  1FCM A;  4BQM A;  2WK0 A;  3ZG8 B;  5GHX A;  3HL9 A;  2XDM A;  4BEN A;  5E2E A;  2ZQC A;  1KGF A;  1Z6F A;  3VMA A;  1ES3 A;  1HTZ A;  3M2K A;  3W8K A;  3HLE A;  2EX2 A;  1G68 A;  3N4I A;  3GTC A;  4K0W A;  3WS4 A;  3V3S A;  1GHM A;  3VP3 A;  4C3Q A;  3Q7V B;  3RXX A;  1YLZ A;  2H10 A;  4UAA A;  5E2H A;  3N8L A;  4XXR A;  2FFF B;  4ZAM A;  2EFU A;  4OKP A;  4KQR A;  2JCH A;  3IF6 B;  3A3F A;  3BFD A;  1MXO A;  3UDI A;  3WS1 A;  2Y4A A;  1YLP A;  4S2M A;  1GA0 A;  3IH9 A;  3OPR A;  3HUM A;  4L0L A;  3V39 A;  5L2F A;  4K0X A;  3HLG A;  2H5S A;  1FSW A;  2Y55 A;  5FAQ A;  2HP5 A;  1YLT A;  2PBY A;  4WMC A;  5D3O A;  1K6S A;  1ERO A;  4KG5 A;  5FQQ A;  3PAG A;  4QY6 A;  4YIN A;  3LCE A;  2XH9 A;  3PBR A;  2CC1 A;  1QME A;  4S2N A;  1I5Q A;  3ZVW A;  1K6R A;  4Y0U A;  4U0X A;  5GLB A;  4DRT A;  3VP2 A;  3ZG9 B;  5CGW A;  4ZJ3 A;  4S2N C;  4KZA A;  4PMA A;  1W7F A;  3IXG A;  2Y2L A;  4K91 A;  1CEG A;  3HLB A;  2DNS A;  1DJA A;  1YMS A;  2Q9N A;  3O87 A;  3C4P A;  1ZG4 A;  4KZ8 A;  2R9X A;  4QU3 A;  4EV4 A;  1WYC A;  4RVA A;  4LCL A;  3GRJ A;  3ITB A;  4OQH A;  4PM8 A;  4O7D A;  2PU2 A;  2HP9 A;  2EX8 A;  5EVL A;  4B88 A;  1K55 A;  4GN2 A;  4WEK A;  5EUA A;  1MWU A;  2OSU A;  2V1Z A;  4EBL A;  4RYE A;  1NYM A;  3Q82 A;  1K55 C;  1SDE A;  4OQ0 A;  1K54 A;  4CPK A;  3C7V A;  5HL1 A;  2UWX A;  2XLN A;  1K54 C;  5A92 A;  3CMZ A;  4E6W A;  3HBR A;  4S2I A;  1RCJ A;  5F1G A;  2E8I A;  1S0W A;  2HDS A;  4KEN B;  4X6T A;  5EE8 A;  3G31 A;  1VQQ A;  5CHU A;  2WGV A;  1XP4 A;  1LI0 A;  3UPO A;  1DJC A;  4KZ7 A;  1W5D A;  5EEC A;  2ZC6 B;  1XXM A;  1VM1 A;  4FD8 A;  1LL9 A;  5AQB A;  5CTM A;  3GR2 A;  3GSG A;  5IHV A;  4E3O A;  3LY3 A;  1NYY A;  3MBZ A;  3D4F A;  2ZM0 A;  4E3L A;  1XPB A;  5A90 A;  3Q81 A;  4X69 A;  2WGI A;  2ZQA A;  4OPR A;  1E25 A;  4ZBE A;  5FQM A;  3ZCZ A;  4DDY A;  4Q8I A;  4OLG A;  3WS0 A;  3BYD A;  3V5M A;  2DRW A;  3LEZ A;  4E3I A;  3FWL A;  3HUO A;  1GHP A;  4H8R A;  4FH4 A;  2XEP A;  1ES2 A;  1FSY A;  1AXB A;  2C5W B;  4Y0O A;  1NZO A;  5CHM A;  2P74 A;  3WWX A;  5FI2 A;  2ZC3 B;  1O07 A;  3HVF A;  4U0T A;  4HEF A;  3IHB A;  3BM6 A;  3IWO A;  4IVI A;  4JXW A;  4DDS A;  3S4X A;  3GMW A;  1IKG A;  1ONG A;  2JBF A;  4GB7 A;  5DF7 A;  5HAR A;  1EI5 A;  1Y54 A;  2ZM2 A;  3ZVT A;  1IKI A;  1K56 D;  4FCF A;  4JKT A;  4ZTK A;  4OOM A;  1N9B A;  2EXB A;  3OZH A;  2G2U A;  3QNC A;  3NC8 A;  5KMW A;  3IWQ A;  3G30 A;  1CK3 A;  2WZZ A;  2XQZ A;  2B5R A;  2Y2K A;  3AGD A;  3SH7 A;  3VP4 A;  1FR1 A;  2ZM8 A;  2WAF A;  2H0T A;  5AQ9 A;  4GD6 A;  4BL2 A;  5HW3 A;  3M2J A;  5DTT A;  3FKW A;  5TR7 A;  1MY8 A;  3ZNT A;  4EWF A;  4KQO A;  3N7W A;  3IXD A;  4KZB A;  3PTE A;  1L0G A;  3NIA A;  1YLJ A;  4OPY A;  3W4O A;  3G35 A;  3HLW A;  4QD4 A;  1JWV A;  4S2L A;  5DF9 A;  1L2S A;  5DTS A;  3N8R A;  4JBF A;  4QB8 A;  1HZO A;  4X56 A;  5EPH A;  4JF4 A;  1N4O A;  2OLV A;  3CZD A;  1ZKJ A;  3SOI A;  5M19 A;  3NDG A;  2HPB A;  3BEC A;  3IHA A;  3MKF A;  3G2Y A;  2V2F F;  4IBR A;  1JTG A;  4KZ4 A;  3UNW A;  3OPL A;  4R4R A;  4S2K A;  1RP5 A;  2XFS A;  2Z2L B;  4M3K A;  3G32 A;  4P87 A;  5TGF A;  1MBL A;  1U60 A;  2Y2M A;  4P0M A;  2X02 A;  4E6X A;  3G2Z A;  3Q7Z A;  1LI9 A;  3M6B A;  1NY0 A;  5CEC A;  1BUE A;  4KZ9 A;  2VGK A;  3DWK A;  5TFQ A;  4X53 A;  5GHZ A;  3VFH A;  1SKF A;  3WRT A;  1W8Y A;  4JF6 A;  3O88 A;  5EVI A;  1DJB A;  3S1Y A;  2Y2J A;  2J9O A;  1BLC A;  3MKE A;  4OVD A;  3IQA A;  1PZP A;  2H0Y A;  5KZH A;  3A3D A;  1ERM A;  4NET A;  4OH0 A;  2FFY A;  2ZD8 A;  5EVI C;  5CER A;  4S2P A;  3TSG A;  3VSL A;  1M6K A;  4EUZ A;  1KE4 A;  3EQU A;  5KSC A;  1KVL A;  4MBF A;  4DF6 A;  2Y2O A;  1K4E A;  2ZLY A;  4N9L A;  5EOE A;  1WE4 A;  2Q9M A;  1O7E A;  1K57 A;  1MPL A;  3CG5 A;  4KG2 A;  2I72 A;  4DXB A;  4JXV A;  3SH9 A;  1H5X A;  3FV7 A;  4GZB A;  4OQI A;  3OC2 A;  1K57 C;  5U47 A;  3OCN A;  4U3T A;  4X68 A;  4P85 A;  2ZJ9 A;  4R4S A;  3HRE A;  1BZA A;  4S2O A;  1PYY A;  3Q1F A;  3ZGA B;  3P09 A;  2XF3 A;  3GQZ A;  3BLM A;  2OLU A;  3PBN A;  2X01 A;  3MFD A;  4UA9 A;  5EVI B;  3V50 A;  4WZ4 A;  2ZMA A;  1NJ4 A;  3HUN A;  3FZC A;  4OPZ A;  4QHC A;  1YQS A;  1NRF A;  5AQ7 A;  2XFT A;  1YM1 A;  1FCO A;  4JXS A;  1KGE A;  4XUZ A;  4LV0 A;  2ZQ8 A;  5FQK A;  2HP6 A;  1Q2Q A;  1YLW A;  3PBT A;  4BLM A;  2ZQD A;  1NZU A;  2Y2I A;  2XR0 A;  4E3M A;  4PM5 A;  5KSH A;  2P9V A;  5FQ9 A;  2WGW A;  5FI7 A;  3UE0 A;  2EFX A;  1LLB A;  1RGZ A;  1E3U A;  3A3I A;  1SDN A;  5E43 A;  1JWP A;  3WS5 A;  4R23 A;  2ZQ9 A;  4UA7 A;  5CXW A;  4N9K A;  4WBG A;  1GCE A;  5JYP A;  2WYX A;  2XD5 A;  4ID4 A;  1S6R A;  3I7J A;  5GHY A;  4B4Z A;  3A3J A;  1M40 A;  5FI6 A;  4QJG A;  1W8Q A;  3JYI A;  5FAT A;  2WUQ A;  3NBL A;  2XGN A;  2EXA A;  3ZFZ A;  2JC7 A;  3VSK A;  3IWI A;  3ZNY A;  2Y2G A;  3NDE A;  1H8Z A;  4WEL A;  3W4Q A;  4JXG A;  4WEJ A;  1ERQ A;  4RA7 A;  4WMC D;  4KZ3 A;  4FSF A;  4XUX A;  1L0D A;  2EX6 A;  2P9V B;  4KZ6 A;  5DVA A;  2WGW B;  3IXH A;  3BEB A;  4GDB A;  5BOH A;  1K38 A;  2Z2M B;  1FR6 A;  1C3B A;  1MWS A;  3BFG A;  3M6H A;  4RX2 A;  5DTK A;  1L0F A;  1NXY A;  1PWD A;  3BRM A;  3IH8 A;  3WS2 A;  1W79 A;  1DY6 A;  3UE1 A;  4LV3 A;  3ZG0 A;  5A93 A;  4FH2 A;  2HDQ A;  4WYY A;  2XD1 A;  2ZC4 B;  4UA6 A;  1ES4 A;  5CTN A;  1XA7 A;  5FA7 A;  4LV2 A;  3VOY A;  3VP1 A;  4Z9Q A;  3LY4 A;  4N1X A;  4MLL A;  1K25 A;  4JF5 A;  3UDF A;  3IXB A;  4NK3 A;  4PM9 A;  1KE3 A;  2PU4 A;  1HD8 A;  1LHY A;  1XKZ A;  3NCK A;  2Y91 A;  4WZ5 A;  1H8Y A;  5GLA A;  1ZC2 A;  2IWB A;  3MZF A;  1ESI A;  4LEN A;  4WZ5 C;  1BUL A;  2WAD A;  3W4P A;  4GD8 A;  2DCF A;  3GV9 A;  1KE0 A;  3UPP A;  4S2J A;  2C6W B;  3MXR A;  4KG6 A;  1WYB A;  5FQI A;  5CHJ A;  2Y2N A;  3E2K A;  5HAP A;  1I2S A;  1E4D A;  4YFM A;  5HAQ A;  4GKU A;  2X71 A;  3LO7 A;  3A3E A;  1BLS A;  3AGE A;  4R0Q A;  4X55 A;  1BLP A;  1XGJ A;  3G34 A;  1E3U D;  1KVM A;  4B4X A;  3QNB A;  3O3V A;  1YT4 A;  5CRF A;  3SS5 A;  1LL5 A;  2OV5 A;  3C4O A;  1XX2 A;  1G6A A;  1ZG6 A;  3ITA A;  3NY4 A;  3RJU A;  2RL3 A;  4JLF A;  1YMX A;  1EWZ A;  2QPN A;  3AGF A;  3IT9 A;  1BT5 A;  5CGX A;  5E2G A;  3ZDJ A;  1SHV A;  3B3X A;  1BSG A;  1FCN A;  1GA9 A;  2WKE A;  3FYZ A;  4OQG A;  2ZQ7 A;  3FKV A;  1QMF A;  1PW1 A;  1CEF A;  3ISG A;  5DF8 A;  3HLF A;  1ES5 A;  1MWT A;  3N6I A;  1YLY A;  1TDG A;  2G2W A;  1MKI A;  5I94 A;  4PM6 A;  2R9W A;  1IYQ A;  3ZHH A;  4RX3 A;  1XA1 A;  1I2W A;  1L0E A;  3QHY A;  2XK1 A;  3UPN A;  3P98 A;  5FDH A;  4LCM A;  1Q2P A;  5GLD A;  2ZC5 B;  1IEL A;  5J8X A;  4N92 A;  4R1G A;  5M18 A;  3PBS A;  5CED A;  1TVF A;  5M1A A;  1K56 A;  4IBX A;  1ESU A;  4IVK A;  1SCW A;  3BFF A;  4MBH A;  3VOZ A;  5FAP A;  1PZO A;  3SS4 A;  2RCX A;  4DE1 A;  4LV1 A;  4ZJ2 A;  2V20 A;  4PPR A;  4R3B A;  4OOY A;  1RGY A;  4DE3 A;  1BLH A;  2J7V A;  2VGJ A;  2WAE A;  4PM7 A;  5FAS A;  5F82 A;  1JVJ A;  4MNR A;  3WRZ A;  4E3N A; 
#chains in the Genus database with same CATH topology
 4BMW A;  1TEM A;  5IU1 A;  3KYE A;  3T4Q A;  4G3W A;  2Y59 A;  4KQQ A;  1LSX A;  1TDL A;  3UMD A;  4ZJ1 A;  3F1N A;  3TOI A;  2Y2Q A;  1KDW A;  3OPP A;  3G4P A;  1IYP A;  4MBK A;  4GW9 A;  1PWC A;  3UME A;  3CJM A;  3MZE A;  4HES A;  3E2L A;  1IYS A;  4O01 A;  3S22 A;  4X1M A;  4BD1 A;  4QY5 A;  3NI9 A;  4BBT A;  2PD8 A;  2Y2P A;  4UHU A;  4ZDX A;  2A49 A;  3F1N B;  3DTM A;  2QWS A;  2J9P A;  2HZ5 A;  3S7Q A;  3SS3 A;  4KZ5 A;  4MEZ A;  3HLD A;  3ZG7 B;  4JPM A;  4HBT A;  3UY6 A;  3HLC A;  2EX9 A;  2HF6 A;  4FUW A;  4C6Y A;  2GDN A;  2IA2 A;  3A0V A;  4EQI A;  2BG1 A;  4I38 A;  4D2O A;  1G5U A;  2JKG A;  1FQG A;  3UN7 A;  1W63 M;  4BQM A;  5GHX A;  4NKP A;  1AWI A;  1ACF A;  5E2E A;  3VMA A;  1S66 L;  1G68 A;  2GZA A;  3GTC A;  4K0W A;  2W1R A;  3RXX A;  2K2N A;  1SKO A;  4KQR A;  2JCH A;  3UDI A;  3IH9 A;  4L0L A;  1FSW A;  2Y55 A;  4R70 A;  2FH5 A;  2BTF P;  1QME A;  1I5Q A;  2BAS A;  4ME4 A;  4DRT A;  3ZG9 B;  5I5L A;  4S2N C;  5HSQ A;  1YMS A;  2ZOI A;  2R9X A;  4GCZ A;  4OQH A;  1SKO B;  3T4J A;  1UWN X;  4WEK A;  5EUA A;  3MQQ A;  4EBL A;  3Q82 A;  1K55 C;  1K54 A;  4CPK A;  3CI6 A;  4G3V A;  4Q0I A;  1S4R A;  2PR6 A;  4S2I A;  3MF0 A;  3TE8 A;  5LBR A;  5HWV A;  4X6T A;  2HDS A;  3NUL A;  2WGV A;  4HH3 A;  2W1T A;  1VM1 A;  3GR2 A;  3P7N A;  4E3O A;  1NYY A;  3L7H A;  1XPB A;  1MZU A;  2WGI A;  4OPR A;  4ZBE A;  1K0K A;  3V5M A;  2PR5 A;  2NUT C;  4FH4 A;  2XEP A;  1ES2 A;  1FSY A;  4Y0O A;  4Y3I A;  4PHT A;  5FI2 A;  2OAQ 1;  4IVI A;  3IWO A;  2W1T B;  1IKG A;  5DF7 A;  4EER A;  2ZM2 A;  1IKI A;  4FCF A;  2KDK A;  5KMW A;  4HNB A;  2Y2K A;  3VP4 A;  3AGD A;  2H0T A;  5AQ9 A;  3ICY A;  4KQO A;  3N7W A;  4IUH A;  1YLJ A;  3W4O A;  4QD4 A;  3N8R A;  4QB8 A;  5EPH A;  4X56 A;  2Z6D A;  3CZD A;  2HPB A;  2V2F F;  3O5Y A;  3KSI A;  3CUE C;  4P87 A;  3G32 A;  2X02 A;  5F68 A;  2MJ6 A;  3VV4 A;  3VFH A;  5GHZ A;  1SKF A;  4JF6 A;  3S1Y A;  4GHI A;  1BLC A;  3OLO A;  5KZH A;  3LR4 A;  4NET A;  2ZD8 A;  4EUZ A;  3VE3 A;  4S2P A;  1NRJ A;  3SZT A;  4DJ3 A;  4MBF A;  4DF6 A;  3T4K A;  2QKP A;  4DXB A;  2E8J A;  1K57 C;  3OCN A;  2OAP 1;  4X68 A;  2ZJ9 A;  1BZA A;  3ZGA B;  3OBF A;  4JGQ A;  2J3T C;  2XF3 A;  3GQZ A;  4KUO A;  2M7V A;  3MFD A;  4UA9 A;  4GHI B;  4CLC C;  2ZMA A;  1NJ4 A;  3HUN A;  4E04 A;  1X0O A;  1NRF A;  2XFT A;  1FCO A;  2ZQ8 A;  1Q2Q A;  4BLM A;  1NZU A;  1P0Z A;  5FQ9 A;  2KOI A;  2WGW A;  1E3U A;  3D72 A;  1SDN A;  4I3J A;  3DTE A;  5E43 A;  4EXO A;  4L9E A;  3SW1 A;  2WYX A;  4ARZ A;  5GHY A;  3A3J A;  1OTA A;  3NBL A;  2JC7 A;  5DKK A;  3ZNY A;  3W4Q A;  4JXG A;  4RA7 A;  4XUX A;  2EX6 A;  2WGW B;  5DFY A;  4GDB A;  5BOH A;  4P6Z S;  3LI8 A;  4LPZ A;  2Z6C A;  3BFG A;  3M6H A;  5DFX A;  3IH8 A;  3ZG0 A;  4LV3 A;  4ARZ B;  2HDQ A;  1CF0 A;  2ZC4 B;  1ES4 A;  1GSX A;  2J3W A;  4Z9Q A;  3LY4 A;  4JF5 A;  2W3F A;  5DJU A;  4WZ5 A;  2H28 A;  1XKZ A;  3NCK A;  2Y91 A;  1ZC2 A;  1ESI A;  5J4E A;  3LUQ A;  4K08 A;  2JKR M;  2PAV P;  5F5Y A;  2C6W B;  1WYB A;  5EM1 A;  1F2K A;  2VX8 A;  3C2W A;  1E4D A;  2V9A A;  1D06 A;  2ZMV A;  1G28 A;  2X71 A;  1E3U D;  1YT4 A;  5CRF A;  2OV5 A;  3MMH A;  3C4O A;  4HJ6 A;  1XJ6 A;  4LLO B;  4HJ3 A;  1SHV A;  3B3X A;  1FCN A;  4OQG A;  3FKV A;  1QMF A;  5DF8 A;  3N6I A;  1TDG A;  2G2W A;  1MKI A;  3ZHH A;  3KYQ A;  4YOF A;  1L0E A;  2W3G A;  3QHY A;  3A0R A;  3UB6 A;  1LSW A;  3PBS A;  1TVF A;  5M1A A;  4IBX A;  5FAP A;  4ZJ2 A;  4PPR A;  4OOY A;  5DKL A;  2M7U A;  3BY8 A;  2VGJ A;  1OT6 A;  2JKT M;  4E3N A;  5F1F A;  1IYO A;  3EWK A;  3T1S A;  3EEH A;  2IWD A;  4OPQ A;  5G18 A;  3MXS A;  1T18 A;  4BD0 A;  3EQV A;  2Y2H A;  3KSH A;  3UE3 A;  3PAE A;  4EEU A;  3S7P A;  1JWZ A;  4BJP A;  2J80 A;  5E2F A;  4OP8 A;  4DE2 A;  3MQO A;  1XJ4 A;  2P08 A;  2V8C A;  1F5M A;  4R3J A;  4Y2F A;  3CPT A;  2HJE A;  2J8Y A;  5A8B A;  3KX0 X;  5EVI D;  4HI4 A;  4F3L A;  4IED A;  5FSR A;  1PNE A;  3UE6 A;  3NOT C;  1K4F A;  1OME A;  4EBP A;  3QP4 A;  1Y4O A;  4NXB A;  4L9G A;  1S1Y A;  3NEC A;  5AQA A;  1H0M A;  3E4Q A;  3C5A A;  3T4S A;  1TF1 A;  3IX3 A;  4BWI A;  3CPT B;  1D1J A;  4F3L B;  2W3D A;  2WKH A;  3Q07 A;  5HX9 A;  3BFC A;  3EGD C;  2ZL1 A;  4E3J A;  4A5R A;  1PI5 A;  1W63 Q;  1T1C A;  2PRF A;  4HBU A;  3N8S A;  3UO9 A;  4WLA A;  3IF5 A;  4OOL A;  1TS8 A;  2WK0 A;  3MS6 A;  2VGL S;  2ZQC A;  3TJZ C;  1HTZ A;  3MJQ A;  2B18 A;  4C3Q A;  3VP3 A;  1YLZ A;  3N8L A;  4XXR A;  3UB7 A;  2FFF B;  4ZAM A;  2EFU A;  3A3F A;  3BFD A;  2Y4A A;  1YLP A;  2ZL1 B;  2G7U A;  3HUM A;  3EEA A;  5L2F A;  4FOF A;  1YLT A;  2PBY A;  4WMC A;  4Q0H A;  1ERO A;  4KG5 A;  4QY6 A;  2XH9 A;  4S2N A;  2HJ9 C;  3ZVW A;  4U0X A;  4ZJ3 A;  2LB5 A;  4I5S A;  3LR0 A;  4PMA A;  1W7F A;  5J7E A;  1N9L A;  1CEG A;  5TBM A;  4KZ8 A;  1DJA A;  4EV4 A;  1WYC A;  4RVA A;  3GRJ A;  3ITB A;  2PU2 A;  2HP9 A;  1KOU A;  4B88 A;  1K55 A;  2JKF A;  1EW0 A;  1N9N A;  4HH2 A;  1MWU A;  2V1Z A;  4RYE A;  1NYM A;  1SDE A;  4GLQ A;  2UWX A;  2XLN A;  3E4P A;  2OWH A;  3CMZ A;  3HBR A;  2O9B A;  5EE8 A;  3BQ8 A;  1VQQ A;  2FZ0 A;  5TBM B;  3BWL A;  5EEC A;  2ZC6 B;  1BYW A;  4FD8 A;  2GNX A;  1LL9 A;  3U4L P;  5G4Z A;  5CTM A;  4ETZ A;  3TW8 A;  4EQ1 A;  3GSG A;  5IHV A;  3KO6 A;  3LY3 A;  2ZM0 A;  4X69 A;  1E25 A;  3K3C A;  3ZCZ A;  4Q8I A;  3LEZ A;  3FWL A;  3HUO A;  3EGX C;  3PR6 A;  1AXB A;  4HJ4 A;  3HVF A;  1CQA A;  3IHB A;  3BM6 A;  4JXW A;  4CLC E;  3GMW A;  1ONG A;  3HCY A;  1OTI A;  3QNC A;  3NC8 A;  1J3W A;  3G30 A;  3JPU A;  5AVE A;  4GD6 A;  5DTT A;  1VHM A;  3ZNT A;  4EWF A;  2B02 A;  3IXD A;  1L0G A;  3NIA A;  5TJJ A;  2DMW A;  3G35 A;  4QPR A;  5HDS A;  4S2L A;  5DF9 A;  4JF4 A;  2OLV A;  3CUE A;  5M19 A;  1ZHH B;  3TRC A;  1FIK A;  3BEC A;  4IBR A;  4S2K A;  2YKH A;  2ZBB A;  1RP5 A;  5TGF A;  4P0M A;  3G2Z A;  3M6B A;  1BUE A;  3F1O A;  3DWK A;  5TFQ A;  3DTK A;  4IJG A;  3T4L A;  3A3D A;  3LR3 A;  3TSG A;  1DRM A;  3QP5 A;  2V1B A;  3CG5 A;  3R4K A;  1K57 A;  1LT0 A;  4JXV A;  1H5X A;  4GZB A;  1YPR A;  1UWP X;  1WA9 A;  1G6O A;  4U3T A;  2D02 A;  2OWJ A;  2QJ7 A;  3F1O B;  4II7 A;  1GSV A;  3HJK A;  2OLU A;  3QP8 A;  2X01 A;  2K31 A;  2NUP C;  2WKQ A;  3FZC A;  5AQ7 A;  1YM1 A;  4JXS A;  3A0S A;  4LV0 A;  1YLW A;  3PBT A;  4I3A A;  2ZQD A;  4NG2 A;  4E3M A;  1GSW A;  2VGL M;  5FI7 A;  1RGZ A;  4H6J A;  3UB5 P;  1JWP A;  4UA7 A;  2KLI A;  1XFN A;  4YWZ A;  4WBG A;  1GCE A;  5JYP A;  2XD5 A;  3IS2 A;  1S6R A;  3I7J A;  3EOI A;  1M40 A;  3B47 A;  1W8Q A;  2AVX A;  2XGN A;  3G6O A;  4LRZ E;  3IWI A;  1DP8 A;  3NDE A;  1H8Z A;  1ERQ A;  5DVA A;  3IXH A;  4H6J B;  1FR6 A;  1STZ A;  1OJ5 A;  4RX2 A;  1L0F A;  5HDC A;  4LRX C;  3WS2 A;  3RTY A;  1TS6 A;  2V0W A;  4UA6 A;  2JN7 A;  5CTN A;  1XA7 A;  5FA7 A;  1V9Y A;  4LV2 A;  3UDF A;  3IXB A;  4NK3 A;  1KE3 A;  5DJT A;  1DP6 A;  3MZF A;  2GX5 A;  1CJF A;  1KE0 A;  1A0K A;  1P97 A;  4S2J A;  3MXR A;  4KG6 A;  5CHJ A;  2Y2N A;  4PAU A;  4R6L A;  4YFM A;  3U2A A;  3ZYT A;  5EVE A;  4X55 A;  1BLS A;  4R0Q A;  1V9Z A;  2Q0O A;  4O0P A;  3ZQ5 A;  1LL5 A;  1XX2 A;  1ZG6 A;  3ITA A;  1XFQ A;  3RJU A;  2O9A A;  4JLF A;  1YMX A;  2QPN A;  4EET B;  1BT5 A;  5CGX A;  4CQH A;  1TS0 A;  2ZQ7 A;  1CEF A;  5L10 A;  3LR5 A;  1YLY A;  3C8C A;  2R9W A;  4RX3 A;  1XA1 A;  2XK1 A;  4JGO A;  3P98 A;  4WL9 A;  5GLD A;  3HJI A;  2ZC5 B;  4O8G A;  1H3Q A;  3QP1 A;  1K56 A;  4MN7 A;  1ESU A;  4R3B A;  5HWT A;  2Y79 A;  2INW A;  1BLH A;  5FAS A;  5F82 A;  1JVJ A;  3WRZ A;  4FTX A;  3KYZ A;  3QP6 A;  3T50 A;  2WKI A;  2HDU A;  3UDX A;  5HDD A;  2V8F A;  5FQJ A;  5CGS A;  3PBO A;  3LFV A;  4D60 A;  3BFE A;  4OLD A;  3GVB A;  5A91 A;  1FOF A;  2QMI A;  1XGI A;  3DW0 A;  3NHQ A;  2V1A A;  5HFO A;  1CI9 A;  4I3I A;  1PIO A;  4DE0 A;  4F94 A;  4G3K A;  1KGG A;  2IWC A;  2QZ6 A;  1BTL A;  2P04 A;  1PW8 A;  4R38 A;  3LGO A;  2W0N A;  3H7W A;  4CJN A;  1GHI A;  2PT7 A;  4GDN A;  2I9V A;  3PBQ A;  1HVB A;  1JTD A;  4BL3 A;  4RQ9 A;  1PWG A;  1T19 A;  4X25 A;  5L07 A;  1LL8 A;  4P6B A;  3IF6 C;  4E3K A;  3O86 A;  5HWW A;  2WZX A;  4Y13 A;  3HL9 A;  1YSQ A;  4BEN A;  3H7W B;  4Z1W A;  1Z6F A;  3VOL A;  3HLE A;  3N4I A;  3WS4 A;  1GHM A;  3NOP C;  3NJA A;  5E2H A;  5HD5 A;  1XJ2 A;  4OKP A;  1MXO A;  1GA0 A;  3OPR A;  3V39 A;  4K0X A;  3HLG A;  2VJW A;  5D3O A;  2JHE A;  5FQQ A;  2OOL A;  3PAG A;  4YIN A;  5GLB A;  3VP2 A;  3MSH A;  5CGW A;  4KZA A;  4JGR A;  3IXG A;  2Y2L A;  4K91 A;  3HLB A;  3UB9 A;  2Q9N A;  3C4P A;  4PKY G;  4AFI A;  4QU3 A;  4LCL A;  3DTI A;  2EX8 A;  5EVL A;  4GN2 A;  2OSU A;  2L1M A;  1OJG A;  3C7V A;  5HL1 A;  4M4X A;  2PYP A;  4LFU A;  1RCJ A;  4KEN B;  3G31 A;  5CHU A;  1XP4 A;  1LI0 A;  3UPO A;  3BJN A;  1DJC A;  4KZ7 A;  1XXM A;  3T12 B;  1DP9 A;  1Z09 A;  5EFW A;  4KUK A;  4NXF A;  2VV6 A;  3T1X A;  2EA9 A;  4E3L A;  3CLO A;  3Q81 A;  2ZQA A;  5FQM A;  4OLG A;  1ZTU A;  3IX4 A;  3S7N A;  2XSS A;  4H8R A;  3WWX A;  5IS1 A;  2ZC3 B;  1O07 A;  3LIF A;  4DDS A;  2JBF A;  4GB7 A;  3IBJ A;  1Y54 A;  3ZVT A;  4OOM A;  2EXB A;  5FEF A;  1OT9 A;  3OZH A;  3T4O A;  1CK3 A;  2WZZ A;  2XQZ A;  2B5R A;  3D9Y A;  4NEE D;  1FR1 A;  5HW3 A;  4BL2 A;  3M2J A;  3LIB A;  3PTE A;  2O99 A;  4MMN A;  3HLW A;  1SZV A;  5CX7 A;  1JWV A;  2PD7 A;  1L2S A;  1HZO A;  5C5K A;  5G4Y A;  1ZKJ A;  3IHA A;  3G2Y A;  3CAX A;  1JTG A;  3UNW A;  4IUK A;  3OPL A;  3B42 A;  1YSP A;  2Y2M A;  3LIE A;  1LI9 A;  4DJ2 A;  5CEC A;  3IBR A;  2VGK A;  3OOV A;  4Y15 A;  3MR0 A;  2A24 A;  5HPI A;  3MKE A;  4OVD A;  3IQA A;  1PZP A;  2O9C A;  4OH0 A;  1ERM A;  5EVI C;  5CER A;  1M6K A;  5KSC A;  3EQU A;  1YKD A;  2Y2O A;  2ZLY A;  4N9L A;  5EOE A;  1WE4 A;  1O7E A;  1MPL A;  4UQI M;  3FV7 A;  4OQI A;  3OC2 A;  2QHK A;  4MN5 A;  1S67 L;  5L8M A;  1PYY A;  3PBN A;  3C38 A;  2A24 B;  5EV0 A;  4QHC A;  1ODV A;  1YQS A;  5AVF A;  5FQK A;  5MC7 A;  2XR0 A;  2P9V A;  3KSG A;  3CIT A;  4BBV A;  3UE0 A;  2EFX A;  1LLB A;  3A3I A;  4HIA A;  3WS5 A;  2ZQ9 A;  4HQA A;  1Y28 A;  4ID4 A;  2HV1 A;  4Y5F A;  1D7E A;  1OTD A;  2P7J A;  5FI6 A;  4QJG A;  3JYI A;  3T1R A;  2EXA A;  4NXE A;  1TD5 A;  4WEL A;  2XA7 M;  4WEJ A;  4WMC D;  4KZ3 A;  3LIC A;  4KZ6 A;  2P9V B;  3W2Z A;  3BEB A;  1K38 A;  2Z2M B;  5DTK A;  1P9R A;  1NXY A;  5A93 A;  3LID A;  4FH2 A;  4WYY A;  2XD1 A;  2W27 A;  3VOY A;  1MC0 A;  1YAX A;  4N1X A;  4MLL A;  3PXP A;  2B95 A;  4PM9 A;  2PU4 A;  1HD8 A;  2IWB A;  5GLA A;  1H8Y A;  4LEN A;  2WAD A;  4GD8 A;  3B33 A;  3NOU C;  3PYP A;  3GV9 A;  4B9O A;  3E2K A;  5HAP A;  1I2S A;  2O0Y A;  3JVV A;  1P9W A;  3H82 A;  4HOI A;  1BLP A;  4BBU A;  4WN5 A;  1F98 A;  1KVM A;  4B4X A;  3QNB A;  3SS5 A;  5K5B A;  2UV0 E;  2KX6 A;  1G6A A;  5FL3 A;  2QYB A;  2EWV A;  4WF0 A;  3IT9 A;  1EWZ A;  3AGF A;  3MQ0 A;  5E2G A;  2HGV A;  3K3D A;  1BSG A;  3FYZ A;  3FPV A;  5F69 A;  1PW1 A;  1ES5 A;  1MWT A;  4HHD A;  4PM6 A;  3E0Y A;  3H82 B;  5F6A A;  3MXQ A;  2Y8H A;  2VEA A;  3UPN A;  2PBD P;  5FDH A;  4LCM A;  1Q2P A;  4CLC A;  5HZH A;  1IEL A;  5J8X A;  4N92 A;  3L9K A;  2XRN A;  1VET A;  4IVK A;  3GDI A;  3BFF A;  2RCX A;  4LV1 A;  2V20 A;  1HLU P;  4DE3 A;  2J7V A;  4PM7 A;  4MNR A;  3VP0 A;  1IEM A;  5F83 A;  1NLZ A;  3T4T A;  3DWZ A;  4XT2 A;  4L9F A;  3C7U A;  4N1H A;  3BY9 A;  3LI9 A;  2ZC7 A;  4CLC B;  4EU0 A;  2VV8 A;  1ONH A;  1VET B;  5GLC A;  4GNU A;  4Y0T A;  2W3E A;  4DKI A;  4EEP A;  2VLG A;  1KDS A;  4C75 A;  4PKY A;  1S4S A;  3T1Q B;  3BLS A;  5EOO A;  3K2N A;  4XT2 B;  1MKM A;  4Y7P A;  4GS9 A;  1ALQ A;  2BLS A;  3OCL A;  3E4O A;  4MDZ A;  1T1A A;  3GEC A;  3IS2 B;  4QWO A;  5CEB A;  1CI8 A;  4OON A;  3OPH A;  4GOG A;  4KQD A;  2J3T D;  2CMN A;  4HP9 A;  3V3R A;  5GL9 A;  1PI4 A;  4CLC D;  3ULF A;  3MZD A;  5JYO A;  5FAO A;  3Q7V A;  1MWR A;  3TG9 A;  3RXW A;  1OTE A;  4WM9 A;  1TS7 A;  3ZG5 A;  2LB9 A;  3VFF A;  3IF6 A;  2VA0 A;  3S7O A;  1J9M A;  4MN6 A;  4GS9 B;  4DXC A;  5HAI A;  2A3U A;  3SH8 A;  4OP5 A;  4EES A;  4EBN A;  2JE5 A;  2HDR A;  1FCM A;  3ZG8 B;  3CWF A;  2XDM A;  3QP2 A;  1KGF A;  1ES3 A;  1NLY A;  3M2K A;  3W8K A;  2PDR A;  2EX2 A;  1N9O A;  4X1L A;  3V3S A;  3CHW P;  3Q7V B;  1VEU A;  2H10 A;  4UAA A;  4ZRR A;  3IF6 B;  2R78 A;  3WS1 A;  2W3H A;  4S2M A;  4LRY C;  2H5S A;  5FAQ A;  2HP5 A;  2JKR I;  1K6S A;  2D01 A;  3LCE A;  3PBR A;  2PHY A;  2CC1 A;  3MFX A;  1K6R A;  4Y0U A;  1JNU A;  2DNS A;  5HL6 A;  3O87 A;  5FDS A;  1ZG4 A;  1VEU B;  4ESP A;  4EUV A;  4PM8 A;  4EW7 A;  4O7D A;  2ACG A;  1UGU A;  4NXG A;  1XJ3 A;  4OQ0 A;  1K54 C;  5A92 A;  4E6W A;  5F1G A;  2E8I A;  1S0W A;  4DMZ A;  1W5D A;  5AQB A;  2K7S A;  3MBZ A;  3D4F A;  5A90 A;  2JKT I;  4DDY A;  3WS0 A;  3BYD A;  2DRW A;  2VK3 A;  4E3I A;  4UQI S;  1GHP A;  3DBA A;  3VE4 A;  2C5W B;  5CHM A;  1NZO A;  2P74 A;  4U0T A;  4HEF A;  3BW6 A;  3S4X A;  2WKP A;  5HAR A;  1EI5 A;  1K56 D;  4JKT A;  4ZTK A;  5HPF A;  1N9B A;  5L09 A;  2G2U A;  3IWQ A;  1S1Z A;  3SH7 A;  2ZM8 A;  2WAF A;  1T1B A;  3RH8 B;  3FKW A;  5TR7 A;  1MY8 A;  4KZB A;  5AJG A;  4OPY A;  2GJ3 A;  5DTS A;  4JBF A;  4DN0 A;  1N4O A;  3FG8 A;  3SOI A;  3NDG A;  3MKF A;  3R7W A;  5IT5 A;  5J3W A;  4KZ4 A;  4R4R A;  2XFS A;  2Z2L B;  4M3K A;  4E6X A;  1MBL A;  1U60 A;  3V67 A;  3Q7Z A;  1NY0 A;  4KZ9 A;  4X53 A;  3WRT A;  1W8Y A;  3O88 A;  5EVI A;  1DJB A;  2Y2J A;  2J9O A;  4HY8 A;  2XA7 S;  2VKS A;  2EWW A;  2H0Y A;  2FFY A;  3VSL A;  2VZW A;  1KE4 A;  1KVL A;  2L0W A;  4UEY A;  1K4E A;  2QJ5 A;  2A2L A;  2Q9M A;  4KG2 A;  3IX8 A;  2I72 A;  3R7W B;  3SH9 A;  1OPX A;  5U47 A;  5FEG A;  4P85 A;  2XRO A;  4R4S A;  3FC7 A;  2M1C A;  4B93 A;  3HRE A;  4S2O A;  3Q1F A;  4MCW A;  3P09 A;  3BLM A;  4LGW A;  5EVI B;  3V50 A;  4WZ4 A;  4OPZ A;  3LEQ A;  1KGE A;  4XUZ A;  1L3L A;  2HP6 A;  2Y2I A;  4PM5 A;  5KSH A;  4GJ4 A;  3F1P A;  3RFB A;  3KSF A;  1F9I A;  4R23 A;  5CXW A;  4N9K A;  2YKF A;  4R3A A;  4B4Z A;  5FAT A;  2WUQ A;  3ZFZ A;  3VSK A;  4WUJ A;  2Y2G A;  3JVU A;  4I39 A;  3P01 A;  3FPW A;  4FSF A;  1L0D A;  4HP4 A;  3F1P B;  2VV7 A;  5HD3 A;  1C3B A;  1MWS A;  1PWD A;  3BRM A;  1W79 A;  1DY6 A;  3UE1 A;  1IOU A;  3VP1 A;  3E98 A;  2L4R A;  1K25 A;  3PHY A;  4YNR A;  4JGP A;  3BQA A;  1LHY A;  3LYX A;  1OTB A;  1FIL A;  1PFL A;  4ETX A;  4WZ5 C;  1BUL A;  3W4P A;  4IHQ A;  2DCF A;  3UPP A;  5FQI A;  5HAQ A;  4GKU A;  2ZMF A;  3LO7 A;  2ZOH A;  3A3E A;  3AGE A;  3G34 A;  1XGJ A;  3O3V A;  5EM0 A;  3LIA A;  3NY4 A;  2RL3 A;  3ZDJ A;  3DAV A;  1H8M A;  1GA9 A;  2WKE A;  3ISG A;  1IFQ A;  3HLF A;  5I94 A;  2WKR A;  1IYQ A;  4Y17 A;  5KIZ A;  1I2W A;  3D3O A;  4P6Z M;  2PYR A;  3UB8 A;  4Q0J A;  1PRQ A;  4R1G A;  5M18 A;  5CED A;  1NWZ A;  2V0U A;  3H9W A;  1SCW A;  4MBH A;  3VOZ A;  1PZO A;  3SS4 A;  4DE1 A;  1LSV A;  1RGY A;  1VB6 A;  2WAE A;  3C30 A; 
#chains in the Genus database with same CATH homology
 5F1F A;  3VP0 A;  1IYO A;  1IEM A;  5F83 A;  1TEM A;  3DWZ A;  2IWD A;  3C7U A;  4OPQ A;  4N1H A;  5G18 A;  2WKI A;  2Y59 A;  2ZC7 A;  2HDU A;  3UDX A;  4KQQ A;  1TDL A;  3MXS A;  4BD0 A;  3EQV A;  2Y2H A;  3UE3 A;  3PAE A;  1ONH A;  4ZJ1 A;  1JWZ A;  3TOI A;  2Y2Q A;  5FQJ A;  1KDW A;  5CGS A;  5E2F A;  4BJP A;  3OPP A;  3PBO A;  3G4P A;  4OP8 A;  4DE2 A;  5GLC A;  1IYP A;  4GNU A;  4MBK A;  3BFE A;  4OLD A;  4Y0T A;  1PWC A;  3GVB A;  4R3J A;  4DKI A;  5A91 A;  2J8Y A;  1FOF A;  3CJM A;  5EVI D;  2QMI A;  1KDS A;  4C75 A;  4IED A;  1XGI A;  3DW0 A;  5FSR A;  3BLS A;  3MZE A;  4HES A;  5EOO A;  3E2L A;  1IYS A;  5HFO A;  1CI9 A;  3S22 A;  4Y7P A;  4BD1 A;  1PIO A;  1K4F A;  4QY5 A;  1ALQ A;  4DE0 A;  4F94 A;  2BLS A;  1OME A;  3NI9 A;  3OCL A;  1KGG A;  2IWC A;  2QZ6 A;  5CEB A;  1BTL A;  2Y2P A;  4UHU A;  4EBP A;  4ZDX A;  1CI8 A;  2A49 A;  4OON A;  3OPH A;  4GOG A;  3DTM A;  1PW8 A;  2J9P A;  5AQA A;  3C5A A;  3V3R A;  3SS3 A;  5GL9 A;  4CJN A;  1GHI A;  1PI4 A;  4KZ5 A;  3MZD A;  4MEZ A;  4GDN A;  5JYO A;  3HLD A;  3PBQ A;  3ZG7 B;  5FAO A;  4JPM A;  3Q7V A;  1MWR A;  4HBT A;  3TG9 A;  1HVB A;  3RXW A;  1JTD A;  4WM9 A;  2WKH A;  3UY6 A;  3ZG5 A;  4BL3 A;  1PWG A;  3HLC A;  3Q07 A;  3VFF A;  2EX9 A;  3IF6 A;  5HX9 A;  3BFC A;  1J9M A;  4C6Y A;  2GDN A;  4DXC A;  4P6B A;  3IF6 C;  5HAI A;  4E3J A;  4A5R A;  2A3U A;  4EQI A;  1PI5 A;  4E3K A;  3SH8 A;  4HBU A;  2BG1 A;  4OP5 A;  3N8S A;  4EBN A;  2JE5 A;  4D2O A;  3O86 A;  3UO9 A;  2HDR A;  1FQG A;  3IF5 A;  2WZX A;  4OOL A;  3UN7 A;  1FCM A;  4BQM A;  2WK0 A;  3ZG8 B;  5GHX A;  3HL9 A;  2XDM A;  4BEN A;  5E2E A;  2ZQC A;  1KGF A;  1Z6F A;  3VMA A;  1ES3 A;  1HTZ A;  3M2K A;  3W8K A;  3HLE A;  2EX2 A;  1G68 A;  3N4I A;  3GTC A;  4K0W A;  3WS4 A;  3V3S A;  1GHM A;  3VP3 A;  4C3Q A;  3Q7V B;  3RXX A;  1YLZ A;  2H10 A;  4UAA A;  5E2H A;  3N8L A;  4XXR A;  2FFF B;  4ZAM A;  2EFU A;  4OKP A;  4KQR A;  2JCH A;  3IF6 B;  3A3F A;  3BFD A;  1MXO A;  3UDI A;  3WS1 A;  2Y4A A;  1YLP A;  4S2M A;  1GA0 A;  3IH9 A;  3OPR A;  3HUM A;  4L0L A;  3V39 A;  5L2F A;  4K0X A;  3HLG A;  2H5S A;  1FSW A;  2Y55 A;  5FAQ A;  2HP5 A;  1YLT A;  2PBY A;  4WMC A;  5D3O A;  1K6S A;  1ERO A;  4KG5 A;  5FQQ A;  3PAG A;  4QY6 A;  4YIN A;  3LCE A;  2XH9 A;  3PBR A;  2CC1 A;  1QME A;  4S2N A;  1I5Q A;  3ZVW A;  1K6R A;  4Y0U A;  4U0X A;  5GLB A;  4DRT A;  3VP2 A;  3ZG9 B;  5CGW A;  4ZJ3 A;  4S2N C;  4KZA A;  4PMA A;  1W7F A;  3IXG A;  2Y2L A;  4K91 A;  1CEG A;  3HLB A;  2DNS A;  1DJA A;  1YMS A;  2Q9N A;  3O87 A;  3C4P A;  1ZG4 A;  4KZ8 A;  2R9X A;  4QU3 A;  4EV4 A;  1WYC A;  4RVA A;  4LCL A;  3GRJ A;  3ITB A;  4OQH A;  4PM8 A;  4O7D A;  2PU2 A;  2HP9 A;  2EX8 A;  5EVL A;  4B88 A;  1K55 A;  4GN2 A;  4WEK A;  5EUA A;  1MWU A;  2OSU A;  2V1Z A;  4EBL A;  4RYE A;  1NYM A;  3Q82 A;  1K55 C;  1SDE A;  4OQ0 A;  1K54 A;  4CPK A;  3C7V A;  5HL1 A;  2UWX A;  2XLN A;  1K54 C;  5A92 A;  3CMZ A;  4E6W A;  3HBR A;  4S2I A;  1RCJ A;  5F1G A;  2E8I A;  1S0W A;  2HDS A;  4KEN B;  4X6T A;  5EE8 A;  3G31 A;  1VQQ A;  5CHU A;  2WGV A;  1XP4 A;  1LI0 A;  3UPO A;  1DJC A;  4KZ7 A;  1W5D A;  5EEC A;  2ZC6 B;  1XXM A;  1VM1 A;  4FD8 A;  1LL9 A;  5AQB A;  5CTM A;  3GR2 A;  3GSG A;  5IHV A;  4E3O A;  3LY3 A;  1NYY A;  3MBZ A;  3D4F A;  2ZM0 A;  4E3L A;  1XPB A;  5A90 A;  3Q81 A;  4X69 A;  2WGI A;  2ZQA A;  4OPR A;  1E25 A;  4ZBE A;  5FQM A;  3ZCZ A;  4DDY A;  4Q8I A;  4OLG A;  3WS0 A;  3BYD A;  3V5M A;  2DRW A;  3LEZ A;  4E3I A;  3FWL A;  3HUO A;  1GHP A;  4H8R A;  4FH4 A;  2XEP A;  1ES2 A;  1FSY A;  1AXB A;  2C5W B;  4Y0O A;  1NZO A;  5CHM A;  2P74 A;  3WWX A;  5FI2 A;  2ZC3 B;  1O07 A;  3HVF A;  4U0T A;  4HEF A;  3IHB A;  3BM6 A;  3IWO A;  4IVI A;  4JXW A;  4DDS A;  3S4X A;  3GMW A;  1IKG A;  1ONG A;  2JBF A;  4GB7 A;  5DF7 A;  5HAR A;  1EI5 A;  1Y54 A;  2ZM2 A;  3ZVT A;  1IKI A;  1K56 D;  4FCF A;  4JKT A;  4ZTK A;  4OOM A;  1N9B A;  2EXB A;  3OZH A;  2G2U A;  3QNC A;  3NC8 A;  5KMW A;  3IWQ A;  3G30 A;  1CK3 A;  2WZZ A;  2XQZ A;  2B5R A;  2Y2K A;  3AGD A;  3SH7 A;  3VP4 A;  1FR1 A;  2ZM8 A;  2WAF A;  2H0T A;  5AQ9 A;  4GD6 A;  4BL2 A;  5HW3 A;  3M2J A;  5DTT A;  3FKW A;  5TR7 A;  1MY8 A;  3ZNT A;  4EWF A;  4KQO A;  3N7W A;  3IXD A;  4KZB A;  3PTE A;  1L0G A;  3NIA A;  1YLJ A;  4OPY A;  3W4O A;  3G35 A;  3HLW A;  4QD4 A;  1JWV A;  4S2L A;  5DF9 A;  1L2S A;  5DTS A;  3N8R A;  4JBF A;  4QB8 A;  1HZO A;  4X56 A;  5EPH A;  4JF4 A;  1N4O A;  2OLV A;  3CZD A;  1ZKJ A;  3SOI A;  5M19 A;  3NDG A;  2HPB A;  3BEC A;  3IHA A;  3MKF A;  3G2Y A;  2V2F F;  4IBR A;  1JTG A;  4KZ4 A;  3UNW A;  3OPL A;  4R4R A;  4S2K A;  1RP5 A;  2XFS A;  2Z2L B;  4M3K A;  3G32 A;  4P87 A;  5TGF A;  1MBL A;  1U60 A;  2Y2M A;  4P0M A;  2X02 A;  4E6X A;  3G2Z A;  3Q7Z A;  1LI9 A;  3M6B A;  1NY0 A;  5CEC A;  1BUE A;  4KZ9 A;  2VGK A;  3DWK A;  5TFQ A;  4X53 A;  5GHZ A;  3VFH A;  1SKF A;  3WRT A;  1W8Y A;  4JF6 A;  3O88 A;  5EVI A;  1DJB A;  3S1Y A;  2Y2J A;  2J9O A;  1BLC A;  3MKE A;  4OVD A;  3IQA A;  1PZP A;  2H0Y A;  5KZH A;  3A3D A;  1ERM A;  4NET A;  4OH0 A;  2FFY A;  2ZD8 A;  5EVI C;  5CER A;  4S2P A;  3TSG A;  3VSL A;  1M6K A;  4EUZ A;  1KE4 A;  3EQU A;  5KSC A;  1KVL A;  4MBF A;  4DF6 A;  2Y2O A;  1K4E A;  2ZLY A;  4N9L A;  5EOE A;  1WE4 A;  2Q9M A;  1O7E A;  1K57 A;  1MPL A;  3CG5 A;  4KG2 A;  2I72 A;  4DXB A;  4JXV A;  3SH9 A;  1H5X A;  3FV7 A;  4GZB A;  4OQI A;  3OC2 A;  1K57 C;  5U47 A;  3OCN A;  4U3T A;  4X68 A;  4P85 A;  2ZJ9 A;  4R4S A;  3HRE A;  1BZA A;  4S2O A;  1PYY A;  3Q1F A;  3ZGA B;  3P09 A;  2XF3 A;  3GQZ A;  3BLM A;  2OLU A;  3PBN A;  2X01 A;  3MFD A;  4UA9 A;  5EVI B;  3V50 A;  4WZ4 A;  2ZMA A;  1NJ4 A;  3HUN A;  3FZC A;  4OPZ A;  4QHC A;  1YQS A;  1NRF A;  5AQ7 A;  2XFT A;  1YM1 A;  1FCO A;  4JXS A;  1KGE A;  4XUZ A;  4LV0 A;  2ZQ8 A;  5FQK A;  2HP6 A;  1Q2Q A;  1YLW A;  3PBT A;  4BLM A;  2ZQD A;  1NZU A;  2Y2I A;  2XR0 A;  4E3M A;  4PM5 A;  5KSH A;  2P9V A;  5FQ9 A;  2WGW A;  5FI7 A;  3UE0 A;  2EFX A;  1LLB A;  1RGZ A;  1E3U A;  3A3I A;  1SDN A;  5E43 A;  1JWP A;  3WS5 A;  4R23 A;  2ZQ9 A;  4UA7 A;  5CXW A;  4N9K A;  4WBG A;  1GCE A;  5JYP A;  2WYX A;  2XD5 A;  4ID4 A;  1S6R A;  3I7J A;  5GHY A;  4B4Z A;  3A3J A;  1M40 A;  5FI6 A;  4QJG A;  1W8Q A;  3JYI A;  5FAT A;  2WUQ A;  3NBL A;  2XGN A;  2EXA A;  3ZFZ A;  2JC7 A;  3VSK A;  3IWI A;  3ZNY A;  2Y2G A;  3NDE A;  1H8Z A;  4WEL A;  3W4Q A;  4JXG A;  4WEJ A;  1ERQ A;  4RA7 A;  4WMC D;  4KZ3 A;  4FSF A;  4XUX A;  1L0D A;  2EX6 A;  2P9V B;  4KZ6 A;  5DVA A;  2WGW B;  3IXH A;  3BEB A;  4GDB A;  5BOH A;  1K38 A;  2Z2M B;  1FR6 A;  1C3B A;  1MWS A;  3BFG A;  3M6H A;  4RX2 A;  5DTK A;  1L0F A;  1NXY A;  1PWD A;  3BRM A;  3IH8 A;  3WS2 A;  1W79 A;  1DY6 A;  3UE1 A;  4LV3 A;  3ZG0 A;  5A93 A;  4FH2 A;  2HDQ A;  4WYY A;  2XD1 A;  2ZC4 B;  4UA6 A;  1ES4 A;  5CTN A;  1XA7 A;  5FA7 A;  4LV2 A;  3VOY A;  3VP1 A;  4Z9Q A;  3LY4 A;  4N1X A;  4MLL A;  1K25 A;  4JF5 A;  3UDF A;  3IXB A;  4NK3 A;  4PM9 A;  1KE3 A;  2PU4 A;  1HD8 A;  1LHY A;  1XKZ A;  3NCK A;  2Y91 A;  4WZ5 A;  1H8Y A;  5GLA A;  1ZC2 A;  2IWB A;  3MZF A;  1ESI A;  4LEN A;  4WZ5 C;  1BUL A;  2WAD A;  3W4P A;  4GD8 A;  2DCF A;  3GV9 A;  1KE0 A;  3UPP A;  4S2J A;  2C6W B;  3MXR A;  4KG6 A;  1WYB A;  5FQI A;  5CHJ A;  2Y2N A;  3E2K A;  5HAP A;  1I2S A;  1E4D A;  4YFM A;  5HAQ A;  4GKU A;  2X71 A;  3LO7 A;  3A3E A;  1BLS A;  3AGE A;  4R0Q A;  4X55 A;  1BLP A;  1XGJ A;  3G34 A;  1E3U D;  1KVM A;  4B4X A;  3QNB A;  3O3V A;  1YT4 A;  5CRF A;  3SS5 A;  1LL5 A;  2OV5 A;  3C4O A;  1XX2 A;  1G6A A;  1ZG6 A;  3ITA A;  3NY4 A;  3RJU A;  2RL3 A;  4JLF A;  1YMX A;  1EWZ A;  2QPN A;  3AGF A;  3IT9 A;  1BT5 A;  5CGX A;  5E2G A;  3ZDJ A;  1SHV A;  3B3X A;  1BSG A;  1FCN A;  1GA9 A;  2WKE A;  3FYZ A;  4OQG A;  2ZQ7 A;  3FKV A;  1QMF A;  1PW1 A;  1CEF A;  3ISG A;  5DF8 A;  3HLF A;  1ES5 A;  1MWT A;  3N6I A;  1YLY A;  1TDG A;  2G2W A;  1MKI A;  5I94 A;  4PM6 A;  2R9W A;  1IYQ A;  3ZHH A;  4RX3 A;  1XA1 A;  1I2W A;  1L0E A;  3QHY A;  2XK1 A;  3UPN A;  3P98 A;  5FDH A;  4LCM A;  1Q2P A;  5GLD A;  2ZC5 B;  1IEL A;  5J8X A;  4N92 A;  4R1G A;  5M18 A;  3PBS A;  5CED A;  1TVF A;  5M1A A;  1K56 A;  4IBX A;  1ESU A;  4IVK A;  1SCW A;  3BFF A;  4MBH A;  3VOZ A;  5FAP A;  1PZO A;  3SS4 A;  2RCX A;  4DE1 A;  4LV1 A;  4ZJ2 A;  2V20 A;  4PPR A;  4R3B A;  4OOY A;  1RGY A;  4DE3 A;  1BLH A;  2J7V A;  2VGJ A;  2WAE A;  4PM7 A;  5FAS A;  5F82 A;  1JVJ A;  4MNR A;  3WRZ A;  4E3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...