4GO1A

Crystal structure of full length transcription repressor lsrr from e. coli.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
297
Chain Sequence
EQGMCEEEQVARIAWFYYHDGLTQSEISDRLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYETQLRRQFSLQHVRVIPGLADADVGGRLGIGAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIGQLNAACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAADVAIVGIGAVSQGEQLMIGRKGAVGDILGYFFDAKGDVVTNIKIHNELIGLPLSALKTIPVRVGVAGGENKAEAIAAAMKGGYINALVTDQDTAAAILRSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Phosphorylated Autoinducer-2 Modulation of the Oligomerization State of the Global Transcription Regulator LsrR from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Transcriptional regulator LsrR
total genus 92
structure length 297
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04198 Sugar-bind Putative sugar-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4go1A01
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4go1A02
4AVPA 4O5VA 1FYLA 1T0FA 4G7HF 2P7CB 3IKVA 3W6KB 3I53A 1WWXA 4CYDA 1Z91A 5ILUA 5IT9Z 1L3LA 3RYRA 5D6EA 5D8LB 2OQRA 4HX8A 3WTVC 2XAFA 5D6FA 4Y13A 4FHTA 1OYYA 1OPCA 2HQRA 1UJ5A 4KA4A 2Y0MA 1QBJA 4UVBA 3V7SA 1YTYA 3QPTA 5HS7A 3QOPA 2NRAC 4JBAA 2FE3A 4OQPA 5CJ9A 1JGSA 5DUKA 4DQ2A 2KJBA 3GO5A 3LWDA 4MQ9F 2A6HF 2FA5A 4OIRF 3GW2A 1ZG5A 4P55A 5BMZA 2XVCA 1TQIA 3HRMA 2BKXA 2FSWA 1ULYA 2W24A 1Z9CA 1T6SA 3ICOA 4R79A 3K1MA 2KKOA 5CVIA 3TGNA 4ENNA 2VT2A 5AONA 2STWA 1ZHFA 1ZAOA 4QWQA 2L4MA 4HYEA 1ZG3A 3CO7C 3FHZA 1FBUA 4HV6A 1SAXA 3BXFA 3HOSA 3E5XA 2HFHA 4NHJA 1YW7A 2X0LA 3KP5A 3D0SA 1LB2A 4MTEA 3LAJA 2ZNYA 1DEAA 2IT0A 5LGUA 4HF2A 1Z6RA 2FBIA 4HBLA 5BQTA 2HWVA 5DEQA 1OR7A 3ZPLA 3HYIA 5D4RA 2BYVE 5HVQC 2X4HA 3L00A 3K0LA 2GWRA 2VBZA 2CFXA 2H27A 3MZYA 3KP6A 3RKXA 1ZGJA 3VEPA 1LNWA 5E1ZB 4WCGA 3ZMUA 1XGOA 2GNPA 4Q47A 3FMQA 5F6FA 1TNSA 4QLCU 3ECOA 4PDKA 2FMYA 4HF0A 1R58A 4CDGA 4U88A 1QZYA 5ILSA 1KYWA 1HSJA 3FXUA 3F8FA 2F2EA 4A5NA 1FS5A 4M9ZA 4EJWA 2FF4A 1YS6A 3BP8A 3H3ZA 2M1BA 1KGSA 4IRGA 2W85A 1WKMA 4WWCA 1MD0A 1R00A 1ZH5A 2F5DA 1J7KA 4EM2A 4HQEA 1O3RA 3JSPA 2H6CA 2A61A 2NYXA 1OMIA 2V9VA 4G94A 4UUVA 4XLPF 4JK1X 3E6DA 2QENA 3TO6A 4AIJA 1D8JA 4AIKA 3QU6A 3QP5A 5ICCA 1F1ZA 1T38A 1J59A 3J7AO 2EV5A 1G3SA 4NQWA 1IUYA 3ZN1A 1HW2A 2ESNA 4R7TA 1TLHB 1K79A 1O57A 1RIOH 3IL2A 3REOA 4L50A 1LK7A 3ZMSA 3IKTA 2YX7A 4ZYHA 5ICEA 3KWMA 1BC7C 1WSUA 4MEXF 2Z3YA 3LAPA 4L51A 5ILVA 3KP2A 4L18B 3CLOA 5D8KB 3V4GA 2MH2A 2OZUA 2IA2A 3WG9A 2DLLA 5HLHA 2MH9A 1CD5A 1TNTA 2QQ9A 2XGXA 2KRFA 1FS6A 1TTYA 4I2OA 1IN5A 2MBFA 2EFOA 2XAHA 3Q5FA 1IAWA 2DFIA 4ZH4F 4BNCA 4BQAA 1P4XA 3K2ZA 4PCQA 1XTZA 4YG2F 1FT9A 3HSFA 3KZYA 2HS5A 4I0AA 5EEHA 1W7PD 5LGNA 3DQVC 3U1DA 3J80K 4CO8A 5LLQA 1H9GA 3KCCA 3DF8A 5K5OA 4L0ZB 2ETHA 4M9XA 5AIQA 2EB7A 4OIPF 2DW4A 4WK8F 2XAGA 4LG0A 1P6RA 2O61A 5LGTA 2R3SA 4HW0A 3U9GA 5L3BA 2M45A 4HDUA 1IRFA 4BHPA 1UB9A 4ETSA 5D4SA 4KIGA 5DD4A 1LK5A 1OYWA 1YS7A 1R5GA 3IHUA 2K7LA 4UXNA 2CO5A 4LK1F 3I4PA 1STZA 2HTSA 2XIGA 4R9NA 3TX2A 3CH7A 2E1CA 3PQKA 2M5WA 2ZMEA 3PQJA 4AIHA 1DUXC 4PZJA 2VE9A 3IWZA 5FO5A 2VONA 3ZN0A 5J6XA 2IJLA 2GA2A 3M9AA 1F5TA 3JSOA 1QPMA 3ML6A 2RN7A 1W7PA 3ZQ7A 2RQPA 1USTA 1ONVA 1WI9A 3EQLF 3Q9VA 2H09A 3ZMZA 3WTZA 1RZ4A 1I5ZA 3TO7A 2VN2A 4BH9A 2W57A 3N97A 1CF7A 3HUGA 2DPUA 1KU7A 2F8MA 2ISYA 1PBTA 5JHUA 1WRJA 1XGNA 1KQ8A 2P5KA 2L4AA 4U7BA 1SFEA 1U5TA 1YLFA 1P2FA 2LDUA 1ZN2A 3LA7A 3SZTA 2J5PA 2DU9A 3COAC 3V7CA 2PI0A 4BXUA 1GXPA 3BJOA 2PQ8A 2Z5UA 2W25A 4L9VA 1ZG1A 2JPCA 1ZRFA 5JI6A 5K5QA 3DXJF 4LB5A 4A6EA 1HSTA 5D5WB 4HLXA 3C7JA 4KIBA 2H94A 4R8HA 4YFKF 3RKWA 3IRQA 3EB9A 5E18F 5CYVA 3N4MA 1YG2A 3WGIA 2VXZA 3SFZA 1REPC 2WV0A 3NWPA 4RB3C 3SZPA 2Q8KA 3DP7A 4NMLA 1S29A 3KE2A 3F8NA 4G7ZF 4TV7A 4GMKA 4MQVA 4WF2A 1KA8A 1HKTA 1MJAA 2MC3A 5J8FA 2XAQA 5E1WA 5A2QK 2HZTA 4OIOF 2O3FA 4IRIA 3R0JA 1J2XA 3L7OA 1R22A 3M8FA 5LHIA 5CVJA 5F1RA 4LK0F 5L3EA 3FF5A 5TRDA 1X3UA 2DO7A 1QQIA 3P9CA 1KS2A 2V6CA 2WTEA 3BXGA 3ULQB 3J81K 4FT8A 5E17F 4ESJA 2Y75A 3J80Z 1YYVA 4M6YA 2V1DA 2P6TA 3KZZA 4YIIA 4G9YA 1GVJA 1Z6TA 1FZPB 3ENQA 3NZEA 3K9TA 3F8CA 2NNNA 2G7UA 2GQQA 4MHGA 2GA1A 2CSOA 4I09A 2XAJA 3WTUC 3QPHA 3F8MA 2YPRA 5E20A 1ZGAA 4UVAA 1U3EM 5CVRA 3RI4A 4ENKA 3HSRA 3JAMZ 2D1HA 1IN7A 1PUEE 3GWZA 2HOEA 2QWWA 2K86A 3TQNA 3GVAA 5E1XA 3F22A 1USSA 4D0PA 2ISZA 2OAZA 4HLYA 1BIAA 1DPRA 1BC8C 2HKXA 4K2EA 2BBYA 1EV7A 1KQ9A 3EUHA 3LSTA 4KIFA 4N0BA 3BJAA 4B8XA 2HEOA 4I98B 2A6EF 3CDHA 4L4YA 2ZCWA 3C1DA 5LEJA 3P9IA 2PMHA 1FYMA 3WU1B 3MWMA 4RGUA 1Q1HA 2Y48A 5J8CA 1FSHA 2JSCA 1XSVA 3NQOA 4R1HA 1XGSA 2VBYA 3P7NA 3ZMVA 3F23A 2CW0F 2EA4A 5LHHA 1F9NA 2UWMA 2MLGA 2R7FA 1H9TA 3DKWA 4EJVA 1G6NA 3GF2A 2ZMEB 3IXQA 5EEGA 1BOAA 5ERIA 1ZRCA 2JRTA 4IVNA 5D5UB 3JW4A 1JHFA 2MA3A 5CVUA 1J0RA 2ZKZA 2QLZA 2OBPA 2EFPA 4LJZF 3V8KA 3RIRA 4RB0A 2FBHA 3I5UA 1XMKA 1XB4A 4B09A 2RGVA 1U5TC 5HDGA 2D1VA 3KP3A 1HBXG 4LLNA 5DYMA 4JQFA 1PP7U 2NS0A 1TW3A 5FB2A 2VT3A 1O7LA 1FX7A 2M8EA 4Z2YA 1JHHA 3I59A 4P9FA 1R36A 2QBYB 3WTTC 1W4MA 3WGGA 4UVCA 2E7XA 3MEXA 3L09A 4RGSA 3I54A 5DCMB 2OKGA 3F3XA 1LQ1A 2AS5F 4ESBA 3T0YA 5BOXA 3GFMA 2FEZA 2GXBA 4N9HA 1S7AA 2IW5A 3CUQB 2VOPA 4GXOA 4AD9A 5L3GA 2QZ8A 1FPQA 2E1NA 3ABTA 2UZKA 2JPBA 4HF1A 2XUBA 4KICA 1U8RA 1IW7F 4Q5SF 1U2WA 5HS8A 1P4WA 4I01A 4NB5A 3R60A 1MGTA 2CG4A 1HW1A 3ECHA 4WXDA 2VC0A 4M74A 1KU3A 4A5MA 3BY6A 1SMTA 3QRFF 1IXRC 1P92A 1B4AA 1S8NA 4I0BA 3BXEA 2UXNA 2ZNZA 3KETA 3WGHA 4EQQA 2NNYA 1HOTA 1UJ4A 1YW9A 2IA0A 3V8JA 5HDKA 3KLOA 3K1PA 4EVIA 2DK5A 1B6AA 3WTYC 1S6LA 3ZP5A 3E5QA 1T2KA 2P6SA 5BS6A 1YO5C 1F4KA 1XSXA 1IXCA 5LBQA 5LRSA 4RAZA 1T98A 2K27A 5BPIA 3O6BB 1K6OA 3D5LA 2V79A 2XKOA 5E8IA 2HDCA 1SD5A 4ON0A 1HW5A 2EA2A 2BGCA 1D5VA 1YQAA 4M6XA 1NE7A 2IA1A 3R0AA 1KU9A 2XKPA 2KIUA 4XSZF 2BV6A 2QVOA 2O6GE 3E6MA 4KUMA 1HKQA 4YFNF 2FQ3A 2XASA 4HDVA 1SD4A 1RUOA 3W6JB 2STTA 1BM9A 3T8RA 3TDZC 3ERED 3MAJA 1IRGA 1BI0A 1H0MA 4TM8A 3IC7A 3QU3A 2V1XA 4L9TA 4LB6B 1K78B 4LG0B 4M72A 2FOKA 4M73A 1MZBA 3HN6A 5HS9A 3VODA 3FX3A 1VL1A 3LHIA 3RPUA 4MTDA 1Y0UA 3GEZA 3KEQA 4G6QA 4ESFA 1QO0D 1U6GA 3VFZA 2L02A 1I6XA 3LA2A 3E6BA 3L7WA 2CWEA 1T39A 4M71A 2O0YA 2J5OA 4M8LA 2IVMA 1R1VA 3F6OA 2L54A 5ED4A 5LHGA 2EFQA 5FD6A 3BROA 4LFUA 2LNBA 4U0VA 4WXHA 2MLKA 3FXQA 3NRVA 4RGRA 3GYHX 3MFKA 1LDJA 4U0YA 2F5EA 4A0YA 1U78A 3H3UA 5HLGA 1UJ6A 3KLNA 1Z1DA 5CLSA 4OQQA 3ISPA 4LLLA 2ADUA 1IN6A 3HTUA 3RDIA 3GLXA 2CYYA 4G6DA 1CF7B 2D2WA 2W84A 4BHBA 4OIQF 4ZZDA 2IPQX 1HORA 1SD6A 4YIFA 3F72A 1HQCA 2ESHA 3M8EA 1SMYF 3T1BA 5KK1A 2CGPA 4GO1A 1XN7A 2COMA 3BDDA 1O8BA 4AWXB 3SQNA 3JTGA 1V3FA 1IN8A 2RNJA 1LVAA 4L9NA 2GZWA 3JTHA 3E5UA 1BJAA 2VODA 2P4WA 1BI2A 4KFCA 1A04A 2P8TA 3SXYA 2Z33A 2RVCA 2PFBA 4HA8A 4ZYGA 3MQ0A 4A0ZA 4S04A 3F6VA 3KP4A 4RB1A 2EJRA 4GYIA 4MNUA 4S05A 3L2CA 3E15A 1SFXA 3TO9A 1CGPA 4IPAA 2CQKA 3FWEA 3R61A 1LDKB 2HQNA 1BBYA 3VB2A 4KT5C 2A69F 1FSEA 3BXHA 3ZMDA 5L3DA 2XV4S 3FMSA 2E7WA 2QQAA 2EV6A 4L5IA 2RC4A 2RDPA 1RUNA 4KMFA 1TQPA 4N9IA 2B0LA 1QZZA 4HX4A 3BWGA 1Z05A 5KVRA 2QQBA 1I1SA 2WC2A 3DPTA 4HAMA 1FWZA 2MD5A 5DV5A 4OINF 3QAHA 4L5JA 2PG4A 2ELHA 1BIBA 1MKMA 2PMUA 5HLIA 2A3SA 3K69A 1BI3A 2P7VB 1RI7A 2IP2A 3H92A 4KYWA 4FX4A 3EDPA 2PEXA 2O8XA 2WU1A 3ZMTA 4ZYDA 4EJOA 1UCRA 2HR3A 1ZRDA 5FD5A 4ZZLA 4MGRA 1JXSA 4Y15A 1XDSA 3ENVA 1FYKA 5HJ5A 3I64A 4CHUA 3ELKA 3S2WA 2A68F 4CZZA 1LKZA 4XSXF 2G7HA 4IO1A 3WTSC 5DD8A 4A0XA 4BAYA 1S3JA 5HDNA 2DK8A 2JZYA 3WE3A 1XD7A 4KN7X 1JE8A 3VOEA 4EM1A 4Q4ZF 1LDDA 1SD7A 1DP7P 5FLXZ 3L9FA 2F5CA 4P96A 1EH8A 2EFNA 2FU4A 1OKRA 3O2PE 2O0MA 2OD5A 5DCFA 1SFUA 4UHTA 3V7RA 1ON1A 3WTWC 2XRNA 2YSRA 2PN6A 2C6YA 3HHGA 1R1TA 3RJPA 1P4AA 3EYIA 5AIPA 3OOPA 3LWFA 4U0WA 4WXCA 5JVTA 1C0WA 3GFJA 1G3TA 3RYPA 1D3YA 1FBQA 2GAUA 1MDMB 2ACJA 2YR2A 2DBBA 1GHCA 5K1YA 2DTRA 1IN4A 3HIFA 4GCVA 1K78A 1D8KA 3ENWA 2LF7A 3GX4X 2H6BA 4IHSA 4P9UA 5CVVA 4WX9A 3G73A 4CXFA 1FLIA 3F21A 1TBXA 2VBWA 4IHTA 3CUOA 4U7DA 3J81Z 1KQ0A 1WQ2A 1FQOA 3FM5A 2KJCA 3B02A 2PBIA 2GXGA 2WWYA 1V4RA 1LEBA 1G3YA 2VE8A 1FSFA 1J9IA 4RS8A 3WODF 4EJUA 3NEUA 1E17A 2R5FA 3I59B 2K02A 5BPDA 4HQMA 1LEAA 3HHHA 1B9NA 3E7FA 3KP7A 3SHFA 1J5YA 5K5RA 4UV8A 4ENMA 3U2RA 4X84A 1DPUA 1O3TA 3P9KA 3LQQA 2P5VA 3BOQA 1FP1D 2G9WA 4KN4X 3V8LA 5D5XB 4MEYF 2FMLA 2FBKA 2A5YB 3ABUA 1OYIA 2W48A 2FNPA 2VBXA 3CUQC 3RPQA 3HRUA 3BZ6A 4EJTA 3EFBA 3MZHA 1FRZA 3QP6A 4CICA 3PFIA 4GYGA 2GIVA 4LLGF 1E2XA 4TM7A 1IXSB 4RGXA 5H6RA 2HYFA 3LFKA 3WTXC 3EYYA 4BHCA 1YFHA 2RKHA 1XCBA 4OU0A 4XRFA 1FY7A 4G8XA 3OV8A 2QUFA 2VOOA 3IWFA 2BKVA 1YIOA 3BPXA 1HXDA 1ZREA 4HOBA 3M1EA 1W5SA 3T5XA 3DFGA 2PLYA 2QBYA 5IT9K 1QGPA 2LKPA 5ICGA 4PGHA 1MJBA 3DV8A 5DCMA 4CGZA 4OMYA 1PDNC 3I0TA 1ZARA 1LJ9A 1TW2A 3HRTA 2DI3A 3KV1A 2ZBKA 3GFLA 4IJAA 3JAMK 3CUQA 2F5FA 3BPVA 6PAXA 3RKYA 2HKOA 4IXAA 2YX4A 4UV9A 1O7FA 1I1GA 1KYZA 2YU3A 2PJPA 1ON2A 4HZFA 1KU2A 2FRHA 1R1UA 3O3KA 5LRRA 3WE2A 3E3VA 2LF8A 5H20A 2BE5F 2RI1A 3HTSB 2OA4A 1FBSA 3OC6A 1R7JA 4A2UA 3TKYA 2EFWA 1O3SA 4H0EA 2P5LC 3KFWX 2ZJ2A 3IRRA 4Y17A 2L01A 4LMYA 5IT3A 4P5OA 3KEOA 1J75A 4M9SA 4I02A 1MDMA 4L4ZA 4EM0B 5FLXK 2RV8A 4L0YB 2ZXJA 3I58A 4O6JA 1ODDA 1IZ1A 3RTRA 2FXAA 1ZLKA 3UW1A 2OQGA 2KIFA 3EETA 1M0SA 4RB2C 1GXQA 5LEKA 2BEOA 1RNLA 3MCZA 3GUDA 5L3FA 4KDPA 4IRHA 3WU0A 1UFMA 1Y89A 1FC3A 1FNNA 4HV5A 4PGGA 5FFZA 1U5TB 1ZYRF 2M87A 4LGWA 4FX0A 3C18A 4L9JA 3FXRA 1G4DA 1BN5A 2RI0A 1S7OA 1G3WA 1YW8A 4IF4A 1B9MA 3CSSA 2DQLA 2XHKA 4EGYA 1BI1A 3E97A 3HRSA 5F64A 4OMZA 5L3CA 4ASNA 3TOAA 4DNCA 1JT9A 5E8GA 5HOOA 1I27A 4KNYA 1W7PB 3F8BA 1IF1A 4A6DA 2DPDA 1K7AA 3K1NA 2JT1A 3GZ6A 2UXXA 5FGMA 3E6CC 1EH7A 3TDUC 2IRFG 4RAYA 1O3QA 2J0EA 1B1BA 2HTJA 2Z99A 2NAZA 1ZLJA 3R6SA 3TOBA 1XDUA 5H6QA 3G3ZA 1EH6A 2KIMA 2VC1A 4Q48A 3M7GA 4ENJA 3HHEA 5DDGA 1XSDA 4EV0A 3B73A 2L3DA 2A07F 1TQMA 2M30A 3Q9SA 2K4BA 2R7DA 3R4KA 5JR3A 2DQRA 2EV0A 2EWNA 1XGMA 4YFXF 4E70A 4OOIA 4O3MA 1UHWA 1AOYA 2HYGD 1XMAA 3T8TA 3LA3A 3LQRA 4EMSA 1MJ9A 3C3WA 3FM3A 2V1UA 3GXOA 3U7JA 3HSEA 1PP8F 3AAFA 2QM3A 4XLNF 1UHMA 1W5TA 2JTVA 2LSOA 1R23A 1R5HA 2XROA 1NHAA 1QNTA 3DPLC 4G7OF 5DUIA 1XCVA 4XBFA 2Q2EA 2Z9OA 3HOTA 2EK5A 2Q0OA 3CJNA 4GGGA 3GZ5A 2ZFWA 3FMRA 1Z7UA 2TDXA 4BYYA 2OZ6A 1DDNA 2AXLA 4KMUX 3BJ6A 4LD5A 4ZYEA 2K4JA 2O03A 1FOKA 5JFRA 4EGZA 5A2QZ 4I7HA 3GFIA 1B59A 3CO6C 4HX7A 5FFXA 2HGCA 2DT5A 1L0OC 4A12A 5TJJA 2D45A 3DEUA 1FP2A 2OU2A 5D5VB 2QYOA 4UNOA 3I71A 2DAOA 3CTAA 2ZO4A 2FNAA 3ROUA 4F7ZA 1VTNC 5ICFA 1AWCA 1HKSA 3FZVA
chains in the Genus database with same CATH superfamily
1BW5A 2GERA 2JLCA 3UEOA 4DUPA 3FETA 1MRSA 1RSZA 1VI6A 2CFTA 3MK31 4MWZA 2CU7A 1HE1C 1TIKA 5BQXA 2D06A 2O7RA 3GUZA 3HS3A 5BRJA 5JY6A 4MW5A 1O6CA 3U1TA 3B9BA 3AU9A 5CT4A 4FU0A 4Z0PA 5IYZA 2PL5A 1RAHA 4RTPA 2O2ZA 3DR3A 2I2BA 2ZIGA 1L5RA 2C5FA 3V2UA 3OKFA 2DU8A 2G63A 4J16C 5LD2C 1WWXA 4NAHA 1FMCA 1XZ8A 3JWJA 1QFXA 5BW8A 4TTVA 3TLBA 1Z91A 1VCNA 4LX8A 2PUVA 3EWSA 3LX5A 4EW6A 4Z49A 5ILUA 5IT9Z 2FPWA 3COSA 3G4SI 3G0GA 4QVGA 1UDBA 4F2PA 5J4VA 3GLLA 4L7QA 3S93A 1N57A 1PJAA 3AI3A 1FVXA 1FXSA 3N07A 4AUXA 5SY6A 4AJ1A 2QCOA 3V8VA 4HX8A 1B8UA 2C2KA 1Q0HA 2XAFA 2ZWMA 1L2TA 2W8BA 1NQUA 1WJGA 3LW8A 4MYTA 5KTYA 1E2UA 3U09A 4AKGA 2DXIA 2HPAA 4JA2A 1YK0A 1E9EA 2PZKA 4TTAA 4FHTA 1CY1A 2Y2UA 5DNYB 1OPCA 4A3CJ 2Z3VA 4KA4A 2BFNA 3V7FA 1G5TA 5BNGA 1G8AA 5HE9A 1YFKA 2GD1O 4BU2A 1WD7A 4P54A 2VXBA 1OIXA 4KQGA 4QRDA 4GAEA 4XPZA 3RS5A 4I55A 4QQNA 3QKSA 2W4QA 2XMPA 1JGSA 2LDBA 3CR7A 1TO6A 3N87A 2CXTA 4BV8A 3LWDA 1YDHA 1E9VA 2OCIA 4HLUA 4EHDA 2WT8A 3DHNA 3IV6A 3UICA 2YVKA 4MQ9F 5IVKA 4Q19A 4MW0A 4NVRA 1LBEA 4XK4A 1G3IA 4JENA 1VDZA 2VPWA 2Q41A 2XVCA 3HRMA 4HH1A 1RRJA 2HMWA 2PQ6A 4JJZA 2W24A 5HZHA 2AJLI 3G6EI 1WLSA 3CLRD 4C7VA 5K2OA 1Z9CA 4J9VA 1T6SA 1E1RA 1R64A 1JQ5A 2EGHA 5DGTA 1TFUA 4IJKA 4E33A 4NPHA 5CBPA 4WXPA 5AVXA 4R79A 4CF5A 1VSUA 5BORA 1PWZA 5A5DA 4A0HA 4KXUA 3J7TA 1CVIA 1NATA 2AE2A 1QG0A 3UB3A 3WKBA 2ZYRA 2GETA 4OEHA 5A3QA 4LN1A 1CZHA 4QJ5A 3GNLA 2HQSA 4I99A 4EUNA 1L6IA 2BY4A 1JLKA 1Y7TA 2I66A 5DBFA 3K70B 3NHLA 2XUHA 1WH7A 1Z36A 2QPLA 1R9NA 2G09A 1B72A 2HVRA 3OMLA 3ZE0B 3PSAA 5HMLA 5TVGA 4IJ6A 1IDZA 1BW9A 3LPDA 1WKBA 1OI3A 4G5FA 4LDRA 4Q4DA 3T7EA 4WIAA 3WSTA 2H5EA 3IOBA 4CFYA 3IP3A 2FW1A 4BVKA 2ERXA 1XNGA 1QH8B 2QGFA 5JQGF 1U8EA 5IX8A 1EHIA 3FXLA 1GRCA 2VQHA 1QR2A 2C4UA 2H63A 2MHCA 2J07A 2R66A 2XVMA 2YXNA 3BXFA 4TLAA 5IDVA 4YRFA 4QVIA 4GGOA 3BM5A 4FSDA 1D2AA 4ZVRA 5KREA 3I30X 1R4NA 3K9WA 3OOUA 3VISA 3I1IA 2VYND 1A0OA 4NHJA 1J2RA 4RHEA 1SVLA 1J2UA 3UTDA 5LWHA 5IJ9B 5EE0A 2KQRA 4QJ4A 4TSRA 4YEDA 2BSAA 2EHJA 2D2IA 3LSJA 1HGXA 2AKEA 4NPCA 3TSAA 1J1IA 1XNRB 2ODEA 3DLLF 5ITZB 4ZEMA 3OEYA 5AKKA 3MYYA 1O2DA 2ZNYA 1Y80A 1OWOA 2G17A 3GFSA 4Q4HA 4YN3A 5FI5A 1GTL1 1A9SA 1OCTC 4Q3EA 1Z6RA 1JKMA 3PNVA 1YHZA 2JCXA 2PGXA 3FKIJ 2HF2A 1YHYA 4BE4A 2R68A 2X7HA 4LYJA 4D8WA 1EF4A 4DR5B 3WLSA 3TQRA 3MJFA 1BHO1 1T6NA 1U8FO 1U2SA 1FK8A 4R68A 2DGDA 2R7VA 1N6KA 1VFCA 4TL7A 3DMDA 1NUQA 2DE0X 2QJRA 2B6HA 3LX4A 4DV5B 1QPBA 4IG4A 3QMPA 3QVSA 3MZYA 1WCV1 4MIYA 5EZYB 1G20E 3M7IA 1O08A 3RKXA 4YRAA 1JDBB 3AIMA 3TIXB 2WJYA 3W3AD 4UM8B 1LNWA 2NQTA 4RFSA 5E1ZB 1VPDA 1R6VA 3ZMUA 4U4AA 4W4TA 2UVPB 3K4MA 3RU7A 6CHYA 4Q47A 2A2ZA 2DODA 3QK7A 1J8VA 4ZI2A 2X2PA 3DBRA 3JARA 5I7SA 3ECOA 4MQ5A 2EEZA 1E2FA 2W2LD 2RFLA 3N5CA 4G36A 1PSDA 4JEMA 4KFRA 3TMYA 3H16A 1GN9A 3SQOA 3PVSA 2ZVJA 3O83A 3S8PA 2VKHA 5TR9A 1KYWA 4H6PA 4XVCA 2P2CA 1W34A 2YFYA 3L6BA 1KXZA 4B83A 3RW9A 3PNLA 4XD2A 4A5NA 2GVZC 2XODA 3KUKA 4PN7A 1MW8X 3CNBA 3KCQA 4EJWA 5HGJA 5KNDD 4XIDA 2OYSA 3BP8A 1SC9A 3H3ZA 2HA2A 1FUUA 2OLEA 2VP4A 3FDXA 5CX1B 3WR5A 5ICMA 4CXMA 4R2XA 2WAOA 3KHKA 1CU1A 3GRUA 3ZQHA 1MC4A 4L8LA 1MO4A 3BZKA 1WKMA 1S01A 3E8XA 5G02A 4BEBA 4AS1A 2RKBA 3GZTB 5JXGA 3T15A 1AQUA 5F23A 1KI7A 4PCAA 5CIYA 1E9RA 4TLMB 3ZY6A 1J7KA 3E2IA 4AWAA 5F9HA 5A7GA 2VKDA 5DNEA 3WU2C 4F91B 1O3RA 3JSPA 2I4MA 2WAYA 3C6XA 4XIYA 5NULA 1UFKA 2H9AA 5J1YA 3THSA 4OHBA 2PVSA 5BMVF 1HC7A 2LKDA 3LNQA 3CF6R 4DQXA 2NYXA 1OQAA 2Q8NA 5A5GA 2V9VA 1YTUA 3PJFA 5F2EA 1GY8A 4UUVA 1P39A 2B36A 3HO6A 5EXEA 4XLPF 5K2MA 3RUFA 4JK1X 3LIPA 4ZEVA 1JQBA 3E6DA 1G6Q1 2GN9A 3FUTA 3AY3A 4R84A 4P7FA 5CVCA 2JG3A 1YR7A 2Z8YM 3WISA 3KSAC 2B2XA 4G56A 2X22A 1TZCA 3INGA 1D8JA 4ND4A 4MQFA 5ICCA 1F1ZA 3X1KA 2FLWA 2DEUA 1RE0A 2LRHA 3QEMB 2HA7A 4BMCA 1G3SA 3DBHB 4NQWA 2RK6A 1IUYA 3QXSA 2X6WA 3ZN1A 2PM8A 3S1SA 1HW2A 4KW7A 4MJLA 1B0AA 2GHIA 4XSHA 3I8OA 3U26A 3QF4A 1H3FA 3AM3A 3D5QA 1KIMA 1E0AA 5AM2A 5KWSA 3R5KA 2O5RA 4HV4A 1LPNA 4L73A 3UGKA 1A4RA 3C3JA 3RJTA 1ZH8A 4URZR 4A2CA 3NDBB 5F78A 4A93J 1RIOH 4G41A 2VCYA 4LJKA 2V7VA 4P84A 5L4NA 3L7BA 1NH3A 3CN9A 1LF5A 2XMRA 3NCTA 1TJNA 1IHUA 1H1LA 1YCDA 1BXGB 1TI7A 2FPIB 4UUSA 1G17A 2NXCA 2WAAA 2IEGA 3FTNA 4HFMA 4IS3A 4Q12A 5T4FA 4EG6A 2B8WA 4GMHA 5A06A 5M5WJ 1LK7A 1YB5A 4UDNA 2NYRA 5KSOA 2IUTA 2J3LA 3ZMSA 1C7FA 1UPCA 3RB8A 4B7ZA 2J9FB 2E3JA 1NVXQ 4FGJA 3PXBA 4MRSA 2EZIA 1YQEA 2QMQA 4LRWA 3U81A 1CUVA 2X1DA 4HATA 2ZT6A 1W7AA 3KYIB 1YMVA 4LIVA 1VE3A 3RS2A 2J7PA 1FTGA 5AHOA 4ZYHA 4QTRA 4CG1A 1AE1A 4K9QA 1BC7C 3I76A 3W5AA 3NMUF 2M0CA 2YS7A 3A4NA 3FIWA 1WSUA 1R3DA 4S1VA 1EAMA 4U5XA 3U9LA 1R9GA 4B46A 2XIJA 4BO2A 5DP2A 3GFPA 4OX9Y 3IT0A 3HXLA 4IXDA 1E0JA 3KP2A 1JFLA 4XD7A 1N3BA 5BY2A 2OBMA 3E8SA 5E4TA 3MQFA 1YFJA 3HWX1 1K5HA 3DWIA 1CIVA 4M86A 1IH8A 4RNCA 4TYPA 4X1YA 4KVZA 3LBFA 2OZUA 2IA2A 5DHRA 5JV5A 1QNLA 1E98A 2W2NA 3GW8A 4E5MA 2Q9UA 2JD2A 3VU0A 2AFHA 2DLLA 1JKIA 1GV1A 3O1IC 1EUCA 3IURA 1KA9H 5ELLA 4OI1A 4UVHA 3HOUJ 3F5QA 5EESA 2PY6A 3B70A 1YRNA 5IP7J 1I6KA 1MJGA 2LBPA 3CUUA 1CD5A 5AWFC 3GA7A 2QQ9A 3ONDA 3R8CA 3S55A 5K01A 2DSTA 1FS6A 4PX5A 1KAMA 5EMJA 4GLJA 2L7ZA 2GZ2A 3DV2A 1IBSA 3NBMA 3RHZA 4EQ6B 1TTYA 1BD4A 2EZTA 2Z9CA 3PR2B 5DLQC 5MN4A 5IM4F 4I2OA 2VIXA 1YASA 5FEUA 1ZWKA 1RBMA 2HB6A 1SWVA 1N2EA 4LDZA 2RHLA 3LC7O 3T3MB 1IAWA 4BFTA 1TLLA 3GA5A 4FYYA 5FF9A 4BNCA 5LQRA 4Z4GA 3ILXA 1KI6B 3CZRA 3OPYA 1MOQA 4BQAA 1H0KA 1KH3A 4CM1A 4KR2A 3LQYA 3JD3A 4UHBA 1X87A 2QL9A 3EK2A 3K6GA 1XTZA 2BOVA 3GGJA 2C2ZA 5JTUA 4YG2F 2P2ZA 3AV0B 4LJ8A 3KZYA 3HBNA 2HRDA 1V5IA 3WQHA 3OQNA 1VECA 5IJ9A 2UVPA 1I01A 3FBGA 1PT9A 5HDQA 3KHTA 4QVKA 4J2OA 1BCRA 3EXAA 1SJ9A 4P98A 4D42A 3F74A 1N2CA 1GUFA 4LYDA 4G9GA 1W7PD 3AUKA 5LGNA 3FXAA 3P2YA 4U2DA 5I8ZA 2QUAA 4OLBA 5K3FA 3SN6A 1ADBA 1C3LA 1F2UB 2ANBA 3U1DA 1QE5A 2X9DA 2F3SA 1ESDA 4P9NA 4R9RA 5FORA 4HJXA 2CS3A 4FOLA 1M5TA 4QLAA 1CR0A 4AW9A 4ZT4A 4A3KJ 3ZDBA 1K6YA 1I2MA 3TUIC 3Q10A 5BMOA 5FAXA 2HJ9A 1WSWA 4XLHA 2H48A 1BKDR 1C41A 2FR0A 3K09C 3OUTA 1H9GA 1Z26A 5DWVA 4LDAA 3PWKA 4TXLA 3DFMA 3BLYA 1W8DA 4ETWA 4BJ6C 1RR6A 1VQ9I 4L0ZB 1X4OA 1RQ2A 2AB0A 2PRYA 3UNGC 3GGCA 3OF3A 1RRVA 3L6CA 3KJQA 3O8OB 4IV5A 4KYVA 4WINA 1PGOA 1XWFA 1EAYA 2L19A 2PIAA 4IIDA 4U7HA 3WKAA 1JG3A 3REFA 2HJRA 3ZQGA 5TLSA 5KU7A 4OIPF 1QHGA 1XRQA 2DW4A 3QI2A 4WK8F 2XAGA 1DO0A 2QP3A 4MLPA 4KRXA 4MUKA 1YOVB 1RIFA 1V9SA 5LGTA 4CN8A 2QLTA 5LP1A 4AJNA 4HW0A 5L3BA 1J9EA 2OVFA 1H22A 1I2DA 3UATA 4MUEA 3VDMA 1H6BA 5AW3A 4TYWA 2UUCB 2YOGA 4F2WA 4BHPA 2ODWA 1I32A 1UB9A 1CP3A 1HT0A 3UYLA 1GQFA 1YZLA 1B8IA 1EIZA 2JFUA 1E3OC 1D03A 3JALB 3KZCA 1LK5A 4H0NA 1JUPA 3VVMA 1GNQA 3CH5A 1PJCA 1YS7A 3OFND 4C0JA 1C1DB 1MJFA 3RVJA 2K7LA 2ISSD 4MVJE 2XTZA 1HT2E 3W4IA 1JDBC 2P9YA 3O5AA 2LCIA 3VSDA 2P27A 3IMGA 4RETA 2WNSA 3KKNA 2QZPA 1JB9A 1QONA 3DHYA 2V0NA 4DCMA 1SUPA 1B76A 3GBGA 4RKFA 3B7WA 3DW3X 4TLCA 3K3PA 2JJ1A 1STZA 4LRXA 4P1ZA 3ZZUA 4R5HA 5BN5A 4G2TA 4IOJA 4W1PA 1I3CA 3AVUA 3CH7A 3EXG1 2E1CA 3UXMA 1DU4A 2QB5A 2HJGA 3RQIA 2ZMEA 2XI4A 1T4BA 3GC6A 2HEIA 3Q3VA 1C4XA 2BR3A 3FLBA 4FFNA 4KLNA 4MZXA 2ELKA 1TVKA 5EJ4A 1LUAA 4PZUA 1WTCA 2ZRGA 3GEGA 1MQSA 2ZE5A 3KKOA 5FOTA 3A06A 3AFMA 4JXJA 2GN0A 4ZDKA 3EW7A 3VDNB 1YE3A 3SC3A 3OF5A 3OZEA 2AJTA 3PO3J 1OD6A 3OJEA 3ZYCA 2HJSA 1QJ4A 4Y0AA 2R1VB 1QFSA 5EP3A 2VXOA 5E6RA 5TPWA 4CKEB 1B72B 2NVTJ 1VDMA 1OXKB 5J6XA 1YC5A 1Z13A 4QU9A 3LTEA 2IJLA 4EY8A 2PBFA 3P5SA 3CVUA 2FWRA 5FTLA 4Z6KA 1BOFA 2BIFA 1M2OB 4B34A 3GT3A 3PRYA 4WJKB 4WOKA 1LTQA 2FZ5A 5TGTA 1BA3A 2PPLA 3K1YA 1S8AA 2ZB2A 4HDMB 1QPMA 1PJQA 1Q1GA 3ML6A 3AW8A 5HCNA 5GONB 1W7PA 4H1TA 2O54A 4HUQA 3WSWA 4HL6A 5CK5A 5CTAA 3KZXA 2ZWAA 3A2LA 5C5DA 1USTA 2WZQA 4JI2B 1WI9A 1VTKA 1G3UA 1EVIA 3FYCA 3KZKA 3F8WA 3QEKA 4X1OA 4Z4EA 4G5OA 5CFMA 1ISRA 2IIQA 5EWMA 2Y6UA 1EDZA 2IU0A 4EHFA 2NSHA 3NTXA 3D5EA 3UM9A 1VQMI 4DEXA 3D3EA 2IJGX 2C7RA 3ZMZA 1ZD5A 1NFFA 2IU6A 3HB7A 5TQJA 4EM6A 4NYJR 3C70A 4FEAA 3K5PA 1A4IA 4KAAA 3ZQJA 3DTVB 3IT2A 3JATB 3ED5A 4DLBA 4F84A 5H9WA 1IO2A 3TO7A 4DT1B 4BGIA 2P0WA 1QP8A 3P9SA 4I55B 4R7GA 2XB2A 4BVEA 3QLVC 2X1CA 4OKSA 4BEHA 1E6MA 1YMUA 3MQ2A 1U8BA 2V8OA 3VTAA 3N97A 4MEJA 5A05A 3MFYA 1LY1A 1CF7A 1DP4A 1J8FA 1FS4A 2ET6A 2DPUA 1KY5A 3B85A 5DCUA 1KETA 2EW1A 4NJMB 2HIMA 5AM4A 2YKGA 5BP7A 1TAGA 3SQXA 4U39A 3BTLA 2H4ZA 1R16A 2ISYA 3JQFC 3NH9A 1PBTA 3CCCA 3BAZA 4JHXA 4WL0A 5JSQA 2HFKA 2WSSD 3C5CA 4IRMA 3GH1A 4O2AB 2R47A 2D0DA 3R3ZA 4RH0A 4HEA2 3CUYA 4NJEA 1XMXA 1DNPA 3EEOA 3MHPA 2DOKA 3NONA 4ZCQA 1OBFO 2I33A 5A6SB 1USVA 1ZM4A 3EEFA 1Z5GA 1P2FA 3D54D 4D79A 4Z6YA 1XXHA 2OGUA 1C4OA 1Q0QA 3R6DA 2R6FA 2Q5EA 1L4YA 3GCZA 3CCMI 4L08A 2H08A 3H6KA 3WDLA 4GW3A 5DASA 5HF6A 1QJCA 4I5FA 3KQTA 3D2LA 4UZSA 3PFNA 1BFUA 3COAC 2XRLA 1HRKA 1YV9A 1GL7A 2OCYC 1A2OA 2PI0A 2E1MC 1ADJA 1YU6A 2FLKA 1CIPA 1GXPA 3QVKA 4RLFA 4YXFA 3R7WA 121PA 1E3EA 2KP6A 3PGVA 3WK4A 1STOA 3RG8A 4AKEA 1C80A 3F9IA 2E5NA 4HNAB 5FUBA 2EBHX 2PR2A 3HZJA 4A3FJ 3SX2A 1DV1A 5KQSA 2PQ8A 1OLOA 1Z5UA 3C2QA 2W25A 2JEZA 1YB2A 1X80A 4BY1J 3FNGA 4O2BF 3Q7QA 2M7AA 5H68A 1BNCA 3HFJA 4TWBA 3T9CA 5G1NA 1SG9A 1Y8QA 3KJIA 1QQ7A 2GJ8A 3UZUA 4GI1A 4P93A 1GD1O 3O82A 1IWPB 4C87A 3DXJF 1T26A 3A6LA 4FEYA 3DTEA 4IQ4A 2IDJA 4PC2A 4GT1A 4PO9A 2BDUA 2REBA 4UBOA 5E6SB 2ZXFA 4UXHA 2W6OA 3AESA 3D6FA 3AVPA 5AVYA 4HWSA 4PVDA 1EVZA 2XGSA 4HLXA 3ZC3A 1RLTA 3DYBA 3DMRA 3IO3A 5CTJA 2H94A 3GRRA 2ZTSA 4M54A 2G9UA 3IRQA 2QVBA 3FLEA 1CJTC 1T9KA 1GZ7A 5F51A 3AV3A 4OQMA 1IQPA 4FNMA 2GK3A 2C88A 2PZAA 3MTGA 3N8DA 2YVAA 3U4QA 4F93B 5KOYA 4N8SA 3VU1A 2YINC 1QPIA 1CVLA 3AIIA 1F8GA 1GKIA 1WD5A 1LWNA 2IOFA 3DEHA 4TLDA 2AK2A 2HCTA 3SFZA 2VHQA 1REPC 2WV0A 2ZBGA 1P17A 3NOOA 4L2IB 5ALKA 3EDRA 3OJ0A 5CG1A 3D9QX 1J09A 4KP7A 2WA0A 2Q8KA 3DP7A 3F6BX 1W75A 4HFRA 1NJ2A 3CJRA 4NH4A 3SZUA 5CPRB 1KU6A 1TIBA 3T0IA 4UVIA 1DDGA 3F8NA 4G0NA 4GMKA 3M83A 2CMHA 4RK4A 3BBPA 5LB4A 1KE1A 3A3NA 4D9NA 2AKAB 1O4XA 2RHCA 1NW8A 3TMOA 1A9XB 4URFA 1MJAA 1V7CA 3LOQA 3OG9A 5JH7B 3CNQS 3ILVA 5CHEA 5FHRA 5T8KA 2XAQA 2EJCA 1SEVA 1E58A 2JATA 4OIOF 2Q5OA 2O3FA 4IRIA 4YP1A 4LYEA 3R0JA 1J2XA 1JJFA 1Y3BE 4K1XA 3PFKA 2GD6A 4I3FA 5IKEA 5B58T 3COJA 4Q16A 4V0QA 4AO7A 2E89A 3RSNA 2GLUA 1SD2A 3FMOB 3MBKA 2NO4A 2F00A 1CZKA 3LKBA 1TU4A 3N0WA 3W4JA 1QVZA 4G0ZA 1EINA 4P4SA 3FK6A 5BV8A 3M34A 4COOA 4W9NA 1LX7A 4RHUA 1KFJB 2EKBA 3OYGA 3GGPA 4N3CA 5TRDA 1TL8A 4OI0A 1F4VA 2JA5J 4JCCA 5JJKA 1RJFA 4PSDA 2DO7A 5EUBA 1FU4A 4YI3A 4L3WA 1RXVA 3P9CA 3SGLA 4XZ3A 5I7UA 2J08A 1M7BA 3AXSA 4JJ4A 1YB6A 4ZQFA 2PKYX 4M8KA 2W2QA 2I7XA 4V0LA 1IQRA 5ILGA 1RCTE 1SQFA 3OZCA 5C1OA 4BIIA 1EX7A 3BR0A 3J81K 5KHDA 1QBKC 3ISTA 4FT8A 1YR6A 2MJLA 4KR6A 5GADl 5E17F 5DSZA 2V6MA 1DQUA 1G4HA 4KMOA 4IICA 4PGAA 5FR2A 3N2GB 3J80Z 1XDWA 4J1TC 3VR2A 4AJLA 4F1WA 2PG3A 3G2KA 1B6TA 1VPTA 4M6YA 4E5VA 2Z2JA 4UU8A 2V1DA 2P6TA 1ISPA 2X3YA 3A4LA 4FCCA 2ZMEC 5KNCD 1Y3AA 2XRYA 4ZOBA 1L8OA 4QUIA 4FZRA 3TOVA 3U17A 2O1SA 4C4AA 2J0QA 1VBMA 2D0OB 5IXJA 3VTKA 1Q7BA 3BGVA 4CI0B 2FPUA 3K16A 1MNDA 4B1RA 2BFAA 2KWIA 2Y30A 3O26A 3MJRA 4I4TA 4CMKA 2WY2D 4K6HA 5DW0A 1NUHA 1E0EA 2OD9A 1ZS9A 2VHYA 4DV0B 1OWLA 2NYVA 3B9QA 1K3UB 1BXRA 1RVDA 2XCSB 4P0QB 4TUYB 3LKZA 3NHSA 2XNSA 1Z67A 1X77A 1WIWA 5CJJA 1CZNA 4Y52J 4FOPA 1DAOA 3UBTA 1PUFB 2RJ3A 5EHQA 3ZDRA 4A3LJ 4LC1A 4S0HB 4XSVA 2X86A 2YFHA 4PIVA 4CTKA 5IJ0B 4KR9A 3S15J 4UTRA 4I09A 3S2DJ 3HU2A 3THWB 1JJBA 1AA7A 1ZZEA 2B0JA 4L1KA 5BW6B 2PUDA 1BG6A 2CD9A 2PIDA 4WXYB 4DUGD 4LNUB 3CXUA 3ZQCA 1UBGA 1VF9A 2DFEA 5E20A 1JR3E 1P73A 2PX5A 3AUXA 3H8VA 4CODB 1F3OA 4K9PA 2JFOA 3JVDA 4CYCB 4UVAA 1WX1A 4QM7A 3IEKA 2CWDA 3HL4A 2JFZA 5FI3A 3O8DA 4KDEA 2AH5A 3TIFA 3UCEA 2R97A 3HDVA 4IUYA 4M1MA 3TOXA 3ELUA 3QU7A 4IIJB 2YY7A 4XRRA 1ONNA 5FP0A 3JAMZ 4CNQA 3JR9A 4YT8A 2FP4B 1JXMA 3I2GA 3LPAA 3UC5A 2HHCA 1KYYA 1IHXA 1CUZA 1O96B 1UM9A 5HZGA 1VHTA 2OOSA 1WUYA 2VLBA 2PU5A 3I6QA 1U2ZA 4CL8A 2C3OA 1PV4A 2QWWA 4RLQA 1SA0B 2ZJZA 1GGHA 2Z6UA 2ZSBA 3AJEA 4ZT2A 2AZXA 3F22A 3A2MA 4FFBB 5C4MA 1X92A 2JGJA 4KYUA 2WWIA 1XTJA 1VB5A 4HLYA 1ZUIA 2QTAA 2WYIA 1C7ZA 4FNGA 2A0YA 4I2VA 1BIAA 4BQNA 1D0VA 2SKCA 1A8QA 5J4HA 2KDOA 2EFGA 3FJOA 3RUPA 4Y2HA 4FPXA 2P7HA 3H5TA 2GAFA 4RIFA 2O7NA 4YLGA 2W2KB 2LE0A 2A3NA 2LBFB 4GG1A 2OL4A 4JL8A 5IBRA 1EFVB 1F0PA 1LPMA 2PSFA 2P9JA 1OT3A 1U3UA 2K2WA 5LJLA 3VOAA 5HE8A 2XPCA 2P5YA 2WSIA 4UE2A 4B2YA 1DIOB 4KIFA 5F0FA 2QX6A 1IBMB 2DUUA 4D3DA 2WF5A 4MDYA 1VPWA 1FDTA 4BATA 3RDPA 2BRUC 1AHDP 3KQLA 1NVWQ 4B8XA 3NARA 1ELOA 3B8EA 2WYOA 5A9SA 3VM6A 2YBEA 2WV9A 3IH4A 1DWOA 4XM3A 4L4YA 2HXIA 3F96A 3C1DA 3M4OJ 4RF3A 5LEJA 2PANA 1C3JA 4RH3A 3R0ZA 2CY0A 3JQAA 3ZKWA 4H7EA 4CTNA 2KZGA 1PGPA 3NHWA 3RTGA 1IQUA 1DV2A 3TDNA 4H7IA 1FYMA 4B3MB 3OESA 3WU1B 3KU4A 4NYMR 4Z0HO 4EHHA 3QU4A 2VATA 4FGLA 4JGIA 5KNCA 5LR6A 3DV0A 1JR6A 1L1QA 2D1YA 1DC8A 2XYRA 3HABA 4HGNA 1Z18A 1ZHOA 4OAZA 4EG5A 1U2PA 1JBEA 2NT4A 5ALXA 1FJXA 5JQWA 3BB1A 4X3OA 3U4AA 4D25A 1H1DA 1MBKA 1UCFA 2IXSA 3P7NA 2VJOA 1XPOA 5EQDA 4QPOA 2JAUA 2CW0F 4LBVA 2EA4A 4AMZA 4DW6A 4YX9A 4DV1B 5IWAB 1GUAA 1G4UR 1O6FA 1V8DA 5JZVA 1XLUA 1SCNE 2MSLA 2PX0A 4HTFA 3HY6A 2MLGA 1H9TA 2NSLA 3HACA 2WQ6A 4TMTA 3DKWA 4EJVA 4S0XA 1G6NA 1Y9JA 1QA6A 4IHQA 4JLAA 2VWQA 3RABA 4ATNA 5JCXA 2ZMEB 2AFIE 2YYZA 1Q1QA 1Z5NA 3IH3A 1ZRCA 1ZPDA 1X0VA 2MR6A 3KPHA 4IHYA 1CUHA 1XNQB 3ZQLA 1EA5A 2QVLA 4FWIB 4I08A 4P3NA 3KUDA 1WNFA 4UZEA 5ALMA 1JLRA 4QNNA 2FUEA 1TKRA 2AR7A 2RB4A 2YYSA 3BA6A 2Y99A 4WZAE 5IYZF 1Z34A 2BN4A 2DBZA 2J5XA 4RV9A 3TWOA 5CVUA 5CRIA 2QUZA 2YR0A 3ND8A 4X3PA 4Z86A 5TMEA 5ALUA 4CEIB 4Z9FA 4CCWA 3MWEA 2EFJA 3AM1A 1THMA 4B4OA 3IUMA 3FSGD 3NTLA 1GTG1 3RVPA 5E7QA 1AS0A 1P45A 3EZFA 2H1CA 2R7SA 4C78A 1MENA 4CLHA 4UEWA 4DG8A 3RIRA 4EO4A 4EPWA 3CZ9A 3GPBA 2QGUA 2GDZA 4PJMA 2FBHA 4RX1A 2JQ7A 3DZFA 1U7UA 4Z3OA 3U7FB 1QHHD 1GUDA 4B4DA 1YL7A 1XB4A 1M2HA 2IHTA 4DZZA 4LG3A 2F2TA 3OCYA 5HDGA 1BEZA 3E7WA 3H2KA 4DIUA 2WYWA 4D46A 4AMUA 4IDDA 3UV3A 3G68A 1R50A 1IZ7A 4K9LA 4OHPA 4LLNA 2FV8A 4DSTA 5DYMA 3THOA 1PP7U 3S1AB 2PRIA 3CRRA 4F9GA 1FNCA 4JC5A 4R9SA 2AEFA 2CSXA 2VJYA 1LI5A 5JXHA 3LBHA 4LW8A 4MUNA 2DB3A 4ESOA 5CT9A 5TS3A 1VKOA 4RTSA 3I2FA 1MXHA 1YBHA 2I6FA 1F3LA 2OY0A 1MX1A 2VS1A 1O7LA 1NR5A 1PWHA 1FX7A 2CXHA 5F0HA 4MKHA 3G2OA 3HGTA 2FQWA 2HWWA 2B8JA 2YC2C 4OP1A 2FF7A 1FYFA 4X6YA 1XJ5A 3I59A 6AT1A 2CEAA 3KSMA 4EY7A 1FX0A 3AP1A 2QBYB 1UMCB 2V1NA 2R1TA 3AFHA 4NCJA 5ALHA 1SC3A 1TVKB 1UT5A 4DWJA 1XZPA 3M4ZA 2HSEA 4MQ4A 4MRAA 2GK4A 5IFKA 1QIDA 3G1TA 1RYHA 3MBOA 5IAJA 1ZJYA 3PNOA 5B7QA 4LFBB 3WL3A 2GOXB 1VSTA 1CUJA 4RGSA 3I54A 4HEA1 2DYSH 5DCMB 2VK8A 3F3XA 3K0AA 3UWDA 2PGLA 4RWEA 5AVJA 2UV1A 3N2LA 1YZ3A 2AS5F 4WEQA 1MO2A 1XCMA 3IP6A 1K8RA 4EIWA 5KTPA 1GAEO 2VQGA 1EBUA 4RNDB 5H8WA 3KDAA 4IJWA 5KPDA 2HLDA 2CYBA 3LBYA 1Y4AE 2GEFA 3HUEA 4RSRA 4XW2A 1AGYA 4OLJA 5FWNA 1FX0B 2HK8A 1GLVA 4N9WA 4QA9A 1RI4A 2TYSB 4HGQA 2IW5A 1Z8DA 4OJMX 3NXKA 3CUQB 1W5AA 4XX0B 1LS1A 2ZC2A 1V7QA 1KP2A 2FZGA 4TT3D 5AW7A 4GXOA 4IOLA 4AD9A 3PXGA 2E1NA 4X7MA 3CSUA 1KZ6A 2G9QA 4HNGA 5B2ZA 5EXTA 1OVGA 3K9BA 2Z56A 4HF1A 2VOEA 2OGTA 3CVVA 2KRHA 2CV1A 1JBKA 4I14A 2GXSA 4KO1S 4V39A 3ILHA 1GGKA 1B0ZA 1ODLA 2GQ0A 3DQZA 3T8YA 1O97C 2IYFA 4F7WA 1IW7F 4KRGA 3GPCA 4GXNA 1PR4A 2QL7A 4PTZA 1ML4A 3FPEA 4FC6A 1QOPB 1P4WA 4D5GA 4NB5A 1V11A 1E7SA 4KACA 4TPKA 4YV1A 2CG4A 4M49A 3CGGA 3G5MA 4LYGA 4XARA 5JJBA 3QE9Y 3QODA 1NMZA 4UBJA 3TYXA 1C30B 2V7FA 3GN1A 2AE1A 2XJ9A 2PKCA 2JMWA 4EO9A 3JYNA 5H81A 1P44A 3MVEA 4YEJA 1I4WA 1CERA 1E96A 1NN3A 2RH4A 4W63A 5CVDA 1P92A 4EI2A 4ABTA 2ZSAA 4XGIA 3B9RA 4YHBA 2C99A 3TGWA 4MLDA 1GRVA 4KGZA 1PNTA 3NP9A 3D6VA 4ND1A 1THGA 2HF8A 3ANMA 3DDSA 4EMBA 4MV8A 4TWAA 2Y1GA 2NNYA 1B14A 1JZTA 1HOTA 3AUJB 2EEPA 2OGSA 3LPNA 3P27A 3PV0A 1YW9A 3EUEA 4MV7A 2XXAA 1L5QA 4PX2A 2Q1WA 3OTWA 3PUIA 3MINA 4FVTA 2GH1A 4UUAA 3TW0A 2IA0A 4CG3A 1DIBA 4R8MA 1L8XA 1N1EA 2ZSIB 2J7PD 3QXGA 4ND8B 2CLCX 1A9YA 2NO0A 4MPDA 2ATXA 4KWEA 1OFUX 1M2FA 2NNLD 1HURA 2PBZA 4WA7A 5ALTA 1CUSA 3IRUA 2WWRA 5FO0A 1IK6A 2P2SA 2PRKA 2XDWA 1ID1A 3M4NA 4D56A 4N5MA 2PCJA 2OZEA 1D2NA 3L79A 3WTYC 4CMAA 1UH5A 2X6XA 1R6TA 3PGLA 3K92A 5B57C 5BYKA 1NULA 1OZAA 1RYFA 3PXCX 3AR3A 1S9DA 3U37A 4CEHB 3OIPA 4KB5A 3E03A 4OSPA 2QW0X 3WK8A 4F9FA 1YO5C 1I4LD 2POCA 3NRCA 1F4KA 4YWJA 1AKHA 3EEYA 1G55A 7MHTA 1HPLA 1IXCA 1J97A 1L5HB 1BE8A 4YJ3B 4RY2A 3GYGA 4NJOA 4JBNA 5F7ZA 5IAKA 2P2YA 4R69A 4PC7A 1Z63A 1ZNXA 5DEIA 1CNFA 1T98A 1GCGA 1NSFA 2X5OA 2ZUBA 3K0CC 4HXFB 4IXWA 2K27A 4J0FA 2GCOB 3MTEA 4US0R 4OB8A 5A9RA 2G4VA 2QZ4A 3VPCA 4U9UA 3WS7A 4F3TA 1Y1WJ 2QJOA 2VL7A 5CQGA 1GFZA 4K9DA 4FISA 3GHYA 4A2QA 3KEYA 2F4VB 2R6CA 3R5TA 4HWPA 3GF4A 2IXTA 1GIAA 3P32A 3PQ7A 1DIGA 1M7GA 4II2A 3DF7A 4Z53A 4YPOA 2CLDX 4XFKA 5BXQC 3EQZA 3WK9A 1D5VA 4TXMA 3FK7A 1HFEL 1U5BB 2FSHA 4HOYA 5G0TA 3UPUA 5KCMA 2JHFA 4WW0A 3FNHA 3ADBA 3H1FA 2IK8A 3BVPA 4F45A 2JN6A 1NR7A 4HEJA 3GRYA 3SKXA 2Q5IA 3H13A 2ZUTA 2IA1A 3OZTA 4NICA 4UNNA 5M5YJ 4R16A 5DI3A 1W2GA 3L18A 1QQBA 3R0AA 4ERNA 2NADA 2QT0A 3M2TA 2HIHA 4IIEA 1KU9A 4G63A 5LD2B 4KR3A 4WADA 2YVLA 1WQ1R 2ZUCA 2WEKA 4FYWA 5EGNA 2Q45A 2FRDC 2R7KA 3ZJ5A 2H0QA 1U7XA 5CITA 2X40A 2AF4C 2O50A 1TAUA 2QR3A 5EE3A 2BONA 1ST3A 4BVLA 4BQRA 1E3IA 2R6ZA 5EI5A 1AGXA 3FXKA 1CEEA 3HB0A 1CP2A 2R2AA 3OLWA 1EFRA 1M1ZA 1X38A 1KDPA 3A3KA 1AS2A 4UOZA 3V8PA 2O8DA 1ODJA 3ZTYA 3NB0A 4DZRA 4AY3A 4WZZA 3UJDA 1JEYA 3HY3A 4A8JC 4XB1A 1MMFB 1BM9A 1M0WA 1R1DA 3COVA 4OYLA 1M6VA 1XAIA 4RVOA 2HMVA 4D74A 3I3LA 3ORYA 3ASNH 1YZKA 2ZRQA 2F1IA 4O25A 4IFTA 3TUJC 5HIAA 1CY4A 1NBMA 2YJGA 3GJ6A 3OOEA 1V9CA 3ZV3A 3FIUA 2C04A 3AR4A 1P5JA 3P4XA 4B3HA 4I1PA 1YRWA 3FYUA 3L4SO 3G0HA 5FBZA 2QRPA 2NUAA 4NQWB 2YWEA 2CMDA 3DBHA 3IC7A 3QU3A 5B6JA 2AFIB 1E5DA 1B26A 1E9DA 1YBMA 3GLKA 1UANA 5H02A 3UYKA 4JU8A 5A6VA 1U0LA 4BS9A 2WADA 4YRVA 2FPOA 2ZIAA 4KQ6A 5I9SA 5GADJ 2C2XA 2ETVA 1NVVR 3HVUA 1K78B 5HQTA 3M81A 5CAEB 4LG0B 1DZIA 2HQOA 2CLEB 1K7FB 2P0YA 3WDKA 4DSAA 2LZ0A 2IS4A 1EQAA 4DLNA 2E37A 3MKYB 5HS9A 3VODA 4XE5A 1TMGE 1Y7HA 2NZ2A 3KXLA 1XZHA 3W5DA 3TZEA 1HTWA 4JP8A 1AURA 4KVGA 5DYWA 2Z16A 4HXYA 4RXUA 4UZFA 4KYTA 1UQUA 3RPUA 2O1XA 1JQLB 2X8AA 1Y0UA 1ZOPA 2QXYA 2AQKA 2Z5FA 5BV0A 3JQEA 2DTZA 2K3FA 4MV3A 4XASA 4EAAA 4YAIA 1CRWG 3OJFA 4M98A 5ITZA 3OYKA 4JJIA 3WGQA 2INGX 4L8GA 1MRZA 2QD1A 4BMPB 3DOCA 5BOSB 3DNMA 4XKCA 1KK0A 2HD4A 3L7WA 4POAA 4N5NA 3D4IA 1O8CA 2OHIA 1E4EA 1ZW6A 3DP9A 3HCRA 1JTEA 2FEXA 2P90A 3M1LA 3OJLA 4JEUA 4W1QA 4WLFA 5IAAA 3RE1A 5KKCA 3DM9B 3HBMA 4PAOA 2XHEA 4IIVA 3UOAB 3ZCPA 2O0YA 4IIJF 3TIVA 2WC1A 3R3WA 4FN4A 2O8NA 2PO5A 3SHOA 5JW6A 1X1AA 1JHMA 3F6OA 1RRFA 1V25A 2DBRA 2HK6A 2K3PA 4Y3OA 5ED4A 1D2CA 1F06A 1Z5PA 1XQ6A 1Y1LA 3K9QO 3PHHA 2WIFA 1TM3E 3LDFA 1Z17A 3OUUA 3P9PA 1SZPA 4U0VA 3RH0A 1EMDA 3R5HA 4FKZA 3OCVA 1KWGA 2Z1DA 3VJRA 3O90A 1GARA 1SOUA 2ZI3A 1SBZA 2E21A 2X2OA 3HPQA 3JVVA 3A4MA 4FHFA 3PS9A 4AZ3B 1ZD9A 4DDVA 4DIOA 4JV5B 1F9EA 2XY4A 5EJ7A 3GYHX 1XU7A 2L0XA 4L6CA 3EWIA 3OFSA 3C24A 4XA8A 5T8KC 2EKDA 3WRWA 1PR9A 1ICIA 2BGLA 2RHDA 3AOGA 2QE7A 1LBQA 4QDTA 4EDHA 1ITYA 1WY5A 3H0CA 4QTXA 3VNUA 3UBMA 1N2IA 2WF7A 5LXTF 1GQRA 3AP2A 2QDXA 4O02B 4HSTA 1WLYA 1LDNA 5HLGA 4CH7A 1P9RA 3HJAA 4OMCA 1BSVA 4WZAA 1Z1DA 4NFHA 2W2PA 4LLLA 1UJMA 4OXKA 2DA5A 3HA5A 2ADUA 3G85A 5DCYA 2V0CA 4I9UA 5EXSA 1JTFA 1BFKA 2H7YA 3M6LA 4GPD1 3SEFA 1GNTA 3IVAA 3AUSA 2R7XA 1B2RA 2H17A 3GVXA 3LCRA 1M0EA 4F3RA 5FYDA 2NU7B 1P77A 1H69A 2GBCA 4ZAYA 2I54A 2YQ4A 1R12A 1WDKA 3EBOA 4RFLA 2HA0A 4OUDB 5JEEA 3U6BA 1VHLA 4PBRA 2R93J 1V0JA 1AHIA 1U80A 3B7PA 1JWAB 4U0KA 1OF1A 2LR8A 2W2XA 3D3JA 2ESHA 3NHZA 5ERYA 1QWOA 1ZI9A 2G4LA 2R6GA 3Q3GE 1U7PA 4EF4A 3AYXB 5KK1A 2CGPA 2O2SA 4MHSA 5CJPA 4YJ2B 3H5IA 3LSKA 2EQRA 4GO1A 2HA4A 4QDJA 4TKUB 5C8ZA 1UBEA 2XC7A 2QW1A 4GOMD 2M6KA 1CQXA 3RNLA 1LCIA 2QTLA 1A9OA 4C21A 1DKUA 3D5TA 4M1OA 4AWXB 3CW2A 1XAJA 1NR1A 2QN8A 4BP1A 2I62A 3K4HA 3VSKA 5I7EA 4MIMA 2C7QA 5JWHA 1Q84A 3LPLA 1JTVA 3L1UA 3JTGA 1V3FA 2CXSA 2Q1UA 1IN8A 2QKYA 1ZSYA 3ZE8A 5AUQA 1C7EA 3ICPA 2PSJA 3BK7A 5H80A 1GVHA 1Y8QB 1YHNA 1CRLA 3V48A 1LLCA 4MDHA 3RVSA 2V8BA 1KQGA 2X8WA 1VQ5I 1E6UA 1PQYA 2RHBA 3GOQA 3LA8A 5BRAA 4QUJA 1C1XA 5BO5A 3VKUA 3JTHA 1JDUA 1QRAA 1W29A 3CM0A 3TMAA 3W2HA 2Y8EA 3UWMA 5EC8A 2E49A 1BJAA 4NFYA 5EJIA 3RVRA 2HYIC 2QD4A 1P7PA 2QG6A 1NGSA 2VDNB 3PSHA 4NE9A 5DX0A 1DVRA 3LP8A 3PX2A 5I9TA 2QLNA 4IWNA 3GLFA 1NPDA 2WYVA 3L04A 3JQGA 1X8KA 4RMJA 3D7SA 3AHHA 3D81A 1K83J 3HPGA 1G8SA 3ZLVA 2P8TA 4EKYA 3OWXA 4CMIA 4XTCS 3IYLW 3EZXA 2A57A 1M1XB 2XUAA 3PENA 2NSDA 3BMQA 3GFVA 5LMCA 1YDEA 3FUXA 4ZYGA 3RFCA 2I7DA 3ZWCA 2XPVA 5BT8A 1SB8A 3KTFA 2QQFA 3ZK9A 4BZQA 3LDHA 1VHDA 3F6VA 1W88A 2RHGB 3P2EA 2QQ0A 4RB1A 3LM8A 3M1AA 1CULC 2WWFA 3KVNA 4TMFA 4GYIA 5ALSA 3GLIB 3IHWA 2QL5A 1S72I 3LS2A 3SM9A 2HMYB 4MA5A 2Q0QA 2XJ4A 4N0MA 3R0IA 1YD7A 3OT1A 3P9RA 2E1OA 2Q46A 1Y3FE 3P9NA 4UUMA 1C0EA 2CQKA 1C8LA 5AH0A 3BULA 1RTKA 4JQCA 2HQNA 4Q4AA 3DEWA 3MBIA 5K4GA 1BBYA 3VB2A 1HYHA 2IEAA 2WJ6A 5FUVA 3V4LA 5JT1A 4KT5C 3K9GA 1IOWA 4JNCA 3B6IA 3OLYA 1Z6PA 4W7SA 3IQGX 3O4JA 3S4YA 1PR3A 1FSEA 1A2QA 4CF7A 3KQUA 3T0FA 4FS8A 1KBZA 4QXQA 2GAOA 1WCXA 5DM1A 5K09A 5L3DA 1C9YA 2HEGA 5B4TA 2FPPA 4KIUA 1NYLA 3DWEX 3W5CA 1M8KA 3KBBA 1HC8A 5DHPA 3A1VA 1RI1A 3BSYA 4ROTA 3SBDA 1YK1A 2BKEA 3E61A 3G6KA 3DLIA 4KXWA 3BGWA 1TQPA 1IY1A 4QBIA 4H4DA 1RYZA 4GYWA 4RANA 3VXKA 1DCMA 3SI7A 4EUEA 1BOBA 2P4UA 5LQAA 1P6QA 4WFIA 4TXNA 4YP7A 4C0QC 1N3YA 1Z0AA 4FFPA 4YUVA 1ZNZA 2QWXA 4AM3A 4EPTA 2PKXA 3QTTA 4GU5A 1W5CC 2P6OA 1CSEE 1YQTA 5COAA 3RFTA 2OZKA 1M73E 4LI3X 4GFDA 4V1CI 3PNSA 3N2EA 2BM9A 2C2YA 2QQBA 2Q7DA 4P3OA 1I1SA 4BZXA 2QVCA 2QYHA 1Q77A 1P81A 3CD6I 2BPOA 2FOXA 2FKAA 3OZFA 4O4LA 3VPGA 3CMAI 2FY8A 2VDMB 1ZMBA 3FNQA 1XLTA 3NT5A 3P0FA 5K0TA 1K0UA 5CBKA 1HL7A 3RRZA 3FBWA 1HRDA 5M04A 4R2KA 1OC4A 1EVJA 2AW3A 1EX9A 1T1JA 3BGIA 5C8VA 4M36A 1P1CA 2R8EA 4X8HA 5FYQA 1S5LC 3ROTA 5EIHA 3VV2A 4L5JA 1SUBA 1ECCA 5FPYA 2XHZA 3OS2A 5CB8A 2W6QA 4D6XA 4YJ2A 1VG1A 1A8SA 2VNKA 3ND5A 4IDCA 5ADVA 1LC0A 3HCEA 3N86A 2AN4A 2I99A 2IL1A 3Q7SA 2BSQA 3CIOA 5H82A 1MB0A 4BE1A 3WMEA 2OBXA 2ZBUA 2PMUA 2ZULA 1MMAA 2UDPA 3KTAA 2C8VA 4G1VA 4PRKA 4PXAA 4BMDA 2ENWA 3K69A 3W3AA 4BYGA 4D80A 2GYWA 2DERA 5GPBA 2P7VB 2DJ5A 2WPNA 4LC0A 4EJ6A 2D5VA 3CEAA 1BGVA 3FUWA 5FTNA 4P3KA 2WRZA 5K6TA 2VJPA 3HTXA 3W2WA 3NXSA 3OL3A 4IEFB 2GHRA 4F4FA 1TMKA 4RIIA 4B7UA 2XGMA 4YRBA 4KPUB 3AVYA 3DC7A 3J80A 2OGZA 2AMVA 4DG5A 4JYZA 2AOVA 5C1IA 1GKKA 1E2BA 2CDRA 2UKDA 3I9NA 1QS0B 1TJ5A 3E5MA 2L9VA 1U7OA 2OM2A 2PX9A 1YRYE 2IZ0A 3IIMA 4G9EA 4I66A 4Y6RA 4WESB 4FT2A 4C3ZA 4Z7JA 1L9XA 5FD5A 3T9DA 2BY3A 4MGRA 1E6EA 1JXSA 1ULSA 1U5BA 5EIAA 5FA6A 1ADGA 2A33A 1LSSA 4R2HA 2NZXA 4QHTA 5DGDA 4AS3A 4D4KA 2XZLA 3OLZA 5AJYA 4Q18A 2NZWA 4U7PB 4BCBA 4X0EA 3QLUC 4EI7A 1OBVA 1NXVA 1XU9A 3BBLA 3DAHA 4PZDA 2JDID 3E3AA 4EZIA 1FYKA 1QSGA 1U1EA 2DT6A 1VCMA 2AA3A 2C5SA 2Y0BA 3CLTC 3CSDA 3PHLA 3X0DA 4DSZA 1WJFA 2B1RA 4PK4A 2E2WA 2J85A 3MLBA 3T9BA 4B3JA 1SHKA 2BHNA 3OY2A 4KNWA 3FSGA 3GFTA 4MPRA 5LVAA 2UZ0A 4DIBA 3ERMA 1EP3B 2QD5A 3EARA 2G5GX 1NF8A 3BQYA 4M0MA 4FW8A 1GQQA 4L5AA 5BUZA 5LU8A 4IO1A 1R0KA 1WVMA 4KLCA 5JBQA 4DV2B 5A7HA 3CIFA 2C5AA 1IBCA 3J7AC 1QWSA 1NI5A 3MS4A 3F6CA 1X1BA 1CV2A 4BAYA 4YYEA 1E94E 5LN1A 5IPAA 1MX9A 3BGOS 2GT1A 2ID7A 2ZSEA 4BMOB 2YY5A 3OFKA 1R71A 5C1BA 3UN1A 5TF0A 3WE3A 1X0XA 4EEFG 2X7JA 4OQZA 2Y0SA 2H57A 1AB5A 4XLFA 2IHYA 4KN7X 3CZAA 1JE8A 4HXEB 3DMPA 4JL6A 4Q4ZF 1NQ5A 4V1CB 3W2AA 2YMLA 2NZ8A 1ZBDA 3C1UA 4DF3A 4IH9A 1GFWA 2QZJA 3WBKA 3SZLA 2H1SA 1W1WE 3L9FA 1XEXA 2FQ1A 1NYQA 4O2RA 4OMUA 4ZO6A 2MSDB 4LRUA 5DHAA 5EAIA 3U7QB 4KDFA 1CEQA 4QXRA 1G8PA 4ZZ3A 3IEMA 1J49A 4J4BA 3C48A 3NJ8A 4KOAA 2ZI7A 2Y9MB 1VFPA 1DT3A 1OV4A 2DVMA 3AKZA 2P75A 3BQNB 3IOEA 5JDIC 1WVIA 2RGRA 1SXJC 1K6IA 1PVEA 1CR1A 2B3TA 3DB1A 3PFHA 3TM5A 1V71A 4ZYYA 3AHEA 2VRCA 1V5WA 1E5QA 3IAS1 3RS3A 3LZ6A 3UFBA 4BAUA 2EKLA 1K66A 2XRNA 3HVKA 3I9V6 1CVRA 2IT1A 4GPZA 1PEYA 4ZDIA 1XK7A 4G1CA 1XEAA 3CH4B 4BUCA 4DYHA 4IL5A 2MTBA 2PN1A 1YJAA 1XQXA 1HDIA 2O2EA 2VC2B 1U2RA 3LUHA 2FXVA 3ELBA 4TTQA 1ZGGA 3RJPA 2YIMA 2ZITA 3BFVA 3Q41A 1U9CA 4TLEA 5ES3A 5K0NA 5CLJA 5PGMA 3QPUA 3WYNA 5EGSA 2R6DA 2O0KA 1E0SA 2HPZA 3RJMA 1LE8A 1KMNA 5LMZA 4PYIA 4DPMA 5KPJA 2AL7A 2IWHA 1XKTA 3CU5A 3MPOA 3LXXA 3OTIA 4K8OA 3V32A 5JVTA 4WXCA 1MB3A 5BUSA 1IXZA 4RK6A 4XYLA 1IUKA 2BISA 3TDKA 5BNTA 4IMPA 4DLSA 3WRXC 4Q15A 3L4BC 4AZSA 1AUPA 3BL8A 4PANA 1FBQA 3WLEA 1WHTB 1W0JA 1BJRE 4HRIA 2WNIA 1UXOA 1XZCA 2ECQA 3NX4A 4HRXA 1IUNA 4L78A 1IM8A 3DBVO 1HFWA 3HZRA 4PAWA 4QBGB 4ZGBA 4BEJA 2R0QC 1U5CA 2QN3A 5HYVA 1EK0A 3DNFA 2C95A 3UIEA 2Y4OA 4BP9A 1F38A 1SPXA 2Z5GA 5EYRA 1GPWB 1BD3A 2BHTA 3VZBA 4CL0A 1K78A 1U0BB 3QVGA 1P7ZA 4BFSA 2VBGA 2IZ5A 4LJ4A 1DDIA 1FMWA 3GX4X 4BLUA 2H31A 4P9UA 2QRNA 4KLAA 2CF6A 4GECA 4EL5A 9LDBA 1MMSA 3USCS 3QFFA 2NS7A 1HR0B 2XDAA 1AXRA 2B69A 3AXTA 4QOIA 5I4IA 3CZPA 2YWCA 2JFBA 4F92B 3IELA 4ISCA 1TVEA 2HU7A 3E48A 4DV4B 4NWIA 1TOAA 4O2BB 3BR2A 3ANXA 3AUTA 4IHTA 2IXAA 1PT5A 3SK0A 1KYIA 1MEEA 1PIWA 3TB4A 1AV6A 4CHTA 3OS1A 2J5BA 1GAWA 2C42A 3C39A 2BEUB 3LOPA 4MR9B 4QPDA 4HNTA 4LGYA 3EQ8A 2LTAA 3PITA 3V46A 3CZ6A 2ZSIA 1YRHA 3FM5A 2AXEA 2ZJBA 2DM6A 3N28A 4M2LA 1W94A 5FWXA 4WFKA 3NYWA 4Z99A 1SR8A 1ABBA 1TQ4A 2E1MB 2CF5A 1ZVVA 4NV0A 2XSJC 1CDDA 2PBIA 3K70C 4L0QA 3K8OE 4URHA 3RWMB 3RFVA 4WBSA 1E5XA 4YONB 1CUBA 1GG8A 1QDEA 1QIEA 1LEBA 1QR6A 2XE6A 4AJOA 4YROA 4NNPA 4EGQA 3RHSA 1JSLA 1VJ5A 1XTAA 1FSFA 5T5QA 3W7AA 3B3QA 1AKHB 1KYXA 4MJ3A 3NEUA 1OLUB 4AFNA 2R5FA 2CLSA 3U62A 4D99A 1ZGCA 3C6MA 4O8CA 2O0JA 2JBAA 1SCJA 1N9KA 1NLZA 3AL3A 4GKVA 1MTOA 4GLLA 2XSDC 1LEAA 2D2VA 2JAPA 2VG8A 5FKLA 2O3RA 1J4AA 4MYRA 2C57A 4MRMA 2OOKA 1KJYA 2XWQA 2P4SA 1Z0JA 3HVIA 1LRLA 4YJHB 4XCQA 4XJSA 3KP7A 3FRIA 2DMPA 2RH8A 4V19K 3PC8A 1D0YA 3PEFA 2EWMA 5A71A 3H2YA 1XC5A 2DPYA 2FJPA 2R5YB 3KAQA 1GSAA 1J5YA 4FT4A 4LY0A 3CLSC 4IUBS 4BU1A 1CUDA 1TCUA 3ZHVA 2WLSA 1XRNA 4BWFB 3U2RA 2Q4TA 4JQYA 4A69C 2WG0A 1DPUA 3KU1A 4X84A 3T99A 2G83A 1BN6A 3SIWA 2Q29A 2IV3A 3QEAZ 5HODA 3EIEA 2F9FA 5F1JA 4KN5A 4MNTA 2XUIA 4YBRA 3M6AA 5JMPA 1YACA 4LUCA 2GM4A 3PBKA 4A8JB 2P5VA 4RAQA 2X7XA 1I2BA 3ZX4A 5JHHB 3SOPA 4CKWA 5D5XB 2H51A 4F4IA 4MEYF 2QX9A 5DI3B 2FBKA 3I37X 2VBFA 3IULA 4KUGA 5AVSA 1TEZA 3ZZ0A 1GL3A 2GM9A 4BUJA 3IQXA 1RPZA 1F0NA 2CQNA 2HSDA 2IHBA 3H87A 4FLMA 1F1JA 1FEXA 4QODA 3ZWAA 3EVFA 2XB0X 4UHEA 2VBXA 5D3KA 1EWKA 3HRUA 2WKSA 4B9EA 2G71A 1JDTA 2ZI4A 2NO6A 4G6ZA 2C77A 4K46A 4BDZA 1OU0A 1SUEA 5M7EA 2CBXA 5IMSA 3CT4A 1GG9A 2XR1A 4UQPA 1YITI 1WVRA 1FRZA 2OORC 1YO6A 3AL2A 3RBXA 5LMNB 2ID8A 4Y0NA 4GR4A 4HAVA 4KO2S 4J0QA 1XWIA 2UZ3A 2VP2A 4TYQA 3ZGOA 4BLVA 4R0VA 4GYGA 5FLEX 5FRNA 3RSZA 4CCMA 4C14A 2LREA 5F1YA 1HLDA 1PUXA 2HJWA 5DBIA 2J32A 4LLGF 1X7DA 2VTBA 1ZC4A 1NP7A 1ZL0A 3K30A 4PIMA 5BN3A 3BIFA 2V7QD 2Z3WA 2Q28A 1XA4A 3R3SA 4XGRA 3RK4A 3UKGA 1HNNA 3DEKA 5IRCD 3QPCA 3G1UA 4ARIA 4LQDA 3PQ8A 1C7IA 1HL3A 3IJPA 2CCGA 3A11A 3NBKA 5ILQA 2DA3A 5K7SA 2TCTA 2PHZA 5D5HA 3Q4GA 3T4UA 3H2GA 2ONKA 4TTTS 3LV8A 4A23A 5K6RA 1XA0A 2GEBA 2NXJA 4G07A 4NABA 5WRFA 5KWJA 3BJEA 4ZGGA 2IUYA 4CM9D 4LOAA 2I9KA 3SVZA 3B6EA 1TLFA 4DLYA 2QX7A 1JAYA 1KJIA 2RKHA 1FFSA 3QVWA 1PYVA 2Q27A 5E9AA 4D82A 3DOJA 1XRMA 1AKVA 2BZ0A 4JX4A 1BWPA 1PD0A 2VWHA 2QQ5A 4DMFA 1N2GA 2QTZA 4U7GA 1KFEB 4EECA 2UUZA 1QZ3A 2BKVA 3FRJA 4YAJA 3LLSA 1YIOA 3BPXA 2D2XA 3MB8A 1P7CA 1UMKA 4OFBA 1Y7LA 1BDMA 2FR8C 3FRHA 1PVVA 3H4IA 3KD3A 4OQLA 5AFSA 1EWVA 4WRRA 4QZVA 4HEQA 1B8NA 3IXLA 4F60A 2PUCA 4JNKA 1XZAA 4ZMBA 5I9LA 4ZYVA 4JVLA 1W85B 4M8NE 2Q4EA 2JIBA 3ROPA 1IWBB 3CMMA 2PLYA 2QBYA 2JIQA 1RAIA 5IT9K 3BN3A 4K26A 1C30A 4O3FA 5HMMA 3R9KA 3WGZA 5ICGA 4CMBA 2WKPA 3S5JA 1EVKA 1MJHA 1W25A 2CNOA 3TAXA 4WKNA 4PSXA 4QUDA 1I5OA 2WAQN 3N53A 1MJBA 3DV8A 1X3LA 2WSSA 5DCMA 4QNMA 5JHFA 1GP2A 3BCBA 2I8AA 2PLRA 3UHJA 3ZE7A 1KDTA 3ITEA 3KZIC 3HB4X 4JP2A 2PZMA 3ESAA 2EG5A 2WJHA 1UIMA 3GDFA 3IAM2 3K4NA 4LJ5A 1LJ9A 2BHRA 3L4BA 2IP4A 1IJWC 4WPGA 5KNCH 1TW2A 3HRTA 4P1WA 2CQXA 1Y5RA 5CH5A 3IQZA 1CF4A 3X2FA 1ULUA 1TVCA 3DMHA 2XUPA 1EFVA 2ZBKA 3PRJA 2OFPA 4RK0A 1QNFA 3WAKA 1HYBA 1G2HA 2R7ZJ 3CUQA 2GZAA 2QRQA 3FOBA 4KT6A 1X7WB 2R60A 3TOSA 4CM8A 2CHQA 2GARA 1RWNA 4I4IA 2B61A 2Z95A 3LUFA 3A3PA 3TRFA 4F5DA 4L5BA 3RKYA 4ZOLF 1UKEA 3REQA 4DYQA 1I3OA 3LYLA 2BBTA 4UMFA 1VMKA 3PUYA 4BFLA 4BKXA 3ABMH 1ZP6A 1Z21A 1UC8A 1V11B 3Q3HA 4OIMA 1O95D 4R3NA 3OICA 3U39A 1ISGA 3Q0WA 1EXMA 3RROA 4M6VA 5C1PA 3HJEA 1I1GA 1KYZA 1SCKA 1AU9A 3IPAA 5JAUA 3WGLA 1YR2A 5L8VA 4XN3A 2R8PA 3LRTA 5SZKB 1YA6A 2FRHA 1R1UA 4WV3A 3I62A 4AZWA 1VMEA 5F3RA 1P0QA 2VP0A 2XBLA 1XNHA 5FUQA 2JA2A 3QPWA 3FBTA 5LCXA 2BE5F 4BJ3A 4C3UA 2H2DA 5JDCC 3BS4A 3QXJA 3R7FA 1Y7PA 1A4XA 3I6BA 4FXOA 3EXFB 1VFNA 1R7JA 2REXB 4A2UA 1E7MA 1R37A 4TQUS 1MMDA 3GROA 1D0XA 3T3NA 4Y2RA 5KVCA 1IRXA 1VZ3A 3FGOA 3U9TA 3O2NA 5IVIA 5G0VA 2X0EA 1G41A 3GGSA 2WZCA 4NBNA 2P5LC 1M1YE 3A4TA 2GHTA 4O1HA 5C7YA 2GBGA 5JD3A 3EIHA 2BI7A 3MLEA 3BG3A 3RRBA 2ZJ2A 2ISCA 3IRRA 1OLSA 3EGDA 4EHJA 1DGQA 1FQWA 2QM8A 3PIIA 3KQQA 4N7JA 2H92A 1CQPA 2VSFA 1E1CA 4HQFA 2WD7A 1UIRA 4TMYA 3GFFA 4KK4A 4Y2VA 3QIVA 3NU1A 4YRRA 3DV0B 4F2GA 4HK4A 1LFUP 3D8HA 4A2WA 1KOJA 4EELA 2IVZA 2L17A 4L4ZA 4D6YA 5AW4A 4XKVA 1GGMA 1Y1SA 2I9PA 4RVNA 5HS4A 5TIIA 1T08B 1D4ZA 2O52A 1J5EB 1R3UA 5K7ZA 1UK6A 2DTDA 1GL6A 2VF5X 4MV6A 2JEYA 2O8EA 1NDQA 3K35A 1PQWA 3KQNA 1L7OA 2VHWA 3PZBA 2ZJAA 4BLQA 1ADFA 3C6KA 1ZD8A 4BE0A 3GNSA 2DYKA 5ADHA 1IZ1A 4BFCA 4BNHA 2HSJA 2GKSA 1I2CA 3MWKA 2FUG1 1WBJB 3LY8A 3N2GA 1QIKA 2OV2A 2IW1A 2VCEA 5LUBA 4QFCA 4DCJA 2Q21A 2ZBPA 2YWBA 1UDAA 3M8JA 2DN0A 1GXQA 3IIIA 4OCZA 4RADA 4WCFC 1E7YA 4HUTA 5LEKA 1P4GA 1R6XA 3AB7A 3N6RA 4EBFA 3JRIA 4HUJA 4ECAA 1A7JA 2A9QA 5AHRA 2GRAA 4G5RA 1RNLA 8OHMA 1JAHA 2J1LA 4DTIA 3R8FA 3DE0X 1S0UA 3F90A 3FSEA 3HSYA 3A4IA 3R3JA 4REQA 4E2YA 4B48A 2NQ8A 1HNXB 2I3DA 3DXFA 2ZOSA 3KQOA 3DLTA 5IG2A 4LECA 1JYFA 3WI7A 2ZRIA 1GZSA 2ZAGA 1W44A 4GM1A 4QGGA 4TYMA 2FUCA 4RMGA 7ADHA 5FFZA 2YRWA 2GPSA 5IC6A 5J3JA 2QYSA 4ZHQF 3PQ5A 1LLQA 3SLKA 4R1MA 2PNFA 5CNMA 4Q3LA 2REQA 5CGZA 1Z74A 1MBHA 3O95A 5FI1B 2QRHA 4INPA 5MGBA 3PTLA 2E2IJ 1FVFA 1OLTA 1E2LA 3ROGA 4BNMA 1ZL2A 4OHYA 5FBHA 3ROXA 4ZCLA 2BJVA 1S7OA 1IVNA 3NNNA 3NT2A 3A01A 1VG9B 4P38A 4BFVA 1JJIA 1FJ2A 3QGMA 4RLSA 3RSSA 4CM7A 4NNOA 2EGGA 2QKLB 5DBEX 4EYEA 2WY8Q 3FPBA 1FC0A 5C5CA 3IRVA 3TF5A 4CUZA 1YW8A 1EE1A 2PLAA 3DGEC 3ZE6A 4DHEA 2MW8A 2ZFUA 1PSWA 3ZWMA 1FMLA 1Z4IA 1U0HC 1TU0A 3A25A 2DQLA 3K2QA 3QE4A 5FBRB 1ODKA 3EASA 4JSRA 2PGOA 1J20A 3CBQA 3HCDA 3SMQA 4LGMA 1OWPA 3IFSA 2JAOA 1XTRA 3RSFA 2MC4A 3JQ6A 3GVCA 4A3GJ 3G7SA 5FUXA 3UHPA 3DJFA 3CCBA 3JRGA 1QAMA 1UBUS 3UJHA 5B12A 1JHZA 4DS3A 3F97A 4OO3A 1Z2NX 4JBLA 1W8IA 3ST7A 1JVBA 4I46A 3P2OA 1ORKA 4M0KA 2X0FA 4X66B 4LK2A 4U2CA 5HOOA 4RZHA 1Q11A 4PHCA 4KLZA 5ESRA 4ANFA 1NU6A 1SANA 1NLMA 1ZMTA 2YHSA 4C0XA 2MT9A 4OHXA 2CT8A 1BMTA 3DEZA 2BJHA 4C5CA 3MUFA 3TZ6A 4IZZA 5JSFA 3MGKA 1HG1A 1FLVA 1QC5B 1VYUA 2JFQA 4FR0A 3CVJA 3K5IA 4NC8A 1NMXA 1SURA 1YG