4GO1A

Crystal structure of full length transcription repressor lsrr from e. coli.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
297
Chain Sequence
b'EQGMCEEEQVARIAWFYYHDGLTQSEISDRLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYETQLRRQFSLQHVRVIPGLADADVGGRLGIGAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIGQLNAACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAADVAIVGIGAVSQGEQLMIGRKGAVGDILGYFFDAKGDVVTNIKIHNELIGLPLSALKTIPVRVGVAGGENKAEAIAAAMKGGYINALVTDQDTAAAILRSLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator LsrR
publication title Structural Basis for Phosphorylated Autoinducer-2 Modulation of the Oligomerization State of the Global Transcription Regulator LsrR from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 92
structure length 297
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04198 Sugar-bind Putative sugar-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4go1A01
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4go1A02
4ENKA 2P7VB 1TW2A 1HOTA 4GGGA 3JW4A 3T0YA 2QENA 2IT0A 5AONA 2XAJA 2L3DA 1YQAA 1F9NA 1BJAA 3KV1A 2ZNYA 3ZMVA 4NMLA 4GYIA 4EJUA 4M9SA 3J81K 1ZG1A 5K1YA 3LA2A 1HKSA 2OA4A 3Q9VA 2RI1A 4I2OA 1XTZA 4MGRA 1IN5A 5TJJA 2HS5A 2A5YB 1IN8A 4MQ9F 2MC3A 3T5XA 3GZ6A 2OD5A 3I54A 4IVNA 5HDGA 5HS8A 2HFHA 3K69A 4KN4X 4KN7X 2E1CA 1U5TB 4BH9A 4IRGA 4B09A 3RKXA 3U7JA 2IA2A 3E5UA 4KUMA 1VL1A 2Y75A 5AIPA 4DNCA 1SFUA 3K1PA 1R1TA 4Z2YA 1LK7A 1P2FA 3J80Z 3MFKA 2L02A 4EJVA 4L9NA 1MDMA 4G7OF 5JVTA 3GF2A 4HOBA 3TO6A 3OC6A 1CGPA 2VXZA 2HTSA 1OMIA 3HRUA 2GAUA 3GZ5A 1TTYA 2DQLA 2MH9A 4BNCA 3Q5FA 1SMTA 1YS7A 3HIFA 3ZMDA 2EK5A 2K27A 3KEQA 1WSUA 3HRTA 2ETHA 1KQ9A 2P5KA 3E6MA 4I01A 4KDPA 3GFMA 5AIQA 2FMLA 3E97A 1GHCA 5DCFA 5E8IA 1R5GA 1QGPA 4HZFA 2QLZA 3ENVA 3LQQA 3SQNA 4JQFA 1LDKB 2ZMEB 3WTSC 4M6YA 2BE5F 4GCVA 3IKTA 3WGHA 1YW9A 4RB2C 3ENQA 4GYGA 2XIGA 3IRQA 3ROUA 4ESFA 3P9KA 1IF1A 3E6CC 3WTUC 1YYVA 2XHKA 4AIHA 2XRNA 1W4MA 1SD7A 2ZFWA 2EA2A 5DCMA 4PZJA 3JAMZ 2JZYA 3EQLF 3ZMSA 4LK0F 4ZYDA 2LDUA 4O5VA 1K79A 3T8RA 2RNJA 2G9WA 3HSFA 1Z9CA 2M45A 2OKGA 1KU3A 1F5TA 2F5EA 4CYDA 1YS6A 2PI0A 2ZKZA 1Z91A 2O6GE 2UXXA 3IXQA 5HLHA 1ZREA 2O8XA 2HZTA 3LAJA 4TV7A 3E7FA 5HDKA 3TGNA 2P5LC 1T0FA 2Q2EA 1O3SA 2COMA 4L0YB 5LRSA 2WV0A 5D4SA 5F64A 5LBQA 2Z33A 5KK1A 4ASNA 1T98A 1OYWA 3D5LA 5K5QA 1IRGA 3L7WA 4LLNA 1MGTA 2EFPA 1R1UA 1U2WA 1MJAA 2QYOA 3IC7A 2NNNA 4XLPF 2QM3A 3IWFA 3KCCA 2B0LA 4LK1F 2IP2A 2LKPA 2RC4A 3H3ZA 5ERIA 1XDSA 1I1GA 5D5UB 5LEKA 5HLGA 1XMAA 3WE2A 3BZ6A 3FXRA 3DXJF 3FF5A 1UHWA 4DQ2A 1G3WA 1HSTA 3KFWX 3V7CA 1OYYA 3SHFA 4CZZA 2D1HA 4U0YA 3WU1B 2WU1A 1TQMA 2MLKA 4HA8A 3NRVA 4LD5A 3ICOA 1LDDA 3QP6A 1MKMA 1YG2A 3R61A 1XMKA 3LSTA 4EV0A 2IVMA 2M8EA 3TO9A 2M30A 4H0EA 2W57A 1IRFA 2DO7A 1LEBA 1R00A 4KIGA 3BJ6A 4EJTA 4RAYA 5IT9K 3G73A 1H9TA 1B9NA 1FS6A 1IXCA 1G3SA 2Z99A 1B1BA 4HAMA 2KRFA 3FMRA 3ZN0A 2DT5A 5DV5A 4KYWA 2O0MA 3M8EA 3FHZA 1OYIA 3REOA 4Q4ZF 2VT2A 5BPDA 3CH7A 1ON1A 2BKVA 2W48A 4P9UA 1P4AA 2JT1A 2DBBA 3KP7A 2EFWA 4NHJA 4UVAA 2UWMA 4A0XA 5LHGA 1FYKA 2UXNA 3GW2A 2GXBA 1J7KA 4YG2F 5ILUA 5HJ5A 1H0MA 5FO5A 3J80K 3WTZA 1S6LA 4GXOA 3P9IA 4G6QA 3CUOA 3E5XA 1DUXC 2O3FA 5D8KB 1K7AA 4A6EA 4LB6B 1KQ0A 3KP2A 2GWRA 3I58A 4L4YA 3M9AA 4EM2A 2QZ8A 3W6JB 1B59A 3RIRA 3FXUA 5DEQA 4HX7A 4IJAA 3T8TA 1U6GA 5LLQA 1XGOA 1LKZA 1MJBA 1P6RA 3CSSA 1O8BA 1TNSA 4M8LA 3E6DA 4F7ZA 4ON0A 2EWNA 3LA3A 1EH8A 2OQRA 3EYYA 5FD5A 4M6XA 5L3BA 3IRRA 4KFCA 3P9CA 2VOPA 2R7FA 4EGYA 1J2XA 4BQAA 1JT9A 4HYEA 4LB5A 1EH6A 4GO1A 1OR7A 2Y0MA 4KICA 5LGTA 2FRHA 3LAPA 1IXSB 4IHSA 2R7DA 4TM7A 2QVOA 4RGRA 3HRSA 2A61A 2W25A 1UFMA 2QQ9A 1ULYA 1TQIA 2QUFA 3BWGA 1B4AA 4UXNA 2P8TA 2XKOA 3RDIA 5D8LB 2L54A 1U5TA 4IXAA 1LEAA 3F3XA 2STTA 3TQNA 3KLOA 1WKMA 1J59A 3JAMK 2YPRA 1FBQA 5H6RA 2ISZA 5J6XA 1SAXA 2VBYA 1ZH5A 4XBFA 1UJ6A 2G7HA 3M8FA 5HS9A 5FLXZ 3KZYA 1FYMA 1FOKA 3V7RA 4WF2A 1SFEA 1ZGAA 1D8JA 4G6DA 5JFRA 1DPUA 2ADUA 2VBWA 3V7SA 2HQRA 4M9XA 1G3TA 4AVPA 1LVAA 2LNBA 4LGWA 5ICCA 4ENJA 2NYXA 1T6SA 3RYRA 4ESBA 5LRRA 3V8KA 4IRIA 2BBYA 2IJLA 4Y15A 1WWXA 1BBYA 4L5IA 3LA7A 1HSJA 3NWPA 1GXQA 3R6SA 2EB7A 1ZARA 1O3RA 4N9HA 1C0WA 2NRAC 5DYMA 2XVCA 2STWA 3WU0A 5LHHA 1ZLJA 4WCGA 3HN6A 2ZMEA 3BPXA 3BP8A 5TRDA 1I6XA 5K5RA 3R4KA 4K2EA 1W5SA 4RGXA 3BOQA 4UHTA 3DPTA 4LMYA 4Q47A 4MHGA 4CICA 2IA0A 4BYYA 4EM0B 5CVRA 4ESJA 2DFIA 5E1XA 3TDUC 2VODA 1UHMA 3LQRA 3NQOA 2CWEA 2ISYA 2M87A 4ZYHA 2C6YA 4NB5A 2XUBA 2MA3A 2BKXA 4JBAA 6PAXA 4XLNF 2MH2A 4IO1A 4XSXF 4KIFA 2UZKA 3BXFA 1P4WA 4LLLA 3QOPA 2HEOA 2FSWA 1CF7B 1FC3A 4CGZA 1FQOA 2K02A 2GNPA 4WX9A 4OQQA 3M1EA 1FNNA 2PG4A 4Y13A 4L9TA 2FA5A 3HSEA 1IAWA 5DDGA 3F6VA 2O03A 2H6CA 4N0BA 4KMFA 1I27A 4P55A 2FXAA 1YW7A 1I1SA 3U1DA 2A68F 2IPQX 2ZCWA 3EUHA 4KMUX 3HTSB 1ZLKA 2A07F 4X84A 3KP4A 2BGCA 4HW0A 4EQQA 2KJBA 4FX0A 3FMQA 1IN6A 2VN2A 5L3CA 2FE3A 2DLLA 3GX4X 4RGUA 4HF2A 2DU9A 3SFZA 3FX3A 5A2QZ 3CJNA 2X0LA 3KWMA 3GVAA 5HS7A 1QZZA 3JTGA 2W84A 4MEXF 1A04A 4LJZF 3BPVA 2PEXA 1QZYA 1XSXA 2ZO4A 1P4XA 3CUQC 2P7CB 2CSOA 2M5WA 5DUKA 2HKOA 4G8XA 2J5PA 3ELKA 1XGSA 4IHTA 1QQIA 2GXGA 2A69F 4PGHA 3WTXC 1PDNC 1Q1HA 3KP3A 1M0SA 2XAGA 4I02A 2EJRA 4CDGA 1QBJA 3QU3A 3H3UA 5FGMA 2R5FA 3F72A 5D6FA 4OIQF 3DKWA 3L00A 3FXQA 4HQEA 5CVUA 1VTNC 3WODF 1TQPA 1KS2A 1RUOA 1R58A 1TLHB 2J5OA 4JK1X 3K2ZA 2YX4A 5CLSA 2FBHA 2GIVA 3CO6C 2EV0A 4QLCU 3F8CA 2OAZA 2XGXA 4KIBA 4OIOF 2Z5UA 4PDKA 3LFKA 3C3WA 4YFNF 3GLXA 2H09A 3KEOA 2PQ8A 5L3GA 2E7WA 2VE9A 1PP8F 2GA1A 3RJPA 3OV8A 1DEAA 3F23A 1HORA 2VBXA 2RQPA 3QP5A 4TM8A 5JHUA 5FLXK 1E17A 2EV5A 2D2WA 3WE3A 5HVQC 4O3MA 3K9TA 4HV6A 3UW1A 3D0SA 1H9GA 4RB3C 4D0PA 4IPAA 2Q8KA 1ZRDA 4YFXF 1MZBA 1OKRA 1TNTA 4U0WA 5CVJA 5J8FA 2F8MA 3GWZA 1L0OC 4CHUA 1LDJA 1ZAOA 3E6BA 4BHCA 1XB4A 3DF8A 5ICFA 3RTRA 4PGGA 1W7PD 3FMSA 3WG9A 4MQVA 3I53A 3TKYA 2VC0A 3EFBA 3WTWC 5FFXA 1G6NA 5BPIA 4OIRF 5H6QA 3GO5A 1Y0UA 1S3JA 4EMSA 2KIMA 3TOAA 2D1VA 5ICGA 2W85A 3RKWA 4ZZDA 2Q0OA 3K1NA 1XSVA 3F8MA 4NQWA 1S8NA 3LHIA 3K1MA 2O0YA 1K6OA 3GUDA 4RS8A 2LF8A 1RI7A 2V9VA 5HOOA 2ESHA 4OQPA 1BC8C 3F21A 1RIOH 1HKTA 2YU3A 1QPMA 5L3EA 2PLYA 5HDNA 1RUNA 1HKQA 2JTVA 1IW7F 3N97A 3CO7C 4UUVA 2ZJ2A 4LG0B 3V4GA 3R0JA 3HTUA 2HWVA 2LF7A 3L7OA 1O7FA 2V1DA 3HUGA 3FM3A 3ENWA 3WGGA 1SMYF 2R3SA 4I09A 4L5JA 4RGSA 4RB0A 4QWQA 1Z6RA 1U8RA 1G3YA 1V4RA 3VEPA 4L0ZB 2VONA 3QPTA 1HW2A 2A6HF 3WTYC 3KP5A 3FM5A 3K0LA 4AWXB 1Y89A 2YSRA 4WXCA 3E5QA 3PFIA 4EGZA 1D8KA 3F22A 1T2KA 3SZTA 3OOPA 3HHGA 1KYWA 5HLIA 2XAHA 1KGSA 2DTRA 2KJCA 3MCZA 3ABUA 4WXDA 5ILSA 1HXDA 3DPLC 3SZPA 2VOOA 3TDZC 1REPC 2CYYA 4WXHA 1Z05A 2EFQA 3V8JA 4U7BA 1F4KA 1G4DA 3C18A 1KU2A 3QPHA 2L4AA 1HQCA 3U2RA 1FWZA 3E15A 2FNAA 1BC7C 5EEGA 3TX2A 4IF4A 1Z7UA 4HDUA 1BI2A 2OU2A 4OINF 1S7OA 4HV5A 2MBFA 2XAQA 1GXPA 1SD4A 2NS0A 3IL2A 3PQJA 4KA4A 1F1ZA 2XKPA 4UNOA 2V79A 4ENNA 4G9YA 1KU7A 5E1ZB 4E70A 2A3SA 2K4BA 3L9FA 1UCRA 2CFXA 2XV4S 1CF7A 2ZNZA 1UJ5A 1FP2A 1ZRCA 2HGCA 2QWWA 1AWCA 3I59B 3MEXA 3CDHA 4A2UA 4M72A 2ESNA 2PJPA 1ZYRF 4BAYA 4OMYA 2MLGA 4MTEA 2IRFG 3BDDA 3CTAA 3HSRA 3DEUA 1R22A 1JXSA 1O3TA 2GZWA 5ED4A 2PMHA 3I71A 5IT3A 4A12A 1XDUA 2KIFA 3BJAA 3ZP5A 2VE8A 2CG4A 5CVIA 1XCBA 4HDVA 3B73A 3VB2A 3LWFA 3EDPA 5FB2A 5ILVA 3BROA 1D5VA 2PMUA 2KIUA 2DQRA 3QAHA 1O57A 2MD5A 1K78B 1STZA 3F6OA 1XCVA 1QNTA 5D6EA 4S05A 2FU4A 3PQKA 2PBIA 1O3QA 3G3ZA 3MQ0A 1R23A 1P92A 3MAJA 5LGNA 1DPRA 4IRHA 2K7LA 2V1UA 3ECHA 5JR3A 3O2PE 4MEYF 3RPUA 3ZMUA 1XN7A 2F2EA 1L3LA 1JGSA 2L4MA 2NNYA 2QBYB 3EYIA 4ETSA 5IT9Z 4XSZF 2H94A 1BIBA 2AS5F 5D4RA 3QRFF 2F5DA 1HBXG 5LEJA 2Z3YA 2JSCA 3HHHA 1Z6TA 1KQ8A 2ZXJA 1JHHA 1U3EM 1FBSA 2P4WA 2P6TA 3ML6A 4I7HA 4GMKA 1B9MA 1BI3A 3C7JA 2E1NA 3F8BA 1KA8A 2OQGA 4R9NA 1FSEA 3F8FA 2XROA 1ZG5A 1IUYA 3CUQB 1HW1A 4YFKF 3JSOA 2EFOA 3E3VA 2WTEA 1FY7A 3GFJA 4Q5SF 3JSPA 1PP7U 1USTA 5FD6A 2RN7A 4EJOA 1FS5A 1WQ2A 3GEZA 2G7UA 1USSA 4M73A 5J8CA 4RB1A 4P96A 2L01A 2HTJA 1R1VA 1LK5A 5E1WA 4AIKA 1CD5A 1TW3A 2H6BA 1FRZA 2NAZA 1T39A 2QQBA 3NZEA 5K5OA 3GYHX 2IW5A 3DP7A 2HKXA 4KNYA 3ULQB 3RYPA 4HF1A 1SD6A 1FT9A 3KETA 2CQKA 1KYZA 1WRJA 2WC2A 4KT5C 1XGNA 2CGPA 2DI3A 3C1DA 5CJ9A 2VT3A 1DDNA 2D45A 2VBZA 4YIIA 3BY6A 3QU6A 4ZZLA 4R8HA 4ENMA 5E20A 1U5TC 3BJOA 5D5XB 1XD7A 2V6CA 1U78A 2F5CA 2WWYA 4PCQA 1IZ1A 3COAC 2RV8A 2JPBA 2P5VA 3I4PA 3GXOA 4HF0A 2PFBA 3HOTA 1J75A 4Q48A 4OIPF 2K86A 2GA2A 4N9IA 4HBLA 2LSOA 2HQNA 4MTDA 5ICEA 5BS6A 2DK8A 5CVVA 4L9JA 2A6EF 4M9ZA 2HR3A 2JRTA 3ECOA 3S2WA 4A0YA 2FMYA 1BI0A 3B02A 3R0AA 4G7HF 2M1BA 2X4HA 1BOAA 1OPCA 1NE7A 4ZYEA 1KU9A 1Z1DA 4L50A 4L51A 4ZH4F 1XSDA 1MJ9A 1IN4A 2EV6A 3GFLA 3MZHA 1PUEE 2RI0A 4BXUA 4I0BA 4U88A 4BHPA 4HQMA 5BQTA 3M7GA 2ELHA 1YTYA 2FOKA 2FBIA 1HW5A 2AXLA 1MDMB 1SD5A 3I0TA 2J0EA 4LG0A 4UVCA 1EV7A 3Q9SA 4A6DA 3RI4A 3FWEA 4S04A 4M71A 3VOEA 1D3YA 2F5FA 1T38A 4B8XA 1B6AA 2V1XA 3DV8A 1BM9A 4LFUA 2CW0F 1J9IA 3DQVC 1ZRFA 4A5MA 5F6FA 1XGMA 3I5UA 3ZPLA 2VC1A 5EEHA 4XRFA 3ZMTA 4I0AA 3ISPA 4P9FA 4YIFA 1R7JA 3JTHA 2H27A 4G94A 3W6KB 1R5HA 1W5TA 2ACJA 3R60A 4R1HA 3HOSA 3ABTA 2HDCA 3WTVC 2YX7A 4HX4A 2RVCA 3ZQ7A 3O3KA 1FP1D 3LWDA 3J81Z 2K4JA 1BIAA 1AOYA 5E17F 1FPQA 1IXRC 5H20A 1SFXA 3P7NA 2JPCA 3N4MA 4O6JA 1ZG3A 1X3UA 5DD8A 2BV6A 5E8GA 5JI6A 2FQ3A 4WK8F 3J7AO 4HLYA 1J5YA 3VFZA 4UVBA 4FHTA 4OU0A 3HYIA 3L2CA 1UB9A 3IKVA 4P5OA 5DCMB 4UV9A 2Y48A 2XASA 3EB9A 3I64A 3RKYA 2TDXA 3CLOA 4U7DA 1JE8A 1RZ4A 2KKOA 3IWZA 1FSHA 2RKHA 1QO0D 4FT8A 3HHEA 4I98B 3KZZA 1ZHFA 2RDPA 1R36A 2OZ6A 3FZVA 5D5WB 1BN5A 5DD4A 3I59A 3F8NA 3L09A 4R79A 1GVJA 1DP7P 3TOBA 2FF4A 3ZMZA 2O61A 5E18F 2BEOA 4LLGF 1LNWA 3DFGA 2FNPA 1ON2A 4HX8A 1PBTA 3MZYA 4L9VA 2XAFA 3WTTC 3BXEA 4Y17A 4L18B 1W7PA 1MD0A 1K78A 2DW4A 2EFNA 3U9GA 5LGUA 3EETA 4BHBA 3ERED 3H92A 1YIOA 4EJWA 5DUIA 2OZUA 5CYVA 2W24A 3TO7A 1YO5C 2DPUA 1FBUA 2P6SA 1YW8A 4L4ZA 2ZBKA 1I5ZA 1BI1A 5A2QK 1RNLA 2DPDA 1WI9A 4UV8A 4OOIA 4FX4A 1FSFA 3RPQA 2YR2A 2Z9OA 4MNUA 1YLFA 2QBYA 1FX7A 1UJ4A 5F1RA 2HYGD 2CO5A 4AD9A 4HLXA 3T1BA 1YFHA 3ZN1A 3HRMA 5BOXA 4R7TA 4A5NA 2IA1A 4RAZA 1ONVA 1LB2A 1ODDA 1S7AA 1ZGJA 1S29A 1ZN2A 2EA4A 2PN6A 3CUQA 3SXYA 1NHAA 2HYFA 2OBPA 1J0RA 2BYVE 2FBKA 3IHUA 3GFIA 1O7LA 4AIJA 1EH7A 2RGVA 3VODA 1FZPB 4ZYGA 1LQ1A 1V3FA 5KVRA 5L3FA 1FLIA 2DK5A 1E2XA 4U0VA 4OMZA 3V8LA 2QQAA 2HOEA 5D5VB 3WGIA 3KP6A 2E7XA 1LJ9A 1TBXA 4EM1A 4M74A 5FFZA 3BXGA 3KE2A 4G7ZF 3BXHA 1W7PB 2DAOA 3NEUA 5L3DA 1IN7A 1JHFA 4EVIA 2FEZA 3KLNA 4A0ZA 3MWMA 3O6BB 2GQQA 4CO8A 5LHIA 4CXFA 5BMZA 1FYLA 3AAFA 4WWCA
chains in the Genus database with same CATH superfamily
4LDNA 4GZLA 2P7VB 2SKDA 3ZU5A 4MI9A 4NRDA 1U0OC 1P2GA 1P4GA 1T3SA 1ZGHA 3DT6A 4OI1A 5BSTA 3KYDB 2PMZN 4M1MA 1SBNE 5K20A 1V39A 2GEFA 2IYZA 2AUNA 5L4SA 3R9KA 2HS5A 3EWNA 3FSGA 4Q16A 2WRZA 3ESCA 4RGVA 2X0RA 2BUCA 1OCZH 1HT2E 5AM2A 2PU5A 3DAYA 3LY9A 3SBEA 3QG5A 3NQ41 1S2OA 5F0HA 3J80A 4Z2YA 5IBRA 1LK7A 1P2FA 1EQAA 3I4CA 3F4LA 1GNVA 5DI9A 2AZDA 4CLRB 4HOBA 3IE1A 5FKOA 4YRVA 1V3TA 4G5GA 1TKBA 3E7PA 4B6RA 1YF3A 3ZHYA 4IJ6A 2MSYA 4K9PA 4EEFG 1MOQA 4BO6A 1HR0B 3KEQA 5BMVB 2AGVA 4LBZA 3ZZMA 3DZFA 3E97A 5DK6A 1JR2A 5GTHC 2NTVA 3RODA 4LHYA 3UWPA 2GO1A 2HSDA 1Q22A 3GTOJ 3L1IA 4YRGA 3FKJA 1RI1A 1XKXA 3K5PA 3MSXA 3I2HA 2VQHA 3JPWA 3ENQA 5EQDA 3BDVA 4TKVA 2QNIA 4JR2A 2EW1A 3OC0A 1Q7BA 1QVVA 4MZDA 4UUSB 4JKIA 4NBSA 1J8QA 3VJMA 1PK9A 4XEHA 1US8A 5CYGA 4V0RA 4X1OA 4M9QA 5DCMA 3EQLF 4FZRA 5JZBA 2JKZA 3PI7A 1FLVA 3CWZA 1XLUA 3QUBA 3T8RA 2C5EA 5AKLA 2I4LA 4I9GA 5FQNA 1F5TA 3JRGA 3CF4A 2F5EA 5GV8A 3I9FA 2QT1A 4MA0A 2O6GE 3GD5A 4MVYA 5GONF 2GXQA 3WA6A 5I7UA 2VJQA 4R9VA 2X2FA 5FBVB 4TV7A 4YLEA 1T0FA 5JXWA 2A9JA 1O3SA 4R81A 4L0YB 4B2IA 1AKWA 3IQFA 4HRVA 5T67A 4AO8A 1ML4A 1T98A 2RHDA 4URXR 1L7AA 4EO4A 3L7WA 2V4MA 5A05A 4GS5A 2B5OA 1O77A 2FG5A 4QDOA 5FDFA 2W82A 4YPFA 1PF7E 2RG1A 4MSUA 5G02A 2RC4A 4RF2A 2IE8A 1U2GA 4UAJA 2J07A 4YLGA 1QF9A 1ETHA 3T7IA 3I6BA 3AL0B 1ZRSA 2B8TA 4P5PA 3WQHA 3DKKA 4F4JA 5KB3A 2JGIA 1ZN8A 1JNYA 1M1NA 2G9UA 4HA8A 2R62A 4OQ4A 4DF3A 1XV5A 4YCDA 1FDVA 1W96A 2VF5X 4NK4A 4DL9A 4YAEA 2GA8A 3TSCA 3PDUA 4MW0A 1PGPA 2M8EA 3W1EA 4CKBA 4H0EA 4MS3B 1ZVVA 5KYVA 4DR5B 4RPKA 1DIRA 1SQ0A 2FSVA 1N2BA 1UBGA 3T5CA 2RGRA 3ELUA 3GJZA 4MWSA 1IXCA 2O2DA 4XK4A 1RQRA 5A7HA 4DN6A 1B1BA 3OZEA 4G1FA 1B3RA 1IU9A 3OQHA 1KOFA 5EKXA 4PLTA 2PO5A 1RZRD 4CEHB 4DJJA 2FG6C 3PZBA 4EX7A 2DBBA 3K7EA 4CF5A 3ILHA 1JN0A 1P1JA 1I7PA 2Z1DA 2O3UA 2UXNA 3AF3A 4MGYR 2NZ2A 3BH7A 2HOAA 1DL5A 4JMPA 2O8BA 3DGFC 2DOKA 1DT5A 1PGQA 1Q0RA 3RT7A 5BN4B 1MPTA 4UMEA 2VPLA 3Q2OA 1Z5WA 1DLJA 3UG7A 1K7AA 5JC8A 1SC9A 1N7JA 3GVPA 2ZYUX 1KSFX 3QYJA 5IAGA 4BLVA 4F52A 2QZ4A 4Y2XA 4FFWA 1C4WA 3HKCA 3CDIA 1NQ5A 1VIDA 1C7JA 1T36B 3K2EA 3TMKA 1D1SA 4ZRNA 3ZWOA 4QHYA 2KRCA 3UMJA 1RP1A 3EYYA 3LWBA 2YMLA 2UXBB 1HO3A 1JLLA 2VRBA 1XI2A 4FC6A 1PYDA 1WM1A 4E46A 1UG0A 1KC3A 4C21A 3AB8A 5A5GA 2XCSB 2HIAA 2BDEA 2Q2OA 1I30A 1KJJA 5CM2Z 3GGDA 4EHBA 3AEUA 2L7KA 4YRSA 4RZ3A 4BMPB 4BUZA 1OVMA 4YX9A 1TEVA 4X1KB 5IT5A 1RYMA 2ISZA 3ZHZA 3N7TA 1P81A 3PXBA 3NFYA 2CEAA 2W6QA 4GOND 2C00A 4UJ5A 2CW7A 3M8FA 2C9MA 2GYUA 5AVYA 2V8BA 2L9VA 2G7ZA 1ZNWA 3PG5A 1JIIA 4XD7A 2ADUA 2VUSA 3R5TA 2WTMA 4K9OA 4DA8A 4YMTA 4KR3A 1SU6A 2LVBA 3H9BA 2VKVA 3GG2A 3AUXA 1LGYA 4Z6KA 1E63A 2Y0BA 1VSVA 3GWGA 2QMZA 3LX4A 4UE3S 4UQPA 1QPGA 2QX6A 1K6YA 3NWPA 3RGWS 4GGOA 2XLBA 2PS3A 5IP9J 1TYZA 3CJQA 5CCBA 1N2EA 1V1JA 5KOJA 4XQGA 1M34B 2PNJA 4ZQFA 4J1TA 3NUGA 5E3IA 1KR2A 2NAFA 3D3QA 1ONNA 4FMDF 5LYYA 3GAFA 4AIIA 1FNCA 2P9YA 1QWSA 3JZFA 5BVHA 1G41A 3OQJA 1SG0A 4RKWA 4MHGA 2BFCA 3MYYA 2VYCA 1K9VF 4KU4A 5DNCA 4PQFA 4B17A 1IRXA 2DFIA 3NNSA 4JR0A 3A3KA 5JQGB 1W4ZA 4ZYHA 3UZUA 5HP4A 1E3WB 4GOXA 1WD7A 5G4KB 3PXCX 5IYZA 4I99C 4JUAA 4XLNF 2G4VA 3IYLW 4BY7J 4DIKA 1NONA 5TT1A 1QVAA 4HSGA 4ARBA 1GOTA 2VHXA 3ZU3A 4RDCA 1FQOA 5ALXA 3AQ4A 1NI3A 5F9HA 2BM1A 3P0JA 5EMMA 1UR5A 1RYDA 1JXMA 2LP0A 5CT9A 1XLWA 1W4BA 1U9ZA 1O97C 1N25A 3L18A 4NULA 1JHDA 3VZPA 2HDWA 4KMFA 3Q7EA 3A0BC 1DGQA 1ZU5A 1WDTA 4NL4H 2YVAA 2AMLA 1C9JA 3FPJA 4N8SA 3WLIA 5L3CA 3RAGA 4BATA 1K7SN 3L8ZA 2LRHA 4RGUA 1A35A 1D0XA 4RPJA 2XNDA 3FX3A 5CMLA 1SKBA 2Q8PA 4LF5B 5AK0A 1GUYA 5K99A 2YFHA 1E0EA 3URKA 1MNQA 4DSTA 2CSOA 1D1CA 1E79A 1RSZA 1C0PA 3VU0A 2GERA 1FQJA 2IZ5A 2JBAA 1QQIA 1E2FA 1JLKA 3ELWA 1NBME 5IDXA 3IUEA 3ETNA 4PLFA 5FJJA 3QU3A 4BE2A 5FGMA 1IMJA 3G8CA 5D6FA 2EYQA 4JX8A 1U2DA 5JNTA 4GOLD 3UMYA 4X0GA 2H65A 2BVNA 2NUAB 1UBNA 5FI0B 4JK1X 3QPUA 5ETJA 1U11A 1U0LA 4NFLA 2VDUE 4W4TA 5HTKA 1QXSA 3ASVA 3ASNH 3FK7A 1TA4A 3FXOA 3LS2A 4PDKA 2YWRA 4B3HA 4YFNF 1UM8A 4YMHA 4ZKEA 4DNPA 1Z13A 1KMMA 1WXXA 1OQAA 3GJSA 3AU9A 3O95A 1KEEB 4BVFA 3D6MA 4F5ZA 3IUMA 4M87A 4TM8A 1FDRA 3H18A 4JODA 3ERMA 2R6R1 4AJJA 2BSXA 3RH0A 3NATA 3T12A 1TO2E 2PSEA 4U7GA 4Y2PA 2QL6A 4AECA 2Q8KA 3OZCA 5KAFC 2XVAA 4LZLA 3T8YA 1OAAA 5F4ZA 3CW9A 2YNMA 3K92A 2GPYA 3K0EA 1WABA 3R3UA 1Q1NA 1KHTA 1M6YA 5A0VA 1NOKA 1KQPA 3TKYA 2VC0A 4IDOA 2V3WA 1XL0A 3NCTA 4BLSA 2SCUA 1JA1A 5D5QA 5H6QA 1E6UA 4J6FA 2XYGA 5G1PA 2Q1UA 1YDMA 1W2GA 2D1VA 1OASA 2B83A 4DZZA 4BMYA 1CETA 5CKTA 3FXMA 3CNBA 3PC2A 2GNOA 4AY2A 3NJRA 4L7QA 4Q05A 4GNRA 4BB9A 1L1FA 3QBEA 2ORWA 2GF9A 1K6OA 4F46A 2EFEB 1UOOA 3KJNA 4M6WA 2HMAA 1YR3A 3HDJA 3DZGA 1G66A 1QB8A 2I9PA 1D03A 5G53C 2XTAA 5E3MA 4MRNA 3GGPA 4WLFA 2PLYA 3UTCA 3JARA 4IRMA 2FLWA 5IP6A 3LQFA 5MN5A 3GELA 5G3YA 4Z6YA 5LP6C 4IWXA 3K6GA 3DOOA 3S1SA 4KHZA 5IUKC 4W1PA 4Q3AA 2IVZA 2ZPAA 3CB2A 4HLUC 1XEXA 5KC8A 4QWQA 1Z6RA 3WRXA 4LVUA 3PNKA 4H6VA 1OXBB 3N0WA 1APBA 1PJSA 3OF3A 4P81A 1ETUA 3TXAA 4C0WA 4KN8A 3IVGA 1DMSA 5FTKA 1EUDA 1JBQA 3OR1C 3C2GA 1WFXA 3MB8A 1L9XA 1N75A 2I1LA 4B1FA 5GPCA 3QPHA 4FKBA 1W6UA 3OLZA 4RMNA 2W8BB 1N1DA 3DCNA 4QU8A 4MDHA 4F11A 1Z7EA 3ZCVA 2JEZA 4ENQA 4E7LA 3DFZA 1JW9B 1YA4A 2YIVX 3MCVA 1DQUA 3N2LA 1PTJA 5C80A 3HP7A 2CLHB 3QVSA 1YFLA 4PSWA 2DHEA 2A2ZA 1X8JA 2HZ7A 4WI1A 2OV3A 2Q3EA 3NNNA 1ZYRF 4A03A 2V45A 4XVQA 4CU5A 2ZJQF 4B2YA 3WGNA 5F1YA 2O5EA 1MMGA 1UEJA 1T1JA 3BORA 4IXMA 1V41E 2PXHA 3W2HA 1UOPA 2AR0A 1KR5A 1FXWF 3C5VA 1N0IA 4FGKA 1QHHA 1LS1A 4WK4B 1JKRC 1N3BA 1QNTA 3EZYA 1XPOA 5M04A 3G3ZA 3O2NA 5IARA 3U5TA 2PLRA 3CF0A 1ENOA 3G2PA 1X8KA 3VR3A 3BKWA 1U2RA 4TMWA 3NAQA 2XSZA 2DB3A 4L4UA 2EZUA 3B78A 2H48A 1AK1A 2D1QA 4Y18A 3A04A 3KLPX 5EP4A 3WYNA 1GG8A 1NTCA 4HEA6 3GLUA 1I3KA 2CXPA 3QFFA 3CCRI 3ESBA 3KHTA 4OJTA 2FQYA 4NJEA 4DJDC 3MWJA 3HU3A 3P9PA 4NBNA 4H35A 3HMQA 4D0SA 1P7IA 1U3EM 4D9BA 3ESZA 4I7HA 1RYYA 4QXRA 1KFJB 1E1MA 1W6RA 3JSOA 4RGYA 2EFOA 1MBZA 1FY7A 1DXHA 1Y7PA 1E1RD 4JJKA 4HATA 4ZD6A 4B0OA 4A6XA 4CIAA 4JUIA 4PLCA 4CKEB 1IMOA 3BMOB 3BJEA 1OAKA 4X6UA 1OLUB 1XTTA 3RC9A 2H3HA 4KR9A 3EGDB 4PHFA 5CFRA 1YASA 1EJ2A 2PIAA 2P1ZA 3U60B 1OFUX 1DKMA 1DJMA 4F4UA 1MMAA 1UUFA 5AXDA 2V7QD 5DSZA 3BL8A 2BFWA 1XGNA 2CGPA 1C0LA 3C1DA 4CPDA 4EITA 1HV8A 3WO0A 3SS7X 1IK4A 3Q8LA 2QRKA 1CCWA 2XITA 4P7BA 4I3FA 2E4WA 1F8XA 1SZCA 2A33A 1FU8A 1TMKA 1E3MA 1KAQA 4YGXB 1MQSA 5CA0B 3LCJA 4XLHA 4PCQA 3COAC 4HS4A 2WSYB 2OUMA 4PS0A 3HABA 1V11A 1ZNYA 1AKMA 3KYCB 1Q1AA 4XPIA 3B82A 1GTSA 4MTDA 2WIAA 4BNVA 2YV1A 1JAIA 3KKMA 5TGDA 2CN1A 4FOOA 4Q4AA 3VZQA 5B30A 3AESA 1M67A 4IWNA 1IY0A 5CGQB 4OAQA 1Z1DA 5JSZA 1RAIA 2QT0A 1QNFA 5JY1A 2C7VA 1XSDA 1MJ9A 3L0ZA 1W34A 1Q0TA 2XQVA 4LYGA 4B35A 3AI3A 4AUXA 5EJ2A 2HQBA 5B6PA 3PIIA 2QVLA 3RUHA 3T7TA 2XODA 3QOWA 2QVBA 2DMNA 4YUWA 1J5PA 4K0RA 3F73A 4K9NA 5EZGA 1MO6A 1HYGA 3MC1A 1RE0A 4B8XA 4MS4B 2JH3A 1PZXA 3FGOA 2B25A 2PYDA 4D3ZA 5DYWA 3E9EA 1CULC 2KMUA 4J16C 1KKLA 3KEFA 2V7WA 3LUKA 4M1WA 1C7FA 4PFOA 1D5YA 2QN6A 4EKDA 4I1PA 2G1JA 2GBGA 3ZWYA 2IVFA 4C3UA 3PNYA 4URUR 1N6NA 2BEKA 4WZZA 3F5SA 3PWZA 3ABTA 5EINA 3TM4A 4ATNA 2ZAYA 4EB6A 1I7NA 4YT8A 1Z6GA 1P62B 1ZCBA 4D1YA 3NHSA 3KEYA 3Q41A 4HX4A 1JHQA 4AO6A 3OIOA 5DHSA 1ECCA 1Z3IX 2ABWA 5LBIA 3MMNA 1B72A 3J7AC 4UEKA 2QSYA 3BE6A 4ZTBA 4L6IA 2JAWA 5BQ3A 2GGSA 1KQNA 4Q1BA 1U9OA 1Y6FA 1QX3A 3AVPA 4RS4A 1UM9B 1Z6AA 3ZVNA 3K0AA 4P5OA 4BU0A 4RPIA 1N36B 1Y9DA 1OAOA 3IDZA 1BC5A 1SVWA 1WZUA 3KUXA 3D7NA 3A0HC 3ORYA 4DC0A 3KT3A 4MUHA 6PFKA 1B43A 1M74A 4BAGA 3GEEA 4V38A 3PEEA 1BXGB 2IUYA 3F8NA 4BNIA 2QRVB 3FVWA 3U7RA 1TM7E 3D8SA 2FCRA 1KU0A 5DHPA 3QVTA 4AFNA 4PCAA 5K4GA 2IKSA 2ZLBA 4YK7A 4LX0A 4EHNA 1BWQA 3BXEA 4UU0A 3TJMA 1YVDA 2Z6AA 5LGUA 1MUUA 1IIRA 1N3IA 2WHEA 4DFDA 4FX2A 4OHCA 2QN1A 5ITSA 4LRXA 4QUGA 3DC7A 1YW8A 1JSXA 2PGNA 4CIWA 3S8EA 4Z0TA 4IHQA 1JJFA 3UT5A 2LCQA 4UV8A 1OFCX 2QQGA 4ZMBA 2YR2A 5F2KA 4E09A 2XWJI 1SB8A 3QOXA 1UC8A 5GV7A 1ODKA 1G20E 1V55H 2P6MA 4G3XA 4LIVA 3FB1A 1OT3A 3GC6A 4EHHA 3RPUD 4M98A 3AUAA 3GCXA 4PPNA 4FCCA 1S7AA 3IVAA 3W8EA 5HX7A 3SSOA 1NHAA 3MBKA 3ND6A 1CTQA 2ISSD 1W25A 2FWMX 3RNLA 4MUKA 5AJYA 3NRCA 4OGWA 1EH7A 4EGSA 4EUSA 1AKTA 4JX9A 1WJCA 2B3DA 4QUAA 4B46A 2GN1A 1OFHA 3SZMA 1I4TD 4IEFB 1X13A 3VISA 4E5YA 1UMQA 2VHWA 2GHQA 1GFSA 3QF7A 1LLQA 1L7VC 5D00A 5AD1A 3X1DA 1IC6A 3RBAA 2H11A 4JLDA 3BXHA 2HA2A 4RVUA 5K3FA 3JQAD 3IEIA 2M8GX 2GRUA 1V8BA 1VPTA 3AJ8A 2ODPA 3K9WA 4RV4A 2IOYA 4CTNA 3H8SA 4UEOA 4NBKA 4RIIA 4INAA 1D0ZA 3K8ZA 2HIHA 4OLBA 2ELKA 1NXQA 3WWDA 2WHYA 3JVUA 2GHTA 4HEA2 2DUNA 4CM9D 4UC0A 4KRGA 4W5NA 3ZJUA 3EMKA 3I3OA 1C8VB 1VQPI 5I7SA 4K9KA 2ZSDA 4WKNA 5SICE 1ZG1A 1NQXA 3WLLA 3S7ZA 1IN5A 1MJFA 4ILEA 2E36A 2AFVA 1HPLA 1TA0A 4MQ9F 1KK2A 5T6MA 1GCOA 3BFPA 2OCCH 2H9AA 3I32A 5HS8A 3BB3A 4EZEA 5HKLA 3ZHRA 4Y33A 1AO0A 2QZPA 2WJ4A 4U3JB 2JK3A 2A9FA 3ONFA 2DPXA 3K0KA 2BY1A 4Q01A 4UD6A 1XZIA 2PCJA 1HNXB 2HQ5A 1QHSA 2ZDQA 3VGPA 3DAGA 1M2JA 2IZ1A 4P33A 4DLTA 1ZQ9A 4I9HA 4UHJA 3S1NJ 1Q74A 4FJ1A 2KPMA 4R8MA 4F9GA 3IIEA 4BEHB 2HTSA 1QYCA 3MD2A 1W2HA 3NS7A 3SVLA 1VBFA 1V5GA 2Q1XA 1LRLA 2D0IA 3PJEA 3IP3A 1ZWLA 5KJ6A 1JQJC 1X2MA 1KL7A 3VC1A 3ZMDA 4PBTA 5BUCA 4NS1A 3FBTA 1SXHA 3NHZA 1EEXB 4CLDA 4BXOA 3HRTA 1PO7A 1KQ9A 3EBPA 1XB2A 3ZQ4A 2REQB 4BKUA 5CFPA 4QRIA 3U6KA 4HZFA 1FUKA 1TKCA 3G0DA 1V16A 1IVSA 3UOGA 1R3UA 3ABKH 5EIWA 4BFTA 1N5RA 4E15A 4EG3A 2IQIA 1WSWA 1FVOA 4AWAA 1GL6A 3PUXA 5JH7F 2CUTA 1TC2A 2HJ9A 1DTSA 1KJNA 2XNJA 3FBIB 5C4MA 3LVFO 1H3EA 1P2TA 3BG9A 2Z8YA 1W4MA 3MS2A 1M2OA 1VJTA 2Y66A 1B8NA 4R6WA 4UNQA 1J09A 2EG5A 2C1EA 1TVKA 2HF8A 3DV0A 1CZRA 3LF1A 3B1ZA 3IODA 1J25A 4EGJA 1V9LA 2BKEA 2PI0A 2ZKZA 2Y2UA 3P71T 3KE8A 3NM4A 4R69A 1J8DA 2P5SA 3L77A 1XDDA 1JKPC 2G82A 1F0NA 1M2GA 4H16A 2Y1KA 2I99A 3K0CC 4DBLE 3J7ZI 2I2BA 4TMVA 3C1OA 4L5EA 1T2CA 2UV8A 3GDHA 1T56A 4ZTZB 2HWKA 4B4OA 4ZOAA 3FR7A 4XH9B 4R01A 1GNQA 3D7SA 4YRRA 1V9CA 1B14A 3FLAA 4I0WB 4EYEA 5CM9C 2EJWA 2B8EA 3U81A 1QE3A 5D5UB 5E7JA 5HQJA 4JLKA 4KEAA 4PZAA 4TZ0A 1LFBA 3E03A 4XJVA 2PZFA 4AYTA 4R2IA 3PQCA 4LXQA 2JHFA 3TYXA 1N9ZA 3RVLA 3BFXA 4NC8A 1KZ4A 3CX8A 2Q7OE 3R76A 2WI8A 1RMTA 2EKBA 4AMGA 4JJZA 2WHQA 2WLSA 2XF8A 2GJ9A 4B9AA 1HLFA 3AH8A 4R9RA 3LU1A 3OYCA 2R1VA 4YONB 1YZYA 4BFCA 5HVNA 4YELA 3QW2A 3EUHC 4QJ4A 4NBLA 3ABIA 4MR7B 4HAWA 3VO9A 3F6CA 3JYLA 1ODFA 3IQDB 3ZN0A 3FVRA 1C1HA 4AMYA 3AIKA 1TTPB 4OQMA 3WIVA 1G5IA 4ZJUA 1U8BA 3ZLBA 3PWSA 1VKJA 4YUZA 5FBKA 3UICA 3IAAA 2UWMA 3OPYB 2V65A 2CUKA 4BCDA 2Y6UA 1OCRH 3G23A 2NXNB 2GB4A 5IKPA 3CC2I 1G2OA 2O14A 4YP5A 5M2QA 4NJMA 2JIRA 2A0KA 1YUNA 5E3LA 3BJMA 3U0BA 1B8OA 2Y27A 4KX5A 5FP0A 2GKGA 4K1XA 4D8VA 1F3OA 4O4JB 2HSWA 3AVYA 3M5CA 4M0PA 3TWOA 1JQBA 2MC4A 5AKYA 3CSSA 1MP0A 1WY7A 2RREA 2X9VA 4ON0A 2A5LA 2EWNA 4N3AA 3LA3A 1CHDA 3CS3A 1OKKA 3DXXA 4ZHQA 2VZLA 4II7A 1RFGE 3PWKA 4MVJM 2VHZA 4OB7A 1M6VB 2PZEA 3I56I 3C8UA 1EH6A 5DNUA 3AHCA 3JD1A 4RTNA 2IXTA 2QGFA 2H08A 2G5TA 3QIVA 5FA5A 2BFFA 3W5BA 4WK6A 3G17A 3OYBA 2OFXA 3GNLA 3GPBA 1GCGA 4LECA 2XKOA 4PVDA 3SGLA 4M0CA 4B7UA 3MFQA 2JIPA 1U5TA 2W4SA 1JHXA 2AKYA 1GNPA 4CMGA 1N7IA 1K7EB 5TPWB 5GTDA 2DULA 3OYKA 3CLTD 1SAXA 3U3DA 4L9SA 1YE5A 4TV8B 1FOKA 3U2QA 1FYMA 5BSRA 1EFAA 2GZAA 3I30X 3E81A 2G7MC 2XTMA 2HF2A 2ODBA 4LOHA 2FF5A 2APJA 3MSCA 2D5VA 3W3CA 4AG3A 4KDEA 5T6BA 2QORA 2COUA 2FR8C 4MULA 1ZM9A 3S1QJ 1QGAA 1UADA 1TYAE 1X7DA 4D9CA 3DMGA 1W36D 2WJJA 2A5DA 2DXIA 3BXPA 4Q18A 5BYKA 1GDHA 3HUEA 3V5NA 3L1UA 4V0OA 5C32A 4I8IA 2XB6A 3ORSA 2JFNA 1DBQA 2BFBB 2QYHA 1NUTA 1TQDA 2JJQA 1X9GA 2PMFA 1PUFB 3IGFA 3PUYA 4OBEA 3WAKA 3MAGA 1NXWA 4LOJA 3QMWA 4OF4A 2FPUA 3N6VA 3RIXA 1Z4QA 1DDOA 1L5VA 2JF0A 3A3PA 4J0CA 4PZYA 3L4BA 4PZEA 3A31A 1EIWA 4AJ1A 4F38A 5JOQA 2W8ZA 1DHTA 3CVJA 2A0UA 1S3IA 1N8NA 1CF7B 1FC3A 5DS9A 4CGZA 1RJ9A 1WXFA 2O5VA 2Y71A 1UFKA 3MCUA 1YKFA 4DM3A 3CEAA 3LDGA 2IXDA 2I6UA 2CNLA 1ETOA 1CF2O 3WBJA 4EA9A 1BVUA 5JDIA 5C5CA 1H6AA 4HNGA 1S3GA 3Q6IA 4F9TA 2OTCA 2B1RA 3A8TA 1YTLA 2BGCA 2DQSA 2ECQA 3PFGA 4ZVNA 3VU9A 2W2VA 4LTMA 1PG2A 4HF2A 4XLLA 1UFOA 3P26A 5A7GA 3O2QB 2JI6A 3V1LA 3GVAA 2P5TB 1QFYA 3GLVA 3J7AY 3OL4A 4TYNA 2YOGA 2AL7A 3S32A 2V7PA 3KXLA 1HFJA 1J2TA 3NUQA 1Z4IA 1XGSA 2Q5OA 9ATCA 2BOVA 2Q6LA 2XWSA 4KREA 1AURA 5IKEA 4FSHA 3COJA 2A4KA 5DSXA 4QJ3A 4HNVA 3N0TA 4EATA 4OIQF 5ALRA 5JIBA 4M54A 2B21A 3WP0A 1LBEA 1LDEA 2PNFA 1R58A 3IE0A 2H2WA 5JNLA 3MKWB 4ARAA 2GYWA 4COKA 3PI6A 3FOCA 4CJXA 1UMBB 3DV9A 2OZLB 3LUCA 2X6XA 1K6EA 2B63J 2XGXA 1CRWG 5LQCA 4TT3D 5T7BA 1KGDA 5G0TA 3NVAA 3TOZA 3JQAB 2XVZA 3AHJA 2F3SA 4H18A 3BTVA 3MN2A 2FZKA 2IP1A 3IOEA 1NVEA 1XEFA 3M6MD 2J1LA 2PCLA 4N8DA 1Z4MA 4Q3CA 2RE8A 5F7JA 4EQ6A 3OKFA 4JCOA 4PR0A 3B70A 2R6FA 5FHQA 1TM2A 2NU6A 2CXHA 2KIQA 4HV6A 3MNFA 1H9GA 3DBIA 3BJZA 4YFXF 2DYKA 4OXRA 1OKRA 16PKA 2A1IA 3WKDA 3F3YA 4IXNA 5GZ6A 2D00A 3VO1A 5HM6A 1UAGA 4TQ9A 4IH4A 1KYIA 2Y0CA 1Q3KA 1TADA 3K09C 1JU9A 3WG9A 2X4LA 1A6QA 3GN2A 3WGMA 4NYMQ 3N1UA 5JASA 3WU2C 2I7DA 3AUYA 4ZARA 4DZJA 3WSTA 4U9IS 3CLSC 4PC1A 2B98A 2WK1A 4MWGA 1O95A 2QD5A 3SZGA 3BWBA 1W4AA 1EGVB 5J5AA 5F0CA 4B6SA 4QO7A 3A6HA 1YZLA 3QK7A 4MWOA 2LF8A 3K4HA 2VYNA 4JBYA 3DWFA 3V4PB 3MWEB 4OQPA 2XMZA 2VPIA 3SC2A 4R83A 3NBUA 4UMDA 3KL4A 1N8SA 2G9QA 4BNLA 4JX6A 2Y6VA 3RYTC 4B1RA 3T5BA 3ON5A 2KLOA 2MMGA 2I34A 4UZSA 2VAVA 4MQ4A 5LOVA 1B8IA 5J1YA 4DLRA 1LPSA 2X8AA 3GFSA 3ZQKA 1WPKA 4GAEA 3U4DA 1VQ4I 1YJNI 3R8XA 3KVNA 3ZJ5A 4N5DA 4N6NA 3ME5A 3DFKA 4ZAXA 1E7MA 3D6HA 4X8LA 2BGLA 2A6HF 1GIAA 2QRHA 3HOZJ 5DBIA 3EOBI 4TUYB 2IZ6A 2D5IA 5AW5A 2H7YA 2H8KA 1NC1A 3ETLA 4RL4A 1QBGA 3I4FA 4IIYA 1MB3A 3I45A 3CZ4A 3SZPA 1XTKA 1REPC 2OLEA 2PUDA 1BTOA 3ZHOA 3UJ6A 2NU9B 4F1KA 4IS3A 1KU2A 3DYIA 2OBMA 1GGJA 3T5TA 2B35A 3RF7A 3SDZA 4I14A 4PAOA 4DNQA 4JXZA 4HL6A 4KXMA 5DVZA 1KOLA 4F9EA 4NZZA 1CY1A 1KFKB 4MDFA 1EFUA 3BD7A 2MBFA 3RHTA 4BP9A 3JAKA 5MN6A 4XB2A 3VKGA 2GARA 5HZMA 3RCBA 5AUPB 3FUTA 5HFJA 4AU7A 1EE2A 1M1YB 1ZQ3P 2P8JA 1TCBA 2PXCA 4PN7A 2ZNZA 2ZQZA 1VFPA 5CBKA 2IPOA 1T43A 1TAGA 1RAEA 1AWCA 4XKVA 1TNDA 2G76A 2PRZA 1U3CA 2QQ8A 5K8CA 2KJQA 3KC2A 2YJZA 2QTBA 3BB1A 4IQ4A 4MKXA 2A14A 2NYRA 3F78A 4J90A 2PMHA 2VF4X 2JIQA 1WD5A 3G85A 2PKRA 3VBCA 1YFZA 5AW7A 1NJFA 5AHKA 3DLLF 3ED5A 4EY8A 2WBMA 2LV8A 3BILA 4MUAA 1FIPA 3F6OA 4KTVE 1BRTA 3QEBZ 3EBOA 4S05A 1XNGA 3HXQA 2PBIA 1REQA 4HO1X 3UXMA 4J7AA 1OU4A 2XUQA 5LGNA 4C0BA 3TOXA 2ZBRA 1GU7A 4P22A 4CM7A 3RI3A 1OXVA 1QHXA 4DLZA 2FMUA 3DCYA 3T9EA 1NHGA 5KDOA 2VSNA 2HB6A 4WCFB 4YUYA 4ZEMA 4NC9A 4AZVA 3OQBA 2JA8J 1VSTA 3HXKA 1XN7A 1VL8A 3OECA 4RC9A 1JGSA 4BVEA 2L4MA 3ZHXA 2QBYB 1IM8A 4M89A 3KVRA 4UM7A 5CITA 4UEQA 5ARDA 4D44A 5IT9Z 3WLRA 2DA5A 4H7KA 1MDFA 5JO0A 5GAGJ 2WF6A 1PNVA 3UXYA 5REQA 3ZCQA 4BFLA 4RULA 1UKEA 2W6JD 2BTOA 1E1CA 2AVNA 2NP7A 1MH4A 2IUEA 4OP2A 4R31A 4XVCA 1T9DA 2OV2A 4QYSA 4IXWA 1HT3A 2ZSJA 3QE9Y 3LSHA 1EP3B 3MXOA 2RK6A 3L7KA 1SOAA 4IV0A 2DEUA 1UP6A 2XHZA 4JEHA 2RN7A 4EJOA 3WQRA 3LUDA 1H2EA 5ITWA 2VPWA 2DMRA 1XFAA 1E1KA 3LXXA 2QAGB 3NWEA 1OCEA 4CQMD 1QCZA 2AI3A 1KY5A 4EHDA 2RK4A 3NT5A 3EXHB 4PZLA 1NR7A 3G02A 1ZUNB 4Y6PA 4XOIA 2OC4A 1G2IA 1KEZA 3PFKA 5FB3A 1SKAA 3MGGA 1N2CE 1WRJA 1QVUA 1I1QB 2VPQA 3I73A 1GL3A 1XAGA 3IV9A 3WGZA 1MX9A 1IXKA 1TUEA 2YV3A 3RRBA 3E7LA 4YIIA 4WL0A 1MT0A 1UKCA 5GZ3A 4F4CA 2R92J 1UIMA 5E20A 2VT6A 4JEMA 1LV8A 5EJFA 4IQ8A 1MABA 5B3KA 2E9SA 4D8XA 1NU6A 2XCOA 4HF0A 4WOBA 3PHGA 4A91A 3HOTA 2L82A 4QX6A 2DDBA 4LBYA 4A27A 1V6AA 4BL5A 3BIWA 3PUKA 1YJXA 3EMVA 4HUQB 2BBSA 1LDBA 1Z07A 2D5AA 5BY2A 1DOAA 1BMFD 1YCFA 2WIGA 5SZHB 2JRTA 4MVCA 3S2WA 3ESRA 3K0SA 1CV2A 1TL7C 1G60A 1Z6YA 3MLBA 3LYAA 2OXIA 1N77A 3PD7A 5BWMA 3QYBA 1T0BA 2X6YA 4PLWA 1YZTA 3EGXB 3VHRA 3PT9A 3M7GA 2WIJA 5I8WA 3LAWA 3CE6A 1MDMB 2NPOA 3QBVA 4DJ5X 3WHPA 4N48A 4LG0A 3GIWA 4YR9A 1E96A 3RI4A 4ZO9A 2L0KA 1DGRM 4OYRA 2M7BA 1T38A 2ORIA 5D2CA 4UU1A 2VAMA 2E4UA 2O8DB 3JYHA 3ER6A 2FRDC 2VPPA 4N4NB 3VH1A 2VC1A 2C4NA 2ONKA 1E62A 3OJEA 2OUIA 3W6KB 5DI3B 1JMKC 1MG5A 3OEED 1S2MA 1RIFA 4MQEB 1EDZA 4OLJA 5TQJA 4GBGA 5LA6B 4TMZA 1QP7A 4K6GA 5AI9A 4HBZA 1WJAA 2VK8A 1MHPA 2C2HA 2IYQA 3S99A 5C7YA 4UOQA 3GRYA 5MFPA 3PXAA 1NVMB 4CHTA 1YE9A 2CJYA 2JAHA 2IBDA 4WK8F 4DEVA 1SKYE 2CQ7A 5AI8A 2IBMA 4HADA 2XASA 4EPYA 2QUAA 3U1BA 2C1ZA 1X58A 2YIDA 5FKNA 2WKPA 2POCA 1L3IA 5TGTA 3TVTA 1JDJA 2XD9A 2P9HA 2WJ6A 2H92A 3V4OA 4DCVA 5GIPE 5IYBJ 5J2TB 1A31A 4K5QA 3N59A 3ZGXA 7REQA 4MWCA 3AJAA 3OM1A 2QGUA 1MQ9A 3VVCA 2JGRA 1QPZA 3GHYA 5HEKA 2CLLB 4L95C 5C81A 5IEJA 1UWCA 4E7ZA 1SN7A 4ZZ1A 1YL6A 2VDVE 5HF8A 4V0QA 1IBSA 2C2OA 3K6SA 3NHKA 3LBAA 2EFNA 2PVSA 1JI8A 3JATA 4RK1A 4PHCA 4YV2A 5LXTB 4V1CI 2YVUA 4U9HS 4YJ2A 2P6SA 2ZT7A 3BX1A 4N39A 4WK0B 3BG6A 2VNJA 4ZVSA 1HH4A 1K8XB 1RNLA 4DIQA 1R6TA 2Y1GA 3K16A 1TDJA 3RYCA 4BVAA 3R7AA 3SXUA 3DDOA 1T8TA 3KKZA 2HQOA 4UDYX 1UJ4A 1XJQA 3T94A 1BRMA 1PGJA 2FXIA 2O7SA 1ZICA 4PO3X 3I0ZA 4Y0NA 2VEDA 3I0MA 5C8ZA 5E2AA 4RAZA 4PX5A 4XOUA 2FEPA 1SOVA 2X8JA 1R16A 2NQ2C 1ZGJA 2DFLA 2MMCA 3N8IA 4XSGA 1T6ZA 1GTG1 1W5FA 1T26A 1J0RA 2BYVE 4HB2A 5IN5A 3PSHA 1RYEA 1JVNA 3K4CA 5FI1B 2WAAA 9GPBA 2G5GX 1FLIA 1Y1VJ 1RLMA 3CCFA 1CDOA 4RVDA 3UHJA 4O2BB 4E5SA 1CE8A 4MA5A 4EM1A 3MWDB 3H8JA 1A9XA 4V24A 5HZKA 2R65A 4M1OA 3P5JA 1RS0A 1M2WA 3FYUB 4HX9A 2BN4A 1YL7A 4DV7B 5E8JA 1UL1X 4ZT3A 2VXDA 4JEIA 1ZBQA 1I50J 3UHFA 1WXWA 1NNLA 1UPFA 2V5UA 1Z5VA 3ZE7A 2EINH 3TQRA 4UXJA 4E5VA 4DNXA 1MQAA 5IU6A 1VBMA 1RXWA 4N1AA 2QENA 2J7KA 2J3HA 4QRDA 3LX5A 5FV7A 3L05A 1BJAA 2J31A 2PUHA 5EIHA 5JD4A 1EFPB 1K0FA 3HYSA 2CVQA 3J81K 3A1UA 4PYNA 2IODA 4V1CB 4Y9UA 2FTKE 1DT3A 4F93B 5P21A 5TJJA 3O93A 4MIMA 1Z8FA 3PCXA 2ZJ5A 3GL9A 1W2WB 1YHNA 1F36A 1PSZA 2GJSA 2O0JA 2PKCA 4HVTA 4Z9XA 5F5XA 4RESA 1V1RB 3VHXB 4GQAA 5A71A 5JV5A 1AKVA 4LXXA 4TVKA 4L3WA 1M6WA 3U3MA 4I6EA 1R1TA 13PKA 3F49S 4BJTA 3TRIA 3ZPXA 4E30A 2C5AA 2H2IA 2IH4A 4EJVA 2XKAA 3P5BA 2ZJRF 1RR6A 1QPBA 2YXEA 3RSOA 4JH0A 3NC1C 2H17A 5DLEA 1KY3A 1NLFA 1CR4A 2H1HA 1BE0A 3F9RA 5GADJ 4CW7A 3BTCA 1H2YA 2AJDA 3NWOA 2Q3BA 5CLGA 1PFWA 1Q12A 5CD9A 1RC8A 1X74A 2O50A 1SGWA 1ZL2A 2JFBA 4DIMA 1U0HC 2ZWIA 1R18A 3TZKA 2OXTA 2ZRBA 2FGJA 4IVPA 5D5PA 2R7OA 2QMUA 5CUQA 3RC7A 5FAKA 2NSHA 3I3SR 2WADA 2W6CX 1ZBDA 1NWCA 4NMHA 5JU6A 2XRNA 3AO0B 3SC4A 4BDZA 3U4GA 3LT1A 4OX9B 4K8OA 3IAFA 5DLDA 1N78A 3CISA 5C4JJ 1UPCA 1HM5A 3B1FA 3GDGA 4CYCA 2WAYA 1M7HA 1ACMA 2VNSA 4OBBA 1F38A 3F7OA 3HSFA 3OCZA 3VC2A 5F76A 3RTEA 1J0CA 4CR8A 4Z4FA 1X1DA 2ZTHA 3BL5A 3RTGA 2WWRA 3CEHA 1NPDA 2ECBA 2IPAB 5DM70 1Z8NA 2AQFA 3GCMA 2WV0A 4RACA 1YK1A 5ILOA 1LPQA 1Q3HA 2K7ZA 4IIBA 1OXMA 4ZU1X 5CH5A 1APLC 4LLNA 4B48A 2ZJBA 3UMFA 3SICE 1YITI 2HLHA 3OSUA 2W4MA 2YN2A 1SC7A 4LK1F 2AWNA 5ERIA 4L8WB 2W2XA 2PIDA 3LCUA 3GJQA 1Z75A 1FFAA 2R5YA 4R16A 3E9QA 2R7QA 2IAIA 2WKRA 4BQRA 1DX4A 4YN3A 4MAFA 2XSJC 1G98A 3OHPA 1MV8A 2LDXA 3QXXA 1NH3A 3PE6A 1RAAA 3QE2A 5KEIA 2DTEA 1C80A 4JYZA 1XVVA 2KDZA 4NG4A 3TD2A 4C05A 4LS3A 2I4NA 3V1NA 4CM4B 2HBQA 4KIGA 3QA9A 3F1LA 1Y8QB 4K26A 4FWIB 4RIFA 1IZZA 1UEIA 3JVDA 3GEDA 3PFNA 4WESB 4FWTA 1BEEA 3CP8A 4D0LB 2CJWB 1IY2A 4CQMB 4E07A 5JMWA 1QYWA 4DZTA 5ITVA 1NG1A 2W48A 3QOFA 4CM6A 4BBAA 1MBKA 1MX3A 1FNMA 3H2GA 2FW9A 3NIBA 4LSMA 3G9XA 4YG2F 3T1YB 1HL7A 3DO5A 4RHEA 2XAUA 3VNAA 3WTZA 2EDCA 1FDOA 3FCAA 3E5XA 5EUQB 1JWBB 3PNVA 1PDOA 1KQ0A 1TF5A 5JWHA 4B4CA 3RBXA 3L06A 1JEQA 1NQUA 2LUOA 5CDGA 5C31A 4HPJB 2HK7A 5FBWB 3FXUA 2WVAA 4HNHA 2PVCA 1FOYA 3M1AA 5KJEA 3NEPX 1LKZA 3VR5H 2HU8A 4DBRA 1HKHA 3QXGA 4EENA 2FCAA 4RW0A 4CMJA 1ITYA 1R10A 4Z4GA 4DBZA 2O4UX 2R7FA 1Y8RB 5JS1A 1G8XA 4INPA 4MVJP 1ZD2P 3VSDA 3C3PA 4XX1A 4HY3A 1IZYA 1U9CA 1N2ZA 1SKUA 2C99A 2X5XA 3NO4A 2BL4A 1CY8A 2FDXA 1Z2AA 3FETA 3MAAC 1J33A 1SXGA 2O07A 3PXDA 3IH4A 2DFVA 3UWMA 3FYTA 3U9LA 1G3QA 4NV0A 3COWA 2QIOA 2W2TA 1BE8A 4Y9DA 5K7ZA 3S0JA 1X8XA 1JT0A 4GXRA 4IHWA 3KZMA 1AM4D 5H9VA 1IN1A 1XXHA 4IXAA 2HRQA 3W5AA 3KLOA 2M4GA 3DMFA 1XRRA 1QG4A 4IUCS 1SUWA 1COWA 3V4FA 1QQBA 1OTYA 2KBFA 2OFOA 4DLWA 2G1AA 4EJSA 3PA6A 4OXIA 1IQUA 3PEYA 2XUAA 3X44A 4X20A 1X92A 3GB9A 4NAUA 3IT1A 1W9MA 3LCCA 4C4OA 3EUWA 3QPWA 4TXLA 1NVUQ 2E1RA 4AVPA 1MR3F 1YZNA 4M36A 4LGCA 4CYMA 1OCPA 4NC6A 1JR3E 3TSAA 1G21E 1R9TJ 4PE5B 1Z7LA 3V8KA 2HRBA 1PUJA 3T7CA 1ZJ4A 1CX9B 1QGOA 3V8MA 3A01B 2JARA 1QVZA 3TLGB 1SQ5A 3H1PA 3U44B 4ER6A 3IAS6 4IOMA 3OICA 2A5FA 3KJGA 4N0EA 3B13B 3AHGA 3HS3A 3R20A 1ZGWA 4BPBA 1SFKA 4JOCA 3GFQA 4ND5A 3WNVA 3TQIA 2DVMA 3BPXA 1K75A 1BH6A 4YRDA 4YHHB 4OI4A 4K2EA 3PJGA 2RJOA 3DPTA 1CJVC 1P1IA 1O9BA 2QPLA 4DW8A 4CICA 1RLOA 1G4UR 1W88B 4XX0B 3AVQA 1QX4A 3O26A 1E5DA 3I37X 3HEMA 2CWEA 2EBHX 3H3VK 4CCNA 2OF7A 3BH6A 3VYSB 4IO1A 5FPQA 5E3OA 4UU8A 1T5LA 4KJXA 5HKKD 1RPJA 2K02A 4PICA 4KXWA 3F6PA 4OQQA 3F6RA 4A0RA 5B7QA 1OI4A 4E4HA 5K0SA 4GPD1 1N32B 4EPRA 4MR9A 3BA6A 1U8TA 5DDGA 4I36A 3MWLA 4H3HB 4NZNA 1R49A 1OBVA 4HXGA 3BTOA 1FMCA 3P4UA 1OLSA 2IDZA 1QTNA 4CL3A 1WCWA 1H05A 1YQDA 5ITZA 4I46A 2XEDA 3TTXA 4JXKA 3K70C 4D99A 4KMMA 3EFOB 5EJ6A 4C04A 2II6A 2Q2VA 1D2HA 1R6XA 5JADA 1IUOA 2EGGA 3KWMA 1TPZA 5ILQA 2VT7A 1RPTA 2ANBA 4BJ6C 2WVGA 4LRSB 5C1DA 2C7PA 5CNKA 4N4OB 5DISB 1ZLYA 5CG1A 2A8YA 3CUQC 4ZI7B 3M6VA 1IBCA 1JG1A 3H0EA 1MOPA 2J5PA 2VCHA 4QPQA 1KZ7B 2XDQA 1JEYA 1GVDA 1Q1ZA 3A36A 2XKKA 3CUUA 3GRUA 3JYOA 2YRFA 1TZ2A 1IONA 1WULS 4UTPA 1QDEA 3PLAE 2O8CA 4MGKR 3AINA 5KKCA 4HZUA 3RROA 4GZ3A 3PICA 4RZQA 1RUOA 1CY4A 5BV2P 3DDSA 2Z95A 2IHBA 3SEQA 1L9KA 2Z04A 2JZCA 4BP8A 5KBYA 4YYZA 3WYDA 2YX4A 2IXEA 3GTJJ 2WT9A 4DJAA 1T0HB 4BPRA 2PA3A 3HU2A 2XQGA 5TEVA 2GJAA 2WOOA 2GBFA 3DEHA 1K61A 3ND5A 3UUFA 3M83A 4ZAGA 1PP8F 3SBXA 2GA1A 1Q1EA 1UBTS 4JBGA 3OYAA 2XXAA 5JRZA 3ZUGA 2JFVA 4F04A 1JH8A 5EJ4A 4NLLA 421PA 4R1NA 1QTQA 3LUJA 1LH0A 5C35A 1P0IA 1UAAA 1R6AA 4DV3B 1KJWA 2X0IA 4WVLA 5EE0A 2YWEA 1TJ5A 3ANYB 5ICFA 2BD0A 5JW6A 2GOYA 5DH9A 2CNWA 1NVXQ 4NV3A 4YJGB 2V7FA 7ADHA 5EHGA 1CNFA 5A4DA 1S8AA 4OGKA 1E8DA 3B53X 2YHUA 1XTPA 3HBJA 2WHPB 3FDYA 3C3EA 5ICGA 2W85A 3W90A 1X1AA 4TSRA 3PP8A 4CQLB 5KS2A 3JD3A 1E3PA 5A3VA 4XYEA 4OHRA 4DMGA 4O4LA 1M7GA 4DBLC 3B38A 2IUUA 3RARA 4QBKA 5BSEA 5T3YA 3VRHA 1ONBA 3QHQA 4UHBA 4WH0A 4D5GA 3QKTA 4QNMA 1PLLA 4B9EA 4Z4QA 3JZAA 2VUMJ 3AY7A 4HQ6A 1ND5A 2DR3A 4A16A 3V7UA 5JLWA 1R4ZA 1W5BA 1RZVA 4A8TA 5AQ1A 4PWYA 2HBYA 2RAVA 1PFVA 2QP3A 3TVYA 4XR6A 3A6FA 4BLRA 3R7FA 3I42A 4YREA 1TMYA 2NUPA 1UQTA 1VJGA 2PMEA 3DWGA 3M4XA 4HAOA 2F1RA 3QQPA 1XTIA 3Q3CA 1TZJA 4IX9A 4RGSA 1NK3P 3DKRA 2IYVA 1OF1A 1U8RA 1V4RA 2R47A 3N2YA 3OYNA 3B3FA 2NUTB 3JWGA 3LGAA 1ANKA 2RAPA 2O3JA 2I1VB 2PG3A 2XUOA 3SSNA 3RUDA 5LBUA 4KIUA 3OY9A 3S4YA 4CM3A 2OFPA 1CU1A 1SK8A 4MI6A 3KS9A 3OFJA 2JJYA 2QTFA 1D6NA 4WOCA 1KGSA 4PFPA 1K89A 2TSYB 5EJAA 1BMTA 1CVIA 5HRUA 2L0XA 2Z5GA 1XWIA 4DM4A 1WG8A 1HXDA 3QKRA 3CQ9A 2DFTA 3VM6A 4U7BA 1F4KA 3MILA 1G4DA 1N2XA 3NOXA 2ZSKA 1E9AA 4EHIA 2JJMA 4P1ZA 1CR1A 2OAGA 4L9AA 5NULA 2DOFA 2VJJA 4HDUA 4OINF 3X3HA 5ALDA 3O1IC 4R3NA 4DUYB 2JVGA 1T3GA 4RHCA 3E27A 3G2MA 2IF0A 3DF7A 4Z3OA 3LPAA 3L6EA 5E1ZB 3RB8A 1QDUA 2UKDA 2I6SA 1RE1A 2QGZA 1PT5A 2QRLA 5J4HA 3WYAA 1MF7A 2B4RO 5HHTA 4XTCS 5KOYA 4JU9A 1KIMA 3I61A 3HKZA 1DG9A 2WZCA 2MLGA 1RWPA 4Y1RA 1EB9A 3TDKA 4CE6A 2I76A 5E2IA 1XJ5A 3KZKA 4B3TB 2LD4A 4Y0AA 4U5QA 1BWSA 2W2NA 1MRZA 3G13A 2RBKA 1MW8X 1ZIOA 4HFRA 4HDVA 2QJTA 4LZJA 2C82A 2LY1A 5TS3A 2XJ9A 4QYWA 1NR5A 2Q21A 3Q2KA 4QVGA 1EVKA 3VSKA 3IAS2 3HB4X 1FTNA 1Z38A 2I33A 3OIPA 3V6LA 2XPUA 5EP1A 2JH8A 2R84A 5KNDD 1P4HA 4CMEC 3MQ0A 4E3ZA 4ZRMA 1M34E 1XF9A 3JQFA 3CPSA 4G0VA 2H1FA 2PX6A 1XRSB 4YRMA 3D3EA 2QMOA 2Z2YA 3DNFA 2M3AA 1D0IA 5B57C 2P3SA 1MH3A 2NNYA 4MW2A 1CQZA 5IAKA 3ESDA 4EVSA 4J7XA 4QTTB 2I80A 3CRVA 2QTMA 1SCUB 5K8TA 4KFSA 3HHHA 2HXOA 4DQVA 5BO5A 2X9NA 2L2QA 3BN3A 3E18A 4DV1B 3PQDA 4KMRA 4BV8A 1RKBA 3F8BA 1VRVA 5EJ8A 4DCGA 3H2KA 3ZD8A 5FNVA 5DGCA 1MMFB 2XH8A 3O8QB 3KQNA 3AVWA 1VXOA 2B4TO 2GOMA 3EA4A 4Y2HA 4JI7B 3K72B 5CDHA 3FROA 1DKPA 3LNQA 2G7UA 4KQEA 2UZ1A 1QDLB 4M73A 3H0DA 5CA1F 1Z67A 2HKIA 4F3YA 1T39A 2IY7A 4Q4JB 3ST7A 4UUMA 3PGLA 3KQVA 3OOWA 2O2GA 4KGVA 1NUHA 1GRCA 4ZDKA 4HSRA 5BSWA 5KNCD 2QVZX 4KXXA 3BQYA 4LY9A 1ZTRA 1V9SA 1K08A 4Z0HO 1EJ0A 1G6Q1 5FUYA 5DN9A 1L8AA 1L3CA 1NW8A 4O6VA 3PUJA 5AFSA 4PJ0C 1XWFA 4ZZLA 3T54A 3NM6B 1H93A 4EZBA 1W73A 2BFNA 3KE9A 3UH1A 1RHRA 2QSJA 2JVIA 4OQEA 5JNVA 5HWSA 3IMEA 5D87A 1USVA 5AVSA 4XFKA 1PZNA 3HZJA 3LC7O 2FV8A 1V35A 4J0KA 3C7DB 5YASA 2R68A 1RC1A 5C34B 4U00A 2VJDA 5CDSA 4HN2A 5BS6A 4X61A 4O4IB 3JRAA 2HM7A 3SZUA 2FPGA 2Z83A 3OPYI 1PJZA 4L9JA 3ONVA 3EAQA 4K3VA 3HDQA 3QX3A 1HURA 2ZUWA 2OT3B 4GEGA 3L2RA 1OPCA 2QZSA 1L5YA 2OHVA 3TNDA 4MINA 3D2BA 4Z1MA 4EKYA 1BN6A 1I94B 5BMVF 1B6GA 2NU7A 3IBYA 3C7CB 1XCOA 3SVTA 2Q6IA 2FOKA 3K0HA 5HRAA 3PQ5A 1ABBA 4JKYA 2J0EA 1M8FA 3E84A 4KHPB 1WVRA 4IEEA 2GCNA 3VOEA 4Z49A 2XB4A 4A4DA 1DVRA 3QWAA 2OECA 1K3FA 1J9IA 1FRVA 1P3JA 4DR6B 2WZBA 3WL6A 1DAKA 2XMPA 3ZY3A 3DTYA 3I9V1 4ZAWA 2VJYA 3ZMTA 4BFVA 3PR2B 2AFIE 1Q83A 3BFVA 3INYA 2VUIB 4PBSA 3BR0A 4JT8A 1U0BB 4K81B 5LM3A 4BKQA 5CCXA 3EARA 4ZJPA 4CL8A 4P4SB 3K1AA 5LP1A 5M5BA 2WJVA 3I9JA 3NHRA 3J81A 2X2EA 5AOBA 3ZY4A 1BIAA 1MEOA 4CDNA 4FM9A 1Z25A 2JPCA 1SHKA 1ZG3A 3IQGX 2W58A 4OMFG 3OJXA 2X2OA 1EX6A 3WQBA 4QATA 1JFFA 3HNPA 2YZ2A 3FVQA 4UVBA 3IB3A 2ZI4A 4QXPA 2ZR7A 1QKJA 3IKVA 1TT7A 4G0UA 2ZR9A 3EB9A 3HJNA 1WY5A 5H4GA 1RPNA 4DYRA 1Y6GA 4OJQA 4LZWA 1TL8A 4I4NA 4WOKA 4C6TB 1FSHA 1MAWA 1OXUA 4B7CA 3ZDCA 4YAJA 1QO0D 1D6SA 5F5NA 4D92A 1R0KA 4P0PB 2OKCA 5JZMA 4RVGA 2PV7A 4PG7A 4TS9A 2BTQA 4BYMA 3X2SA 5HGXA 2NOAA 3U4QB 4J01A 3MXTA 2DR2A 1EQ2A 3GZNB 3RG2A 2A9QA 1E0DA 1AUXA 1M75A 4D1QA 1PQUA 1ON2A 2J45A 2BGIA 4KRFA 1W7PA 3UENA 1DUIA 1CEEA 2UYYA 2AEFA 2E7ZA 5JCOC 5B3LA 4M1YA 2QLMA 4M1ZA 2BRUA 2VL8A 4JB8A 4L4ZA 2A5JA 2R6DA 4LNUA 2KL4A 1Y7HA 2QRPA 5DBOA 3CG0A 5DGHA 1CDEA 1PJAA 1LBSA 2FZLA 1QLWA 1XZNA 3N2GA 1WF3A 1D04A 1QIMA 1Z47A 5EY5B 5DB4A 4EQZA 4QTXA 3KALA 5AVRA 3OE7D 3U4AA 1H65A 4KK3A 2WKSA 1PEAA 3Q3VA 1TYDE 2RHBA 1DS6A 3L01A 3TBFA 5K6TA 1AB6A 1V54H 1JUMA 2P65A 1C50A 1CUDA 5AVKA 1T5OA 3BWYA 4C3OB 2P6OA 1HYHA 2RMKA 5FTNA 2K87A 3PNQA 2KLHA 1JA9A 3CJTB 2EV9A 4UKDA 4Q93A 5HDQA 1LQ1A 1FOXA 2C4TA 5KVRA 4QPNA 4EW1A 2XUJA 4HGQA 4J29A 3EFHA 1SCIA 5BSHA 2DK5A 1ZMOA 4D98A 4MGZR 2VASA 3JWPA 5H8WA 1UFVA 1K6XA 1EH5A 1ILEA 2CVHA 4E4RA 4QFMA 1XNQB 3ZDAA 3KE2A 2AC2A 2EBUA 3QLUA 3BR5A 3S2IA 4BO1A 4KLRA 2WOJA 2PX4A 3WLPA 3VXKA 2VDRB 4LK3A 1N8TA 1KO1A 3VYWA 1O1YA 1E7YA 4E7HA 2WILA 3K1TA 2ZIGA 2GSWA 3IPLA 4IQ0A 1K5PA 2WZDA 3ANSA 2ZBFA 3R5HA 1MAHA 1UMDB 1L7DA 4G9GA 5CIWA 3LBNA 3NIGB 2XDVA 3QVGA 3LRTA 2JI8A 1ZZEA 1WQ1R 4FOLA 4YJ3A 3L5KA 4QJIA 4ZA2A 3G1TA 3OM0A 3O3OB 1BHO1 5CHEA 4MQFB 2RI1A 3DZIA 2WWVD 2WFLB 2BBOA 3THYB 1M2VA 1H8HD 2JZNA 4IGKA 2A5YB 4G4SP 3Q12A 3I54A 4B3FX 4Q4CA 2YU9J 4G36A 3HRIA 3JYQA 1WB4A 2XVMA 4BO2A 3TL3A 2HZBA 4W8GA 4IDBA 5B7PA 1FMFA 3ICPA 1W85B 1UXJA 3EHDA 3IR7A 1JP7A 5BR7A 3SY8A 2GMWA 1EAYA 1CB7A 4JT4A 3EX7C 2OMKA 4CETA 4GU5A 5CB0A 2HHAA 1YRYE 4OO3A 1AHNA 4LZPA 1NLUA 5JTUA 3KQLA 1SMTA 1XPXA 4CG1A 5ALQA 2BGRA 4YDSA 5JVDA 3NHAA 3L7AA 3CCBA 1LWOA 1UKBA 3S27A 2XGEA 1D2RA 4FD2A 4IZ6A 5DTRA 3U17A 3NWSA 5JQGF 4D9HA 2PH7A 3FRHA 4CL0A 4BFSA 3BTLA 1FYWA 2X9DA 2PGLA 1LDNA 5J58A 1QRAA 3CZ5A 1G8JA 3A6KA 1W0KD 4GYGA 3MELA 1YRQA 3L4JA 4Q9AA 2M6RA 7MHTA 3CONA 1JALA 2IXGA 1T25A 1YO6A 1LRJA 4A1FA 1L5HA 4QXMA 1R5NA 3H13A 2ZFWA 3HI4A 1B16A 1YDWA 4MMYB 4RZHA 1K79A 1YR9A 5LQMA 3A2MA 3PGXA 3A1SA 3H0KA 4WN9A 4UREA 3LQ2A 1RCUA 2YZNA 1D5WA 2QJOA 3GJ8A 3RE1A 1SUBA 2HNHA 2OSBA 3MGAA 4BMVA 2ZZNA 3WB1A 1CDZA 5CQEA 1R0RE 5AJWA 5LQNA 4DT1B 2IQ5A 3TGNA 1K4YA 1O0CA 1ACIA 4TLCA 4X6XA 4B6QA 3DF9A 1I2AA 1JQ3A 1AXRA 4BO7A 1Y33E 4D9NA 3BL6A 1A9TA 1F9AA 1IAQA 3ORFA 1BQEA 1U2WA 3U7QA 4PXYA 4EGFA 3MJSA 3SD7A 3QV1A 2BF4A 2ZSEA 1PX2A 1AKEA 3N53A 4WTOA 3K71B 2GAOA 1JFRA 1XMAA 4IHJA 1WCXA 1TQ4A 4GQBA 1PP4A 1NDUA 1F3LA 5FKMA 2W93A 3CZ9A 4MEJA 3PDIA 2NYAA 1A7KA 5DF1A 5WRFA 3VGJA 2D1HA 3UK6A 1PJQA 4UY8I 1ZAKA 4B44A 4ZZ2A 1E64A 2XQKA 1SBCA 4DDMA 4Q39A 2IVMA 1OH5A 2NXCA 1ZXBA 4KO8A 3TO9A 2W57A 1IRFA 2JS7A 3D1LA 2VZ9A 4QWMA 3FCXA 1YRNA 5GJWC 4G8JA 3FK6A 1P1FA 4NABA 3LUAA 3MMZA 1B9NA 4BBZA 4HQ0A 2FH5B 2I78A 4H4CA 4QYIA 2DCUA 2ODNA 2Z6VA 2EG9A 3IEUA 2C7GA 2DLNA 4LOKA 3KZVA 2M7AA 3CMCO 2VDWA 3Q3JB 5ADUS 1IJWC 4NV1A 2SHKA 3BR2A 2YY6A 4P93A 5DXJA 4Q4ZF 3FPLA 5JE8A 3ANMA 1JMYA 2A7XA 4F7DA 3FW1A 2FUEA 4XFDA 1BHSA 1XQWA 3FTCA 2XX3A 2L9SA 2F48A 4ARZB 2GZMA 5EXEA 4NHJA 1VYVA 1HOMA 5K8JB 5L8VA 4TKMA 1MSFC 1S9HA 4BKOA 5KAMA 3V4ZA 2COEA 3NC4A 4DIBA 2Q6TA 1SIBE 1NVKA 3KHSA 2WUWE 4FT2A 4RVFA 3E7DA 4ZT5A 1B0AA 3HOVJ 1H4SA 4Z0PA 5IXSA 3P2YA 3TEMA 3I58A 1H9AA 4C06A 4JQOA 4ID9A 1VYUA 4UE6A 3T8TA 4RTOA 3W5UA 1P6RA 4Z0NA 2RH4A 3FYHA 1SQ6A 3B85A 1Z39A 4DMLA 3SDGA 4WAUA 1QAQA 3AG3H 5BRNA 1FPMA 3DQZA 2Z5VA 5F27A 2XUGA 3M6IA 1E1LA 3QVKA 1AS3A 2L9NA 2IOHA 5JD5A 1P9RA 1V2HE 2A4MA 3N0VA 1EUCB 2FRHA 3HM2A 3CRRA 3WR5A 2REOA 2QVOA 2HJHA 4P36A 4ETIA 3PGVA 4JWTA 2OV7A 1U4OA 2DFDA 3DHYA 1HY3A 3ETDA 4IFBA 2PL3A 3E22A 2EFYA 3NRBA 3FIWA 5J2UA 5DBEX 4DNOA 1CUWA 1QPIA 3IT2A 1S5PA 2BCEA 1NFFA 2VPRA 2FG7C 4BKRA 4YJFB 1DC4A 4G4GA 1GFWA 2UUZA 3W2TA 5DTDA 5BQFA 4F3TA 1QG0A 3RAJA 2ZYDA 2L42A 3DE5X 5FLXZ 4X0EA 2E35A 1ZELA 1DPUA 1Q1GA 2VP2A 4XGIA 4LSZA 2WA0A 4ANFA 3VU8A 4WEQA 3IILA 3ZZTA 5BV8A 4A2QA 4ESBA 5LRRA 3TZEA 5LMUB 1WWXA 2FUKA 3DFUA 2DY1A 4L5IA 3AF0A 1WCYA 2FN8A 4XRSG 1BD3A 2FMKA 1U7PA 4TQAA 4FZ3A 2EB7A 4RORA 4AG5A 3HJFA 1TA9A 2FSSA 2P2SA 3HL4A 2AE1A 2BFAA 3EDRA 4Y2QA 1XLTA 5EEAA 2VQ6A 1Q0LA 1AB5A 2AOVA 1PDVA 3L2WA 5KZMB 5TQ2A 5GOZA 1F12A 3DT9A 2HQSA 1UJNA 1Y4AE 2J08A 3MIIA 2ISYA 1G7SA 4AP5A 3U37A 3I23A 3SYRA 5M3MJ 1E7WA 4Z4EA 1P4WA 1RVV1 2Q1ZB 4I3GA 1KI6B 1HE8B 1GAQA 5FWYB 1LI5A 4JYPA 2EOAA 3HVRA 2QMQA 5CFQA 5MN4A 1E6KA 3KD2A 3CLRD 4Y13A 4WEOA 3K30A 4M9RA 3O8RA 2O03A 2QMEA 2YDYA 4GOKA 3U1DA 3AHFA 2ZCWA 3A06A 2VSOA 1KMCA 2FOWA 4PCUA 2PGAA 4FX0A 3NTXA 4E3WA 3GPDG 5HQTA 1NC3A 3UXEA 3M6LA 4I19A 4UTOA 4TTVA 1GV1A 2XXJA 1TF2A 4C5BA 4BS9A 4QHSA 1YJ8A 4QOFA 3CLQA 5BOVA 1N6HA 1LE8B 2PJRA 1CUXA 4DV4B 5CH3A 2ZO4A 1R66A 1E4EA 2I2FA 1AQJA 1IHXA 2VLIA 5J4LA 2H2DA 3E2IA 3GLFA 1WEHA 4B34A 2QRJA 2V7UA 3G0CA 1ZSYA 3DHEA 2EJRA 1I6KA 3PIPF 4JX5A 4YXWA 4E22A 3ILYA 3DKWA 3FGNA 2DE0X 1H2FA 3SF8A 4D0RA 1BOBA 4NEGA 1C7IA 1TLHB 4C0XA 4KQCA 2VPTA 1T4CA 3L7IA 2P4SA 4UHCA 1AHIA 4U9UA 1P9LA 3RD5A 1E3QA 1W0CA 1QRUA 3AR2A 4JP0A 4CCSA 3HXTA 3GLTA 2CCJA 3OO1A 3R6DA 1YJ9I 2AH5A 3WRVA 5HZGA 2C98A 3V1KA 3B52X 1DBSA 3QP5A 2X1HA 4QFBA 1W36B 5JHUA 4DUGD 2M4KA 4OFBA 1KQ3A 1XD8A 3H1GA 5BWLA 1DADA 4JHLA 2P4EA 1MJHA 3H8VA 1HK7A 1TUBA 1RHJA 1KZHA 4L72A 4XI9A 4MPTA 3I3LA 2XRLA 1I24A 5DTMA 3VJKA 4CIYA 1LVHA 3KJIA 2C3UA 2OYSA 3TSZA 3SHQA 1ZW1A 5L7TA 5CYPA 1I32A 1JQ5A 1JTEA 4FS8A 3QKIA 2DDAA 3RTRA 2VS1A 4J7UA 3OY7A 4FGSA 2GEJA 1Y3CE 2I2XB 3SLRA 1NZJA 5CB4B 1YU6A 4NMMA 4XL9A 4WZAA 2IPXA 5BSKA 4I4IA 3IIKA 2CEKA 2Q3DA 1MIOB 2R8YA 2RC6A 3ZDEA 2H3EA 3UVEA 3ZGZA 2FPPB 1F51E 3H2IA 2A3NA 3OQVA 4PPFA 2X23A 2UZAA 3R7WA 2BEUA 5AJUA 4Q66C 3UMVA 3OA0A 3H2YA