4GO1A

Crystal structure of full length transcription repressor lsrr from e. coli.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
297
Chain Sequence
EQGMCEEEQVARIAWFYYHDGLTQSEISDRLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYETQLRRQFSLQHVRVIPGLADADVGGRLGIGAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIGQLNAACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAADVAIVGIGAVSQGEQLMIGRKGAVGDILGYFFDAKGDVVTNIKIHNELIGLPLSALKTIPVRVGVAGGENKAEAIAAAMKGGYINALVTDQDTAAAILRSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Phosphorylated Autoinducer-2 Modulation of the Oligomerization State of the Global Transcription Regulator LsrR from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Transcriptional regulator LsrR
total genus 92
structure length 297
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04198 Sugar-bind Putative sugar-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4go1A01
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4go1A02
1J75A 1RIOH 2PI0A 3LWFA 5LBQA 4I09A 1ZGAA 3V4GA 1F1ZA 2JZYA 2ADUA 3PQKA 1G3WA 3GLXA 1IXRC 1FBUA 3L00A 5DDGA 2Y75A 1NE7A 3H92A 2VT2A 2YX4A 2GQQA 4RB2C 3JSPA 3EQLF 4RGRA 1I5ZA 1TBXA 3G3ZA 1T39A 4BQAA 4L9JA 4HX7A 3GZ5A 4XBFA 3WTVC 4TM7A 4CICA 2R3SA 3D5LA 5IT9K 5HS9A 4EV0A 1WQ2A 1YS7A 3AAFA 2QBYB 3COAC 3MCZA 1H9GA 1YLFA 2KKOA 4MQ9F 1U8RA 3E5XA 3LA2A 2UWMA 3KV1A 2OZ6A 2RV8A 1B4AA 2WU1A 2R7DA 4WXDA 4LLNA 3JW4A 2XUBA 5D5VB 5DEQA 3LHIA 2C6YA 1ZYRF 5FLXZ 3HOTA 3KEQA 3QU3A 2W24A 1QNTA 3V7RA 4IRHA 2VODA 3K2ZA 2FBIA 4LMYA 4L18B 4KUMA 3VOEA 3MQ0A 2DW4A 2BV6A 4LB5A 2XIGA 1YW7A 2QLZA 4EJVA 2CW0F 3V8JA 5J8CA 4IRGA 1I6XA 2CG4A 4WXHA 4ZYGA 4O6JA 1UCRA 2QQ9A 1BI1A 2FF4A 1XB4A 1HXDA 1KA8A 3F6OA 1EH6A 3L7OA 2P6TA 1XGOA 4KA4A 3FF5A 2A68F 2W57A 3N97A 2PEXA 3M9AA 3HRSA 1V3FA 2WV0A 2LDUA 1JHFA 3IC7A 3L2CA 2L3DA 4OU0A 4EM0B 1A04A 1T38A 3ECOA 3K69A 3SZPA 1RZ4A 4M73A 1O57A 4A0XA 1W7PD 2VBZA 3V8LA 2ACJA 2OAZA 2BE5F 1MJ9A 4YFKF 3FXRA 5EEGA 2XAHA 4UVBA 4I0BA 2FA5A 1FYLA 3FM3A 4GMKA 1MZBA 1IF1A 4L5IA 2CFXA 1Z6RA 2B0LA 1FBQA 4ZH4F 4ZZLA 5A2QZ 2XVCA 1JXSA 3FZVA 5FLXK 2YSRA 3QAHA 1TQIA 2EB7A 4I98B 2EFQA 5AIQA 5CVRA 2K27A 1P6RA 3IL2A 3EUHA 5E1WA 4IHSA 5ILVA 1LK5A 3RDIA 4OQPA 2DQLA 4KICA 2RQPA 2KIFA 4PGGA 1Z05A 2M8EA 1ZRCA 1B9NA 2G7UA 4LG0B 3EB9A 2F5EA 2STWA 4AD9A 1T98A 5F1RA 2AXLA 3KP3A 1DEAA 2M87A 1ZG1A 2G9WA 4BHPA 4Y13A 2PLYA 2X4HA 3GX4X 3L9FA 1YIOA 2TDXA 2EFNA 2XASA 3DKWA 4G6QA 4BAYA 1ZAOA 1D8KA 1O3TA 2DTRA 3EYIA 1IXSB 4LJZF 1KS2A 5K5RA 3T0YA 3FM5A 4GO1A 5EEHA 2IRFG 1U5TA 3KFWX 1CD5A 2EA4A 4ON0A 1ULYA 2CSOA 3ZN1A 1MGTA 4IRIA 1BI3A 5LHIA 4IF4A 4ENJA 2ZBKA 1HBXG 1O8BA 3EYYA 5DV5A 4CDGA 1HORA 3CO7C 4ASNA 2EA2A 5BPIA 2IA0A 5DD4A 3CSSA 3C1DA 1P4XA 1XDUA 4UNOA 2A61A 3VFZA 4CGZA 4BNCA 4P55A 1SMYF 4EGYA 2RGVA 3RJPA 2D1VA 3VODA 2JRTA 2V1UA 2MBFA 4R8HA 2P7CB 4UUVA 2RNJA 3VB2A 1DPUA 4BYYA 4KN7X 1ZH5A 4CXFA 4L9TA 5D4RA 1R22A 2Q2EA 4BXUA 4JBAA 3BROA 3GXOA 1TQMA 3U2RA 2KRFA 2IT0A 2PBIA 4RAYA 4HW0A 2RDPA 4KNYA 2HKOA 3DPTA 1S7OA 4YFNF 4KIFA 3ERED 3D0SA 3ZPLA 4S04A 2QWWA 3ABUA 1ODDA 2IW5A 5ICFA 3TX2A 2FNPA 3BPXA 5FGMA 1STZA 2R5FA 2D1HA 1Z91A 5HDKA 3BXFA 3ZMUA 3BY6A 3QOPA 4RS8A 3J80K 3F8FA 4B8XA 4WWCA 5HDGA 5L3DA 4EJWA 1MJAA 3QP6A 3DFGA 4O3MA 1YQAA 1Q1HA 5L3GA 2MD5A 1XGSA 2A07F 3TO6A 5H20A 3WTTC 1E2XA 1T0FA 2UZKA 2MH9A 4P9UA 1HW2A 3JTGA 5ICGA 5JVTA 5KK1A 1QGPA 1TW2A 1F9NA 5HDNA 1I27A 3CO6C 1S7AA 3PQJA 5E8IA 1FLIA 4A6DA 1XSDA 1OYWA 1FT9A 1RNLA 1J7KA 1T6SA 4OMZA 4FHTA 1R58A 1PP8F 3ELKA 2D2WA 1IUYA 5AONA 3S2WA 5FFZA 1FYMA 2V79A 2EK5A 1QO0D 2HWVA 3RKWA 4HF1A 1Z9CA 2JTVA 1D8JA 1ZARA 5D8LB 3KLOA 3P7NA 3MZHA 3V8KA 4S05A 1AOYA 1G6NA 1V4RA 5J6XA 2FSWA 2UXNA 3KE2A 3F22A 2LKPA 3TOAA 1BC7C 1FSEA 2F5CA 3GZ6A 2Z33A 3ISPA 2BBYA 1ON1A 2ZFWA 3HSRA 2EV0A 2W85A 2VN2A 1K6OA 1IN4A 1D3YA 1ZREA 2QYOA 3MAJA 2WWYA 3HRMA 5LGTA 4PGHA 2DAOA 3MZYA 3CUQA 1MDMA 2FXAA 3TGNA 3U1DA 1UHMA 4LK1F 5D6EA 3C3WA 1KQ9A 4M74A 5E1ZB 1KYZA 4KIBA 5ED4A 5HLHA 4ZZDA 3TO7A 1GXPA 3P9IA 5DUKA 3HSFA 2EV5A 3NWPA 1LNWA 2P5KA 4AVPA 1LDKB 3NEUA 1ONVA 2EFOA 2XKOA 4U88A 1MD0A 3HRUA 5CVVA 3C18A 1YS6A 5DCFA 3TDZC 1KQ8A 4YFXF 2F2EA 2FNAA 2COMA 2V9VA 2HDCA 2D45A 2XAFA 3KP2A 1B9MA 4AIHA 4M9XA 4RGXA 4UHTA 3WTYC 4XRFA 3ZMTA 3I59A 4R1HA 3JAMZ 2M1BA 2YR2A 4CHUA 3WTXC 1BOAA 2YPRA 4TM8A 3KP5A 1XTZA 4EGZA 5DCMA 2VT3A 2O0YA 1Z7UA 3DQVC 5HOOA 3GUDA 2VOPA 3OC6A 2HS5A 3CTAA 2JPCA 2V1DA 3UW1A 3TOBA 1S29A 2HKXA 4NMLA 2PQ8A 3E97A 1OMIA 3O6BB 1IAWA 3ZMZA 3F3XA 1J9IA 5D5WB 3O3KA 4U7BA 1HQCA 2L4AA 2Q0OA 1J0RA 4HX4A 2Y0MA 5FD6A 3V7CA 4N0BA 3SQNA 1FQOA 4QWQA 1FY7A 3REOA 1PUEE 2KJBA 2L02A 1SD7A 2QQBA 2VOOA 3F6VA 4L0YB 2FBKA 1XGNA 5DD8A 2KIMA 2IP2A 2MLGA 3U9GA 1SD4A 2DO7A 5JFRA 2GZWA 2VBYA 2Z3YA 4IHTA 1SFXA 3E6CC 4KFCA 4GGGA 2Z9OA 1HKTA 4IO1A 5TJJA 4JK1X 2DPDA 5JHUA 2ISYA 1BN5A 2A5YB 2IA2A 3M7GA 4M72A 2HOEA 4BHBA 4FX0A 3JAMK 1DP7P 3P9KA 4FX4A 2F5DA 1XCVA 1DPRA 3EDPA 1FNNA 2RI1A 3DXJF 4MGRA 4A0ZA 1K7AA 4RAZA 3TKYA 4EM2A 3ZMDA 1LKZA 3I0TA 2DK8A 3RPQA 3RPUA 2OQGA 4A0YA 3MWMA 2VBWA 1LJ9A 4XSZF 3BJOA 1XGMA 1HW1A 4HQEA 1YYVA 3BXEA 4I2OA 2DI3A 5KVRA 2VXZA 1SFUA 1YW9A 3IHUA 1G4DA 3WG9A 1HW5A 3E6MA 2GWRA 1LDJA 4K2EA 3I54A 2H6CA 4A6EA 5BPDA 3LFKA 3GO5A 1OR7A 1H9TA 3TQNA 1J2XA 4A2UA 2GA1A 3KETA 4HDUA 3R61A 4EMSA 3F21A 2P7VB 3V7SA 1I1GA 5LHGA 1FPQA 1X3UA 4L9VA 2XV4S 3Q9SA 1AWCA 1IW7F 4RGSA 4CZZA 1IXCA 1NHAA 4HV6A 1YG2A 4A5NA 1IRGA 3I59B 5BMZA 2NS0A 4I0AA 2Z5UA 2IA1A 3K1NA 2JT1A 3FXQA 3J7AO 5J8FA 3BP8A 1WWXA 4KIGA 2H27A 3GEZA 1ZGJA 2Z99A 3F8BA 2OKGA 4BHCA 2DK5A 3RI4A 3J81Z 1U5TC 3R0JA 2OZUA 4IPAA 4YIIA 4MTDA 2HGCA 1BC8C 2PMUA 1R1TA 4GXOA 5ILSA 4U0YA 1REPC 4LGWA 1K78B 1U3EM 2EFPA 4UV9A 3WTUC 1XD7A 2XKPA 4OOIA 3ULQB 4EM1A 1Z1DA 1Z6TA 3FWEA 3F8MA 1DDNA 1FOKA 1HSJA 2DPUA 1B59A 3GW2A 4DNCA 3KZZA 5LLQA 1ZRFA 1TNTA 4M71A 2FE3A 2LSOA 4P5OA 4ESJA 3LAJA 4HA8A 4HX8A 3WTWC 4I7HA 2XROA 3CUQC 2QQAA 5LEKA 1UB9A 1UJ4A 5A2QK 3QP5A 4L50A 2HQNA 1QPMA 2NYXA 3HN6A 2HYGD 3CUQB 5HLIA 3JSOA 4NB5A 3KP4A 3HTUA 1HSTA 3TDUC 1E17A 3F72A 2VBXA 4WX9A 1S3JA 3ZN0A 3KEOA 5D8KB 3F23A 2J0EA 1OKRA 3E5UA 1U2WA 3ZMVA 1R7JA 1YO5C 1LEAA 1TW3A 3CUOA 3QPHA 3TO9A 2CO5A 1FRZA 1M0SA 4TV7A 1ZHFA 3IKVA 2IJLA 1D5VA 5LGUA 3KCCA 3LQQA 3EFBA 4Q47A 1WKMA 3IRQA 2K86A 3R60A 4EJOA 4M9SA 3SFZA 2AS5F 2PMHA 1FX7A 5DYMA 3MFKA 4M6XA 2BKVA 3BDDA 3GFMA 3T8RA 3W6KB 1YFHA 3B02A 5F6FA 1XN7A 3BJAA 5JI6A 1TLHB 4RGUA 2LF7A 4JQFA 3T8TA 2STTA 4L0ZB 3QPTA 5HS8A 1XSXA 1TQPA 1CF7A 3P9CA 2HQRA 3E3VA 4WCGA 2QUFA 3M8EA 3GFLA 2VONA 1ZLKA 1MKMA 1BIBA 4R7TA 4D0PA 3CLOA 1KU9A 1SD5A 3WTZA 4LLLA 1SMTA 5E17F 1KU3A 3F8CA 4OIPF 4Y15A 5D6FA 3E7FA 5H6QA 2DLLA 4OIRF 5F64A 3HTSB 1TTYA 2HYFA 1DUXC 5IT9Z 2A3SA 2CQKA 3L7WA 1XMKA 5FFXA 4UVCA 2M5WA 1W7PB 1C0WA 2W84A 2O03A 2EJRA 3WTSC 4LK0F 4P9FA 2ZMEA 4A5MA 1O7LA 4QLCU 1BI0A 3B73A 1LVAA 3W6JB 3HUGA 4U7DA 5HS7A 4M6YA 4G94A 4ENMA 3ECHA 1KU2A 3IWFA 2FOKA 2GXGA 2ZNYA 3KP6A 2ELHA 1F5TA 2FRHA 3WE3A 3JTHA 3RIRA 1ON2A 5DCMB 2VC0A 4I01A 2CGPA 2ESHA 1MDMB 1ZG5A 3QU6A 3ENQA 3NZEA 1BI2A 1QBJA 2OBPA 2ZO4A 2HZTA 2PN6A 2P5LC 4G9YA 1IN8A 3IXQA 1OYIA 2O3FA 4GYGA 5HJ5A 4M9ZA 1PP7U 2OQRA 2HTSA 2WC2A 3E15A 1IRFA 1MJBA 1YTYA 1FP1D 1P4AA 4L9NA 2K7LA 2E7WA 4KDPA 5IT3A 3K9TA 2F8MA 4HOBA 4PDKA 1USSA 3PFIA 4KYWA 3DP7A 1FP2A 1U6GA 4PCQA 2H6BA 1USTA 1O3QA 4OIQF 1EH7A 4GCVA 5E20A 4Q5SF 1W5TA 1ZRDA 3E5QA 2GNPA 4R79A 4Q48A 1BIAA 3RTRA 2IVMA 1FYKA 1HKQA 3J80Z 1JT9A 2K4BA 3LSTA 2M30A 4CYDA 5CVJA 3FHZA 3ICOA 1S8NA 4U0VA 3C7JA 1R36A 3BXHA 1GXQA 4BH9A 4Q4ZF 5BOXA 2E1CA 2QVOA 4HF0A 1FS5A 4ZYHA 5LRRA 4G8XA 2ZNZA 3GYHX 5FB2A 3F8NA 3NRVA 5ERIA 2UXXA 1GVJA 3BXGA 5FO5A 5HVQC 4KMUX 1HKSA 1P4WA 1EV7A 2RKHA 4R9NA 4ZYDA 4KN4X 1PDNC 2J5OA 3HOSA 1R1VA 2XAGA 4UV8A 2PFBA 4M8LA 2G7HA 5FD5A 3L09A 1GHCA 5ICCA 4L4ZA 3BJ6A 5D5UB 4UXNA 5L3FA 2BGCA 3I71A 4MTEA 3K1PA 2MC3A 3EETA 3KP7A 1K78A 3I5UA 3SZTA 2O6GE 4U0WA 2P6SA 4WK8F 2OD5A 1XMAA 2XGXA 4EQQA 4A12A 2MH2A 1FWZA 1IN6A 2J5PA 4G6DA 1UJ6A 5D5XB 1LQ1A 1W5SA 1UHWA 1HOTA 3LWDA 1IN7A 3U7JA 2K02A 1W4MA 1B6AA 3BZ6A 3CJNA 1QZYA 3GFJA 4IVNA 2QZ8A 3K0LA 2EWNA 3RYPA 2BYVE 4OMYA 3GVAA 4LB6B 5JR3A 4AIKA 3FMRA 2V6CA 3LQRA 4WXCA 2K4JA 2L54A 4AWXB 1L0OC 5E8GA 3ROUA 1G3YA 4HLXA 3WE2A 2JSCA 1SAXA 2W48A 3KZYA 4G7ZF 5AIPA 3ZMSA 4EVIA 3HIFA 1KYWA 2R7FA 3ZP5A 4MQVA 1JHHA 4LG0A 4NHJA 3GF2A 1Y89A 2FBHA 4EJUA 4DQ2A 4H0EA 4WF2A 3ZQ7A 1UJ5A 3WODF 2P4WA 2CYYA 1IN5A 3GFIA 2E1NA 4ETSA 3GWZA 2FEZA 3IWZA 2V1XA 1XCBA 3WGHA 5E18F 1W7PA 3CH7A 2O61A 3IKTA 1CGPA 2BEOA 2ZKZA 4ESFA 5CVUA 4LFUA 4RB3C 1LK7A 1RUOA 2ZMEB 1B1BA 4E70A 2GAUA 1R00A 2ZXJA 2KJCA 4ENNA 2YX7A 3G73A 1U5TB 1ZG3A 5CVIA 5LRSA 3KWMA 3HHGA 2O0MA 1BJAA 1G3SA 1L3LA 3HSEA 4OINF 1EH8A 2WTEA 1IZ1A 3FX3A 3IRRA 4UVAA 5K1YA 2OA4A 2M45A 3DV8A 3Q9VA 1PBTA 2VE9A 1FSFA 3WU1B 2IPQX 2EV6A 4KT5C 1TNSA 5CYVA 3NQOA 2HFHA 4NQWA 4ENKA 3I4PA 4PZJA 5K5QA 4YIFA 2HR3A 2QENA 4Y17A 3CDHA 1JE8A 2YU3A 5TRDA 1R23A 3T5XA 2FQ3A 5L3BA 1J5YA 1YW8A 3WGGA 2L01A 2BKXA 1QZZA 4KMFA 3LA3A 2JPBA 3RKXA 2FMLA 4HAMA 2H09A 3Q5FA 3SXYA 4HZFA 1P2FA 5L3EA 2ISZA 1FC3A 2L4MA 4P96A 3RYRA 3FXUA 5LEJA 1CF7B 4HQMA 3H3ZA 1G3TA 2RVCA 2RI0A 4I02A 1FZPB 4L5JA 4ESBA 4G7HF 2A69F 1FS6A 1JGSA 2DU9A 2HTJA 3RKYA 3HRTA 3OOPA 2OU2A 4L51A 4ZYEA 1O3RA 5LHHA 2ETHA 1FSHA 4Z2YA 2GXBA 2FMYA 3ML6A 2RN7A 1FBSA 5BS6A 2MA3A 4MEXF 3I53A 3MEXA 1H0MA 4L4YA 2VC1A 4AIJA 2LNBA 4XLPF 1K79A 1O7FA 1R1UA 4G7OF 2P5VA 2Q8KA 5DUIA 2Y48A 2XAJA 4HDVA 1WRJA 1ZLJA 2GA2A 2MLKA 2VE8A 3HYIA 5D4SA 4HF2A 2ZCWA 1RI7A 2FU4A 5HLGA 3DEUA 3T1BA 3M8FA 4N9HA 4CO8A 2HEOA 1XDSA 1BM9A 1O3SA 3FMQA 5E1XA 4HBLA 3M1EA 1UFMA 1VTNC 1RUNA 2E7XA 2F5FA 3LAPA 3DF8A 1WSUA 1KGSA 3BPVA 2NNYA 3VEPA 1WI9A 3KLNA 2LF8A 3R0AA 3O2PE 3E6DA 5CJ9A 2DT5A 2ZJ2A 3ENWA 5LGNA 4XSXF 1J59A 2NNNA 1LEBA 4HYEA 3SHFA 5ICEA 1F4KA 6PAXA 1XSVA 3HHEA 3I64A 1T2KA 2A6EF 2XHKA 4FT8A 3OV8A 3E6BA 3H3UA 1BBYA 3R6SA 3DPLC 3WGIA 4LLGF 3N4MA 4IXAA 3ENVA 2PG4A 4EJTA 3BOQA 2O8XA 2DFIA 1VL1A 2QBYA 4MNUA 1Y0UA 3K1MA 4OQQA 3HHHA 2KIUA 2H94A 5BQTA 2A6HF 1ZN2A 1QQIA 4F7ZA 4OIOF 1P92A 4RB1A 1S6LA 4IJAA 4MHGA 3R4KA 1SFEA 5CLSA 2GIVA 4YG2F 4B09A 2DBBA 1R5GA 3I58A 5ILUA 1R5HA 2NRAC 4GYIA 2PJPA 1OPCA 4HV5A 1SD6A 2CWEA 2XAQA 3LA7A 1KQ0A 2RC4A 4RB0A 5H6RA 2XRNA 4XLNF 3J81K 2EFWA 1LDDA 4O5VA 2W25A 4X84A 1LB2A 3QRFF 2X0LA 3ABTA 3FMSA 4MEYF 1OYYA 2P8TA 4LD5A 5K5OA 3BWGA 2DQRA 2QM3A 1U78A 2NAZA 1KU7A 2ESNA 5L3CA 3WU0A 4HLYA 1I1SA 4N9IA
chains in the Genus database with same CATH superfamily
4R40A 3PDHA 4NZZA 3CWQA 4TTTS 1LLCA 3WLQA 4E6EA 3LWFA 2CLSA 2CQ7A 4MWBA 1HM5A 2JAQA 5CBPA 5LBQA 4MNTA 3SNHA 1V43A 4LJ6A 4O0MA 4ZI7B 1MVLA 3L7JA 1T3HA 4C0BA 1F1ZA 2B4QA 3FPSA 1MC8A 1CUHA 2GZSA 2QMOA 2CVFA 2ADUA 2PFGA 3A26A 3OYBA 3D5TA 4YK7A 5TY0A 3OOUA 1SCNE 2HSGA 1EVIA 4MKRA 4H59A 1I6KA 1N2EA 3RC8A 2ATCA 4O25A 4H7JA 1EMDA 4OB8A 4WOPA 1A27A 3IBTA 4ARZB 2AH5A 2NP6A 5LLSA 2WV9A 3JQ8A 4GRIA 1V8OA 4TMXA 3K20A 1K7SN 3B8EA 3SM9A 1CC1S 3IMFA 4H1WA 1YRBA 3FHJA 4N0EA 2XMSA 1B8OA 1QDEA 3F97A 3P2MA 2YX4A 4JB3A 1AM4D 1XZNA 2I5PO 3RYFB 5LP6A 2UYGA 2A5GA 3HXTA 4LXXA 4BQNA 4NS1A 5FB3A 4Q4JB 4RIHA 1PQWA 4X90A 4ZHQA 2JRLA 3V80A 3TSAA 1NQAO 3LO5A 3HJBA 3IE2A 2O0HA 3PYXA 4RB2C 3JSPA 3EQLF 1JWAB 3ZYCA 1XZKA 1OXUA 5GTIC 4FMBB 4A5OA 4CQJA 4W9MC 3T3OA 1Y4ZA 3H1AA 2J30A 3WRXA 2PE5A 5JZVA 4WK2B 3ZHTA 1NMEA 1X1RA 1I5ZA 2FA9A 5CT6A 3DZBA 3REFA 1H4TA 4AKHA 2OB1A 4P86A 2YQ4A 4XYLA 2FN7A 3G3ZA 2B99A 3H5AA 2AJBA 2KRHA 1T39A 1O0SA 4MR9B 1NBOA 4JAVC 4CG2A 5JRJA 5A0VA 4XONA 2YVUA 3ER9A 4URFA 4GZMA 2ZTUA 4ZMRA 1B8IB 4XBFA 1SBNE 1VDMA 2WWHA 1W35A 1SCAA 2AG8A 2C5GA 4XJXA 3WTVC 2KRCA 3BQYA 2OMKA 3E3NA 3A9SA 2R1TB 3JYNA 4LVCA 4CICA 2GCNA 2VP3A 2DE0X 4W9NC 4DJDC 2QPTA 2EFDB 2Y9MB 2N8GA 2R3SA 5TC4A 3DE6X 1KONA 3R3JA 3UMVA 4EELA 4JBYA 3THYA 2P0EA 2P75A 2FE4A 3O90A 3FGZA 4BDYA 3PXXA 1RKTA 1WQ2A 5AVJA 1IRXA 3B1KA 3QPBA 4FINA 2LLKA 5IC5A 4EKEA 3KYDA 1L1EA 4MLZA 3STUA 4G89A 2YWHA 1XFDA 2BTOA 1FB5A 3D6VA 3ILYA 3LC7O 3COAC 2B6NA 2YMMA 1N6RA 1SUWA 4HFMA 3RSNA 4JS0A 3U7IA 5B55A 2OCDA 2UZ4A 3SZGA 4OFWA 2DN0A 1HQKA 1H9GA 5EMJA 3S15J 3BJZA 2HUPA 2XX3A 4ZI7F 2PUEA 3K9NA 1U8RA 3GTMJ 4KWEA 3IHWA 1LBQA 1FS4A 4MMYB 3MTEA 5HBGA 3OZDA 2OZ6A 3PIRA 16PKA 2RV8A 1Z34A 4MO9A 3EZ7A 2WHYA 5BNGA 5AW1A 4II2A 4WXDA 4UNNA 1N3YA 2VPQA 1ZC3A 2DQKA 2NADA 3ZLUA 1Y1WJ 3N0TA 1YJWI 4JOQA 2GN4A 4PX2A 4DJ5X 1ZJJA 3EASA 1ZU5A 2V54A 3CF4G 4JJAA 4KFUA 3U13A 5CFNA 1ZEJA 5DEQA 2C7GA 2C6YA 4EI7A 4URXR 2PRKA 1P2UA 2FEPA 2XRLA 3C3KA 4J3NA 3HXOA 2Q7XA 2VL8A 2UVPB 4GYKA 3AG5A 5IUKC 1LBTA 5IKMA 1MB0A 2Y0EA 1MF7A 2X0FA 4EBBA 1TZLA 4UBLA 1EE1A 2VI6A 1EVYA 3ED5A 4ZO7A 1P9QC 4B7ZA 2GLUA 3WGLA 3MQFA 3ZWVA 3ND8A 3PLAE 3K9QO 6REQB 1PTJA 3BVPA 3FPCA 1WLYA 4NS4A 1T3ZA 4AN0A 3JQAB 4HN9A 4IRHA 3ZLVA 4B31A 4OMUA 4JJZA 1UXKA 2FPXA 2FBIA 1N9GA 1SKUA 4LX8A 2RG1A 3OC0A 3IHLA 4JKYA 4OX9Y 3MQ0A 4LB5A 2RG7A 2YUIA 3ESBA 5J2UA 1XAJA 2XIGA 4W5JA 2R7UA 1XLTC 2XOKD 4LHXA 3SFTA 4WNYA 5JWRA 1GAQA 1GLGA 3AUFA 3GDFA 2W2LD 2YZ2A 4JLNA 5J8CA 1SAUA 1U0HC 1YZNA 2WG1A 3EWNA 2Q3CA 2IYRA 4NOJA 1I6XA 3ZWKA 4EJ2A 4WXHA 4Z51A 1TKRA 4ZYGA 4KBYA 1Z4LA 3ZOBA 2A3RA 3O1JC 3ZDEA 3VC2A 4OM8A 3TGLA 4X8LA 4ZCTA 2WJZB 2QQ9A 1V71A 1IJBA 3C5CA 5G2OA 1BI1A 1A5ZA 1YE5A 2GEKA 1OB2A 3VSBA 3DMDA 3MGBA 1QP0A 1XB4A 2HK9A 2Q5IA 3LDUA 2KX7A 4FCCA 1GCUA 1Q50A 4Q3NA 1HXDA 3VAAA 1EUZA 2OBYA 1XJCA 3AJ9A 3G89A 3I52A 5DGDA 4YMVA 2R96A 4KISA 2QRVA 1EH6A 3L7OA 3ZKWA 2P6TA 4M0LA 1BS9A 2HNKA 1NNUA 1TTPB 3FFTA 4R2IA 4YAWA 2CSXA 3VNUA 3ZCTA 1RLIA 2JKVA 4TLLB 3Q0IA 4MIMA 3NOOA 3TQIA 4D3FA 1I36A 1YJCA 3PHJA 4XAQA 3JYHA 2W57A 1FLDA 5C1OA 3C3BA 3OJXA 1S2DA 4Z6YA 2QRMA 3TLMA 1NOIA 4O2BA 4FTHA 1E4EA 5GONA 2IV2X 3VC1A 2Y99A 2PEXA 3BTLA 4WCFC 5C8DA 3E3AA 1RRJA 1ADJA 4M1EA 2VJBA 4I2VA 3L0YA 4CCOA 3E2IA 2RB5A 2TMKA 3UBMA 5BOSB 1UOEA 4K1LA 1YK1A 1GTG1 4QRHA 4BUPA 3EUAA 1NMSA 1JHFA 3IC7A 2CUNA 3L0PA 4EM0B 1XF1A 3K69A 3H3VK 3NJ8A 3ZV5A 3AUXA 2VF2A 4CKWA 2D4HA 4A0XA 2JUCA 2BVMA 2YN4A 1YFKA 2XE8A 4YO8A 2IZ1A 2VBZA 3V8LA 2C7VA 2GK7A 1EH5A 4C4XA 5IEJA 3FXLA 3RCOA 3C1TA 3ZGZA 3D1LA 1BU5A 3DHYA 1W19A 2BHYA 4Y4RA 1C1DA 2OAZA 1Y56A 4XM3A 1V8ZA 3G23A 4S1TA 4BKRA 1XUOA 4H7IA 3KX2A 1V3TA 4LJYA 4N3BA 4NULA 3KFVA 1AF7A 1O95C 1P1IA 1SOVA 1ZRMA 2AN3A 2NU7B 4PZLA 5EJ2A 5KYVA 5TJHA 1JLLB 4Y7NJ 4UVBA 4LOCA 1LQTA 1VHJA 2EX1A 3FUWA 4S35A 1W1IA 1YC2A 1H5QA 5BSWA 1WUKS 1SXJB 3D0RA 3QBTA 3QX8A 1Z67A 5FH9A 1FP4B 4LFCB 2EW8A 1W5BA 3EODA 4WESA 4YUAA 2XW6A 3UJ8A 5DHTA 3HOWJ 1Y1KE 3KPWA 2GAAA 2CFXA 2CFSA 3AEKB 4LV6A 2LY9A 4M53A 2GMWA 2VYCA 4RH3A 1TD9A 2NT3A 2ZI7A 4ZH4F 3IDOA 4LOKA 5E2IA 4A1OA 4DWVA 2OZPA 4LC9A 4Q34A 5EG0A 4AECA 5LDHA 1FLAA 4U7WA 3G85A 4HSTA 1A69A 3H9UA 1I1OA 3AF2A 2DJ5A 2EQRA 3BWBA 1EPUA 2WWRA 1JIIA 3IMKA 4ZKDA 4AS1A 5DISB 5SY9A 3FZVA 3GCDA 1OTYA 2WSSD 3JQ9A 4UHFA 4YMHA 2GTHA 3Q9UA 2G63A 3ROQA 2GN9A 1H88C 3FZEA 4WVLA 1YR9A 3AGPA 2IV7A 2CXNA 1OX6A 2MSCB 3Q6MA 2EB7A 5DTEA 2B7CA 2OBLA 3WRYA 1U7HA 3LLVA 4F8YA 3OPYB 1HPLA 2EFQA 4Y6LA 4O2BB 3SIPA 4NATA 1KC1A 3K0FB 5C31A 3EPPA 3OLZA 4KQKA 1GSHA 4I66A 3ADOA 4HXFB 3CX3A 3IL2A 4XL9A 2AXNA 2FW9A 2BI4A 2H51A 2I6XA 4MINA 4OG2A 4YMWA 3GUYA 4M99A 4IHSA 1P75A 2J0VA 1YDFA 2CUEA 3GFOA 2HHAA 2XODA 2VHQA 2Z4TA 4NCJA 2P0YA 3LGAA 4PZZA 3WB9A 4C0XA 4WRRA 1Z73A 2K87A 1H1LA 1CUSA 1WCXA 3OJFA 1NMYA 2ERYA 5B6PA 2DQLA 1ECJA 2VUMJ 1FUIA 1D6MA 3IYLW 2RQPA 4KLCA 4XB2A 4PWZA 5DYWA 3TDKA 3NALA 4D0GA 2RGRA 2IZZA 2VTBB 3BDAA 4XN3A 4QBTA 2HOAA 2I3BA 4XGKA 3WX0A 4DR4B 2V6FA 1HA3A 5TR9A 3RHTA 3RUFA 1IWOA 1JT0A 1HQYE 1EF4A 1F12A 1ULUA 2I2CA 2WSYB 1B9NA 2Z1NA 2G7UA 4LG0B 4MQLA 3T7DA 1CW2B 1JPUA 1B72A 2VDUE 4IUYA 4NMXB 1Q83A 1PUFB 4HNVA 3ILXA 3O8OB 4IVQA 4R4JA 5K0CA 2H63A 3LUPA 3V00A 3IKLA 1GG2A 1OR8A 5J4KA 4IHXA 1ZYUA 5G4KB 4NF2A 1CUDA 1JTYA 1JW9B 4E7JA 2DYRH 2WTNA 3KP3A 1PN3A 3BR2A 1TAHA 1DEAA 1PEYA 3DOIA 3PJDA 4XKBA 3N8DA 2G9WA 5JCOC 3AU9A 3MBOA 3JQ8B 4B3FX 3RTCA 4N1AA 2E82A 3JD1A 1ODKA 3VUEA 2QVBA 7ABPA 1Q0TA 2BEWB 1Q20A 5K3FA 1DG1G 1NSFA 4HAXA 2BGLA 4YWJA 4RTMA 3DMGA 4WUVA 4Q4HB 2JAPA 3IB3A 1L5NA 2IK8A 5A5DA 5AW3A 4ZOAA 1DBQA 1EWKA 1ZJ4A 2YJ3A 2E87A 4M1MA 3AONB 1D1AA 3HU3A 3WMXA 3WGTA 4ZU6X 2BHRA 2SHKA 1BW9B 4MVJM 2EFNA 1A9YA 2BW0A 4QAQA 2HEGA 2HQOA 2X1DA 2Q1SA 3DAOA 2VPIA 3FXMA 2NUPA 4WECA 4WCFA 4ZGGA 2GVZC 1PK8A 4X20B 1GQ2A 2NSDA 1D8KA 1BMFD 1K4MA 1ZM9A 2X7JA 1XXHA 3BIFA 3FWYA 3GCXA 4OA8A 4CJXA 3GJ6A 3SPXA 2E60A 1EUCB 2WA0A 1JSRA 3JZIA 1NN5A 2Y3IA 4ONEA 5BWCA 3G1TA 4JQZA 3WNCA 5C1DA 1B8IA 5GP9A 3GEIA 3FM5A 3PNKA 4GO1A 2FSFA 5E3LA 3HUDA 3M1IA 3AYXB 3LUJA 2IUYA 2H4XA 2IYWA 2R1TA 4MVJD 1XHEA 3QHAA 4D92A 3NWEA 3RUDA 2NU9A 1V5GA 3A6HA 4R71A 4M7OA 2XF5A 1ID8A 3H11A 5AKEA 5AVWA 5C8YB 2EA4A 1UMDB 4AY6A 3DD5A 3ZHSA 3ZGLA 4NX2A 2BC9A 2C4MA 2E7ZA 3QLTA 3AY0A 5IG2A 1N1DA 1ULYA 2KM1A 1WXFA 3OX4A 4DW8A 3CP2A 2Z43A 3ZN1A 2KDZA 2FXVA 3W8NA 3RHFA 4DEVA 4D9JA 4HPXB 3JRDA 4WIAA 1I3MA 1NVWQ 4BRZA 1XHLA 3TP3A 3CC4I 1BI3A 1TKAA 1ZJ6A 1DP4A 1ZISA 2G0AA 4YIRX 2ZRHA 4KYVA 5BURA 1F0PA 1C7QA 1JLRA 1L4NA 2FWRA 2VSFA 3BSFA 4FZRA 3JATA 4TRJA 3UCXA 4C3OB 3A1UA 4OFZA 4FCVA 1BW6A 4EW6A 3GEHA 2VPLA 1CJMA 1Z74A 2O0KA 2ENUA 3GBSA 1YQWA 3HI4A 3HPQA 1CHDA 3KNZA 3A27A 3I2YX 3PC6A 4KAJA 4MV3A 3H84A 4AWBA 2QY9A 2OKCA 3OZBA 4FLFA 4MV0A 4A8JA 3K96A 1SAYA 2H8KA 5HXAA 2JIQA 4TSFA 2YU9J 5JXJA 1VPVA 2MG4A 1V8BA 2P4SA 1XRPA 2R7NA 2WM3A 3IBCA 1GFZA 3LBIA 1HORA 1CUIA 2GEVA 4FMDF 3S2UA 2R68A 3MC1A 5LM3A 2WLSA 1NTOA 3CO7C 3W2IA 1UMBB 5H83A 3FSJX 4DIUA 1E3TA 3RB8A 5BR7A 2HR1A 3O2JA 4YT4A 5A06A 1OIWA 4IG9A 2IA0A 2R6HA 4PPQA 5FR2A 3GLGE 3T7KA 2F3QA 1YDGA 1NLZA 1P4XA 3HDJA 5F9HA 2OSBA 1HV8A 2AQEA 1I3LA 1ZL2A 2HD4A 4O4LB 4M1KA 2GR9A 2L0XA 5DULA 1QRAA 2G72A 2FR8A 5AKZA 1NIPA 4CGZA 1H66A 1WXQA 1L5LA 3LTNC 4XVQA 2DEUA 1JTFA 3NBYC 2HMUA 2RARA 2BJHA 3RJPA 3SZUA 4A82A 4BJ3A 3OS0A 3T54A 4Y3OA 4CEHA 1L7BA 3WWOA 2MBFA 4W8GA 2JLZA 4LRXA 4G85A 2BGMA 3DTIA 5HM6A 4NBKA 4LZAA 4PYKA 1G19A 4II7A 2R8EA 4E5YA 1THMA 1H8ED 4KN7X 2B5OA 4K26A 4BGUA 4XQFA 1JJIA 2FMXA 2RAPA 4P9NA 4RSMA 3KUUA 4YBZA 5EC8A 3UC9A 4QULA 2E85A 2QE7A 1Y0BA 4AO6A 3F9IA 5E3IA 1S02A 2N0SA 2M0MA 1NC1A 3OQMA 2QLBA 2Z3WA 2EDCA 3I1IA 2IEKA 4B4UA 2V74B 2RREA 4PSWA 2B25A 2DGDA 2GO7A 2Z5VA 3I28A 4JT2A 4QIHA 4BXUA 5EAIA 5I4BA 2I6GA 3FK6A 2P5YA 2WZQA 3B2NA 4NRDA 5EZYF 4JBAA 2G28A 2OJED 1AGYA 1TQMA 3N2KB 4BN4A 2RGAA 2Z58A 5F23A 1IGNA 2YW2A 1YU6A 5DBOA 4JX4A 3AG1H 3NYWA 2DYSH 2O8EB 3FYUC 1JIVA 2YV4A 1TO2E 2XD4A 2PBIA 2X6XA 3Q8XB 4YX9A 3H7AA 5KX5F 3CLHA 2HU8A 3HDDA 1E3QA 1IAVA 1JWLA 1CY0A 1VQ6I 1Z2AA 1BOBA 1P60A 2HN9A 4ETWA 4CR7A 3K1JA 1T1RA 4I1VA 3V48A 4DR7B 3NTLA 4K87A 4TYNA 1CNEA 3DCFA 1WRBA 4DUGD 1H2WA 2RHLA 4ZC8A 1R74A 1DXHA 3PFCA 3R3WA 1S7OA 1Z4JA 3R3VA 3IP4B 3RQIA 2A05A 3D0SA 4X3OA 3U17A 5JC1A 4Z9AA 3G49A 2XWQA 5BMOA 1ND5A 2ZANA 3ABUA 3O7MA 4ZDJA 5CFOA 4O29A 3O9VA 1SXPA 4FMPA 5FQNA 1ZW1A 1VE1A 3I83A 3EZ9A 1Z4NA 5FKLA 2Z6VA 5EE1A 1LNSA 2EGHA 4DL9A 1MTZA 2HRBA 2KDOA 5MN5A 2BXZA 4P7FA 3ZE9A 1W25A 4J0EA 1QIIA 2DYKA 2R5FA 4TWIA 3J7ZI 2R5YB 1Z91A 2DY0A 3GLKA 3LOPA 3TEMA 3UOAB 4B5KA 5AQ1A 1X0VA 2JH8A 2L7ZA 1RBZA 1L7DA 3QG5A 4PFSA 5F5NA 1EDBA 1QK5A 3T95A 5KC9A 3VJRA 3EZYA 3QA3E 4YA6A 3Q0VA 3QOPA 4RS8A 2VKDA 1SXJE 1VI2A 4PE5B 5DTMA 3ZGXA 2BCEA 4RE5A 3ZY5A 3F8FA 4B8XA 1JQBA 3NTQA 4WWCA 3OHMA 2GA9A 3V4VB 3PPVA 3ZS9A 4ZYUA 5ALNA 1CU1A 3VR5H 5FI0B 3EXEB 4ENWA 1MJAA 2CXRA 3QNWA 5D3ZA 1XLUA 5BQPA 3WR5A 2FWPA 1OT5A 1P8AA 3V97A 5L3GA 3ILVA 1XGSA 1H6BA 2ZRGA 3FNQA 2A07F 4PQEA 4RY0A 4JI1B 1U4NA 3RG8A 1NG7A 2XNKA 4C4OA 2C99A 1RXUA 3HCPA 5DBEX 3C5WP 4XORA 2QEXI 1RRVA 2LBPA 4MEBA 4CMCA 5FA8A 2LOOA 1QCCA 2NS8A 5C44J 2H29A 3P2JA 1GSAA 1CQXA 4UPEA 1C1HA 1JG1A 2ZRDA 4JC4A 1M7BA 2DBRA 1SURA 3O4IA 4DSNA 5DIFA 1D7OA 5KIAA 2OC4A 1SBCA 2PFSA 4LTMA 4PG7A 1F6WA 2X4GA 4E5UA 1OF1A 1JEQA 5KK1A 2FWIA 1GKLA 3CEJA 2DB3A 1UFOA 3INRA 1TW2A 2IP1A 1F9NA 5JAMA 1W49A 2OD2A 3QG1A 4FCWA 2IQ5A 4CQNA 2QRQA 4KO3S 4YCDA 4HH0A 1EDDA 5TNXA 1O96A 1VHWA 4MFEA 1EIZA 3GZ4A 4FI3C 1VTKA 5DNVA 5G0UA 5F1YA 3G1LA 4B45A 2VTBA 5DGTA 1RPAA 4QPDA 5HLTA 4A6DA 4EVRA 1V6SA 4FGLA 3EJWA 4LS3A 4DLSA 2FN8A 3GLIE 3N7TA 4PC1A 2P5TB 1RNLA 4JB8A 5LXTF 1PYGA 2UXDB 3COPA 1J7KA 1F8FA 2P68A 2OLJA 2PSEA 1TF5A 3FCUB 2FR1A 3A6ZA 1G5HA 4FHTA 1E66A 3C3EA 3NT2A 1QBKC 5I7AA 2D2WA 1JYFA 3V1TC 5AONA 3S2WA 2AI2A 1DP3A 2HX1A 1VL2A 4GKVA 3ZD7A 3BFJA 3RNLA 1QO0D 3E3MA 3FCXA 1S7CA 3L8ZA 1EWRA 4HSRA 2DFLA 5SZIA 1C0EA 2X0EA 3N2IA 2A1UA 5JS1A 4MRPA 2HJWA 2BRUC 4D0NA 2TRSB 1VJDA 1EVEA 2FSUA 4DLBA 1JKRC 4HMQA 2QA4I 3BPSA 3UJ9A 1TQ6A 2F7SA 3CMMA 2Q28A 1ZARA 4E12A 1MAAA 1HCRA 2Q3MA 3CXUA 3GVHA 4G3XA 1NRIA 4JL6A 1N0HA 4AP6A 5JBIA 1LBSA 5TQ2B 2JLVA 2JI4A 4F3NA 3WGUA 4S05A 1AOYA 3FYSA 4GNRA 1G6NA 3HOUJ 4A3CJ 1QNFA 3C5VA 3DAYA 5J6XA 3SBDA 1ZOSA 1YRQA 1VCOA 1T9AA 2UXNA 3T12A 2Y4NA 4BNKA 4CM5A 1DRWA 1PVEA 1LVHA 3JYLA 4DHWA 4CHGA 3WICA 3TOAA 4JBGA 4LBYA 1T95A 3CZ6A 2Z33A 3ECAA 4NBUA 3VH1A 1GT0C 3WIOA 3R5TA 2DM6A 4X20A 1YIAA 5DLDA 1Y39A 1ZKMA 2W83A 4JX6A 2QJRA 1N9KA 2P35A 3D7LA 3HBFA 2XCLA 3UPTA 4W5QA 2P65A 1QOZA 3KFLA 3HSRA 5DM0A 1NYLA 5AD1A 5ADWA 2AYYA 3T9DA 3DMRA 4JP5A 4TYYA 4MYRA 1Z4PX 2W85A 4XK4A 4PR3A 3IP9A 2F3SA 1JYSA 2CWDA 4GI7A 5IBQA 3SAJA 3P2YA 4MUGA 3T52A 3HO1A 4GM4A 4OHOA 2QYOA 3B5IA 4JLDA 3MS7A 4B3SB 1XU9A 2J33A 1OX4B 4QEZA 5GPAA 1LXCA 2R4UA 1QP7A 2OBMA 5C4GB 1Z13A 3HRMA 4BFCA 1QHIA 3OCCA 3CV3A 1Y5LA 2JI6A 4G5RA 4DPLA 5C8XA 1CUCA 1PW7A 2PDAA 2ZSAA 4A16A 2OP1A 1K5DA 3LCJA 1XK7A 4A3DJ 2GYWA 2ZBVA 4OOEA 3RCBA 5D6OA 4Z7NB 1HDPA 3PNSA 1ZH4A 2D8MA 2EHDA 2N3ZA 3CONA 4BZPA 3QE3A 1VL8A 1NFQA 2ACVA 3CUQA 1QDUA 1RVDA 4LC1A 4BNGA 1MDMA 2FXAA 2G9RA 2P6MA 2PT6A 4J4TA 2P67A 2PEZA 5T57A 1FQJA 4EEKA 3SEQA 1H1LB 3EA5A 4TTRA 1UHMA 4FSXA 4B6FA 5D6EA 4NC8A 7REQB 1W75A 3OQIB 4QBHA 3W34A 1U2GA 5EXSA 4ANFA 4CV1A 2LR0A 4JUCA 4W97A 1SBQA 4LNUA 4OSOA 1ELOA 2I55A 1FEZA 3H0DA 2GARA 3EK2A 4GZLA 1KYZA 4W1QA 2NVXJ 3WZMA 2V8OA 4EUHA 2GK3A 3DE5X 4YLYA 4R8MA 2FP4B 3ETDA 3TO7A 4NARA 1TTTA 4PJNA 3EGEA 4YNBA 5AXBA 4IIYA 3DSRA 2RH8A 1W36B 1VCHA 5B7NA 1P0QA 3L5OA 1X42A 1U99A 4DIKA 2KYRA 2H1SA 3HSFA 2EV5A 1CF9A 1UBLS 4ZCSA 5IEBA 4D57A 3RYIA 4OXNA 1U7XA 4XWOA 3CVJA 3WHIA 3OSUA 1MV8A 2CUTA 3IRUA 1K7EB 1WJAA 3ZQHA 2KP6A 2G9VA 4DNQA 2Q4TA 3NEUA 1ONVA 3WQQA 1U2GC 5DEIA 1JX6A 4LRWA 1G20B 3RTEA 1F7UA 4ACBA 5JD4A 3BCRA 4E6PA 2PR2A 3E0QA 1ZJ5A 4UUSA 1ARZA 1WU8A 1YRNB 1M3SA 2QUJA 2UZAA 1S6YA 1OWLA 3MT7A 1TYDE 3P9XA 1DEHA 1KQOA 4AUMA 4K88A 5LU9A 3OIUA 1YS6A 3CZ9A 4UPDA 1S3IA 1KFKB 1N2XA 2Q3BA 4L95C 4UCXA 3WK9A 1RI5A 5K6AA 3ZE1B 4E5VA 1SXHA 2D4AA 3PQ8A 4QQNA 4NH0A 2NOJB 2UVPA 5BW4A 3MUFA 4D81A 4MRSA 2F2EA 2JA8J 1R8JA 1STOA 1T9CA 2I0FA 5GTHC 3EZFA 4QGFA 4LAFA 5C35A 2AN4A 3TTSA 3IX7A 3R0IA 2H7YA 3KB6A 4BFTA 2H9AA 1JIQA 2QRLA 1YZHA 3FDXA 1U8ZA 4I9HA 1ONBA 1SUFA 4II3A 1UH5A 3P5JA 4RGXA 1E92A 2APJA 3JQAA 3PR3A 5P21A 4JIGA 1BXGA 1U9ZA 4CHUA 2PLWA 2QD3A 3N2NA 1OH5A 2YPRA 2GBGA 1ZPDA 4I5FA 5HW0A 5K8UA 2IIPA 2IXTA 3MZ8A 1Y7LA 1IDN1 5G41A 1Z07A 5FPTA 1HURA 2K9SA 1QHEA 3HGYA 1YS4A 2ZUFA 4XW2A 2VT3A 3M6XA 2PSHA 2RGNA 3VPHA 1G8XA 4F38A 3FB1A 2OC9A 1Z7UA 2H07A 4ARVA 4H1VA 1T6XA 2OILA 1FNDA 2EWVA 3H2IA 1SCUA 4YJHA 3GUDA 1F38A 2VOPA 4G0XA 2IYQA 4GQBA 4RZXA 5HEKA 2YNMD 2AZMA 4XLFA 2NZ2A 3JCZA 3FZNA 2BY1A 1GILA 1PNVA 3D3QA 5EJMA 2JPCA 2FX5A 2V1DA 3WNQA 4A2WA 3B5JA 4F4HA 3HGQA 2HPMA 4IYJA 3R8CA 1XMJA 2RKWA 2QRVB 4FEYA 3LZ6A 4PYOA 1KIFA 3HJCA 4XE5A 5BMVF 2REQA 3ZGNA 1OU0A 1EZ1A 4NMLA 3C5EA 2MSDB 1Z0JA 3BGIA 1JJ6C 2C4WA 5EF6A 4KP7A 1HTBA 1YUBA 2QYHA 4F3YA 5EHZA 1IAWA 3THYB 1D1SA 3ENZA 3JQEA 4EJMA 5JADA 1OC4A 1XVLA 3ONDA 2V5UA 5H7XA 2K9QA 1TE2A 2ZBUA 5D5WB 4PYLA 3WG7H 4U7BA 1IZ0A 1NF8A 3FYUB 3I4FA 1HQCA 4NCKA 4PLVA 4P4SA 4KYUA 1W96A 4BUCA 1W46A 1NDQA 3BWDD 3GGOA 1EUQA 1D4OA 2D54A 4R6WA 1K88A 2XQKA 3RBVA 1J0RA 1PIWA 4M3GA 2H1CA 4FYYA 1NW4A 3D81A 5GM1A 2EZ8A 1IJFA 1AIPA 1W8DA 3RGGA 4WTOA 5FD6A 4HV4A 1DINA 1SHKA 2DWQA 4TN1A 5B4VA 2LKDA 1J2JA 1W0UA 4C4YA 3RVMA 4HRXA 3P97A 2V9ZA 1AN9A 4XWTA 2LY1A 5KYTA 3IDFA 3L4KA 3VR1A 3P96A 2ID8A 4IX1A 2VOOA 2KHZA 1EK6A 3VUFA 1GPNA 3IO5A 3F6VA 2JLBA 4LGVA 4L0YB 1D2CA 4WNAA 1XGNA 3CTPA 1BSVA 4MKXA 1A4IA 1Y4SA 3PHIA 4LCEA 2KIMA 4PM4A 4DCUA 2UYOA 1G8PA 1K6XA 4NZOA 3MT9A 4Q9HA 4IQJA 2CL0X 3ZEAA 1RMYA 3KAJA 5DP2A 2B0JA 2WT4A 3WYCA 5L7WA 1FJXA 4G5YA 1TM4E 3A4LA 4IVPA 3OFVA 3R9WA 1X1CA 1QIDA 2Z3YA 1TQDA 2XUZA 4MV5A 4PYMA 2XLCA 5H16A 1VSUA 4IHTA 2Z2JA 5JMWA 4YP1A 4Y2XA 2QTMA 3E6CC 3QKSA 3DEHA 4JR2A 5DGHA 3B6ZA 3AEKA 1EQUA 1N5KA 5FPYA 2Z9OA 3ST7A 2OCXA 1U5CA 1MDFA 4XGQA 4GZ5A 4M55A 3VSDA 3O8BA 4Q1VA 4IO1A 4A69C 4JK1X 2X2PA 5AICA 2DPDA 2JFNA 2QG4A 5JHUA 3GZJA 2RK3A 4MQEB 3MYYA 1TQ8A 2XECA 4GS5A 4AJPA 1VBFA 4BLQA 3FZYA 2ASEA 4D0RA 4TT3A 1G9XA 1PKEA 1U7UA 3TNLA 1ZI8A 5EPEA 4O1HA 3K15A 2IA2A 3SQDA 621PA 2AE2A 1WG8A 1OZHA 1UUFA 1B0PA 2IHVA 2FOWA 3O1HB 3W6ZA 5B3JC 4ARIA 2HOEA 1ZK8A 1Z5UA 1Z45A 4BE7B 4RCVA 4BHBA 3DT9A 2GXAA 2NXNA 3IVGA 2J9YB 2C3PA 4QHSA 2WY8Q 5TDHA 1I5RA 1YX5A 4FX0A 3N9IA 5CURA 1IY8A 2UZ0A 4BZZA 4DA8A 4ZGBA 4X65B 1LNQA 3Q8LA 4P3YA 5LQUA 3S3MA 4QJ5A 1A9RA 3KDSE 4UHKA 4KN9S 4FX4A 1WXEA 1Z62A 2AGVA 3BZWA 4XM0A 1E7RA 4KR0A 2IAIA 1F14A 3G4SI 3MFYA 4K6FA 5EP3A 1N2BA 4FBLA 5KI6A 1FNNA 4E07A 1JHQA 2JBWA 2PXCA 3ND5A 2IH4A 1U7OA 3U39A 7MHTA 3H9GA 5C1BA 4Z9XA 2HDDA 4BMOB 1VGQA 1YWGO 2C3YA 5FOUA 1FTQA 1WCIB 1YAJA 5JLXA 6GPBA 1Q22A 5D86A 1U9IC 3FFAA 4DCOA 5LOVB 1YACA 2NQ8A 3MRXA 1G6Q1 4P54A 1WJBA 3BCBA 1XTPA 3PDJA 4KDCA 4TL7A 1JLKA 4X1IA 3M9LA 2G40A 5K45A 2X2FA 1QK4A 4OFBA 1GCIA 1TWFJ 4EG4A 3AUJB 3BFVA 5EIFA 3H9QA 3OURA 4EM2A 1UG0A 1NVTA 1VYTA 3VR4H 3I1JA 3PJRA 3ZMDA 1T2EA 1P72A 2Q4RA 2GX6A 1ML4A 2PBFA 3HZHA 3I0TA 1CYEA 1B16A 4BNLA 4LF6B 2CDCA 1RDFA 5DI3B 2DX7A 3GT4A 2TS1A 2YFHA 2XSJC 3RPUA 3EDQA 3EQ2A 2O8BB 1DBSA 3KHKA 3COSA 5IDWA 2W2QA 3MD9A 2FN9A 2I4OA 1WPXA 4E03A 2E9SA 1JXMA 4PFJA 2IEZA 4ND2A 4E7HA 1VIDA 1W93A 5A4JA 3L7LA 3SX2A 1A82A 3DTVD 3F8SA 1DFHA 3G0BA 1MC5A 2OCGA 1XMIA 4C04A 4E7ZA 1CS4C 1E3JA 4S0ZA 1UOQA 1S4QA 3ETGA 4I2OA 2ZUUA 1BG6A 1BFDA 1D0ZA 1ZD1A 4C7BA 4NDNE 4RZQA 1QU2A 4UMDA 5I9LA 1WPKA 1ZUNA 2DMPA 1VBNA 3OT5A 1YX3A 2JA1A 2JLWA 1NI3A 4E2ZA 3AXTA 1W30A 4Z1MA 2WF5A 3FA2A 3RJ9A 2XUQA 4DF3A 4PV7A 1AKUA 1R3UA 1G4DA 1FXUA 2NZXA 4RENA 5CVTA 3OIGA 3PU6A 1S3GA 1LB1B 4BRWA 5ITVA 1I6LA 2BM8A 4FCTA 4V24A 5JUWA 5CT9A 4C76A 1P44A 3QV2A 2F4IA 3WRVA 3R4CA 2C77A 2I3DA 3OKCA 3CR8A 3INGA 4K2EA 2W2KB 3TX6A 3N3BC 4ZVPA 4C88A 1AHPA 4IHWA 4AY5A 5C8YA 4XXHA 2XKBA 4FC7A 4X85A 3TB6A 4QVIA 4EG7A 4TLBA 4Y98A 4EDHA 3ZDCA 1MU0A 3PQFA 3TD9A 5HCUA 1OCRH 5I9IA 2O3RA 4OHRA 1CDZA 1VA4A 5B58C 1CZLA 3JQGB 4QO8A 2D62A 2IBSA 3ZPXA 4CMEC 3TG2A 4ECAA 1KVUA 3FCEA 3GA0A 4A2UA 1KI6A 1WTCA 2GA1A 1E79A 1I4TD 2GZAA 3F3MA 4K9OA 4TXJA 3HS3A 1EINA 4EBFA 3R61A 3L9XA 1K7FB 3AKDA 3GROA 1YBMA 1J8VA 3AKCA 4H1HA 3X0DA 4EMSA 4J0JA 2HWWA 2QX9A 1PG0A 2P7VB 1S89A 1XL0A 4I5GA 4M1OA 4CV3A 4DT1A 4OHWA 3CD6I 4JYKA 1FFHA 1MCZA 1OW3B 1PQYA 2G4CA 2QTGA 1I1GA 2SNIE 3DOOA 4I4LA 1FPQA 3C6XA 2OXEA 4TLEA 3UWDA 1OCZH 1P7VA 4DWJA 2Z4RA 1S7GA 3WMRA 1YI8A 1QGUA 2MCFA 4MHTA 4K2HA 5H02A 3G9QA 1JHVA 3ZWQA 3Q9SA 1QP4A 1ZJYA 2A1TR 1SO8A 3PRYA 2BMAA 4JBLA 5DTRA 5A4KA 5BSHA 1YA6A 2NZJA 1U3VA 4RGSA 1Z08A 3JRAA 2YY5A 4Z9BA 4LHSA 1E9RA 2PQ6A 3NVDA 3GY0A 4HV6A 5IPAA 1SQ6A 5DHPA 5T4FA 4CM6A 1JE1A 4A5NA 1Y42X 5CFPA 2ZUDA 5IF9A 3CPEA 4ZO8A 1RWXA 5IH3A 4DIOA 2QVYX 4K9NA 4L7VA 1TKBA 5HOQA 3D1JA 3ZCPA 2GOYA 2ZETA 4KQFA 3A06A 3U62A 1ONOA 5HZKA 3DLLF 3A9CA 1OBOA 3D6MA 4I50A 4MITA 3M6FA 4PRYA 3W8EA 2GBCA 4Q3DA 2O1SA 2B37A 1RHUA 3BHNA 2FHPA 2KLBA 2D7DA 1D1TA 2B78A 4KIGA 4YJ3F 1AMOA 2BGUA 4MUFA 3MRVA 3GEZA 3DJYA 1ZGJA 2Z99A 3JQFA 3F8BA 3JWJA 3AW9A 1BX0A 4F6CA 5IT0A 2EZHA 2OKGA 1EGAA 3HY3A 4MR7B 3SOZA 2QX7A 3C8DA 3CB2A 3IC5A 1N4AA 4RZHA 4DB4A 4WZZA 3AUKA 4GF5A 1Y3AA 5J47A 3RK0A 2QGZA 3ZR4B 1SIOA 3RI4A 2X19A 1CVRA 3J81Z 1FSGA 5DI9A 3QYAA 5FI3A 4N0DA 2OZUA 1W0JA 3K1YA 3QPWA 3LS2A 2Z98A 4XLTA 1N6KA 5FJIA 3N2KA 3EIWA 1B0UA 1NULA 1GPLA 1R15A 1PL8A 1RTKA 2AJDA 1GDTA 2DUMA 4FDLA 5HSGA 2PMUA 1NT4A 1DBPA 2KFDA 1QTNA 1R1TA 4ZDLA 2E4WA 4RSGA 5CHYA 3WGYA 4CFSA 2AZXA 1CZNA 1KMCA 1NBEA 3GNSA 5H1YA 1OCEA 1GQSA 4RGVA 4B83A 5C4XJ 1Y82A 3T3IA 4P5PA 4CRWB 2VH1A 2ZROA 4ZT4A 5K5EA 2ZYDA 4UV9A 3I62A 1DG9A 3PHBE 3UT5B 1VPLA 2XKPA 2R85A 4EM1A 2C42A 3KWJA 4PNPA 1NJ8A 3R5KA 5DGCA 4GBED 1E32A 1G20A 4NU6A 4PLPA 5EWJB 1E2FA 3HRKA 5KQSA 2BF4A 5HUQA 3V4PB 4EYGA 4WE3A 2DPUA 3D0QA 4QZVA 1BDMA 3R0QA 1C41A 3TW8A 1ETXA 5CT8A 4JDPA 1H5UA 3T7SA 4ALNA 2A14A 1XQVA 1ENZA 3DBRA 3GELA 4I08A 3Q3SA 3DZ8A 2W90A 5IULC 4GX1A 4FFLA 5AI9A 4DLVA 2HJGA 5FEMA 3KZZA 4UMVA 4KREA 2GD0A 1XEXB 2GD6A 4OAYA 3DEEA 4BLWA 2EFEB 3VGJA 2PL5A 2ZE5A 5BNIA 3EIFA 4YPVA 2XAUA 1IZYA 1ESNA 1IWBB 2PUVA 5EQJB 1ZITA 1FVFA 2AVNA 2TMYA 1ETUA 1L4EA 4TWJA 4PLCA 2AHQA 5IJ0B 1RIFA 4GYJA 4HX8A 5B2ZA 2JJMA 4ERXA 1CZKA 5LBUA 4R3NA 4I7HA 3QMMA 1M2FA 4ZOQI 1GZVA 3EXEA 3BDIA 1E7MA 3CUQC 4YR9A 1EBBA 2PO7A 3UVEA 2AFRA 1YE8A 2G9UA 2QQAA 3DEFA 4IILA 4MXDA 3ZWCA 1CR6A 2HYJA 2X9DA 1Q57A 4ZOLB 4ZFNA 3R0VA 3H6HA 1MH3A 1J1IA 4L50A 4Q02A 4DDMA 1E1YA 1LUJB 3DKPA 2HQNA 1EVQA 1QUEA 3CPHA 4CN9A 1XE3A 3G6WA 4QPJC 4BVBA 3HN6A 2DA7A 4XMYA 1J07A 3LDGA 4D0LB 3PFBA 5B1IA 1JIKA 1PFUA 5CMLA 1K2VN 2SCUA 2VPWA 1IYZA 3KR2A 3NYIA 5FEUA 1NLUA 3U44A 2GO1A 3GHHA 2QD1A 3D6HA 3JSOA 3HRHA 3KP4A 3ZCOA 3BE8A 2B8TA 4LWQA 1E17A 1PZGA 3P5BA 5H0IA 4WX9A 1YL5A 3TBFA 3TF5A 5D8KB 2DTZA 2YQ5A 4C22A 1KYVA 1MW9X 4LYEA 5REQA 1OY1A 5K01A 2AK3A 3WDKA 4CU2A 5E9AA 4HDMB 5BVGB 1DPGA 4OIMA 1T8UA 5GAGJ 3LK6A 3W5CA 3E5UA 1G6HA 2JIMA 1ODTC 1U2WA 4EHLA 2C31A 5I47A 3ZMVA 1R7JA 3PHCA 1LWOA 4JR0A 2UU9B 1X1TA 2Y69H 4AKGA 2YS9A 4UDOA 4UAVA 4XYEA 2D1QA 2FPPB 2WZDA 2Q8NA 3WWCA 5JZSA 3E9MA 4PG6A 1ID1A 3ODGA 4BYGA 4MI6A 3PC2A 4Z8YA 2ON6A 3TO9A 4ZYAA 2VQHA 2XGSA 4OGLA 4C1BA 4TVSA 4DCGA 5AI5A 2VXCA 2E5WA 3H9CA 4IHJF 4EZBA 3E03A 5JAQA 1VG1A 3IKVA 4UDYX 2R6ZA 1RWKA 1I2BA 3JQCA 1SG6A 3I2KA 3O1IC 4PHHA 4Y7DA 3KCCA 5KOIA 2R7OA 1E2NA 2QE6A 3PA8A 4GPIB 1UFKA 1VYUA 2CEKA 3ABIA 4RIIA 4WXPA 4GYWA 3CMYA 2VDQB 4R81A 1ILWA 1DIAA 1H6CA 2CLEB 3KQWA 3M9WA 5IVKA 1IG3A 4KMSA 1VQMI 4JVNA 4DLYA 1Z3IX 2Q3LA 5IKEA 3DF9A 1AUPA 4A0GA 1FDTA 2AMVA 5DTDA 4WQMA 5AW9A 5FUMA 1ICIA 5DM60 3SFZA 3RS7A 1CNMA 5E95A 3WL5A 2ARKA 2XV1A 3OIWA 2AS5F 3T06B 1MBGA 2J3IA 4HN2A 2CKDA 4PNEA 3SWWA 3WE7A 1K89A 1EFDN 1JJ7A 2L2QA 2P0AA 4BNWA 5AIBA 2A30A 3EVNA 3JAKB 5JI2E 2X1EA 4MVWA 3VNSA 1OXKB 2WY7Q 5E38A 3PUBA 1MVOA 3AL3A 3PL1A 4GKJB 1V9SA 2BKVA 2MR6A 3ODPA 2IU6A 1M0TA 4MP3A 4XB6B 2Q27A 4L5EA 2H7CA 2G8NA 3LG2A 2JA2A 3OPQA 2GQ0A 1NP7A 3IAM2 3HY6A 3P0EA 4BNIA 5I7WA 4W63A 2I1VB 2W0SA 1KVQA 5LR6A 4WEQA 2C9OA 2Y71A 4MUHA 4UD2A 3U4QB 1TLHB 2DA5A 2VSYA 3P4UA 4GVXA 2RHCA 4NU0A 3W3AH 4E08A 1YCDA 4I4TA 1QRDA 3D0KA 4E5DA 1JZSA 2VXOA 4L0ZB 4YT2A 5J1RA 3CVXA 3CS3A 3W05A 2ODTX 5FBRB 3AG3H 5KAIC 1TK2A 4IOKA 3GGCA 5JS2A 4CW7A 1P0CA 5F7OA 2NG1A 1XZMA 1ITYA 4Q3BA 4FFMA 5IDXA 1HR0B 5JZBA 2QM7A 4M0KA 3ROGA 3S2SA 3QQAA 3AKZA 3M8EA 4AIDA 3ANLA 3GFLA 1O6FA 1B93A 2VONA 1UBNA 3PVCA 3Q5EA 4NXNB 1CB0A 4TS9A 3MWDA 1ZLKA 4BE4A 5KWEA 4DV4B 4XA8A 1EGVB 1W5AA 1XCGB 3F1KA 2V9PA 3GAMA 4X6YA 4DCMA 2WM9B 1OBVA 1P91A 3HCOA 3RIEA 4EWLA 2BOVA 1MJGM 1X8KA 3B3GA 4UBOA 3RSCA 4AUXA 3I2GA 3GLIA 2GN6A 1KU9A 3F90A 4X64B 5MDHA 2R5NA 1SD5A 2OHFA 3I39X 1Y8QA 2Q4BA 1NUHA 3B89A 3C3JA 4IJMA 1EM6A 1KU3A 2WZCA 1SZCA 4H3KB 4IY1A 3E7FA 3BSSA 2FV8A 1Y6ZA 4IUDS 4YFYA 1TZBA 3AHEA 5KNCA 4GMFA 1ZK4A 3GH3A 4IGEA 3UB4A 3PRKE 2HRQA 3RT1A 3WL7A 4UXHA 4RKFA 3D43A 1GFWA 1GL6A 2C61A 4JP2A 5AK3A 1DV1A 4MLDA 2GPNA 1M1EB 2MHCA 2WM8A 3BH6A 4OXIA 2Q1XA 5DNDA 3U4HA 2ORIA 3DTVB 5HZMA 3RFUA 2ZVPX 1ADCA 3ZHUA 6NULA 1P45A 2W93A 1IZ8A 1M2OA 2Z8XA 3CUEF 2R00C 3J7YJ 1RETA 1XMKA 1E5LA 1ZSYA 4UVCA 2IFTA 2ZCUA 3BD7A 4AJJA 4BE2A 2FPLA 1A8PA 2P2ZA 2M5WA 3ABMH 3R5FA 5BN4B 1MSEC 4JB2A 3C2GA 1NXXA 3OE1A 1TVKB 2PWAA 4EUEA 2EJRA 1SQ5A 1EAYA 3WTSC 4LK0F 2PUJA 2W6CX 5EMKA 4MV1A 2HSDA 3H0GJ 1TL8A 1FX0B 1XAIA 4MW6A 1M1NA 4LKRA 4YP7A 1GARA 3UMMA 4BNFA 1JDNA 3ZIUA 3ZW7A 1BYIA 2VT7A 3TTVA 2F1RA 1R8XA 3ESRA 5F7XA 1IVYA 1BI0A 3EYAA 2WSBA 2AG1A 2E37A 5F4BA 1X7YB 4U7DA 5HE9A 2N1BA 2FUG1 1Q2UA 2DPHA 3L6DA 2V4JC 4GC9A 5G40A 4RY9A 2FGKA 2GK6A 3HU1A 3IWFA 2E4UA 4DW6A 4RD6A 2BFBA 1A5AB 1X3ZB 1H22A 3KP6A 1F5TA 1R7RA 2P2YA 2Y0SA 2AWNA 5CRIA 4DREA 2CE7A 2NM0A 4LPSA 3SSAA 1KK1A 2VBGA 3WIEA 2G1KA 2P79A 2PT5A 3G9ZA 1KKLA 3GDWA 1ON2A 4AO8A 1MN6A 3HM2A 3N0WA 3P0HA 3RS3A 2CRGA 2A9FA 4PAWA 2H3HA 3TR5A 2O20A 1TD1A 3A1WA 4J94A 4NG4A 4NCNA 1IB6A 2GUWA 3GYBA 3W9BA 3ZCUA 4B3HA 2WFLA 4WOCA 5HOEA 2UAGA 3PLNA 4C4ZA 1U6IA 1V5WA 4QUBA 3J81A 4L4RA 4TQUS 5T41A 3IEIA 3DH0A 4LJRA 1MDMB 1ODFA 2HI3A 3C2HA 1PFWA 3L8HA 3O26A 2W70A 4DUZB 3L02A 1D2GA 5K0NA 1H2RS 3DOJA 1XC5A 2I03A 2XVAA 3F6SA 2DBZA 1ZZGA 2EV9A 4BO6A 4KGZA 4WBNA 5DBFA 2YH2A 1YASA 2QSYA 4UB8C 3FAZA 3INYA 4PR0A 2ZUTA 3WJ2A 3SQLA 4A6XA 4F4JA 5K6RA 4FBGA 3RFVA 3FHOA 1Q1EA 2DFHA 2HZTA 3FKIJ 3C70A 3Q7EA 1M1YB 2ONJA 2P5LC 1XYGA 4JJ6A 5DCYA 4CQLB 4QGGA 3H1EA 4QXAA 4ENVA 6YASA 1BQEA 1A1SA 1QGUB 1IN8A 5DM6F 1AVTA 3AR3A 3CVVA 4EI9A 4YCAA 3LXUX 5CLGA 3S1MJ 1ZEMA 1OYIA 3M1CA 3ELBA 3G2IA 3JQAD 3A58B 2QPLA 4P4SB 3T9FA 1NR5A 5CT4A 1NQUA 5DP1A 1PP7U 1KRHA 2CWWA 1YJAA 1AQYA 2WJWA 3OUUA 3SEZA 2HTSA 4C29A 3I0ZA 5ALJA 5LXTA 1XPJA 2G25A 2X76A 3H2KA 3OQPA 3O74A 3GYGA 4X71A 1XTVA 2D1YA 3G82C 3H8WA 3KALA 4X24A 1VQ9I 3BGOS 1HL3A 2VJNA 3WNZA 4XLLA 5ETJA 1DAGA 1YRNA 2V6IA 4AVYA 2GASA 1QO7A 2B98A 2JGJA 1C8KA 5KOJA 3OZSA 1W1UA 3C3DA 3V2IA 2REBA 2FPSA 2F2TA 4BL5A 4ER5A 1RAIA 1FP1D 5K7HA 8GPBA 5H68A 5GM2A 5D3MA 1SPXA 1UZMA 1TFRA 1W85B 2K7LA 5H4GA 1I50J 2E7WA 3SHOA 4JVMA 4AZSA 3M6VA 4NMMA 3Q8WA 1MO6A 4Q01A 1N2JA 1EXDA 1T2NA 1YQXA 4WASA 5IT3A 2WNIA 3MGKA 3G0HA 4X1EA 3K9TA 4IEFB 4RVFA 3X1ZA 1IEQA 2JGFA 3K6JA 1X77A 3JWEA 4M6VA 3ZHCA 1USSA 4N65A 1GVNB 2VUIB 3CC8A 3DKRA 2P4EA 1X70A 3L1IA 4KDFA 4PLFA 3TSYA 2WT9A 3QKSB 1XALA 1FP2A 1Z39A 3EA0A 1TQ2A 3QX3A 2O8DA 4IH1A 1N3LA 1ORDA 1R5OA 1RWOA 2AOUB 3TQHA 4EABA 2LIVA 4NCBA 2PRJA 3AJRA 4BNJA 2ZULA 3LRTA 4BX3A 4C6TB 3HLKA 4Q5SF 4FHGA 5FYQA 3CKKA 1VQ4I 1XLTA 4H31A 1ZMBA 3I1FA 3L41A 4HRAA 4MKZA 2BEKA 2WM2A 2HXIA 3ZQJA 2PBZA 4EY7A 1ZRDA 2ZQZA 1QMGA 3KZNA 3E5QA 5A9TA 1RAGA 3C8HA 3VSAA 4YDQA 3ZY4A 3GJSA 2INGX 3I5XA 1WNFA 2CE2X 2NMVA 3D0OA 2ECCA 4OMDA 1Q95A 3RUCA 4JLJA 3TNJA 3VH2A 2XBMA 4TYPA 4GE0A 1R0BA 5TT1A 3ORHA 5F2NA 2J45A 1XMPA 3X1JA 3T94A 3DPIA 3LOUA 4UCFA 1EFRD 4AZ3A 4DA4A 1QZTA 2IEAA 3J80Z 1JT9A 3OOYA 1JG3A 1V26A 1YIDA 3WLNA 3W4JA 1FDWA 4J9VA 4XKJA 2XITA 4UFNA 2QP3A 4LECA 3DXYA 4N7BA 1RC9A 5EL0A 3RSQA 3TW8B 5JMOA 2D0OB 5TS3A 3R8XA 3ICOA 5F73A 2PMEA 4MGYR 4XQGA 3NAQA 3OTOB 1S8NA 1DKLA 3JV7A 1IM8A 1DJOA 1M5UA 3OCZA 3C7JA 1NVVR 2Q45A 4L07A 1QQTA 1Z0FA 2AFIA 1DU0A 2FQWA 2NVBA 3AY6A 4YFVA 1E2UA 1GZSA 4NAHA 4R1TA 2QVOA 5DN9A 4JVOA 4HF0A 1F6BA 4JXKA 5AK4A 1NJSA 1YDEA 2HPHA 4G8XA 4BZXA 5DBIA 5H3HA 3OIPA 2ZBFA 3HR7A 4OHUA 4MOWA 5F1JA 4I4NA 5G1PA 3HWX1 3UMCA 4F3QA 4PW0A 3F8NA 3NRVA 4E33A 3BAFA 4WI1A 1E6LA 1XEFA 1E2LA 1MBEA 3BXGA 4TPKA 4DIFA 4KMUX 1HKSA 2P5SA 2X85A 2NXJA 3FVWA 4EW3A 3QI2A 3HDGA 1RLOA 1EV7A 3KB2A 4BJHB 1QF6A 2BSQA 4BNDA 1NVDA 1P31A 3QU2A 2H1OA 3L0ZA 1TJYA 5GPBA 3CCEI 5ALSA 3OKPA 4KN4X 4IMJB 4B0OA 2V7FA 3GEEA 5TARA 3UKJA 3O8QB 3THRA 5IC4A 1VZ0A 1H2FA 1SU4A 5HDBB 4AQ7A 1H3FA 1RJFA 1Z2PX 3B6AA 1AXRA 2ZUVA 4I1IA 4JYPA 4TZTA 5JECA 1FSZA 3QFCA 5IK2A 3LTEA 1USIA 4C3HJ 2CLIB 2XAGA 2I6FA 4D5CA 2HVRA 3AL0B 1QIKA 1T0BA 3F7TA 3LA8A 4P34A 9ANTA 4JWKA 4OEHA 4UCQA 3RO7A 3WLPA 4BX9A 4QDKA 3BR0A 4DG8A 5L45A 2AJTA 3VOTA 1GGNA 2BGRA 1H8HD 3M5CA 4G5HA 1PZFA 3SEFA 4JC5A 4C4TA 1AZSC 4L5BA 1WUIS 2IELA 1SWWA 2GYUA 2PD6A 2QGNA 4UXNA 4PLTA 2FMHA 1N57A 3JASB 5GGYA 5BVGA 4MKHA 4TZ6A 4RHCA 4FGJA 3I71A 4BEHA 2X42A 2Z5LA 4MTEA 4M1SA 3T5AA 3UG6A 3VR3D 2YWGA 2MC3A 2BFPA 1L3CA 4CSWA 4LXUA 4FHZA 1E2MA 2GPJA 4ENUA 2FPPA 5C34B 4LRSB 4HVLA 3H83A 2PKQP 2VA9A 3CBGA 3MUEA 3AIIA 1F9AA 4MUMA 3RD5A 4U6SA 2QWXA 5K3SA 1PUFA 3O8OA 4R8SA 3AFMA 3ZXSA 2OGZA 4AF8A 2Y9PB 3HSYA 3QLUA 4G26A 1NYTA 4XQ9A 4BWFB 3CW2A 1J2EA 1OFUX 2HK6A 3U60B 2PZEA 1G64A 2VNKA 3EIUA 4PFQA 5JCPA 1IWPB 5LA6A 1GAJA 2MH2A 2NX2A 3KV3O 4TROA 5DM1A 3DLHA 3KQKA 4NICA 2HQSA 3JVVA 4G6DA 1QVVA 1WPRA 3ZCQA 3VA7A 5AH0A 5D5XB 1RKBA 1V2HE 2CXXA 1MMGA 2QOEA 2ZSEA 2ZYRA 3E35A 3HEBA 5AXDA 2I4RA 1NG6A 4PYNA 4FFSA 4LF7B 4F4CA 2I91A 3OHPA 2Y1FA 1GPAA 1RQXA 3RU7A 1I3QJ 4PXAA 4ZAVA 4YMSA 3U7JA 3OA0A 1NVBA 1NL3A 3IQIX 3BN3A 2RJOA 4EF6A 3EVZA 3OR1C 5CGQB 5DGIA 5LBTA 1FP4A 3JAKA 5AK0A 4EFLA 4CMKA 1R0ZA 4KR9A 3GN2A 3BORA 1YI0A 4QBKA 2WQ7A 1E2KA 1U5BB 2W6NA 4FS3A 4QQ8A 5E0OA 5F2EA 4HOYA 2DR0A 3IUNA 3NG1A 1E18A 3ABQB 1GFIA 3PYLA 4CVNA 2KISA 1QZYA 3Q0WA 3GFJA 1KZYC 3A8TA 5AFSA 2ZYVX 3TXYA 2YRFA 2DERA 1M9NA 1Z25A 4JBWA 4ENPA 1ZI6A 3H5IA 2CF5A 3NPAA 4EJFA 3FLMA 2VF7A 1C9JA 1MRZA 1VRCA 3CRNA 2RGUA 3SHQA 3G2NA 1KOLA 1UKVY 3ROEA 1WJ5A 1UBEA 1Q7EA 3GNLA 1YFLA 3COWA 1LS1A 2PS0A 2R93J 3D7MA 1PZEA 4QYTA 1AE1A 4W5WA 1YFJA 3T7JA 1X13A 3L46A 1TEXA 3KTAA 5LQAA 1G5TA 2GM9A 4QNMA 1A2QA 2V6CA 3HBLA 1IC6A 4P93A 5HPYB 3NOXA 1RR7A 2WFLB 4R83A 5HIMA 1TU3A 3QBJA 5PGMA 4M9QA 4PO9A 1QHHB 2ZIXB 4TV9A 4B4OA 1Q1VA 1EI9A 5EJ4A 3FWKA 5EYRA 2FOIA 3HCEA 5ALYA 2IH5A 1HE4A 3V1UA 3SYMA 3RFTA 4ZV4A 4DM4A 4S12A 4Y0AA 4IJKA 1G3YA 1OWPA 5B1AH 1P17A 1PS9A 2CHVA 2IEYA 3VQTA 3QJ5A 1X6VA 2FKNA 3OS1A 3HL4A 4B87A 4Y2YA 1NLMA 3KZYA 2JAOA 2JFWA 4O4JF 3UJHA 3ZMSA 2F00A 2YMPA 3IP6A 4AW9A 3HIFA 1KYWA 4ZJZA 4Y6PA 2QW0X 4EKGA 1CS0B 3JRCA 1I32A 4LG0A 1JHHA 1RAFA 3BOSA 2LG4A 3SVTA 2AEFA 3GF2A 3ZV4A 4ALKA 2W2OA 1QGED 1HFEL 4EJUA 2GTPA 4DQ2A 3EXHB 2ZATA 2VEOA 3MTBA 4C7VA 3QWLA 3I4MJ 2VAXA 4PHTA 2E5NA 1OWNA 2IS4A 1UJ5A 2VKTA 3O4JA 3SU8A 3C2BA 3VVBA 1TYAE 3BQMB 4F60A 1TVEA 1EE9A 4D1QA 3BYZA 1GGMA 3B85A 1W8IA 4Y2UA 3ZHBA 3A1CA 3JD0A 4XIJA 3WODF 1OA1A 2Q1UA 4EDFA 2ID6A 5CG1A 2QLMA 2XGOA 2Y77A 3LUDA 4J1SA 4ZVUA 4I3FA 4UM9D 3UHJA 4M37A 2CYYA 1ISFA 3C8UA 3K0EA 4H4DA 3JYQA 4NP6A 1GZDA 4WBXC 5G4LA 1NI4B 3CSUA 2VQLA 4F9TA 3LBAA 4ZVVA 1XCBA 5A5VA 5E18F 5IXJA 3MTAA 4H18A 5FFMA 3IKTA 2EQ5A 4Q66C 1YB6A 4UOEA 5BO5A 3GGPA 1JH9A 4LVOA 1OI7A 4JP1A 2DQSA 3GLLA 3FMPB 1V55H 1TYCA 1A9PA 3IVXA 3GMTA 5DV9A 2OUKA 2FSHA 1UL1X 4I1UA 2VTVA 3U49A 3GWGA 5IDQA 4ES6A 5H8WA 2FCAA 5CPFA 5GIPE 2GXUA 2C88A 3FW1A 4FOTA 3QU4A 3W0LB 4RFSA 3AF5A 3WHBA 3QX7A 1RRGA 2QL6A 3D5EA 4GX2A 3W78A 3WYEA 4DFDA 4F2GA 5K0LA 1RXWA 3GTJJ 1M7GA 1G5QA 1ZIDA 1FFXB 3MMPA 2AFHA 5CDTA 5KYKA 1NJ6A 2BZTA 2KJCA 2KLOA 1Z75A 2CXHA 4DIEA 2O8NA 2FI1A 1U5TB 2OVBA 2WSIA 3FBIB 2GDJA 4N8DA 2XMBA 4DJTA 1ZG3A 2IIVA 2C03A 1F2TB 3F4KA 3L8GA 4PZYA 1KE1A 1BJZA 5AQEA 4DYVA 4QL3A 1DEXA 1N3IA 2ELKA 3HHGA 3KWMA 4UCWA 2O2HA 5AHKA 1JTXA 4NOMA 5CB4F 3UBTA 2V7WA 2MYTA 1B8NA 3NETA 1R8YA 2A7XA 4CYCB 1J00A 3HSEA 3THXA 4Q3CA 1XR3A 4OINF 1YULA 1UAGA 1WBDA 2J0SA 2GPYA 5IM4F 3HACA 3OKFA 3OQ1A 5JSHA 4Z3KA 2PXHA 3FX3A 3A03A 1DQNA 1RWPA 3IRRA 3ISTA 3W90A 3WOHA 1FCJA 1PGPA 2IGKA 2L5QA 4BKXA 1U8FO 1XS9A 3JR7A 3JATB 1EP1B 2ZJ6A 3AVXA 3TCXB 5H9WA 5K1YA 1QYXA 2OA4A 4N5DA 1HDIA 1PHPA 1VKZA 2DUWA 3ANMA 1JDBB 2ZBDA 2Q5OA 3RH0A 5REQB 4DPKA 4E1VA 4C78A 2M1XA 2GJ4A 5BT9A 2Q1TA 2K2WA 1P7IA 5JNUA 2H3EA 3UXMA 3K09A 1D4AA 2BI8A 2MW8A 1QE3A 3NHKA 4RAGA 2IYAA 3U61B 5C53B 1C9MA 1D6JA 1YHNA 1PCXA 5BOVA 2Z8YA 3RVRA 1QYCA 5FADA 2QJTA 4IXMA 2EV6A 4KT5C 1NW5A 1TNSA 2C3MA 3IAAA 9ATCA 3AM5A 5FF9A 5B58T 1KE2A 4JASB 4G63A 4FX2A 5CYVA 2EFHB 2GF0A 1DFGA 2OHIA 1KU6A 2W6MA 2A1TS 4MB0A 3VPDA 2K6GA 3M8KA 4NQWA 4ND3A 3FOZA 2CBZA 4D3SA 4DMFA 2EP7A 3LSYA 4LCBA 1K8QA 1AMUA 1OGIA 4JYCA 2PMZN 3CINA 4LJ4A 4BQRA 4YRZA 3ANXA 1WUTA 1I6WA 4UBIA 4WFKA 3MRTA 1BKYA 3HVUA 5HIIA 2JH9A 5DLYA 5KQRA 1E3SA 1JKJA 1V3VA 4ZXFA 5JZ9A 1F4LA 1WCYA 2WKPA 1TQ4A 4EB3A 4G4SP 2OLEA 3KJXA 4Q39A 2FG7C 2J3DA 1CLEA 1E2PA 2RGDA 2VHWA 2A8YA 2XQIA 4YCJA 5TB5A 4CE6A 2FN3A 3K0CA 1M6VA 2X5OA 2PYZA 4TRMA 1PQ4A 2MGQA 1TJ4A 1ZNXA 2RKBA 3B7PA 4KN6A 4CF6A 5D5HA 1SXJD 2GZHA 1ICEA 1P5HA 1GZ6A 1SVUA 3U1KA 2QTVA 4G0PA 4DTIA 2NTNA 2AYXA 3L7MA 1Z0ZA 1G2IA 3FUVA 3L06A 4OXRA 4FZJA 3WGGA 2L01A 3HJEA 1X3LA 2BGJA 3QPUA 3IA2A 2EGUA 3P9RA 5CBPB 4FHDA 2R8PA 4PCAA 1OFUA 1VYVA 1Y1VJ 1HBJA 3A3NA 3DCYA 3RKXA 5C4MA 4HQ6A 1N9GB 2MSLA 1ABBA 4L08A 3R3HA 1L4GA 3CE6A 3MBKA 2FUCA 4YJGB 1G55A 2M6RA 5AM5A 3C8MA 2LTAA 3AI1A 3OVMA 5AKKA 2R9VA 1WCWA 3GHYA 2XCRB 1AH2A 3EXFA 3QPLA 2X4IA 1ZXBA 1P2FA 2CMHA 5L3EA 2ISZA 1DKRA 1TUBB 1SJ9A 5IAEA 1WJGA 4UAJA 2P78A 2ZG6A 4K28A 2R60A 1KAMA 2DA3A 2JL1A 2QUHA 3O94A 4ND4A 4PZ9A 1FXWF 4I4TB 4XFJA 4DBLE 4E7SA 2G6TA 4ZC3A 3BIWA 2AD5A 3T5GA 2ZLBA 2OZKA 3AEQB 3K9GA 5AI0A 4I5IA 4Q16A 1EQ2A 1N2SA 3MCUA 4BVEA 4A4DA 3EVFA 4AZ3B 4P38A 4D8TA 2JI7A 2H1IA 1LSSA 3PSAA 1DGQA 3H3ZA 1TT5B 3TQQA 1HTWA 3INTA 2DU8A 2X2OA 4V0MA 3I2IA 4WZBB 3FCOA 2CLHB 4IOLA 4DOMA 2PEYA 5DDIP 2HGZA 4L5JA 2JFUA 4H35A 2JJ8A 2OD7A 3PGXA 2ATIA 2DLCX 2DSTA 3PQEA 4KVAA 1KYXA 4QDZA 2WAFA 2HPVA 2VPRA 4P0PB 3UV7A 2XPWA 4XR9A 2NV0A 3HYTA 3LZDA 2F5VA 1ODIA 2LYCA 4B2PA 1GCOA 2IYTA 3QU9A 4FT2A 3E05A 2BKUA 3K05A 3TZLA 4L85A 2AQIA 1FVXA 2O7QA 4W1PA 4E13A 4M9RA 4NFLA 3ICQB 1VJ1A 2XE6A 3MJFA 1QH1A 5CNKA 4HRYA 3RANA 1DO8A 2II6A 4Q93A 1X87A 1O3RA 2HJRA 2JFBA 3E22B 3JQ7B 5CPRB 3ZQLA 3OZAA 4QGBA 2F6CA 1PFVA 1YA4A 2I6TA 3JZAA 3OOHA 3OQNA 5FKOA 3ILHA 3SQWA 4Z2YA 1MAUA 2WTAA 2XWJI 3KVVA 1I01A 2FMYA 1Q1NA 4I0WB 4M0MA 3HDHA 4D9