4GNYA

Bovine beta-lactoglobulin complex with dodecyl sulfate
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
161
structure length
157
Chain Sequence
b'IVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title Ligand-binding and self-association cooperativity of beta-lactoglobulin
pubmed doi rcsb
molecule tags Transport protein
total genus 39
structure length 157
sequence length 161
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4gnyA00
2LKKA 2OVAA 1YWDA 1SXWA 4GKCA 5L8IA 3FW5A 4EFGA 1JV4A 1SY2A 3VG5A 3KFIA 4GRJA 1ICNA 1PBOA 3B2JA 2W2BA 2K23A 4ZCBA 4IAWA 4BVMA 1BBPA 4IB8A 2P8GA 3HWGA 3QKGA 2FWVA 4TQ2A 1TXLA 1BSYA 3GAQA 2WEWA 3DTQA 1P6PA 2QM9A 1EXSA 2L67A 4OMXA 3BSZE 4RUUA 3U9PC 3D95A 3APUA 1UZ2X 1X8QA 3EM0A 1YUPA 3PECA 4RUNA 1G74A 3S26A 4ORUA 2LBVA 4TJZA 1I04A 1LIEA 1RBPA 2A3FX 4AZPA 4N7DA 5LJHA 4A1YA 1BWYA 4I3CA 1QABE 5HTDA 5HTEA 2NNDA 3WJBA 4AZMA 5HCDC 3FIQA 3CBSA 1VYFA 5F6BA 2E4JA 1HN2A 1EIOA 3FEPA 3MVFA 3WJDA 4QGWA 4QYNA 1KXOA 1IFCA 4AZOA 1CBIA 1YWBA 1EPAA 1KOIA 1IKEA 5IO6A 2Q2PA 3CR6A 5L8NA 1D3SA 3EBWA 3T1DA 3D96A 2A2GA 4M7MA 1LNMA 4QAEA 5HAEA 4I9SA 2A0AA 3FW4A 1EPBA 3PP6A 4PSQA 4QGXA 3I0AA 3B2KA 3IFBA 5K06A 2NNQA 3APVA 4A1HA 4LKPA 2AT3X 3BDRA 3NQ3A 5DPQA 3OJYC 1VYGA 1LIBA 2ALLX 3BY0A 3C78X 4ZH9A 5D4AA 1ERXA 5LJCA 2JU3A 4HPCA 5C0NA 4TKJA 4N7CA 4ZHFA 1D2UA 4D6AA 4R0BA 1QQSA 4Y0PA 4YFPA 1YWCA 5BVQA 3F9DA 3JSQA 4I3DA 2XSTA 4YGHA 2ANSA 3HWEA 1GX8A 4YKMA 1FDQA 3STKA 1CJ5A 4XMCA 1DV9A 3IA8A 1KGLA 2OVDA 4TKHA 5FFHA 2FR2A 4ZR2A 1JBHA 4ZJ0A 1GT1A 1Z24A 3NP1A 3P6HA 1OEKA 1OEJA 1TOUA 1U0XA 2LB6A 4HPDA 3FELA 4NP1A 5F1EA 1JYJA 1ADLA 2CZTA 4YMYA 5BVTA 1YWAA 2WQ9A 5HZ8A 1BRPA 3L4RA 2NP1A 3UEXA 1GKAA 5HBSA 4KIIA 3U0DA 3RZYA 3RSWA 1XKIA 2OZQA 3BU9A 3FR2A 4XMDA 3JS1A 2NNEA 3C77X 1JJXA 1IKJA 2OFRX 3O22A 3WXQA 5HZ6A 3P6EA 1GKAB 2L68A 4UU3A 1XCAA 4YGGA 1QY0A 2X46A 2RQ0A 5HCEC 2KT4B 5EDCA 3TGAA 4NLIA 2CBRA 4M6SA 1X8OA 2R74A 5LJKA 3SAOA 2FS7A 1AELA 1B4MA 1ERBA 5EPQA 1S2PA 1MX7A 2RCTA 1OPAA 4ZH6A 4IB7A 2OFMX 1GGLA 1I4UA 1AVGI 4YGZA 1SY0A 3U03A 4EEJA 2CBSA 1HQPA 4ODDA 3FLLA 1IFBA 1OBPA 1X8UA 2O62A 1PM1X 5LJEA 1OBUA 4OS0A 5H9LA 4NLJA 3HK1A 1QWDA 2CM9A 1S44A 3ELXA 3CQRA 1NP1A 4IMNA 5HZ5A 3TF6A 1SY3A 2XKLA 4ES7A 1T0VA 5EDBA 1GM6A 1BLRA 2F73A 1VPRA 4AW8A 1SY1A 1SXXA 4QZTA 3P6DA 1CRBA 2RA6A 1OBQA 1LIFA 1R0UA 3C76X 4DQ4A 3BX7A 3FA8A 1KZWA 5EZ2A 4QZUA 2FRSA 3HWFA 5KICA 2A2UA 3AKMA 3WJCA 1CBQA 1G5WA 3O2YA 4ORWA 4ORYA 4Y0RA 4CK4A 1A18A 1I05A 3CMPA 3EYCA 1ZNLA 5H9KA 4YBUA 3PH6A 3WJGA 4IBAA 2AT8X 5LJBA 3STNA 3ELZA 1ZNEA 3TGCA 4YDAA 2WUTA 5D48A 4YBPA 3TGBA 4ZGUA 4WFVA 1B0OA 3CQNA 4YDBA 4DQ3A 1LIDA 5H9AA 3AKNA 1TW4A 5AQ6A 1QY2A 1KQWA 2KTDA 4ZHCA 1YIVA 1TVQA 1E06A 4LKTA 5LJDA 4BOEA 2JU7A 3BU1A 2L5PA 5FENA 1T68X 1JZUA 3CBCA 1KT5A 1H91A 5CE4A 1DFVA 1NGLA 4IB9A 5D45A 2RD7C 2FLJA 2HYSA 4A8ZA 2N93A 3F8AA 2HZRA 1IW2A 2X45A 4Y0SA 1MUPA 1HMRA 3NQ9A 2DM5A 1DZJA 4UU2A 5HA1A 1LICA 1X8PA 3VG6A 2GC9A 5IO7A 3KQ0A 1KT4A 4TLJA 3FENA 1A2DA 3NX1A 1CBSA 4EXZA 2QO6A 5FAZA 4LZVA 3CWKA 1DZMA 5IO5A 4OS3A 1DZKA 3FA9A 3UEVA 3WVMA 4AZRA 1U17A 3BX8A 1HMTA 2HLVA 2W2FA 1X8NA 4WBKA 3D97A 3PPTA 4IB6A 2PY1A 1ZRYA 3KFHA 2R56A 5F58A 3TZSA 1FEMA 3FMZA 1HBPA 2AL0X 2WR6A 3FEKA 4GNYA 1QFTA 3MBTA 1SA8A 2MJIA 2Q4NA 3K3LA 4D6BA 2LFOA 3EBKA 2AH7X 1ZNKA 1FE3A 1RLBE 2JN3A 1G85A 4A60A 1EQDA 4EDEA 3ZUIA 1UREA 3BRNA 4ALBA 4AYHA 2G78A 2FR3A 1ML7A 3WJEA 5EEEA 1LKEA 2AT6X 1ZNHA 4IMOA 5D8JA 4XMFA 2K62A 3BS2A 1ICMA 1A3YA 4ORRA 3I17A 5HCCC 4GH7A 1FELA 4OS8A 1SXYA 2W2AA 3VG7A 2Q2MA 2EU7X 2L9CA 2JOZA 4QYPA 3FR4A 5L8OA 2WQAE 1KZXA 3WJFA 1E00A 2ACPX 2QO4A 2QO5A 2WWPA 1KT3A 3PH5A 1E5PA 3Q6LA 3WBGA 5F6ZA 1AQBA 4MVKA 1MVGA 3KZAA 4YCHA 2POAA 1N0SA 3FR5A 4Y0QA 5KIDA 1ZNGA 3NADA 1LFOA 1HMSA 3P6FA 3VG2A 3KFFA 1BRQA 5D47A 5HZQA 4ORXA 1MDCA 4GNWA 3VG4A 2ACOA 4TKBA 1MX8A 2HMBA 2LBAA 4K19A 4BQUA 1PMPA 4ZFXA 1I06A 3BLGA 1EIIA 1NP4A 3ZQ3A 1E02A 4NYRA 3B2LA 1YP7A 4AZQA 4GETA 1DZPA 4GE1A 3B2IA 4NNTA 2Q39A 1JJJA 5DG4A 4ZHGA 1LPJA 1FTPA 2GJ5A 3PEDA 2CZUA 1BSOA 2FTBA 2A13A 1OEEA 1X71A 1BJ7A 5LKFA 1YP6A 1GT3A 2IFBA 2YG2A 2WEXA 1QFVA 3STMX 1ZNDA 5LKEA 1IIUA 4YCEA 1S7DA 2R73A 1KQXA 1U18A 2AT5X 1PEEA 1ACDA 1BSQA 3DSZA 1B8EA 5B27A 2HZQA 2OVEA 4HPAA 3B2HA 2HNXA 1O8VA 4O9SA 5JR8A 3FA6A 1EALA 2GTFX 2AT0X 3APWA 4NNSA 2ASNX 4XMHA 3NR3A 4ALOA 4I9RA 2BLGA 1ALBA 1SXUA 1GXAA 5F7GA 4NYQA 2FT9A 1KT7A 2FS6A 5H8TA 5H9NA 4HFOA 1O1VA 3ZUOA 3EMMA 4YFQA 1TOWA 1B56A 1A57A 2WSJA 1X89A 4AZNA 4HPBA 1T8VA 4OMWA 4ZHDA 1L6MA 1DC9A 4MVLA 3FA7A 3HWDA 1QG5A 2MO5A 5B29A 1CBRA 5HWZA 4YKOA 1GT4A 1QY1A 5EEDA 1EUOA 4TNNA 4XMEA 1AB0A 3P6CA 1DF3A 1EW3A 1HBQA 5BVSA 3UEWA 3KFGA 3P6GA 3NPOA 5LJGA 4YFRA 3APXA 2QOSC 2MM3A 3NX2A 4YH0A 2JU8A 4QGVA 4ARHA 1FENA 4MVIA 4ORSA 1OPBA 4LZUA 2RCQA 4I3BA 4IAXA 3VG3A 3UEUA 1JYDA 2AKQA 2Q9SA 1GT5A 1G7NA 1BM5A 5HA0A 5HZ9A 4ZHHA 1BEBA 2CM4A 4XMGA 2G7BA 1KT6A 1LF7A 3O19A 5KHPA 1GX9A 1O1UA 2G79A 2AMMX 4WFUA 3G7XA
chains in the Genus database with same CATH superfamily
2IZGB 2LKKA 2OVAA 1MK5A 4CDDA 1SWLA 1LCVA 1SXWA 1YWDA 4GKCA 5FQ7E 5L8IA 3FW5A 4EFGA 4O3YA 1JV4A 4U8UN 5B11O 3RDOA 1SY2A 1RXJA 3SOTA 3KFIA 3T2XA 3VG5A 4BX6A 4GRJA 1ICNA 1VWFB 1PBOA 3B2JA 2W2BA 2K23A 4ZCBA 4IAWA 4BVMA 1BBPA 2PI3O 4IB8A 2P8GA 3VE1A 4FQBB 4QQ1A 3HWGA 3QKGA 2FWVA 4TQ2A 1TXLA 1I9HA 1BSYA 1NQMA 2WEWA 3DTQA 1P6PA 2QM9A 3GAQA 4BX5A 1EXSA 2L67A 2X8SA 3BSZE 4JNJA 4L1NA 4OMXA 4RUUA 3U9PC 5K67A 3D95A 3APUA 1UZ2X 1X8QA 2AF5A 1JJUA 1YUPA 3EM0A 3PECA 4IABA 4RUNA 1G74A 2RTFB 3S26A 4BX5B 4ORUA 2LBVA 4TJZA 1I04A 1LIEA 1RBPA 2A3FX 4AZPA 4N7DA 3S60A 5LJHA 4A1YA 3WYPA 1BWYA 4I3CA 1QABE 1NBXA 1K3BA 5HTDA 5HTEA 4KC7A 4BJ8A 1HQQA 2NNDA 3WJBA 4AZMA 5HCDC 3FIQA 3RY2A 3CBSA 1K24A 1VYFA 5F6BA 2E4JA 1HN2A 4YVBA 1EIOA 3FEPA 3MVFA 5FQ6E 2QMIA 3WJDA 2RTMA 4QGWA 2FGSA 2OL8O 4QYNA 1KXOA 1IFCA 5AJBA 1CBIA 1RXKA 1YWBA 4AZOA 1EPAA 4O49A 1KOIA 3HOLA 1VWLB 5B5FA 2OYBO 4KT5A 1IKEA 4DCBA 5IO6A 4O4OA 2Q2PA 1RSUB 2CAMA 3CR6A 1D3SA 3EBWA 2IZCB 1VWJB 2A2GA 3D96A 4M7MA 1LNMA 3T1DA 4QAEA 1LELA 4I9SA 4ZGFA 2A0AA 2X8FA 1EPBA 1SWBA 3FW4A 3PP6A 2OVSA 4PSQA 4QGXA 2X8TA 3B2KA 3I0AA 2RTPB 3IFBA 2NNQA 3APVA 5K06A 4A1HA 4LKPA 2AT3X 3BDRA 3NQ3A 5DPQA 3OJYC 1VYGA 1LIBA 2ALLX 2GH7A 3BY0A 1AVDA 1N9MA 3C78X 4ZH9A 5D4AA 3CKGA 1ERXA 5LJCA 2JU3A 4HPCA 5C0NA 4TKJA 4N7CA 4ZHFA 1D2UA 3WZQA 4D6AA 1JMZA 2OF9A 4R0BA 1QQSA 4Y0PA 4YFPA 1YWCA 2VFCA 1EI5A 1SWKA 3F9DA 3JSQA 3MX7A 4I3DA 5BVQA 2XSTA 4YGHA 4QNIA 2ANSA 1SWAA 1GX8A 3HWEA 4YKMA 4MVEA 1FDQA 2IZDB 3STKA 1PBYA 2BC3A 4OKAA 1CJ5A 1VWEB 4XMCA 3IA8A 1DV9A 3FDCA 2OVDA 3HPEA 4TKHA 1HY2A 5FFHA 2FR2A 3T6LA 4ZR2A 4DNEA 4ZJ0A 1GT1A 4GK9A 1Z24A 1JMXA 2Y3EA 3NP1A 1OEKA 2I5VO 2QOMA 3P6HA 3ZZVA 1OEJA 1TOUA 4U3QA 3WZOA 3NQKA 1U0XA 1SWDA 2LB6A 4HPDA 3FELA 5HAEA 4NP1A 4OEMA 1JYJA 1VYOA 1ADLA 1Y0GA 2CZTA 5F1EA 3VU1A 4YMYA 3AUMO 1LDOA 2GTLM 3D9WA 5BVTA 1YWAA 1SLGB 1RXHA 4CPFA 2WQ9A 3S5XA 1BRPA 3L4RA 2NP1A 2RTQB 3UEXA 4Z6JA 5HZ8A 1GKAA 1I78A 4INNA 4KIIA 5HBSA 3U0DA 3RZYA 3RSWA 1E2TA 1XKIA 2OZQA 3BU9A 3FR2A 3OBLA 1AVEA 4CSBA 4XMDA 3JS1A 2RTDB 2NNEA 3C77X 3RDXA 1JJXA 1IKJA 2OFRX 3O22A 3WXQA 5HZ6A 3P6EA 3OD9A 1GKAB 2L68A 4UU3A 1XCAA 2C1QA 1QY0A 4YGGA 2X46A 2RQ0A 4IRWA 5K68A 4O4UA 2KT4B 5EDCA 5HCEC 3TGAA 2ZAGA 3WZNA 2OL6O 2CBRA 4NLIA 4M6SA 4GU8A 1X8OA 2R74A 1VWMB 2RTAA 5LJKA 1SLEB 2MF6A 3SAOA 4KC8A 5F2BA 2FS7A 1Y9LA 3RDUA 4FGIB 1AELA 1B4MA 1ERBA 3LHNA 2RTIB 5EPQA 1S2PA 3RDSA 4CPHA 1MX7A 2RCTA 1OPAA 2Y32A 4ZH6A 4IB7A 2OFMX 1GGLA 2RTGB 2AVIA 1SLDB 1I4UA 1AVGI 4YGZA 2X56A 1SY0A 4HWMA 4CPHB 4EEJA 3U03A 2CBSA 1HQPA 1SWCA 1LUQA 3FLLA 4ODDA 1IFBA 1OBPA 4JGLA 1X8UA 2O62A 1PM1X 4GUZA 5LJEA 3H3IA 1OBUA 4OS0A 5H9LA 4NLJA 5CYBA 3HK1A 1QWDA 2CM9A 1S44A 3ELXA 3CQRA 1NP1A 4IMNA 4Z2OA 3FIDA 3SZJA 5HZ5A 3TF6A 2RTHB 1SY3A 2XKLA 2GTLO 2VDFA 3RWXA 4ES7A 1T0VA 5EDBA 4GD9A 1GM6A 1BLRA 2F73A 1VPRA 4AW8A 1N7YA 1SY1A 1SXXA 4QZTA 2RTJA 1CRBA 3P6DA 2RA6A 1OBQA 1LIFA 1R0UA 2IZIA 1Y9TA 3C76X 2F09A 4DQ4A 2RTEB 3BX7A 3FA8A 1KZWA 5EZ2A 2Z4HA 4GGTA 4QZUA 2FRSA 3HWFA 4CPIA 5KICA 2A2UA 3AKMA 3WJCA 1VWQB 1CBQA 3RE6A 2F01A 1JQPA 2IZBA 3HOEA 3O2YA 4ORWA 1G5WA 4ORYA 4Y0RA 4Y5DA 2BHVA 4CK4A 1FJ1E 1A18A 4PJ2A 1I05A 3CMPA 3EYCA 1ZNLA 1NDJA 5H9KA 3RBYA 4YBUA 2RTOB 3PH6A 3WJGA 2ZSCA 2AT8X 4IBAA 3STNA 2A5BA 5LJBA 3ELZA 4EKVA 1ZNEA 3TGCA 4YDAA 4BCSA 2WUTA 5D48A 4BX7A 4EQAC 2YMSA 4GJVA 4YBPA 3TGBA 1VWRB 2FKGA 4ZGUA 3WOVA 5B3MO 4WFVA 4I60A 3UAQA 1B0OA 3CQNA 4YDBA 4DQ3A 5B10O 1LIDA 4MIRA 5H9AA 3AKNA 4O4SA 4O3WA 1TW4A 3PQUA 5AQ6A 1QY2A 1KQWA 2KTDA 3FYFA 1YIVA 1TVQA 4U9CA 4ZHCA 4BX7B 3AEHA 2IZEB 1E06A 4LKTA 5LJDA 4BOEA 2JU7A 2BS6A 2L5PA 3BU1A 5FENA 3MG5A 3RDQA 1T68X 5L3YA 1JZUA 3CBCA 1KT5A 1H91A 3T2WA 1SWHA 3PDFA 5CE4A 1DFVA 1NGLA 4IB9A 5D45A 2RD7C 2FLJA 4BBOA 2HYSA 1VWGB 4A8ZA 2MWHA 2N93A 3F8AA 2HZRA 1IW2A 2X45A 3P02A 4NV8A 4Y0SA 1MUPA 1HMRA 3T6FA 3NQ9A 2UYWA 2DM5A 2OF8A 3SZHA 1DZJA 4UU2A 5HA1A 1LICA 1X8PA 3VG6A 2GC9A 4GGRA 5IO7A 3KQ0A 1KT4A 4TLJA 3FENA 1A2DA 3NX1A 1CBSA 4EXZA 1VWAB 2QO6A 4Z2VA 5FAZA 4LZVA 3CWKA 2RTLA 1DZMA 5IO5A 2A8GA 4GGZA 2DJFA 3OE3A 4OS3A 1N4JA 1DZKA 2X32A 3FA9A 3UEVA 3WVMA 4AZRA 3Q34A 1U17A 3BX8A 1HMTA 1W4TA 3EW1A 2HLVA 2W2FA 1X8NA 4WBKA 3D97A 3PPTA 1SWUA 3VGWA 4IB6A 4LQZA 1SWNA 1SWPA 2PY1A 1ZRYA 1GX3A 3KFHA 2R56A 1VWCB 5F58A 3TZSA 2KW1A 1FEMA 2OL7A 3FMZA 1HBPA 2AL0X 2WR6A 3FEKA 4GNYA 1QFTA 2OFBA 1SA8A 2MJIA 2Q4NA 3K3LA 3MBTA 4D6BA 5IXGA 2LFOA 3EBKA 1SWJA 2AH7X 1VWPB 1ZNKA 3WZPA 5CSEA 1FE3A 1KL3A 1VWKB 1RLBE 2JN3A 1G85A 4O4XA 4A60A 1STRB 1EQDA 3SLOA 4EDEA 1Y52X 1DF8A 1SWOA 1UREA 1UYOX 3BRNA 4L3RA 3RE5A 3ZUIA 4ALBA 4AYHA 2G78A 1SLFB 2FR3A 1ML7A 3WJEA 4ML7B 1STPA 1LKEA 2AT6X 2JMBA 1W6FA 3QQ2A 2FHNX 4JO6A 5EEEA 1ZNHA 2IZFB 4IMOA 5D8JA 2Z4IA 1MEPA 1SMPI 4XMFA 2K62A 3BS2A 1ICMA 1Y53X 4Z2PA 2X34A 1A3YA 1W5RA 1NQNA 4FBVA 4ORRA 3I17A 5HCCC 4GH7A 3V8UA 3VHIA 3ZI8A 1FELA 4OS8A 2HKDA 3ZW0B 1SRFA 1VWBB 2BT9A 1SXYA 4CDEA 2W2AA 2MHDA 3VG7A 4U46A 2Q2MA 1SWTA 1VWIB 2EU7X 2G8CO 2JOZA 2L9CA 3RY1A 2Y3FA 4QYPA 3FR4A 5L8OA 2WQAE 1KZXA 3WJFA 1E00A 2ACPX 2QO4A 1SWFA 2QO5A 2WWPA 1KT3A 3PH5A 5IRUA 4BGFA 5AEOA 1PTSA 1E5PA 3Q6LA 3WBGA 5F6ZA 1AQBA 4MVKA 1MVGA 3KZAA 2RTCB 2POAA 1N0SA 3FR5A 3PQSA 4GZVA 4Y0QA 2C1SA 4YCHA 5B5GA 5KIDA 1ZNGA 3NADA 1LFOA 1HMSA 3P6FA 3VG2A 2GTLN 1KFFA 3KFFA 1BRQA 2RN4A 5D47A 2FHLA 3SZIA 5HZQA 4KCAA 4ORXA 4C5PA 5L8NA 3ZW1A 1MDCA 4BX6B 4GNWA 4CDCA 3VHMA 3VG4A 2ACOA 4NW4A 4TKBA 1MX8A 1VWNB 1LCZA 2HMBA 3ZWEA 2LBAA 4K19A 4BQUA 1PMPA 3LTWA 3MM0A 3ZW1B 4ZFXA 1I06A 3BLGA 2RTBB 1EIIA 1NP4A 4QRLA 4ID2A 2OY5O 3ZQ3A 4B55A 1E02A 4NYRA 1HXLA 2FKJA 2KTSA 3B2LA 1YP7A 4AZQA 4WHIA 4GETA 1DZPA 4GE1A 3B2IA 4NNTA 3EC5A 1MOYA 1NC9A 2Q39A 1JJJA 5DG4A 4ZHGA 2OY8A 1LPJA 1FTPA 2GJ5A 2KD2A 2CZUA 2WPUA 3E3CA 2DJGA 3PEDA 1BSOA 2FTBA 4MISA 2A13A 1SWEA 3VHHA 1OEEA 1X71A 4CPEA 1BJ7A 5LKFA 1KL4A 3SLJA 1YP6A 1GT3A 2IFBA 2YG2A 2WEXA 3KVNA 1QFVA 3RKGA 1ZNDA 1SRJA 2JW1A 3PK2A 1IIUA 4YCEA 1UYNX 3STMX 5LKEA 1S7DA 2R73A 1KQXA 1U18A 2AT5X 2C4IA 1PEEA 2RTNB 1ACDA 1BSQA 3DSZA 3SLTA 1B8EA 3LV4A 4COTA 5B27A 2HZQA 2OVEA 4HPAA 3B2HA 3ZW2A 4Z28A 2HNXA 1O8VA 2LA7A 4O9SA 5JR8A 3FA6A 1EALA 1JIWI 2GTFX 2AT0X 3APWA 4NNSA 2ASNX 3N91A 4U8UM 4XMHA 1IJ8A 1WUBA 1VWDB 3NR3A 4MEEA 4ALOA 4I9RA 2BLGA 1ALBA 1SXUA 2IZAA 1GXAA 5F7GA 3VE2A 1LDQA 4NYQA 3X00A 2FT9A 1SRHA 4KH8A 1KT7A 2FS6A 5H8TA 5H9NA 4HFOA 2IZKA 1O1VA 3ZUOA 3EMMA 4YFQA 1STSB 1TOWA 1B56A 1A57A 2X55A 2WSJA 1X89A 5IRWA 3EW2A 3S5VA 1HXZA 2X4MA 4HPBA 4AZNA 1T8VA 4CV7A 1KGLA 4OMWA 3WYQA 3RDMA 5JD2A 4GDZA 1LCWA 2BSZA 4JHQA 4ZHDA 1L6MA 1SWGA 1DC9A 4MVLA 3F6ZB 1SRGA 2JGSA 3FA7A 1SREA 2IZHB 2QCBA 1WBIA 3HWDA 4FBOA 1QG5A 2MO5A 2ZAIA 5B29A 3GE2A 1CBRA 4GJSA 4OELA 2RTKA 5B2AO 4CDFA 1JBHA 2OY1O 4ON1A 2OY7A 4GDAA 2BS5A 2OFAA 3D4RA 1VWHB 4YKOA 1GT4A 5IRAA 5HWZA 1QY1A 5EEDA 1EUOA 4TNNA 4XMEA 3VPJE 1SWRA 1AB0A 3P6CA 1DF3A 1EW3A 1HBQA 5BVSA 3UEWA 3KFGA 3P6GA 1VWOB 1OSPO 3NPOA 5LJGA 4YFRA 3APXA 2QOSC 5AJCA 1Y55X 2MM3A 5BYPA 3NX2A 4YH0A 1SWSA 2JU8A 1SRIA 3ZW0A 4FBRA 2IZJA 2M4LA 2UZ2A 2A5CA 1N9YA 4QGVA 4ARHA 2VFBA 3CKFA 1FENA 4MVIA 4ORSA 1OPBA 4LZUA 2RCQA 1N43A 2IZLB 4I3BA 4IAXA 3VG3A 5CHKA 4Z27A 3UEUA 2RTRB 4O3ZA 1JYDA 1RSTB 2AKQA 2Q9SA 1GT5A 1G7NA 4Y59A 1BM5A 4I95A 1KL5A 1RAVA 3JQOA 5HA0A 4O3XB 5HZ9A 4NV7A 3NBXX 4ZHHA 1BEBA 3P24A 2G5LA 1SWQA 2CM4A 2I5ZO 4I6SA 4XMGA 2G7BA 1KT6A 1LF7A 3O19A 1MM9A 1GX9A 4U8UO 5KHPA 1O1UA 5FQ8E 3HTYA 2G79A 2AMMX 4WFUA 3G7XA
chains in the Genus database with same CATH topology
2LKKA 2OVAA 1YWDA 1SXWA 4GKCA 5L8IA 5FQ7E 3FW5A 4EFGA 4O3YA 1JV4A 4U8UN 3SOTA 1SY2A 3VG5A 3KFIA 4GRJA 1ICNA 1PBOA 3B2JA 2W2BA 2K23A 4ZCBA 4IAWA 4BVMA 1BBPA 4IB8A 3VE1A 2P8GA 4FQBB 4QQ1A 3HWGA 3QKGA 2FWVA 4TQ2A 1TXLA 1BSYA 3GAQA 2WEWA 3DTQA 1P6PA 2QM9A 1EXSA 2L67A 2X8SA 3BSZE 4L1NA 4OMXA 4RUUA 3U9PC 3D95A 3APUA 1UZ2X 1X8QA 3EM0A 1YUPA 3PECA 4IABA 4RUNA 1G74A 3S26A 4ORUA 2LBVA 4TJZA 1I04A 1LIEA 1RBPA 2A3FX 4AZPA 4N7DA 3S60A 5LJHA 4A1YA 1BWYA 4I3CA 1QABE 5HTDA 5HTEA 4KC7A 2NNDA 3WJBA 4AZMA 5HCDC 3FIQA 3CBSA 1VYFA 5F6BA 2E4JA 1HN2A 1EIOA 3FEPA 3MVFA 5FQ6E 2QMIA 3WJDA 4QGWA 4QYNA 1KXOA 1IFCA 5AJBA 1CBIA 4AZOA 1YWBA 1EPAA 4O49A 1KOIA 3HOLA 4KT5A 1IKEA 5IO6A 4O4OA 2Q2PA 3CR6A 5L8NA 1D3SA 3EBWA 3T1DA 3D96A 2A2GA 4M7MA 1LNMA 4QAEA 4ZGFA 4I9SA 5HAEA 2A0AA 2X8FA 1EPBA 3FW4A 3PP6A 4PSQA 2OVSA 4QGXA 2X8TA 3B2KA 3I0AA 3IFBA 5K06A 2NNQA 3APVA 4A1HA 4LKPA 2AT3X 3BDRA 3NQ3A 5DPQA 3OJYC 1VYGA 1LIBA 2ALLX 3BY0A 3C78X 4ZH9A 5D4AA 1ERXA 5LJCA 2JU3A 4HPCA 5C0NA 4TKJA 4N7CA 4ZHFA 1D2UA 4D6AA 4R0BA 1QQSA 4Y0PA 4YFPA 1YWCA 5BVQA 1EI5A 3F9DA 3JSQA 3MX7A 4I3DA 2XSTA 4YGHA 4QNIA 2ANSA 3HWEA 1GX8A 4YKMA 4MVEA 1FDQA 3STKA 1CJ5A 4XMCA 1DV9A 3IA8A 1KGLA 2OVDA 4TKHA 5FFHA 2FR2A 4ZR2A 1JBHA 4ZJ0A 1GT1A 4GK9A 1Z24A 3NP1A 3P6HA 1OEKA 3ZZVA 1OEJA 1TOUA 4U3QA 3NQKA 1U0XA 2LB6A 4HPDA 3FELA 4NP1A 5F1EA 1JYJA 1ADLA 3VU1A 2CZTA 4YMYA 2GTLM 5BVTA 1YWAA 2WQ9A 3S5XA 1BRPA 3L4RA 2NP1A 3UEXA 5HZ8A 1GKAA 4INNA 4KIIA 5HBSA 3U0DA 3RZYA 3RSWA 1XKIA 2OZQA 3BU9A 3FR2A 3OBLA 4CSBA 4XMDA 3JS1A 2NNEA 3C77X 1JJXA 1IKJA 2OFRX 3O22A 3WXQA 5HZ6A 3P6EA 3OD9A 1GKAB 2L68A 4UU3A 1XCAA 4YGGA 1QY0A 2X46A 2RQ0A 4O4UA 2KT4B 5EDCA 5HCEC 3TGAA 2ZAGA 4NLIA 2CBRA 4M6SA 4GU8A 1X8OA 2R74A 5LJKA 3SAOA 4KC8A 2FS7A 1Y9LA 1AELA 4FGIB 1B4MA 1ERBA 3LHNA 5EPQA 1S2PA 1MX7A 2RCTA 1OPAA 4ZH6A 4IB7A 2OFMX 1GGLA 1I4UA 1AVGI 4YGZA 1SY0A 4HWMA 3U03A 4EEJA 2CBSA 1HQPA 4ODDA 3FLLA 1IFBA 1OBPA 4JGLA 1X8UA 2O62A 1PM1X 5LJEA 3H3IA 1OBUA 4OS0A 5H9LA 4NLJA 5CYBA 3HK1A 1QWDA 2CM9A 1S44A 3ELXA 3CQRA 1NP1A 4IMNA 5HZ5A 3TF6A 1SY3A 2XKLA 2GTLO 3RWXA 4ES7A 1T0VA 5EDBA 1GM6A 1BLRA 2F73A 1VPRA 4AW8A 1SY1A 1SXXA 4QZTA 3P6DA 1CRBA 2RA6A 1OBQA 1LIFA 1R0UA 1Y9TA 3C76X 2F09A 4DQ4A 3BX7A 3FA8A 1KZWA 5EZ2A 2Z4HA 4QZUA 2FRSA 3HWFA 5KICA 2A2UA 3AKMA 3WJCA 1CBQA 1G5WA 3O2YA 3HOEA 4ORWA 4ORYA 4Y0RA 2BHVA 4CK4A 1A18A 4PJ2A 1I05A 3CMPA 3EYCA 1ZNLA 3RBYA 5H9KA 4YBUA 3PH6A 3WJGA 4IBAA 2AT8X 5LJBA 3STNA 3ELZA 1ZNEA 3TGCA 4YDAA 2WUTA 5D48A 4EQAC 2YMSA 4YBPA 3TGBA 4ZGUA 3WOVA 4WFVA 3UAQA 1B0OA 3CQNA 4YDBA 4DQ3A 1LIDA 4MIRA 5H9AA 3AKNA 4O4SA 4O3WA 1TW4A 3PQUA 5AQ6A 1QY2A 1KQWA 2KTDA 3FYFA 1YIVA 1TVQA 4U9CA 4ZHCA 1E06A 4LKTA 5LJDA 4BOEA 2JU7A 2BS6A 2L5PA 3BU1A 5FENA 1T68X 1JZUA 3CBCA 1KT5A 1H91A 5CE4A 1DFVA 1NGLA 4IB9A 5D45A 2RD7C 2FLJA 2HYSA 4A8ZA 2MWHA 2N93A 3F8AA 2HZRA 1IW2A 2X45A 3P02A 4Y0SA 1MUPA 1HMRA 3NQ9A 2DM5A 1DZJA 4UU2A 5HA1A 1LICA 1X8PA 3VG6A 2GC9A 5IO7A 3KQ0A 1KT4A 4TLJA 3FENA 1A2DA 3NX1A 1CBSA 4EXZA 2QO6A 5FAZA 4LZVA 3CWKA 1DZMA 5IO5A 3OE3A 4OS3A 1DZKA 3FA9A 3UEVA 3WVMA 4AZRA 1U17A 3BX8A 1HMTA 2HLVA 2W2FA 1X8NA 4WBKA 3D97A 3PPTA 4IB6A 4LQZA 2PY1A 1ZRYA 3KFHA 2R56A 5F58A 3TZSA 2KW1A 1FEMA 3FMZA 1HBPA 2AL0X 2WR6A 3FEKA 4GNYA 1QFTA 3MBTA 1SA8A 2MJIA 2Q4NA 3K3LA 4D6BA 2LFOA 3EBKA 2AH7X 1ZNKA 1FE3A 1RLBE 2JN3A 1G85A 4O4XA 4A60A 1EQDA 4EDEA 3ZUIA 4L3RA 1UREA 3BRNA 4ALBA 4AYHA 2G78A 2FR3A 1ML7A 3WJEA 4ML7B 5EEEA 1LKEA 2AT6X 2JMBA 1ZNHA 4IMOA 5D8JA 2Z4IA 1SMPI 4XMFA 2K62A 3BS2A 1ICMA 1A3YA 4FBVA 4ORRA 3I17A 5HCCC 4GH7A 3V8UA 3ZI8A 1FELA 4OS8A 3ZW0B 2BT9A 1SXYA 2W2AA 2MHDA 3VG7A 2Q2MA 2EU7X 2L9CA 2JOZA 4QYPA 3FR4A 5L8OA 2WQAE 1KZXA 3WJFA 1E00A 2ACPX 2QO4A 2QO5A 2WWPA 1KT3A 3PH5A 5AEOA 1E5PA 3Q6LA 3WBGA 5F6ZA 1AQBA 4MVKA 1MVGA 3KZAA 4GZVA 2POAA 1N0SA 3FR5A 3PQSA 4NW4A 4Y0QA 4YCHA 5KIDA 1ZNGA 3NADA 1LFOA 1HMSA 3P6FA 3VG2A 2GTLN 3KFFA 1BRQA 2RN4A 5D47A 5HZQA 4KCAA 4ORXA 3ZW1A 1MDCA 4GNWA 3VG4A 2ACOA 4TKBA 1MX8A 2HMBA 3ZWEA 2LBAA 4K19A 4BQUA 1PMPA 3ZW1B 4ZFXA 1I06A 3BLGA 1EIIA 1NP4A 4QRLA 4ID2A 3ZQ3A 1E02A 4NYRA 2KTSA 3B2LA 1YP7A 4AZQA 4WHIA 4GETA 1DZPA 4GE1A 3B2IA 4NNTA 2Q39A 1JJJA 5DG4A 4ZHGA 1LPJA 1FTPA 2GJ5A 2KD2A 2CZUA 3E3CA 3PEDA 1BSOA 2FTBA 4MISA 2A13A 1OEEA 1X71A 1BJ7A 5LKFA 1YP6A 1GT3A 2IFBA 2YG2A 2WEXA 3RKGA 1QFVA 3STMX 1ZNDA 5LKEA 2JW1A 1IIUA 4YCEA 1S7DA 2R73A 1KQXA 1U18A 2AT5X 1PEEA 1ACDA 1BSQA 3DSZA 1B8EA 3LV4A 4COTA 5B27A 2HZQA 2OVEA 4HPAA 3B2HA 3ZW2A 2HNXA 1O8VA 2LA7A 4O9SA 5JR8A 3FA6A 1EALA 1JIWI 2GTFX 2AT0X 3APWA 4NNSA 2ASNX 3N91A 4U8UM 4XMHA 3NR3A 4ALOA 4I9RA 2BLGA 1ALBA 1SXUA 1GXAA 5F7GA 3VE2A 4NYQA 2FT9A 4KH8A 1KT7A 2FS6A 5H8TA 5H9NA 4HFOA 1O1VA 3ZUOA 3EMMA 4YFQA 1TOWA 1B56A 1A57A 2WSJA 1X89A 3S5VA 4AZNA 4HPBA 1T8VA 4CV7A 4OMWA 4GDZA 4ZHDA 1L6MA 1DC9A 4MVLA 3F6ZB 3FA7A 3HWDA 4FBOA 1QG5A 2MO5A 2ZAIA 5B29A 3GE2A 1CBRA 4ON1A 2BS5A 3D4RA 5HWZA 4YKOA 1GT4A 1QY1A 5EEDA 1EUOA 4TNNA 4XMEA 3VPJE 1AB0A 3P6CA 1DF3A 1EW3A 1HBQA 5BVSA 3UEWA 3KFGA 3P6GA 3NPOA 5LJGA 4YFRA 3APXA 2QOSC 5AJCA 2MM3A 5BYPA 3NX2A 4YH0A 2JU8A 3ZW0A 4FBRA 2M4LA 4QGVA 4ARHA 1FENA 4MVIA 4ORSA 1OPBA 4LZUA 2RCQA 4I3BA 4IAXA 3VG3A 3UEUA 4O3ZA 1JYDA 2AKQA 2Q9SA 1GT5A 1G7NA 1BM5A 4I95A 3JQOA 5HA0A 4O3XB 5HZ9A 3NBXX 4ZHHA 1BEBA 3P24A 2CM4A 4I6SA 4XMGA 2G7BA 1KT6A 1LF7A 3O19A 5KHPA 1GX9A 4U8UO 1O1UA 5FQ8E 3HTYA 2G79A 2AMMX 4WFUA 3G7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKK A;  2OVA A;  1YWD A;  1SXW A;  4GKC A;  5L8I A;  3FW5 A;  4EFG A;  1JV4 A;  1SY2 A;  3VG5 A;  3KFI A;  4GRJ A;  1ICN A;  1PBO A;  3B2J A;  2W2B A;  2K23 A;  4ZCB A;  4IAW A;  4BVM A;  1BBP A;  4IB8 A;  2P8G A;  3HWG A;  3QKG A;  2FWV A;  4TQ2 A;  1TXL A;  1BSY A;  3GAQ A;  2WEW A;  3DTQ A;  1P6P A;  2QM9 A;  1EXS A;  2L67 A;  4OMX A;  3BSZ E;  4RUU A;  3U9P C;  3D95 A;  3APU A;  1UZ2 X;  1X8Q A;  3EM0 A;  1YUP A;  3PEC A;  4RUN A;  1G74 A;  3S26 A;  4ORU A;  2LBV A;  4TJZ A;  1I04 A;  1LIE A;  1RBP A;  2A3F X;  4AZP A;  4N7D A;  5LJH A;  4A1Y A;  1BWY A;  4I3C A;  1QAB E;  5HTD A;  5HTE A;  2NND A;  3WJB A;  4AZM A;  5HCD C;  3FIQ A;  3CBS A;  1VYF A;  5F6B A;  2E4J A;  1HN2 A;  1EIO A;  3FEP A;  3MVF A;  3WJD A;  4QGW A;  4QYN A;  1KXO A;  1IFC A;  4AZO A;  1CBI A;  1YWB A;  1EPA A;  1KOI A;  1IKE A;  5IO6 A;  2Q2P A;  3CR6 A;  5L8N A;  1D3S A;  3EBW A;  3T1D A;  3D96 A;  2A2G A;  4M7M A;  1LNM A;  4QAE A;  5HAE A;  4I9S A;  2A0A A;  3FW4 A;  1EPB A;  3PP6 A;  4PSQ A;  4QGX A;  3I0A A;  3B2K A;  3IFB A;  5K06 A;  2NNQ A;  3APV A;  4A1H A;  4LKP A;  2AT3 X;  3BDR A;  3NQ3 A;  5DPQ A;  3OJY C;  1VYG A;  1LIB A;  2ALL X;  3BY0 A;  3C78 X;  4ZH9 A;  5D4A A;  1ERX A;  5LJC A;  2JU3 A;  4HPC A;  5C0N A;  4TKJ A;  4N7C A;  4ZHF A;  1D2U A;  4D6A A;  4R0B A;  1QQS A;  4Y0P A;  4YFP A;  1YWC A;  5BVQ A;  3F9D A;  3JSQ A;  4I3D A;  2XST A;  4YGH A;  2ANS A;  3HWE A;  1GX8 A;  4YKM A;  1FDQ A;  3STK A;  1CJ5 A;  4XMC A;  1DV9 A;  3IA8 A;  1KGL A;  2OVD A;  4TKH A;  5FFH A;  2FR2 A;  4ZR2 A;  1JBH A;  4ZJ0 A;  1GT1 A;  1Z24 A;  3NP1 A;  3P6H A;  1OEK A;  1OEJ A;  1TOU A;  1U0X A;  2LB6 A;  4HPD A;  3FEL A;  4NP1 A;  5F1E A;  1JYJ A;  1ADL A;  2CZT A;  4YMY A;  5BVT A;  1YWA A;  2WQ9 A;  5HZ8 A;  1BRP A;  3L4R A;  2NP1 A;  3UEX A;  1GKA A;  5HBS A;  4KII A;  3U0D A;  3RZY A;  3RSW A;  1XKI A;  2OZQ A;  3BU9 A;  3FR2 A;  4XMD A;  3JS1 A;  2NNE A;  3C77 X;  1JJX A;  1IKJ A;  2OFR X;  3O22 A;  3WXQ A;  5HZ6 A;  3P6E A;  1GKA B;  2L68 A;  4UU3 A;  1XCA A;  4YGG A;  1QY0 A;  2X46 A;  2RQ0 A;  5HCE C;  2KT4 B;  5EDC A;  3TGA A;  4NLI A;  2CBR A;  4M6S A;  1X8O A;  2R74 A;  5LJK A;  3SAO A;  2FS7 A;  1AEL A;  1B4M A;  1ERB A;  5EPQ A;  1S2P A;  1MX7 A;  2RCT A;  1OPA A;  4ZH6 A;  4IB7 A;  2OFM X;  1GGL A;  1I4U A;  1AVG I;  4YGZ A;  1SY0 A;  3U03 A;  4EEJ A;  2CBS A;  1HQP A;  4ODD A;  3FLL A;  1IFB A;  1OBP A;  1X8U A;  2O62 A;  1PM1 X;  5LJE A;  1OBU A;  4OS0 A;  5H9L A;  4NLJ A;  3HK1 A;  1QWD A;  2CM9 A;  1S44 A;  3ELX A;  3CQR A;  1NP1 A;  4IMN A;  5HZ5 A;  3TF6 A;  1SY3 A;  2XKL A;  4ES7 A;  1T0V A;  5EDB A;  1GM6 A;  1BLR A;  2F73 A;  1VPR A;  4AW8 A;  1SY1 A;  1SXX A;  4QZT A;  3P6D A;  1CRB A;  2RA6 A;  1OBQ A;  1LIF A;  1R0U A;  3C76 X;  4DQ4 A;  3BX7 A;  3FA8 A;  1KZW A;  5EZ2 A;  4QZU A;  2FRS A;  3HWF A;  5KIC A;  2A2U A;  3AKM A;  3WJC A;  1CBQ A;  1G5W A;  3O2Y A;  4ORW A;  4ORY A;  4Y0R A;  4CK4 A;  1A18 A;  1I05 A;  3CMP A;  3EYC A;  1ZNL A;  5H9K A;  4YBU A;  3PH6 A;  3WJG A;  4IBA A;  2AT8 X;  5LJB A;  3STN A;  3ELZ A;  1ZNE A;  3TGC A;  4YDA A;  2WUT A;  5D48 A;  4YBP A;  3TGB A;  4ZGU A;  4WFV A;  1B0O A;  3CQN A;  4YDB A;  4DQ3 A;  1LID A;  5H9A A;  3AKN A;  1TW4 A;  5AQ6 A;  1QY2 A;  1KQW A;  2KTD A;  4ZHC A;  1YIV A;  1TVQ A;  1E06 A;  4LKT A;  5LJD A;  4BOE A;  2JU7 A;  3BU1 A;  2L5P A;  5FEN A;  1T68 X;  1JZU A;  3CBC A;  1KT5 A;  1H91 A;  5CE4 A;  1DFV A;  1NGL A;  4IB9 A;  5D45 A;  2RD7 C;  2FLJ A;  2HYS A;  4A8Z A;  2N93 A;  3F8A A;  2HZR A;  1IW2 A;  2X45 A;  4Y0S A;  1MUP A;  1HMR A;  3NQ9 A;  2DM5 A;  1DZJ A;  4UU2 A;  5HA1 A;  1LIC A;  1X8P A;  3VG6 A;  2GC9 A;  5IO7 A;  3KQ0 A;  1KT4 A;  4TLJ A;  3FEN A;  1A2D A;  3NX1 A;  1CBS A;  4EXZ A;  2QO6 A;  5FAZ A;  4LZV A;  3CWK A;  1DZM A;  5IO5 A;  4OS3 A;  1DZK A;  3FA9 A;  3UEV A;  3WVM A;  4AZR A;  1U17 A;  3BX8 A;  1HMT A;  2HLV A;  2W2F A;  1X8N A;  4WBK A;  3D97 A;  3PPT A;  4IB6 A;  2PY1 A;  1ZRY A;  3KFH A;  2R56 A;  5F58 A;  3TZS A;  1FEM A;  3FMZ A;  1HBP A;  2AL0 X;  2WR6 A;  3FEK A;  4GNY A;  1QFT A;  3MBT A;  1SA8 A;  2MJI A;  2Q4N A;  3K3L A;  4D6B A;  2LFO A;  3EBK A;  2AH7 X;  1ZNK A;  1FE3 A;  1RLB E;  2JN3 A;  1G85 A;  4A60 A;  1EQD A;  4EDE A;  3ZUI A;  1URE A;  3BRN A;  4ALB A;  4AYH A;  2G78 A;  2FR3 A;  1ML7 A;  3WJE A;  5EEE A;  1LKE A;  2AT6 X;  1ZNH A;  4IMO A;  5D8J A;  4XMF A;  2K62 A;  3BS2 A;  1ICM A;  1A3Y A;  4ORR A;  3I17 A;  5HCC C;  4GH7 A;  1FEL A;  4OS8 A;  1SXY A;  2W2A A;  3VG7 A;  2Q2M A;  2EU7 X;  2L9C A;  2JOZ A;  4QYP A;  3FR4 A;  5L8O A;  2WQA E;  1KZX A;  3WJF A;  1E00 A;  2ACP X;  2QO4 A;  2QO5 A;  2WWP A;  1KT3 A;  3PH5 A;  1E5P A;  3Q6L A;  3WBG A;  5F6Z A;  1AQB A;  4MVK A;  1MVG A;  3KZA A;  4YCH A;  2POA A;  1N0S A;  3FR5 A;  4Y0Q A;  5KID A;  1ZNG A;  3NAD A;  1LFO A;  1HMS A;  3P6F A;  3VG2 A;  3KFF A;  1BRQ A;  5D47 A;  5HZQ A;  4ORX A;  1MDC A;  4GNW A;  3VG4 A;  2ACO A;  4TKB A;  1MX8 A;  2HMB A;  2LBA A;  4K19 A;  4BQU A;  1PMP A;  4ZFX A;  1I06 A;  3BLG A;  1EII A;  1NP4 A;  3ZQ3 A;  1E02 A;  4NYR A;  3B2L A;  1YP7 A;  4AZQ A;  4GET A;  1DZP A;  4GE1 A;  3B2I A;  4NNT A;  2Q39 A;  1JJJ A;  5DG4 A;  4ZHG A;  1LPJ A;  1FTP A;  2GJ5 A;  3PED A;  2CZU A;  1BSO A;  2FTB A;  2A13 A;  1OEE A;  1X71 A;  1BJ7 A;  5LKF A;  1YP6 A;  1GT3 A;  2IFB A;  2YG2 A;  2WEX A;  1QFV A;  3STM X;  1ZND A;  5LKE A;  1IIU A;  4YCE A;  1S7D A;  2R73 A;  1KQX A;  1U18 A;  2AT5 X;  1PEE A;  1ACD A;  1BSQ A;  3DSZ A;  1B8E A;  5B27 A;  2HZQ A;  2OVE A;  4HPA A;  3B2H A;  2HNX A;  1O8V A;  4O9S A;  5JR8 A;  3FA6 A;  1EAL A;  2GTF X;  2AT0 X;  3APW A;  4NNS A;  2ASN X;  4XMH A;  3NR3 A;  4ALO A;  4I9R A;  2BLG A;  1ALB A;  1SXU A;  1GXA A;  5F7G A;  4NYQ A;  2FT9 A;  1KT7 A;  2FS6 A;  5H8T A;  5H9N A;  4HFO A;  1O1V A;  3ZUO A;  3EMM A;  4YFQ A;  1TOW A;  1B56 A;  1A57 A;  2WSJ A;  1X89 A;  4AZN A;  4HPB A;  1T8V A;  4OMW A;  4ZHD A;  1L6M A;  1DC9 A;  4MVL A;  3FA7 A;  3HWD A;  1QG5 A;  2MO5 A;  5B29 A;  1CBR A;  5HWZ A;  4YKO A;  1GT4 A;  1QY1 A;  5EED A;  1EUO A;  4TNN A;  4XME A;  1AB0 A;  3P6C A;  1DF3 A;  1EW3 A;  1HBQ A;  5BVS A;  3UEW A;  3KFG A;  3P6G A;  3NPO A;  5LJG A;  4YFR A;  3APX A;  2QOS C;  2MM3 A;  3NX2 A;  4YH0 A;  2JU8 A;  4QGV A;  4ARH A;  1FEN A;  4MVI A;  4ORS A;  1OPB A;  4LZU A;  2RCQ A;  4I3B A;  4IAX A;  3VG3 A;  3UEU A;  1JYD A;  2AKQ A;  2Q9S A;  1GT5 A;  1G7N A;  1BM5 A;  5HA0 A;  5HZ9 A;  4ZHH A;  1BEB A;  2CM4 A;  4XMG A;  2G7B A;  1KT6 A;  1LF7 A;  3O19 A;  5KHP A;  1GX9 A;  1O1U A;  2G79 A;  2AMM X;  4WFU A;  3G7X A; 
#chains in the Genus database with same CATH topology
 2IZG B;  2LKK A;  2OVA A;  1MK5 A;  4CDD A;  1SWL A;  1LCV A;  1SXW A;  1YWD A;  4GKC A;  5FQ7 E;  5L8I A;  3FW5 A;  4EFG A;  4O3Y A;  1JV4 A;  4U8U N;  5B11 O;  3RDO A;  1SY2 A;  1RXJ A;  3SOT A;  3KFI A;  3T2X A;  3VG5 A;  4BX6 A;  4GRJ A;  1ICN A;  1VWF B;  1PBO A;  3B2J A;  2W2B A;  2K23 A;  4ZCB A;  4IAW A;  4BVM A;  1BBP A;  2PI3 O;  4IB8 A;  2P8G A;  3VE1 A;  4FQB B;  4QQ1 A;  3HWG A;  3QKG A;  2FWV A;  4TQ2 A;  1TXL A;  1I9H A;  1BSY A;  1NQM A;  2WEW A;  3DTQ A;  1P6P A;  2QM9 A;  3GAQ A;  4BX5 A;  1EXS A;  2L67 A;  2X8S A;  3BSZ E;  4JNJ A;  4L1N A;  4OMX A;  4RUU A;  3U9P C;  5K67 A;  3D95 A;  3APU A;  1UZ2 X;  1X8Q A;  2AF5 A;  1JJU A;  1YUP A;  3EM0 A;  3PEC A;  4IAB A;  4RUN A;  1G74 A;  2RTF B;  3S26 A;  4BX5 B;  4ORU A;  2LBV A;  4TJZ A;  1I04 A;  1LIE A;  1RBP A;  2A3F X;  4AZP A;  4N7D A;  3S60 A;  5LJH A;  4A1Y A;  3WYP A;  1BWY A;  4I3C A;  1QAB E;  1NBX A;  1K3B A;  5HTD A;  5HTE A;  4KC7 A;  4BJ8 A;  1HQQ A;  2NND A;  3WJB A;  4AZM A;  5HCD C;  3FIQ A;  3RY2 A;  3CBS A;  1K24 A;  1VYF A;  5F6B A;  2E4J A;  1HN2 A;  4YVB A;  1EIO A;  3FEP A;  3MVF A;  5FQ6 E;  2QMI A;  3WJD A;  2RTM A;  4QGW A;  2FGS A;  2OL8 O;  4QYN A;  1KXO A;  1IFC A;  5AJB A;  1CBI A;  1RXK A;  1YWB A;  4AZO A;  1EPA A;  4O49 A;  1KOI A;  3HOL A;  1VWL B;  5B5F A;  2OYB O;  4KT5 A;  1IKE A;  4DCB A;  5IO6 A;  4O4O A;  2Q2P A;  1RSU B;  2CAM A;  3CR6 A;  1D3S A;  3EBW A;  2IZC B;  1VWJ B;  2A2G A;  3D96 A;  4M7M A;  1LNM A;  3T1D A;  4QAE A;  1LEL A;  4I9S A;  4ZGF A;  2A0A A;  2X8F A;  1EPB A;  1SWB A;  3FW4 A;  3PP6 A;  2OVS A;  4PSQ A;  4QGX A;  2X8T A;  3B2K A;  3I0A A;  2RTP B;  3IFB A;  2NNQ A;  3APV A;  5K06 A;  4A1H A;  4LKP A;  2AT3 X;  3BDR A;  3NQ3 A;  5DPQ A;  3OJY C;  1VYG A;  1LIB A;  2ALL X;  2GH7 A;  3BY0 A;  1AVD A;  1N9M A;  3C78 X;  4ZH9 A;  5D4A A;  3CKG A;  1ERX A;  5LJC A;  2JU3 A;  4HPC A;  5C0N A;  4TKJ A;  4N7C A;  4ZHF A;  1D2U A;  3WZQ A;  4D6A A;  1JMZ A;  2OF9 A;  4R0B A;  1QQS A;  4Y0P A;  4YFP A;  1YWC A;  2VFC A;  1EI5 A;  1SWK A;  3F9D A;  3JSQ A;  3MX7 A;  4I3D A;  5BVQ A;  2XST A;  4YGH A;  4QNI A;  2ANS A;  1SWA A;  1GX8 A;  3HWE A;  4YKM A;  4MVE A;  1FDQ A;  2IZD B;  3STK A;  1PBY A;  2BC3 A;  4OKA A;  1CJ5 A;  1VWE B;  4XMC A;  3IA8 A;  1DV9 A;  3FDC A;  2OVD A;  3HPE A;  4TKH A;  1HY2 A;  5FFH A;  2FR2 A;  3T6L A;  4ZR2 A;  4DNE A;  4ZJ0 A;  1GT1 A;  4GK9 A;  1Z24 A;  1JMX A;  2Y3E A;  3NP1 A;  1OEK A;  2I5V O;  2QOM A;  3P6H A;  3ZZV A;  1OEJ A;  1TOU A;  4U3Q A;  3WZO A;  3NQK A;  1U0X A;  1SWD A;  2LB6 A;  4HPD A;  3FEL A;  5HAE A;  4NP1 A;  4OEM A;  1JYJ A;  1VYO A;  1ADL A;  1Y0G A;  2CZT A;  5F1E A;  3VU1 A;  4YMY A;  3AUM O;  1LDO A;  2GTL M;  3D9W A;  5BVT A;  1YWA A;  1SLG B;  1RXH A;  4CPF A;  2WQ9 A;  3S5X A;  1BRP A;  3L4R A;  2NP1 A;  2RTQ B;  3UEX A;  4Z6J A;  5HZ8 A;  1GKA A;  1I78 A;  4INN A;  4KII A;  5HBS A;  3U0D A;  3RZY A;  3RSW A;  1E2T A;  1XKI A;  2OZQ A;  3BU9 A;  3FR2 A;  3OBL A;  1AVE A;  4CSB A;  4XMD A;  3JS1 A;  2RTD B;  2NNE A;  3C77 X;  3RDX A;  1JJX A;  1IKJ A;  2OFR X;  3O22 A;  3WXQ A;  5HZ6 A;  3P6E A;  3OD9 A;  1GKA B;  2L68 A;  4UU3 A;  1XCA A;  2C1Q A;  1QY0 A;  4YGG A;  2X46 A;  2RQ0 A;  4IRW A;  5K68 A;  4O4U A;  2KT4 B;  5EDC A;  5HCE C;  3TGA A;  2ZAG A;  3WZN A;  2OL6 O;  2CBR A;  4NLI A;  4M6S A;  4GU8 A;  1X8O A;  2R74 A;  1VWM B;  2RTA A;  5LJK A;  1SLE B;  2MF6 A;  3SAO A;  4KC8 A;  5F2B A;  2FS7 A;  1Y9L A;  3RDU A;  4FGI B;  1AEL A;  1B4M A;  1ERB A;  3LHN A;  2RTI B;  5EPQ A;  1S2P A;  3RDS A;  4CPH A;  1MX7 A;  2RCT A;  1OPA A;  2Y32 A;  4ZH6 A;  4IB7 A;  2OFM X;  1GGL A;  2RTG B;  2AVI A;  1SLD B;  1I4U A;  1AVG I;  4YGZ A;  2X56 A;  1SY0 A;  4HWM A;  4CPH B;  4EEJ A;  3U03 A;  2CBS A;  1HQP A;  1SWC A;  1LUQ A;  3FLL A;  4ODD A;  1IFB A;  1OBP A;  4JGL A;  1X8U A;  2O62 A;  1PM1 X;  4GUZ A;  5LJE A;  3H3I A;  1OBU A;  4OS0 A;  5H9L A;  4NLJ A;  5CYB A;  3HK1 A;  1QWD A;  2CM9 A;  1S44 A;  3ELX A;  3CQR A;  1NP1 A;  4IMN A;  4Z2O A;  3FID A;  3SZJ A;  5HZ5 A;  3TF6 A;  2RTH B;  1SY3 A;  2XKL A;  2GTL O;  2VDF A;  3RWX A;  4ES7 A;  1T0V A;  5EDB A;  4GD9 A;  1GM6 A;  1BLR A;  2F73 A;  1VPR A;  4AW8 A;  1N7Y A;  1SY1 A;  1SXX A;  4QZT A;  2RTJ A;  1CRB A;  3P6D A;  2RA6 A;  1OBQ A;  1LIF A;  1R0U A;  2IZI A;  1Y9T A;  3C76 X;  2F09 A;  4DQ4 A;  2RTE B;  3BX7 A;  3FA8 A;  1KZW A;  5EZ2 A;  2Z4H A;  4GGT A;  4QZU A;  2FRS A;  3HWF A;  4CPI A;  5KIC A;  2A2U A;  3AKM A;  3WJC A;  1VWQ B;  1CBQ A;  3RE6 A;  2F01 A;  1JQP A;  2IZB A;  3HOE A;  3O2Y A;  4ORW A;  1G5W A;  4ORY A;  4Y0R A;  4Y5D A;  2BHV A;  4CK4 A;  1FJ1 E;  1A18 A;  4PJ2 A;  1I05 A;  3CMP A;  3EYC A;  1ZNL A;  1NDJ A;  5H9K A;  3RBY A;  4YBU A;  2RTO B;  3PH6 A;  3WJG A;  2ZSC A;  2AT8 X;  4IBA A;  3STN A;  2A5B A;  5LJB A;  3ELZ A;  4EKV A;  1ZNE A;  3TGC A;  4YDA A;  4BCS A;  2WUT A;  5D48 A;  4BX7 A;  4EQA C;  2YMS A;  4GJV A;  4YBP A;  3TGB A;  1VWR B;  2FKG A;  4ZGU A;  3WOV A;  5B3M O;  4WFV A;  4I60 A;  3UAQ A;  1B0O A;  3CQN A;  4YDB A;  4DQ3 A;  5B10 O;  1LID A;  4MIR A;  5H9A A;  3AKN A;  4O4S A;  4O3W A;  1TW4 A;  3PQU A;  5AQ6 A;  1QY2 A;  1KQW A;  2KTD A;  3FYF A;  1YIV A;  1TVQ A;  4U9C A;  4ZHC A;  4BX7 B;  3AEH A;  2IZE B;  1E06 A;  4LKT A;  5LJD A;  4BOE A;  2JU7 A;  2BS6 A;  2L5P A;  3BU1 A;  5FEN A;  3MG5 A;  3RDQ A;  1T68 X;  5L3Y A;  1JZU A;  3CBC A;  1KT5 A;  1H91 A;  3T2W A;  1SWH A;  3PDF A;  5CE4 A;  1DFV A;  1NGL A;  4IB9 A;  5D45 A;  2RD7 C;  2FLJ A;  4BBO A;  2HYS A;  1VWG B;  4A8Z A;  2MWH A;  2N93 A;  3F8A A;  2HZR A;  1IW2 A;  2X45 A;  3P02 A;  4NV8 A;  4Y0S A;  1MUP A;  1HMR A;  3T6F A;  3NQ9 A;  2UYW A;  2DM5 A;  2OF8 A;  3SZH A;  1DZJ A;  4UU2 A;  5HA1 A;  1LIC A;  1X8P A;  3VG6 A;  2GC9 A;  4GGR A;  5IO7 A;  3KQ0 A;  1KT4 A;  4TLJ A;  3FEN A;  1A2D A;  3NX1 A;  1CBS A;  4EXZ A;  1VWA B;  2QO6 A;  4Z2V A;  5FAZ A;  4LZV A;  3CWK A;  2RTL A;  1DZM A;  5IO5 A;  2A8G A;  4GGZ A;  2DJF A;  3OE3 A;  4OS3 A;  1N4J A;  1DZK A;  2X32 A;  3FA9 A;  3UEV A;  3WVM A;  4AZR A;  3Q34 A;  1U17 A;  3BX8 A;  1HMT A;  1W4T A;  3EW1 A;  2HLV A;  2W2F A;  1X8N A;  4WBK A;  3D97 A;  3PPT A;  1SWU A;  3VGW A;  4IB6 A;  4LQZ A;  1SWN A;  1SWP A;  2PY1 A;  1ZRY A;  1GX3 A;  3KFH A;  2R56 A;  1VWC B;  5F58 A;  3TZS A;  2KW1 A;  1FEM A;  2OL7 A;  3FMZ A;  1HBP A;  2AL0 X;  2WR6 A;  3FEK A;  4GNY A;  1QFT A;  2OFB A;  1SA8 A;  2MJI A;  2Q4N A;  3K3L A;  3MBT A;  4D6B A;  5IXG A;  2LFO A;  3EBK A;  1SWJ A;  2AH7 X;  1VWP B;  1ZNK A;  3WZP A;  5CSE A;  1FE3 A;  1KL3 A;  1VWK B;  1RLB E;  2JN3 A;  1G85 A;  4O4X A;  4A60 A;  1STR B;  1EQD A;  3SLO A;  4EDE A;  1Y52 X;  1DF8 A;  1SWO A;  1URE A;  1UYO X;  3BRN A;  4L3R A;  3RE5 A;  3ZUI A;  4ALB A;  4AYH A;  2G78 A;  1SLF B;  2FR3 A;  1ML7 A;  3WJE A;  4ML7 B;  1STP A;  1LKE A;  2AT6 X;  2JMB A;  1W6F A;  3QQ2 A;  2FHN X;  4JO6 A;  5EEE A;  1ZNH A;  2IZF B;  4IMO A;  5D8J A;  2Z4I A;  1MEP A;  1SMP I;  4XMF A;  2K62 A;  3BS2 A;  1ICM A;  1Y53 X;  4Z2P A;  2X34 A;  1A3Y A;  1W5R A;  1NQN A;  4FBV A;  4ORR A;  3I17 A;  5HCC C;  4GH7 A;  3V8U A;  3VHI A;  3ZI8 A;  1FEL A;  4OS8 A;  2HKD A;  3ZW0 B;  1SRF A;  1VWB B;  2BT9 A;  1SXY A;  4CDE A;  2W2A A;  2MHD A;  3VG7 A;  4U46 A;  2Q2M A;  1SWT A;  1VWI B;  2EU7 X;  2G8C O;  2JOZ A;  2L9C A;  3RY1 A;  2Y3F A;  4QYP A;  3FR4 A;  5L8O A;  2WQA E;  1KZX A;  3WJF A;  1E00 A;  2ACP X;  2QO4 A;  1SWF A;  2QO5 A;  2WWP A;  1KT3 A;  3PH5 A;  5IRU A;  4BGF A;  5AEO A;  1PTS A;  1E5P A;  3Q6L A;  3WBG A;  5F6Z A;  1AQB A;  4MVK A;  1MVG A;  3KZA A;  2RTC B;  2POA A;  1N0S A;  3FR5 A;  3PQS A;  4GZV A;  4Y0Q A;  2C1S A;  4YCH A;  5B5G A;  5KID A;  1ZNG A;  3NAD A;  1LFO A;  1HMS A;  3P6F A;  3VG2 A;  2GTL N;  1KFF A;  3KFF A;  1BRQ A;  2RN4 A;  5D47 A;  2FHL A;  3SZI A;  5HZQ A;  4KCA A;  4ORX A;  4C5P A;  5L8N A;  3ZW1 A;  1MDC A;  4BX6 B;  4GNW A;  4CDC A;  3VHM A;  3VG4 A;  2ACO A;  4NW4 A;  4TKB A;  1MX8 A;  1VWN B;  1LCZ A;  2HMB A;  3ZWE A;  2LBA A;  4K19 A;  4BQU A;  1PMP A;  3LTW A;  3MM0 A;  3ZW1 B;  4ZFX A;  1I06 A;  3BLG A;  2RTB B;  1EII A;  1NP4 A;  4QRL A;  4ID2 A;  2OY5 O;  3ZQ3 A;  4B55 A;  1E02 A;  4NYR A;  1HXL A;  2FKJ A;  2KTS A;  3B2L A;  1YP7 A;  4AZQ A;  4WHI A;  4GET A;  1DZP A;  4GE1 A;  3B2I A;  4NNT A;  3EC5 A;  1MOY A;  1NC9 A;  2Q39 A;  1JJJ A;  5DG4 A;  4ZHG A;  2OY8 A;  1LPJ A;  1FTP A;  2GJ5 A;  2KD2 A;  2CZU A;  2WPU A;  3E3C A;  2DJG A;  3PED A;  1BSO A;  2FTB A;  4MIS A;  2A13 A;  1SWE A;  3VHH A;  1OEE A;  1X71 A;  4CPE A;  1BJ7 A;  5LKF A;  1KL4 A;  3SLJ A;  1YP6 A;  1GT3 A;  2IFB A;  2YG2 A;  2WEX A;  3KVN A;  1QFV A;  3RKG A;  1ZND A;  1SRJ A;  2JW1 A;  3PK2 A;  1IIU A;  4YCE A;  1UYN X;  3STM X;  5LKE A;  1S7D A;  2R73 A;  1KQX A;  1U18 A;  2AT5 X;  2C4I A;  1PEE A;  2RTN B;  1ACD A;  1BSQ A;  3DSZ A;  3SLT A;  1B8E A;  3LV4 A;  4COT A;  5B27 A;  2HZQ A;  2OVE A;  4HPA A;  3B2H A;  3ZW2 A;  4Z28 A;  2HNX A;  1O8V A;  2LA7 A;  4O9S A;  5JR8 A;  3FA6 A;  1EAL A;  1JIW I;  2GTF X;  2AT0 X;  3APW A;  4NNS A;  2ASN X;  3N91 A;  4U8U M;  4XMH A;  1IJ8 A;  1WUB A;  1VWD B;  3NR3 A;  4MEE A;  4ALO A;  4I9R A;  2BLG A;  1ALB A;  1SXU A;  2IZA A;  1GXA A;  5F7G A;  3VE2 A;  1LDQ A;  4NYQ A;  3X00 A;  2FT9 A;  1SRH A;  4KH8 A;  1KT7 A;  2FS6 A;  5H8T A;  5H9N A;  4HFO A;  2IZK A;  1O1V A;  3ZUO A;  3EMM A;  4YFQ A;  1STS B;  1TOW A;  1B56 A;  1A57 A;  2X55 A;  2WSJ A;  1X89 A;  5IRW A;  3EW2 A;  3S5V A;  1HXZ A;  2X4M A;  4HPB A;  4AZN A;  1T8V A;  4CV7 A;  1KGL A;  4OMW A;  3WYQ A;  3RDM A;  5JD2 A;  4GDZ A;  1LCW A;  2BSZ A;  4JHQ A;  4ZHD A;  1L6M A;  1SWG A;  1DC9 A;  4MVL A;  3F6Z B;  1SRG A;  2JGS A;  3FA7 A;  1SRE A;  2IZH B;  2QCB A;  1WBI A;  3HWD A;  4FBO A;  1QG5 A;  2MO5 A;  2ZAI A;  5B29 A;  3GE2 A;  1CBR A;  4GJS A;  4OEL A;  2RTK A;  5B2A O;  4CDF A;  1JBH A;  2OY1 O;  4ON1 A;  2OY7 A;  4GDA A;  2BS5 A;  2OFA A;  3D4R A;  1VWH B;  4YKO A;  1GT4 A;  5IRA A;  5HWZ A;  1QY1 A;  5EED A;  1EUO A;  4TNN A;  4XME A;  3VPJ E;  1SWR A;  1AB0 A;  3P6C A;  1DF3 A;  1EW3 A;  1HBQ A;  5BVS A;  3UEW A;  3KFG A;  3P6G A;  1VWO B;  1OSP O;  3NPO A;  5LJG A;  4YFR A;  3APX A;  2QOS C;  5AJC A;  1Y55 X;  2MM3 A;  5BYP A;  3NX2 A;  4YH0 A;  1SWS A;  2JU8 A;  1SRI A;  3ZW0 A;  4FBR A;  2IZJ A;  2M4L A;  2UZ2 A;  2A5C A;  1N9Y A;  4QGV A;  4ARH A;  2VFB A;  3CKF A;  1FEN A;  4MVI A;  4ORS A;  1OPB A;  4LZU A;  2RCQ A;  1N43 A;  2IZL B;  4I3B A;  4IAX A;  3VG3 A;  5CHK A;  4Z27 A;  3UEU A;  2RTR B;  4O3Z A;  1JYD A;  1RST B;  2AKQ A;  2Q9S A;  1GT5 A;  1G7N A;  4Y59 A;  1BM5 A;  4I95 A;  1KL5 A;  1RAV A;  3JQO A;  5HA0 A;  4O3X B;  5HZ9 A;  4NV7 A;  3NBX X;  4ZHH A;  1BEB A;  3P24 A;  2G5L A;  1SWQ A;  2CM4 A;  2I5Z O;  4I6S A;  4XMG A;  2G7B A;  1KT6 A;  1LF7 A;  3O19 A;  1MM9 A;  1GX9 A;  4U8U O;  5KHP A;  1O1U A;  5FQ8 E;  3HTY A;  2G79 A;  2AMM X;  4WFU A;  3G7X A; 
#chains in the Genus database with same CATH homology
 2LKK A;  2OVA A;  1YWD A;  1SXW A;  4GKC A;  5L8I A;  5FQ7 E;  3FW5 A;  4EFG A;  4O3Y A;  1JV4 A;  4U8U N;  3SOT A;  1SY2 A;  3VG5 A;  3KFI A;  4GRJ A;  1ICN A;  1PBO A;  3B2J A;  2W2B A;  2K23 A;  4ZCB A;  4IAW A;  4BVM A;  1BBP A;  4IB8 A;  3VE1 A;  2P8G A;  4FQB B;  4QQ1 A;  3HWG A;  3QKG A;  2FWV A;  4TQ2 A;  1TXL A;  1BSY A;  3GAQ A;  2WEW A;  3DTQ A;  1P6P A;  2QM9 A;  1EXS A;  2L67 A;  2X8S A;  3BSZ E;  4L1N A;  4OMX A;  4RUU A;  3U9P C;  3D95 A;  3APU A;  1UZ2 X;  1X8Q A;  3EM0 A;  1YUP A;  3PEC A;  4IAB A;  4RUN A;  1G74 A;  3S26 A;  4ORU A;  2LBV A;  4TJZ A;  1I04 A;  1LIE A;  1RBP A;  2A3F X;  4AZP A;  4N7D A;  3S60 A;  5LJH A;  4A1Y A;  1BWY A;  4I3C A;  1QAB E;  5HTD A;  5HTE A;  4KC7 A;  2NND A;  3WJB A;  4AZM A;  5HCD C;  3FIQ A;  3CBS A;  1VYF A;  5F6B A;  2E4J A;  1HN2 A;  1EIO A;  3FEP A;  3MVF A;  5FQ6 E;  2QMI A;  3WJD A;  4QGW A;  4QYN A;  1KXO A;  1IFC A;  5AJB A;  1CBI A;  4AZO A;  1YWB A;  1EPA A;  4O49 A;  1KOI A;  3HOL A;  4KT5 A;  1IKE A;  5IO6 A;  4O4O A;  2Q2P A;  3CR6 A;  5L8N A;  1D3S A;  3EBW A;  3T1D A;  3D96 A;  2A2G A;  4M7M A;  1LNM A;  4QAE A;  4ZGF A;  4I9S A;  5HAE A;  2A0A A;  2X8F A;  1EPB A;  3FW4 A;  3PP6 A;  4PSQ A;  2OVS A;  4QGX A;  2X8T A;  3B2K A;  3I0A A;  3IFB A;  5K06 A;  2NNQ A;  3APV A;  4A1H A;  4LKP A;  2AT3 X;  3BDR A;  3NQ3 A;  5DPQ A;  3OJY C;  1VYG A;  1LIB A;  2ALL X;  3BY0 A;  3C78 X;  4ZH9 A;  5D4A A;  1ERX A;  5LJC A;  2JU3 A;  4HPC A;  5C0N A;  4TKJ A;  4N7C A;  4ZHF A;  1D2U A;  4D6A A;  4R0B A;  1QQS A;  4Y0P A;  4YFP A;  1YWC A;  5BVQ A;  1EI5 A;  3F9D A;  3JSQ A;  3MX7 A;  4I3D A;  2XST A;  4YGH A;  4QNI A;  2ANS A;  3HWE A;  1GX8 A;  4YKM A;  4MVE A;  1FDQ A;  3STK A;  1CJ5 A;  4XMC A;  1DV9 A;  3IA8 A;  1KGL A;  2OVD A;  4TKH A;  5FFH A;  2FR2 A;  4ZR2 A;  1JBH A;  4ZJ0 A;  1GT1 A;  4GK9 A;  1Z24 A;  3NP1 A;  3P6H A;  1OEK A;  3ZZV A;  1OEJ A;  1TOU A;  4U3Q A;  3NQK A;  1U0X A;  2LB6 A;  4HPD A;  3FEL A;  4NP1 A;  5F1E A;  1JYJ A;  1ADL A;  3VU1 A;  2CZT A;  4YMY A;  2GTL M;  5BVT A;  1YWA A;  2WQ9 A;  3S5X A;  1BRP A;  3L4R A;  2NP1 A;  3UEX A;  5HZ8 A;  1GKA A;  4INN A;  4KII A;  5HBS A;  3U0D A;  3RZY A;  3RSW A;  1XKI A;  2OZQ A;  3BU9 A;  3FR2 A;  3OBL A;  4CSB A;  4XMD A;  3JS1 A;  2NNE A;  3C77 X;  1JJX A;  1IKJ A;  2OFR X;  3O22 A;  3WXQ A;  5HZ6 A;  3P6E A;  3OD9 A;  1GKA B;  2L68 A;  4UU3 A;  1XCA A;  4YGG A;  1QY0 A;  2X46 A;  2RQ0 A;  4O4U A;  2KT4 B;  5EDC A;  5HCE C;  3TGA A;  2ZAG A;  4NLI A;  2CBR A;  4M6S A;  4GU8 A;  1X8O A;  2R74 A;  5LJK A;  3SAO A;  4KC8 A;  2FS7 A;  1Y9L A;  1AEL A;  4FGI B;  1B4M A;  1ERB A;  3LHN A;  5EPQ A;  1S2P A;  1MX7 A;  2RCT A;  1OPA A;  4ZH6 A;  4IB7 A;  2OFM X;  1GGL A;  1I4U A;  1AVG I;  4YGZ A;  1SY0 A;  4HWM A;  3U03 A;  4EEJ A;  2CBS A;  1HQP A;  4ODD A;  3FLL A;  1IFB A;  1OBP A;  4JGL A;  1X8U A;  2O62 A;  1PM1 X;  5LJE A;  3H3I A;  1OBU A;  4OS0 A;  5H9L A;  4NLJ A;  5CYB A;  3HK1 A;  1QWD A;  2CM9 A;  1S44 A;  3ELX A;  3CQR A;  1NP1 A;  4IMN A;  5HZ5 A;  3TF6 A;  1SY3 A;  2XKL A;  2GTL O;  3RWX A;  4ES7 A;  1T0V A;  5EDB A;  1GM6 A;  1BLR A;  2F73 A;  1VPR A;  4AW8 A;  1SY1 A;  1SXX A;  4QZT A;  3P6D A;  1CRB A;  2RA6 A;  1OBQ A;  1LIF A;  1R0U A;  1Y9T A;  3C76 X;  2F09 A;  4DQ4 A;  3BX7 A;  3FA8 A;  1KZW A;  5EZ2 A;  2Z4H A;  4QZU A;  2FRS A;  3HWF A;  5KIC A;  2A2U A;  3AKM A;  3WJC A;  1CBQ A;  1G5W A;  3O2Y A;  3HOE A;  4ORW A;  4ORY A;  4Y0R A;  2BHV A;  4CK4 A;  1A18 A;  4PJ2 A;  1I05 A;  3CMP A;  3EYC A;  1ZNL A;  3RBY A;  5H9K A;  4YBU A;  3PH6 A;  3WJG A;  4IBA A;  2AT8 X;  5LJB A;  3STN A;  3ELZ A;  1ZNE A;  3TGC A;  4YDA A;  2WUT A;  5D48 A;  4EQA C;  2YMS A;  4YBP A;  3TGB A;  4ZGU A;  3WOV A;  4WFV A;  3UAQ A;  1B0O A;  3CQN A;  4YDB A;  4DQ3 A;  1LID A;  4MIR A;  5H9A A;  3AKN A;  4O4S A;  4O3W A;  1TW4 A;  3PQU A;  5AQ6 A;  1QY2 A;  1KQW A;  2KTD A;  3FYF A;  1YIV A;  1TVQ A;  4U9C A;  4ZHC A;  1E06 A;  4LKT A;  5LJD A;  4BOE A;  2JU7 A;  2BS6 A;  2L5P A;  3BU1 A;  5FEN A;  1T68 X;  1JZU A;  3CBC A;  1KT5 A;  1H91 A;  5CE4 A;  1DFV A;  1NGL A;  4IB9 A;  5D45 A;  2RD7 C;  2FLJ A;  2HYS A;  4A8Z A;  2MWH A;  2N93 A;  3F8A A;  2HZR A;  1IW2 A;  2X45 A;  3P02 A;  4Y0S A;  1MUP A;  1HMR A;  3NQ9 A;  2DM5 A;  1DZJ A;  4UU2 A;  5HA1 A;  1LIC A;  1X8P A;  3VG6 A;  2GC9 A;  5IO7 A;  3KQ0 A;  1KT4 A;  4TLJ A;  3FEN A;  1A2D A;  3NX1 A;  1CBS A;  4EXZ A;  2QO6 A;  5FAZ A;  4LZV A;  3CWK A;  1DZM A;  5IO5 A;  3OE3 A;  4OS3 A;  1DZK A;  3FA9 A;  3UEV A;  3WVM A;  4AZR A;  1U17 A;  3BX8 A;  1HMT A;  2HLV A;  2W2F A;  1X8N A;  4WBK A;  3D97 A;  3PPT A;  4IB6 A;  4LQZ A;  2PY1 A;  1ZRY A;  3KFH A;  2R56 A;  5F58 A;  3TZS A;  2KW1 A;  1FEM A;  3FMZ A;  1HBP A;  2AL0 X;  2WR6 A;  3FEK A;  4GNY A;  1QFT A;  3MBT A;  1SA8 A;  2MJI A;  2Q4N A;  3K3L A;  4D6B A;  2LFO A;  3EBK A;  2AH7 X;  1ZNK A;  1FE3 A;  1RLB E;  2JN3 A;  1G85 A;  4O4X A;  4A60 A;  1EQD A;  4EDE A;  3ZUI A;  4L3R A;  1URE A;  3BRN A;  4ALB A;  4AYH A;  2G78 A;  2FR3 A;  1ML7 A;  3WJE A;  4ML7 B;  5EEE A;  1LKE A;  2AT6 X;  2JMB A;  1ZNH A;  4IMO A;  5D8J A;  2Z4I A;  1SMP I;  4XMF A;  2K62 A;  3BS2 A;  1ICM A;  1A3Y A;  4FBV A;  4ORR A;  3I17 A;  5HCC C;  4GH7 A;  3V8U A;  3ZI8 A;  1FEL A;  4OS8 A;  3ZW0 B;  2BT9 A;  1SXY A;  2W2A A;  2MHD A;  3VG7 A;  2Q2M A;  2EU7 X;  2L9C A;  2JOZ A;  4QYP A;  3FR4 A;  5L8O A;  2WQA E;  1KZX A;  3WJF A;  1E00 A;  2ACP X;  2QO4 A;  2QO5 A;  2WWP A;  1KT3 A;  3PH5 A;  5AEO A;  1E5P A;  3Q6L A;  3WBG A;  5F6Z A;  1AQB A;  4MVK A;  1MVG A;  3KZA A;  4GZV A;  2POA A;  1N0S A;  3FR5 A;  3PQS A;  4NW4 A;  4Y0Q A;  4YCH A;  5KID A;  1ZNG A;  3NAD A;  1LFO A;  1HMS A;  3P6F A;  3VG2 A;  2GTL N;  3KFF A;  1BRQ A;  2RN4 A;  5D47 A;  5HZQ A;  4KCA A;  4ORX A;  3ZW1 A;  1MDC A;  4GNW A;  3VG4 A;  2ACO A;  4TKB A;  1MX8 A;  2HMB A;  3ZWE A;  2LBA A;  4K19 A;  4BQU A;  1PMP A;  3ZW1 B;  4ZFX A;  1I06 A;  3BLG A;  1EII A;  1NP4 A;  4QRL A;  4ID2 A;  3ZQ3 A;  1E02 A;  4NYR A;  2KTS A;  3B2L A;  1YP7 A;  4AZQ A;  4WHI A;  4GET A;  1DZP A;  4GE1 A;  3B2I A;  4NNT A;  2Q39 A;  1JJJ A;  5DG4 A;  4ZHG A;  1LPJ A;  1FTP A;  2GJ5 A;  2KD2 A;  2CZU A;  3E3C A;  3PED A;  1BSO A;  2FTB A;  4MIS A;  2A13 A;  1OEE A;  1X71 A;  1BJ7 A;  5LKF A;  1YP6 A;  1GT3 A;  2IFB A;  2YG2 A;  2WEX A;  3RKG A;  1QFV A;  3STM X;  1ZND A;  5LKE A;  2JW1 A;  1IIU A;  4YCE A;  1S7D A;  2R73 A;  1KQX A;  1U18 A;  2AT5 X;  1PEE A;  1ACD A;  1BSQ A;  3DSZ A;  1B8E A;  3LV4 A;  4COT A;  5B27 A;  2HZQ A;  2OVE A;  4HPA A;  3B2H A;  3ZW2 A;  2HNX A;  1O8V A;  2LA7 A;  4O9S A;  5JR8 A;  3FA6 A;  1EAL A;  1JIW I;  2GTF X;  2AT0 X;  3APW A;  4NNS A;  2ASN X;  3N91 A;  4U8U M;  4XMH A;  3NR3 A;  4ALO A;  4I9R A;  2BLG A;  1ALB A;  1SXU A;  1GXA A;  5F7G A;  3VE2 A;  4NYQ A;  2FT9 A;  4KH8 A;  1KT7 A;  2FS6 A;  5H8T A;  5H9N A;  4HFO A;  1O1V A;  3ZUO A;  3EMM A;  4YFQ A;  1TOW A;  1B56 A;  1A57 A;  2WSJ A;  1X89 A;  3S5V A;  4AZN A;  4HPB A;  1T8V A;  4CV7 A;  4OMW A;  4GDZ A;  4ZHD A;  1L6M A;  1DC9 A;  4MVL A;  3F6Z B;  3FA7 A;  3HWD A;  4FBO A;  1QG5 A;  2MO5 A;  2ZAI A;  5B29 A;  3GE2 A;  1CBR A;  4ON1 A;  2BS5 A;  3D4R A;  5HWZ A;  4YKO A;  1GT4 A;  1QY1 A;  5EED A;  1EUO A;  4TNN A;  4XME A;  3VPJ E;  1AB0 A;  3P6C A;  1DF3 A;  1EW3 A;  1HBQ A;  5BVS A;  3UEW A;  3KFG A;  3P6G A;  3NPO A;  5LJG A;  4YFR A;  3APX A;  2QOS C;  5AJC A;  2MM3 A;  5BYP A;  3NX2 A;  4YH0 A;  2JU8 A;  3ZW0 A;  4FBR A;  2M4L A;  4QGV A;  4ARH A;  1FEN A;  4MVI A;  4ORS A;  1OPB A;  4LZU A;  2RCQ A;  4I3B A;  4IAX A;  3VG3 A;  3UEU A;  4O3Z A;  1JYD A;  2AKQ A;  2Q9S A;  1GT5 A;  1G7N A;  1BM5 A;  4I95 A;  3JQO A;  5HA0 A;  4O3X B;  5HZ9 A;  3NBX X;  4ZHH A;  1BEB A;  3P24 A;  2CM4 A;  4I6S A;  4XMG A;  2G7B A;  1KT6 A;  1LF7 A;  3O19 A;  5KHP A;  1GX9 A;  4U8U O;  1O1U A;  5FQ8 E;  3HTY A;  2G79 A;  2AMM X;  4WFU A;  3G7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...