4GO1A

Crystal structure of full length transcription repressor lsrr from e. coli.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
297
Chain Sequence
EQGMCEEEQVARIAWFYYHDGLTQSEISDRLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYETQLRRQFSLQHVRVIPGLADADVGGRLGIGAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIGQLNAACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAADVAIVGIGAVSQGEQLMIGRKGAVGDILGYFFDAKGDVVTNIKIHNELIGLPLSALKTIPVRVGVAGGENKAEAIAAAMKGGYINALVTDQDTAAAILRSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Phosphorylated Autoinducer-2 Modulation of the Oligomerization State of the Global Transcription Regulator LsrR from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Transcriptional regulator LsrR
total genus 92
structure length 297
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04198 Sugar-bind Putative sugar-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4go1A01
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4go1A02
3DV8A 4R9NA 1K7AA 3BXGA 2ZXJA 3GZ6A 4CGZA 4DNCA 4R79A 1ON2A 1P4AA 4L4YA 1IXCA 4KDPA 4GCVA 3HN6A 5TJJA 1EV7A 1H0MA 1MDMA 1K79A 2JPCA 1TTYA 1MKMA 1IXRC 3TQNA 4KN7X 4G7OF 5L3GA 3ML6A 3GWZA 1K6OA 1XGOA 1PDNC 2F5EA 4BAYA 4LB5A 1XCBA 5LLQA 3BXFA 1B1BA 3O3KA 2YPRA 3FF5A 1T39A 4UXNA 5D5VB 4Y17A 2HTJA 2PLYA 4Q5SF 2KKOA 1FRZA 4EV0A 2DW4A 3FMQA 2IPQX 3J81Z 3SZPA 3WTXC 4U0VA 3AAFA 4G7ZF 1XDSA 2KIMA 3T8RA 4ESBA 3PQKA 1WI9A 1E2XA 2GXGA 2P6SA 1O3SA 2VT2A 5EEHA 2EV0A 3VB2A 4A2UA 1HOTA 1B6AA 5DD4A 3WG9A 4HLYA 2HQNA 5LRRA 2GNPA 4RGSA 3E6MA 2WC2A 3ABUA 2QQAA 2STTA 1SD5A 5CVIA 4L5IA 2Z33A 2EV6A 2EA4A 4UV9A 3EQLF 2P7CB 1KYZA 1FSEA 4BNCA 2LF7A 2W48A 1KQ8A 4JK1X 2EFWA 5FLXK 2D45A 4XSXF 1IXSB 4P9UA 4MTDA 4RB1A 2IVMA 4OIQF 1TQPA 1V4RA 2VOPA 1YG2A 3WTYC 1HBXG 3WGIA 4UV8A 1TW2A 4M8LA 1HORA 3JTGA 1D8JA 1RIOH 1ZRCA 1I5ZA 4OIRF 3CSSA 1FX7A 5BPIA 2MH2A 2BBYA 3LAPA 3ZMZA 3RI4A 3M1EA 1RZ4A 1U8RA 1UCRA 2GA1A 5E8GA 2XAGA 4ENMA 3R61A 5ILSA 1QQIA 1P4WA 2RKHA 1MJBA 4I2OA 3BDDA 2PFBA 1H9GA 4RAZA 3IHUA 2CFXA 2BYVE 3NWPA 3ENQA 5DUIA 3I0TA 3DXJF 2QENA 2GWRA 4U88A 1ZG5A 1XD7A 3I54A 1IN4A 4YG2F 2DPUA 2HQRA 1SFEA 1OR7A 2IT0A 3E5XA 4CYDA 1QO0D 3NQOA 4LMYA 4Q47A 3IWZA 4L9TA 2O03A 4L9NA 1UJ4A 2ZKZA 1BN5A 2H94A 5CVVA 5HLIA 2DQRA 2O6GE 2HS5A 1XGNA 2R3SA 4RGRA 2HEOA 3WU1B 5D8LB 3E6DA 2IW5A 3N4MA 2V1DA 3JTHA 3JSPA 1XGMA 3GUDA 1YW7A 2Q0OA 5BPDA 1IW7F 5FD5A 2Z5UA 3WTZA 5H20A 5BS6A 2V9VA 1BBYA 1U78A 1R5HA 5IT3A 4KT5C 1J7KA 2OQGA 4KICA 1FSHA 4ON0A 1OKRA 1T6SA 1FP1D 1J9IA 3B02A 5ILUA 3KEQA 1O57A 2QVOA 2VONA 1EH6A 4LLGF 3BJOA 3P9IA 4FT8A 1HQCA 3MZYA 3RPUA 1UJ5A 3F8MA 4AD9A 2VC1A 1QZYA 3EETA 1HKTA 3QU3A 2CG4A 2L02A 4BQAA 5CJ9A 4P55A 4BHCA 1ZAOA 2HKOA 1S3JA 3CDHA 4GGGA 4LJZF 2JPBA 3C7JA 1FYLA 3LWDA 1YQAA 4R7TA 3HUGA 3QPHA 4F7ZA 4MGRA 1G3YA 1BC7C 1U2WA 2IA0A 1RI7A 5DEQA 3R0AA 3LA3A 2FBKA 2NYXA 3WU0A 3Q5FA 1P92A 2KJCA 3ZPLA 2CO5A 2VN2A 3R4KA 2HR3A 4L0ZB 1IF1A 3KLOA 3BROA 3G3ZA 1HXDA 3TOBA 1Z6TA 1D5VA 4ETSA 5A2QK 4IHSA 2F5DA 4MQ9F 3DPTA 3ZQ7A 2K7LA 4U7BA 2VXZA 1BOAA 4AIJA 4I7HA 1HW1A 3QP6A 4O3MA 2GIVA 3F8CA 1A04A 3TX2A 2OU2A 2PEXA 4P96A 3D0SA 5ILVA 3ECOA 2A07F 1AOYA 1M0SA 5FFZA 1ZG1A 2XKOA 4ZYHA 4ZZDA 3FMSA 2L4AA 1FC3A 2JZYA 4G6DA 2VBXA 4EJWA 1LDDA 3R0JA 2EFQA 2V6CA 2BGCA 3B73A 2Q8KA 3HOSA 1SD7A 4EM1A 3OOPA 4KMFA 1LVAA 3J7AO 1U5TC 3SXYA 1ZGAA 2R7FA 5HJ5A 2FA5A 4R1HA 3GFJA 4HX8A 3ISPA 1J5YA 4EQQA 5LHGA 5JHUA 3HRMA 4M6YA 1FT9A 4I02A 1W7PD 4XRFA 1UB9A 4B8XA 5F6FA 1DPUA 3WTVC 1LEBA 3ZMUA 4H0EA 2O0YA 1BI2A 3DQVC 4RAYA 2ETHA 3L2CA 2WWYA 3P9CA 1YIOA 3BXEA 1O7FA 4ZYGA 1L3LA 1D8KA 5K1YA 2P4WA 2JT1A 2XRNA 3V4GA 2AXLA 1W7PA 1V3FA 3J80K 3E97A 3F8NA 1C0WA 3J80Z 1TLHB 3IWFA 5DCMB 3Q9SA 5DD8A 4L50A 3FX3A 2L01A 3MAJA 2ACJA 4QWQA 2OZ6A 1F9NA 4M9XA 2ZBKA 3HHHA 3TDUC 4E70A 4N9IA 1TNSA 1LEAA 4U7DA 1LQ1A 2UWMA 2HKXA 5FB2A 4WXCA 5D5XB 1Z91A 3CUQA 1CD5A 4XLNF 1QGPA 5E20A 2MBFA 2EFNA 3V7RA 3HRSA 3ULQB 2LDUA 3BY6A 4XSZF 1QBJA 3W6JB 1G6NA 1UHWA 2KIFA 1XSVA 2A3SA 4HW0A 4KYWA 1BM9A 1DP7P 3JW4A 4LGWA 1SMYF 1XMKA 3GF2A 3DP7A 2HZTA 4KN4X 2OQRA 2P5KA 4LD5A 3LA2A 1TNTA 4TM7A 4YFXF 5F1RA 4A0ZA 2ADUA 5E17F 4M6XA 1FP2A 2K27A 5KK1A 3SFZA 1TQMA 1KU2A 2F5CA 4OOIA 3E15A 2NNNA 3LA7A 3C3WA 3FWEA 4LG0B 4Q4ZF 5HDNA 4ZH4F 3CLOA 1IN8A 1BI3A 3RPQA 1HW2A 4D0PA 3H92A 4TM8A 1OYWA 2FOKA 2RC4A 1S8NA 5CVJA 1SD6A 2ISYA 3U2RA 5FD6A 1Y0UA 4WCGA 1IRFA 2MLKA 1ON1A 5D4RA 1R36A 1J0RA 3H3ZA 1FBSA 2WU1A 3L9FA 2Y48A 5D6EA 2HDCA 4RB0A 2ZFWA 3C18A 3BPVA 2CGPA 4S04A 1PP8F 2Y75A 3HSRA 2XKPA 1JHHA 1LK7A 5IT9Z 1P2FA 3MQ0A 5L3FA 1HW5A 4FX0A 2RI0A 2CWEA 2XAHA 3CTAA 2G7HA 2Q2EA 4LFUA 2DU9A 4ZZLA 3ELKA 5J6XA 4OINF 2J0EA 3TOAA 2XIGA 4L4ZA 3MWMA 2W84A 5DCMA 3KP3A 4O6JA 2BE5F 3RDIA 3NRVA 5F64A 1B4AA 4BXUA 5DYMA 3E6BA 1E17A 3RKWA 2A6HF 3I53A 3ICOA 3EFBA 2K4BA 2QLZA 1JHFA 1Z9CA 2UXXA 4QLCU 5LGNA 4IJAA 1I6XA 1YLFA 1ODDA 4EVIA 2DLLA 4A5MA 1BI1A 2PJPA 5JFRA 2GZWA 4KIBA 2HTSA 2GQQA 4KFCA 4M9SA 1QNTA 3M9AA 2XGXA 3LQQA 5HLHA 1S6LA 5CLSA 3IXQA 3GFIA 3KV1A 4KA4A 5BOXA 3IKTA 1F5TA 2STWA 3MFKA 4ESJA 3BP8A 3F6OA 2YR2A 4MTEA 1XDUA 2XAQA 4JQFA 3M8FA 4LK1F 3V8LA 1FBQA 4ENNA 1R58A 1FY7A 3QPTA 2VBYA 3F8FA 3KEOA 1SFUA 2VC0A 4EJTA 3QU6A 2O0MA 1ZLJA 1ZLKA 2D1HA 4G7HF 1ZG3A 5K5QA 1WSUA 5E8IA 4RGXA 2YX7A 3E5UA 3K1PA 4RB3C 1FZPB 2W24A 2EA2A 2J5OA 1ZYRF 2VOOA 1OPCA 5HVQC 3ENWA 1ZH5A 4WF2A 5E1WA 2P8TA 4HX4A 1R1UA 2JTVA 1W5TA 3RJPA 3T0YA 3LWFA 4HAMA 3WTUC 5E1XA 3HTSB 3HRUA 2EK5A 2XUBA 4M74A 4LB6B 1HKQA 3F21A 5CVRA 3K0LA 3WTTC 1T38A 2XHKA 2RN7A 3TKYA 4M71A 3KZYA 3P7NA 3HTUA 1JE8A 2M45A 5AIPA 2A61A 3OV8A 3NEUA 4AIKA 2QBYB 1RUOA 3CUQB 1FSFA 3EYYA 4AVPA 2XAFA 4M9ZA 4Z2YA 4UVBA 4EGZA 1G3TA 2OD5A 1H9TA 3T8TA 4HDVA 1O3TA 2ZMEA 5E18F 3WTWC 3GO5A 2DAOA 5HS8A 5BMZA 3SHFA 3QRFF 2YSRA 3E3VA 1HSJA 5L3CA 2VODA 2M30A 2MC3A 3CH7A 3IRQA 1XB4A 3WE2A 2DFIA 1K78A 1VTNC 2KJBA 3GVAA 1T0FA 1O3QA 1MD0A 2EV5A 1STZA 2V1XA 4CZZA 1UFMA 3I4PA 4JBAA 3L7WA 3COAC 3GW2A 2GXBA 4U0WA 4EM0B 5D8KB 3HHEA 2PN6A 4WX9A 2QQBA 2OBPA 4LG0A 1WKMA 2ZO4A 2D1VA 4OU0A 3BXHA 3FHZA 4ZYDA 4ASNA 4HF1A 4PDKA 3O6BB 4R8HA 2MH9A 2LF8A 4EMSA 1YYVA 2B0LA 2YX4A 4CO8A 5E1ZB 1F1ZA 4YIIA 2ZNZA 3LAJA 2BKXA 4PZJA 3HYIA 4I09A 2K86A 3G73A 2RV8A 2AS5F 1SD4A 1B59A 3E7FA 1IN5A 3U7JA 1G3SA 3I59B 2F2EA 1TQIA 4HF0A 3I59A 4CDGA 3GFLA 1NE7A 1WQ2A 1EH7A 1USTA 4RGUA 5LHHA 2IJLA 4TV7A 1CGPA 1CF7B 2L3DA 5LEJA 1J75A 1R7JA 3OC6A 4CICA 4EM2A 2RGVA 2QBYA 4OIOF 3MEXA 2IA2A 1EH8A 2DQLA 2ELHA 4ENJA 2QM3A 3K69A 4A12A 1QPMA 2VBWA 2PMHA 1L0OC 4HYEA 1P6RA 3K2ZA 2FE3A 1W5SA 4EGYA 4LLLA 3KWMA 3GLXA 4I01A 3EUHA 2G7UA 2P7VB 3E5QA 3HSFA 2XASA 3IKVA 1R1TA 4IXAA 4L9VA 3KE2A 3WE3A 2HYGD 5LHIA 3HHGA 2LNBA 4PGHA 2E1NA 3KP5A 2PMUA 2EB7A 5ICEA 5L3DA 1FS6A 3TO9A 2QUFA 1FNNA 2DTRA 2FSWA 2GA2A 1NHAA 4LK0F 1CF7A 1VL1A 4IRGA 1XN7A 2DI3A 3WTSC 4GMKA 4K2EA 2IRFG 3MCZA 1G3WA 2KRFA 2XVCA 4DQ2A 4A6EA 3SZTA 4Y13A 5D5UB 5H6RA 1O8BA 2H6BA 4YIFA 3WGGA 1AWCA 2HGCA 2V1UA 2W25A 1T98A 3FXRA 3F8BA 4PGGA 4HBLA 4KIFA 3NZEA 1USSA 1RUNA 1ULYA 1XCVA 4MHGA 1Z6RA 1FOKA 2QQ9A 1S29A 1LDKB 3Q9VA 3VOEA 2M1BA 3RKXA 1UJ6A 3BJAA 3V8JA 2OKGA 1LNWA 2O61A 3L7OA 1S7AA 3BJ6A 5LGUA 3ZP5A 2H6CA 3BPXA 2PQ8A 2FRHA 4UVAA 5BQTA 3PQJA 4ENKA 2PBIA 3J81K 1IN6A 4IHTA 3KFWX 5HDGA 3JAMK 4HOBA 2COMA 5FFXA 6PAXA 4UHTA 5ICFA 1XTZA 2DT5A 1GXPA 4MNUA 4A6DA 3C1DA 3KP4A 3U9GA 3DFGA 3O2PE 1KU3A 1KYWA 2FF4A 3V7CA 2A5YB 4NMLA 2DK5A 2EFOA 2Z3YA 1PUEE 2FMLA 5L3EA 5H6QA 5LEKA 2L4MA 1R00A 3WODF 1ZREA 3CJNA 3DPLC 3V8KA 4O5VA 2FEZA 4FX4A 1GVJA 1XMAA 1KQ0A 2WTEA 5HS7A 3F22A 3LFKA 1REPC 3KP7A 3BZ6A 3I5UA 5FLXZ 5JVTA 4YFNF 1Z05A 2MA3A 1O7LA 5HOOA 5IT9K 4HDUA 1IUYA 1TBXA 2HYFA 4GXOA 4WXHA 2RQPA 1J2XA 4ZYEA 3VODA 3SQNA 2CQKA 5FGMA 3DEUA 2K4JA 4M73A 2Z9OA 2RDPA 4KUMA 2PG4A 3BOQA 3KLNA 2CYYA 2O8XA 2KIUA 2O3FA 4L18B 3H3UA 4HQMA 4HF2A 3FZVA 3GEZA 2QZ8A 1ZN2A 1BJAA 3T1BA 1LJ9A 3ECHA 4WXDA 2MD5A 4U0YA 4OIPF 1O3RA 2Y0MA 2QWWA 1MDMB 3K9TA 1DDNA 3QAHA 1ZRFA 4GYGA 2BV6A 4NHJA 1YO5C 4XLPF 3CO6C 1BIAA 1KA8A 2W85A 2DPDA 1Q1HA 2V79A 2IP2A 4HQEA 5JR3A 3KP2A 3QOPA 3RYPA 3KETA 4N0BA 1P4XA 5JI6A 4HV6A 1F4KA 4BHBA 5CYVA 2R7DA 3D5LA 1GHCA 1W7PB 1T2KA 1R5GA 4OQPA 5ED4A 4ESFA 2X4HA 3HRTA 3GFMA 3CUQC 4YFKF 4HX7A 5LBQA 4GO1A 3I64A 1Z1DA 3ABTA 4N9HA 3FM3A 2VT3A 3CUOA 4A5NA 2ZMEB 1MJAA 4G8XA 3ZN0A 1KU9A 1YS6A 4MEYF 5D4SA 2X0LA 5LRSA 1IRGA 2GAUA 4L9JA 5L3BA 2P5VA 1LB2A 4B09A 2FXAA 1BIBA 4LLNA 1YW9A 3F6VA 3S2WA 3IRRA 5CVUA 2FBIA 1FYKA 2R5FA 3M7GA 5HS9A 2F5FA 1BC8C 2OAZA 1SAXA 4UNOA 4NQWA 5ERIA 1QZZA 2PI0A 1RNLA 2TDXA 2WV0A 4RS8A 2FNAA 2A68F 4XBFA 3DKWA 5J8FA 5EEGA 3MZHA 1SMTA 1U3EM 2XROA 2M87A 4Y15A 2HFHA 3HSEA 1OYYA 1ONVA 1FPQA 3EDPA 3TO6A 4NB5A 5K5RA 1IN7A 3ZMVA 1DUXC 1SFXA 3ROUA 5TRDA 4HA8A 4IPAA 2DBBA 3P9KA 4OQQA 1I27A 4BH9A 4G94A 4KNYA 4RB2C 1PP7U 3ZMTA 2QYOA 3FM5A 3REOA 3K1NA 4FHTA 1KQ9A 1TW3A 1DPRA 3LHIA 4KMUX 4OMZA 5AIQA 2E7XA 1ZHFA 3GXOA 3K1MA 2FNPA 2C6YA 1KGSA 1XGSA 1YW8A 3KCCA 4P5OA 1FS5A 4CXFA 1JGSA 4HV5A 1ZRDA 1MJ9A 4Q48A 3F23A 3CO7C 1YFHA 2NRAC 3ZMSA 3FXUA 2L54A 2CW0F 4A0YA 3GYHX 3F72A 3I58A 4AWXB 2XV4S 1X3UA 4I98B 3F3XA 1LDJA 2UZKA 2EWNA 1UHMA 4L5JA 2ZCWA 4HLXA 4L0YB 3PFIA 2ZNYA 1W4MA 3KP6A 5HDKA 3RIRA 2BKVA 5J8CA 1ZGJA 4IF4A 2M8EA 1PBTA 4OMYA 4PCQA 1G4DA 1IAWA 1XSDA 3KZZA 2E7WA 3E6CC 3LSTA 2EFPA 1R22A 5ICGA 1FYMA 3DF8A 3U1DA 3JAMZ 2G9WA 2LKPA 1OMIA 4BHPA 2VBZA 2MLGA 3M8EA 1D3YA 1IZ1A 3RTRA 4I0BA 2BEOA 4MQVA 2UXNA 3EYIA 2D2WA 5DCFA 2JSCA 2H27A 1KU7A 2F8MA 5A2QZ 2JRTA 4G9YA 1LKZA 1I1GA 2FU4A 2LSOA 3LQRA 1KS2A 2NNYA 3VEPA 4IVNA 3WGHA 4IRHA 1U5TA 2RVCA 2EJRA 3W6KB 2P6TA 1WWXA 1DEAA 1FQOA 2W57A 4GYIA 3GZ5A 1BI0A 3L09A 2IA1A 2DO7A 5D6FA 3VFZA 5FO5A 3HOTA 1MGTA 3I71A 4HZFA 2VE9A 3TDZC 1K78B 1HSTA 1FLIA 4G6QA 4L51A 1B9NA 4EJVA 5HLGA 2NS0A 1YTYA 2VE8A 2Z99A 3BWGA 3R60A 3QP5A 3N97A 2ZJ2A 1YS7A 2YU3A 3ZN1A 3HIFA 1OYIA 4M72A 3L00A 2CSOA 2A69F 1U6GA 2J5PA 4P9FA 3IC7A 1FWZA 3FMRA 3TGNA 4UUVA 4IO1A 4EJUA 3JSOA 1GXQA 2M5WA 5DV5A 2K02A 3FXQA 3T5XA 1U5TB 1JT9A 3ERED 2H09A 2ESHA 2ESNA 3GX4X 4UVCA 4KIGA 2HOEA 5KVRA 2NAZA 2ISZA 3TO7A 5K5OA 2OZUA 4I0AA 4EJOA 2A6EF 1HKSA 2P5LC 5ICCA 5DUKA 4BYYA 2FMYA 2FQ3A 2RI1A 1JXSA 3UW1A 1Z7UA 2RNJA 1ZARA 4X84A 2E1CA 4IRIA 3RKYA 2FBHA 3V7SA 3ENVA 1WRJA 1FBUA 4WWCA 3ZMDA 1R23A 3IL2A 1Y89A 1I1SA 2DK8A 1XSXA 3RYRA 4AIHA 5LGTA 1LK5A 2HWVA 5DDGA 3EB9A 5D5WB 1J59A 5AONA 4MEXF 4S05A 1R1VA 2OA4A 4WK8F 1MZBA 2XAJA 1B9MA 4A0XA 3R6SA 1S7OA 4CHUA
chains in the Genus database with same CATH superfamily
3GNQA 4RV4A 1K7AA 5CBPB 1Z2DA 2ZXJA 2D2EA 4AWBA 4BNDA 3GZ6A 3A3NA 4CGZA 4NAHA 3CVYA 3TCKA 1TTHA 4IINA 4B3RB 4AO6A 4DNCA 1U1CA 5EHQA 3CE6A 4PO8A 4TZ0A 1LPNA 3ML1A 4PNZA 2YWCA 4D1YA 2QRQA 3Q8LA 3ZQLA 3WLHA 4ER7A 2Q49A 1ON2A 4Q3BA 5CG1A 1JHZA 2D06A 1FDTA 2CDCA 3LRTA 4JEHA 1M1YA 2FQ1A 2IEYA 4MVJG 4YWJA 3VR6A 4D8YA 4BMCA 1X1EA 5IMSA 1DIOB 4Q66C 1ZRNA 3RC3A 3H2KA 1CUSA 5TJJA 4BAUA 4ZQFA 2JFBA 1EV7A 1MDMA 3L9WA 1TTYA 1MKMA 1O89A 2JJMA 3QEAZ 1QOPB 1IXRC 1GLGA 3TQNA 2NZ8A 2NP6A 2BEJA 4ZVQA 3HB1A 3VR5A 4H1UA 3MVPA 4BEBA 2OUIA 2V7WA 1ZJ4A 4QT0A 1L8LA 5K0NA 3ML6A 2ZJOA 3WKDA 3O9ZA 2PCLA 4C7KA 2Y1GA 3FNFA 5JXWA 1UAAA 4PFQA 5LN1A 2Z6UA 1BH2A 1NBHA 2BP7B 3JVEA 4MVJM 5T3UA 3ZWMA 3EFHA 4GGPA 3ZPXA 4BBAA 5LJIA 4BRUA 4E13A 2WZDA 3OS0A 5FO0A 4BAYA 1M73E 3NHJA 3PA8A 1AKUA 2F17A 4GM1A 1TKCA 2YCLA 2HL6A 1XCBA 2RDMA 3DTTA 1X7ZB 4M7RA 4LVCA 1T1EA 1YRBA 4MR9A 3WICA 4B7XA 3PIOF 3BQ9A 4ZANA 4K7JA 4UEQA 2JSPA 3LX5A 4WZAA 1PVVA 4URWR 2VJ5A 4NMWA 1Y8CA 2ZB3A 1QQ7A 2WJ3A 4S1VA 4XW2A 1M0TA 3BCAA 1P2GA 3ECAA 4RD1A 2YWHA 2PA0A 3ILSA 1RHMA 1O94C 3O0TA 4UXNA 5D5VB 4Y17A 4H7JA 2X8JB 4KFTA 4OLFA 4OG2A 5B4VA 4I5IA 4QOSA 4D9IA 1O6GA 1KARA 3GFGA 4BECA 1U0HC 2HT6A 4E7IA 1Y39A 3U3JA 2EKDA 3WHPA 1Y8QA 2VF5X 1RC9A 4Q5SF 1YRWA 2OYSA 4HLCA 4RA6B 5CVCA 4BVEA 3OWTA 1K88A 3WNZA 4DCJA 3K16A 1U5BA 3IR5A 4Z1MA 3FMQA 1TTPB 5DDIP 1YZKA 1XRJA 2X42A 3W8DA 4PQYA 4NH4A 4U3JB 2QE7A 1L5SA 2NXJA 4YBRA 1CULC 3ZOKA 2IA5A 4AZVA 4EENA 3ZJ4A 4Q4CA 1W93A 4JQZA 2RIPA 5B1BH 4NBVA 1G20E 4WXYB 1U8CB 1F2VA 3DLPX 1Y3IA 4ZO4A 4CL2A 4OO3A 3RI3A 3HJBA 3KSRA 3IEVA 3UUEA 1TVMA 2WZBA 5E4TA 3GCZA 2ACVA 4J43A 1I4OA 3QYFA 4IIVA 3B6MA 4PSDA 1GZDA 3ZHZA 2YV4A 1U9NA 1O3SA 3ILVA 4NCAA 4FQGA 1C30B 2VT2A 1CJVC 1UDBA 4HN4B 4HUQA 4M83A 3EVEA 2P3OA 3NHZA 4M0MA 3WMWA 4H77A 5DM0A 2J33A 5ADVA 3C98A 1HOTA 1Z6PA 3KQWA 4RJJA 4ZRDA 2YY6A 2GBLA 3TRJA 3CX7A 2FW7A 3UJAA 2PXXA 3OTGA 5LMNB 2J85A 4D4KA 2WZQA 2OK7A 3GJ0A 1J2TA 2OLEA 2PT6A 4RPCA 4YRGA 1PUFB 5CM9C 4JGIA 5JCOA 3V1TC 2DECA 3FUVA 1H0KA 2P79A 5K8TA 3OM0A 2FV8A 2R7KA 4EHJA 2WC2A 1GG9A 2C8KA 1II0A 2QQAA 2BTQA 1BS2A 3RIEA 5HIAA 4Z4QA 3PPYA 2H48A 3KXPA 2RHRA 1PQWA 3I0MA 4GF5A 4YXWA 3QLEA 4EHAA 1T8WA 2LMDA 1OREA 1YGYA 1OXUA 2HM7A 1KZ7B 4IIYA 3ONEA 5FP0A 4D80A 1F4VA 1DBIA 5REQB 3CLQA 2HXOA 3WBBA 1FMJA 1XPOA 4D0LB 5I8PA 4ENRA 1MZVA 4II2A 2WWTA 3X1KA 3H87A 3K5HA 2VPIA 3ORFA 2DQZA 2XQVA 2FPKA 2JK1A 4J4TA 4TMYA 2LY9A 4UV9A 1BCSA 3NGMA 3M6WA 4YAEA 4D9CA 1Y1KE 4N3BA 1KTIA 1VNDA 3EQLF 1PFYA 1SURA 1APBA 2XGJA 2ZB9A 2H5LA 3L0OA 1FSEA 2H08A 1NZFA 3MMNA 4HGPA 4X20B 3U39A 4EVQA 1ZW1A 4WNIA 2ZWPA 3CR7A 1I4EB 4RAOA 1HT0A 3GDGA 1KQ8A 3BIJA 3QUSA 4GM4A 4DMLA 2V7BA 3B2NA 4PPGA 5CEFA 4RV5A 1T5DX 4HXGA 1NUHA 1E1KA 1TKBA 4M2LA 5ALJA 1P7JA 2D45A 5ALLA 4P9UA 4ASUA 1PJTA 4MGZR 4FU0A 1V43A 3IE0A 2KPMA 1BQ4A 3D3JA 1GFWA 4FLMA 5D7BA 3V1UA 4OIQF 2NZXA 1RRCA 4K6HA 1JAZA 1A82A 2D5VA 2DCEA 4N9WA 1BROA 3BDIA 3OZAA 3ZV5A 4NH0A 2VOPA 1HBXG 3P8ZA 3KIOA 3IQDB 4UV8A 3C6QA 3MD0A 3WGTA 1FMWA 3BCRA 1P4HA 1DC6A 1PTJA 3QKUA 3SBDA 3IT0A 4A3GJ 2JAXA 4TTPA 3H0DA 2VXYA 1WJAA 3HYCA 3P4YA 1SHZA 3AVXA 4CZCA 3BDAA 3QFFA 5M29A 3A9TA 4JYCA 1D8JA 4NJEA 4EF4A 4LHYA 1WBDA 2X0IA 1WVGA 1ZRCA 4IX9A 1HETA 4CYMA 1I5ZA 4A69C 2IEGA 2ZE7A 1U65A 4WKGA 4FXOA 5M3MJ 3VX4A 1IPEA 5CT9A 3WL7A 3PENA 3OZFA 5EE9A 1Y1TA 3G68A 1ZFNA 1J8DA 1NRXA 2V5VA 4L0MA 4FN5A 3ROGA 1Y1PA 4IBOA 3F8WA 1RCFA 1SVIA 4OKNA 4U3JA 3ZU2A 1GNTA 2MH2A 4ZOLB 1FFYA 3ESQA 4GBMA 3O5AA 4LOHA 1L5GB 3BREA 3PX7A 1WCIB 2CXRA 1P0FA 1IRZA 3MVEA 3M1EA 2XDYA 1OXKB 4KQHA 4NKRA 5EMJA 2GA1A 1Y1WJ 3QK7A 4RX1A 3RF7A 1BWSA 2BF4A 2DA1A 4R81A 2Y66A 4KHPB 4BDSA 5ILSA 1MMAA 3LPNA 4G23A 1MW9X 1P4WA 1OAOA 1VKZA 1VLQA 2JJ1A 3B51X 3H9GA 3DXFA 1D9XA 1QFSA 3MMPA 1F2TB 2NXCA 1SKYE 2GK6A 4G4SP 1L4LA 3VR5D 1H6DA 2I54A 3AI3A 2Q41A 3AY3A 4GR5A 2C84A 4I08A 4EX7A 3BB4A 3H5WA 1U4SA 3BDDA 4UNQA 2FG7C 2Z57A 1PNQA 1YXMA 4KRXA 1R7RA 1NMZA 3NDRA 5FR1A 4BQFA 2VTBB 1H9GA 4JYMA 2EYQA 3F3YA 4P98A 5F5LA 1VG1A 2O8VA 1RLUA 2OZLB 2VSOA 4IH4A 3AGQA 5DFAA 3ENQA 5DUIA 2JVHA 2N8GA 2IS6A 2X2PA 3H1AA 3MWFA 3IQZA 1M34E 4ZOCA 3ROMA 1Z16A 4F7DA 5CB4F 3ITEA 3P9PA 3FLAA 1BEZA 4TMWA 2ONKA 3DWEX 5GWXA 4JJAA 1OAAA 3AY6A 4OQXA 5AIBA 3K92A 1Z2EA 1DCTA 3CRW1 1JUPA 1SIUA 2KMLA 5JJIA 3K4BA 5K4HA 3KV3O 2HQRA 4PLHA 1XQ1A 1AVTA 4MUHA 4QAJA 1BWPA 4Y6LA 5FOWA 4K0RA 3KZ1E 1SFEA 5EJ9A 2WTMA 4PS0A 1OR7A 4IDGA 5IJWA 1IG0A 2EFYA 4FBLA 3LFTA 3X2SA 4R41A 3PUKA 1DQPA 4TLAA 3CMMA 2OP1A 4MQLA 1BCSB 2B4YA 2Q4RA 3U3DA 4MUIA 4LF6B 3UUWA 4OOFA 5HCIA 3KU4A 4K3UA 4EA8A 3FKQA 4UATA 3GLSA 4RVGA 4L9TA 4IJ6A 1ZRMA 2V7XA 3W4KA 1TAHA 2QAGC 4RABA 5IU6A 5JS7A 3IAM2 4ISCA 5EJFA 2WAFA 2HCFA 3KPUA 2NVUA 4L72A 4S1OA 4HMPA 1VCNA 1O95D 3Q3SA 4CI9A 1W5CC 2HD4A 5IP5A 2QAGA 3O8BA 2HS5A 3TK1A 5CBKA 1E8MA 2BKLA 3RR2A 3TIXB 2JI8A 4RGRA 4XOPA 2HEOA 3FBNB 1P2SA 2A0KA 3C8UA 1FP4B 3D4NA 3ENZA 3MB8A 3MGKA 3N70A 4QAQA 3STWA 5D8LB 4ARSA 1UPAA 3AOEC 3OYMA 3E6DA 1PR1A 2CF5A 2FWAA 4YACA 5DRYA 1JW9B 2WFZA 4KTTE 2F6RA 4JBWA 5HNKA 3RC9A 1RQXA 3RVNA 5BWNA 1AQLA 1Z37A 2FZGA 4TV8A 2ATCA 4V24A 1MA3A 1G1AA 3PJFA 1F48A 2DPLA 5FD5A 3DMTA 3DVAA 4J29A 3TXYA 3ZLBA 1E99A 4DSNA 4HRVA 4QOJA 2OO5C 2XWSA 2CNWD 5BSGA 2ZJPF 2BKUA 3ELBA 4CE6A 1LSJA 4F91B 4XICA 2XUJA 4G81A 7YASA 5J58A 1U78A 5DNEA 3HXPA 5CCXA 1KNXA 2IOFK 3A1UA 2WV7A 4MPDA 4E7HA 2EF1A 3Q2IA 2JVGA 2ZJ4A 1DC8A 5CT4A 1JDPA 3DL4A 3LZDA 2GN9A 1T4MA 2QDXA 2ZTVA 2QVZX 2OAQ1 3QITA 4JT8A 4MX8A 4Q24A 4EZEA 4UW9A 5AESA 2ZXUA 1PFGA 5J3JA 1IZ9A 1A95A 4ZT2A 4LWOA 2P2YA 3AFIA 5FUXA 1FSHA 4MWSA 2AV6A 2QRJA 3A0UA 3SS7X 2OCKA 3KYLA 4AS1A 1UOQA 3INGA 4II3A 1ERDA 1PYDA 2ZAYA 2VJQA 3HGTA 4YI3A 1OVMA 2QSJA 2XMSA 3IHTA 1ATIA 4YCNA 1J9IA 3Q5DA 2GEBA 5ECGC 2BY2A 2WSIA 5ILUA 4JKOA 2Q6VA 4M99A 3I9MA 4QQNA 1N4AA 4BMZA 5EIBC 3V1MA 2AG8A 2C2XA 2GM3A 1XDWA 2WJHA 3NBKA 3BWDD 4LYGA 2G70A 1JSLA 5C1DA 5DM70 4BFLA 1QRUA 5HJ2A 5F1OA 3SBEA 1RBQA 3L7LA 5K1ZA 2GPBA 5ALUA 4O29A 4RIHA 4AIIA 4XN3A 2C9DA 4BZWA 3RPUA 3MZYA 4FI3C 4GIBA 4MQFA 1QLWA 4TX1A 2UV1A 5CT8A 1PRYA 3HGQA 4P2GA 3NEPX 2H18A 5F4ZA 4K05A 4L8VA 4WJLA 4O02B 2VUTA 5I45A 1B1CA 4ZVMA 1C9YA 2E4UA 1LBSA 1OLXB 2Q5QA 2BJWA 3HXTA 2NUBA 2RMKA 1LVKA 2CWDA 3THXB 4HB3A 4G0VA 2PGLA 3E5NA 4ZMSA 1OWLA 2IOYA 3ZK7A 1NVTA 1UBOS 2EIXA 4J1QA 1O97C 2WHPA 5CIWA 4RVFA 3AEUA 4BEWA 5HJ7A 4GL2A 1CRPA 1PTJC 1DWOA 3FCUB 3IKJA 2YXNA 3RSCA 1SFRA 1BMDA 1AKMA 1SUBA 3EPHA 1QANA 3CZ5A 5EE1A 5KWJA 2V6JA 2DODA 2JAPA 4YC7A 3W90A 4ZYAA 2HKOA 2L9VA 4ZGGA 4K6KA 3CDHA 4NFYA 1TM3E 3BL6A 3LY5A 5BYBA 1C9DB 1YASA 2FPGB 2J3KA 1EWKA 3QF4A 4QUIA 2OO3A 3W78A 1YTUA 2RAEA 4PNHA 1JHPA 1FYLA 1PFWA 4Y2YA 3ROZA 1UODA 2VHWA 2HU5A 2DUMA 3QG5A 4QFMA 1K5HA 4RTRA 2ZRLA 2WWHA 5C4JJ 2JIZD 3BWYA 3BIWA 2IWHA 4F7ZA 2OCYC 2QCOA 4ITVA 1MNEA 4TRMA 3WR5A 4A6PA 4C2BA 2HFKA 4HAVA 5BOSB 2Z3VA 1RI7A 1U0TA 1XROA 4QECA 4TXHA 5DEQA 1NK2P 1QB8A 1H8HA 4ZOAA 4DMHA 2DPXA 2L9RA 2GNOA 3LA3A 1J0AA 1GSHA 1M2HA 3CMCO 3B3FA 4GOXA 5DHPA 1VSTA 1NPYA 1I1HA 2B5VA 3TP0A 2NYXA 2LTPA 3SC3A 3WU0A 1X92A 4E7SA 1MO3A 3Q5FA 1UZUA 4PSVA 5EI5A 4U63A 3ETHA 3TOXA 2CO5A 3FPHA 4XQ0A 4E5MA 4DV0B 4FC6A 1RWQA 3ANLA 4PV7A 3IERA 5CNJA 4IQFA 4I4TA 2RC5A 4PUSA 1CFJA 1YRQA 3AUAA 2C3OA 3KYDA 1JAXA 4L0ZB 4IUCS 3EHDA 1IF1A 2QD2A 3R6DA 4PS1A 4JHLA 3MJRA 4ZQIA 1SHKA 2W6PA 4KTVE 2LRHA 3D4PA 5AXCA 1ETHA 2C0CA 2CUKA 4NCJA 3TWOA 4QU8A 2QLMA 1N57A 3TO5A 3WLTA 4OK5A 2J5XA 1A7AA 3MGBA 5FBRB 3D6NB 3GFBA 4ETSA 1KI2A 2JI7A 2FB9A 3UO8B 4DCOA 1IZYA 2FMKA 3HY6A 3R3HA 2XZOA 1PUFA 4CLXA 1W4ZA 4QG3A 4NJMA 5AKZA 4KISA 1IVSA 1RQGA 1QXSA 2Y1FA 2X6RA 2E48A 3DTVD 4HAIA 3IURA 4GPBA 4MDYA 3MCWA 2XPCA 1YHZA 2A1TS 3R5XA 1XLVA 2AFIB 4LS3A 3HNOA 2X3YA 4ZVPA 4ER0A 3TVTA 1QTIA 1UPBA 2JD0A 4KLRA 4QJBA 3MA0A 5A4JA 3W05A 4AIJA 2CKMA 2NU7A 5LQUA 2HEGA 1UOEA 4D0SA 4N3NA 1PAUA 4IS2A 5TMPA 1G63A 1OWPA 1P3DA 2WUFA 1OCPA 1CZUA 1L0BA 1M1XB 2FI1A 1GNVA 1IHOA 2ACKA 2R79A 3ACBA 1I2BA 3DV9A 2FFAA 1E9AA 4KUGA 4QRHA 4WCFB 2YXEA 4YUZA 4DMUB 2UZ1A 4HS9A 1XQWA 3F8CA 2BZTA 2DSNA 4WGGA 5DTEA 3TX2A 2OU2A 1NVWQ 3UAXA 1L3IA 2PEXA 1YUMA 4Q7QA 1NVBA 4XWOA 1PLJA 5TVKA 1Q22A 2HNBA 4RJTA 2V0NA 2A07F 3S5UA 3EWIA 2HCTA 1PIWA 3NUGA 1JB1A 4Q18A 4NYMR 4QYMA 1ZUWA 1SXJE 2OGWA 4EOGA 3BD7A 5FFZA 2IYWA 3BWCA 1EUCB 5FI0B 1EDEA 1K7SN 2AEJA 3DKPA 2XKOA 1WZUA 1X7XA 4ZYTA 5LB2A 5HVNA 2CMPA 2CY0A 2CXNA 3H4IA 5CH3A 3UH0A 4S2EA 1RYYA 3GLIA 4PAQA 2JA7J 1OV4A 1T9ZA 2HI3A 1NV9A 3BG6A 1Q0RA 3TB6A 5FQNA 3RKQA 1A96A 4G6DA 4JLPA 4O4HB 2VBXA 1RYHA 1NK3P 1H3NA 1SXGA 4FW8A 2H5EA 4HB2A 1G6KA 1W48A 1XCJA 2Q3LA 3R0JA 3IVGA 3SS8A 2QJRA 3PR3A 3WHIA 2C7QA 2CL6X 1RBYA 4I9NA 1FX0B 1Y5NA 2D2IA 2ZXIA 1NM5C 2IHTA 1JFLA 3KSDO 4I1YA 4RDHA 3KB1A 1JPNA 3MYYA 4PM4A 5ENDA 1L4YA 4HPQA 2G9UA 5HS6A 4NNJA 1J2RA 4BY9E 3TYXA 4PWZA 2ZANA 1NJ1A 2QRLA 4O4IF 1M1NA 4NCBA 3N05A 1AHPA 4IFBA 1SD7A 2EEPA 1WMBA 4EM1A 2WHEA 3MWLA 3OOPA 1J49A 1ZWKA 3VFDA 1E92A 1UPCA 4KMFA 3RHSA 1N7GA 1LVAA 1DRWA 4XX0B 3NC1C 5LR6A 3UV6A 2EEZA 5AOCA 2AWNA 5FPHA 4U2DA 3TLZA 5LCXA 4DLBA 3SXYA 3L8HA 2EGUA 4QBGB 4ZCIA 3CKMA 1ZGAA 4UOQA 4NCHA 1TNDA 5I7VA 1WZ2A 1NP3A 2R7FA 5HJ5A 2FA5A 3IAM6 3KS9A 3DBHB 3B89A 3I2FA 2HY7A 3N53A 3NUZA 4B6QA 4P32A 4CH7A 4E2WA 2P6NA 2QLTA 1L4GA 1LZLA 2QRMA 1IOWA 3EEIA 2OVBA 3H8VA 1MC5A 3SIPA 3TZHA 3KJGA 3ZR4B 1A5AB 4EFNA 1KJ8A 3NFYA 2YJTD 3MERA 3ISPA 3I42A 2GQ0A 3OX4A 3EXEB 4TYYA 4H0FA 4RMJA 4B48A 3M8JA 3IIJA 2O2YA 1ZNZA 2J9XB 3E53A 5JHUA 3LC0A 5JMOA 4DEYA 1E96A 2R00C 3QOXA 3T3EA 4GW3A 3TUIC 1SQSA 1M7HA 4F52A 2PZFA 4M6YA 1K8RA 1FT9A 4L4RA 1GVNB 2XGSA 1XTKA 1YZYA 3DBLA 4CTKA 4M7PA 4TS1A 3HS3A 2RHHA 1A69A 2X5JO 4BNZA 3BHIA 3K9WA 4QARA 1EM6A 4I14A 5F6FA 2X2OA 4FSXA 4TLEA 4DW8A 3EOBI 4OQ4A 5BOVA 1E9BA 2I8DA 2IY8A 2VTVA 2BEKA 2QMUA 2WYWA 3IPXA 2H59A 3NWTA 4UZSA 1U63A 1JJFA 1A8PA 1TEVA 1N2JA 1R0LA 3NTOA 5D3KA 4MFEA 1HF3A 2BMJA 3WTVC 2WA2A 2GWHA 4L57A 3JASA 4R0VA 4URZR 2IWRA 5C4IA 3ZMUA 2C2YA 4WCFA 2BR4A 1WY5A 2GT1A 2YZKA 3T7TA 1F17A 3GTQJ 2A9VA 3JYNA 4HUTA 1DTSA 4BJHB 1NMQA 2CLIB 1VHQA 1M2GA 2H92A 4QL3A 1N6LA 1NJGA 1ORWA 2OBLA 3B38A 4YIKA 4CLOA 3P9CA 3SD7A 3GJ5A 1YIOA 3M82A 4DS3A 3M2PA 2OF7A 1HDZA 1JXQA 4TKUA 5CYOA 2PG3A 1G4AE 4PAGA 5FUVA 2OAP1 3IMEA 1K83J 1UT8A 3DDOA 3QKWA 1ZSNA 3VH1A 5J5AA 2UYQA 4MRMA 5CH5A 4BRSA 4RQAA 5DHAA 4EJSA 1TZLA 1TWFJ 2G9ZA 3PDHA 1L3LA 4EW3A 1ZINA 5A04A 1YVPA 4ZKDA 2YFYA 3V9AA 3N5CA 4AG5A 3AY0A 1YJWI 1TYZA 2JEYA 1DOAA 5F2KA 1JB9A 1IEXA 4C4AA 3AQ4A 4IICA 1RPZA 5LVAA 4B3MB 3CJTA 4WFJA 4RMNA 3EODA 3TIIA 1G8FA 2Y1XA 4JFRA 5H81A 3HLYA 1DKPA 1EGVB 3PXXA 4EUFA 1V3FA 5KNCH 2I8AA 1KO1A 1UKZA 3QPDA 4MB2A 4RMHA 2QAIA 4YY3B 1HNZB 1D8AA 2PGJA 3H16A 3L6BA 3SFVA 3K7AJ 1RR8C 2FR0A 8OHMA 1RYBA 1CS4C 1SM4A 3IWFA 3F5FA 3DL7A 1AUQA 5A7HA 4BGVA 4FDTA 4QXPA 3WDMA 4NZ9A 4WPGA 4XKJA 1IWBB 2QJWA 4AY4A 4C6TB 4PCLA 2FP3A 1U5AA 1IC8A 3IQHX 1TXGA 5CLHA 1FFSA 4GFDA 1F9NA 3AVOA 3NT2A 4M8KA 2HF9A 3D4OA 4ZICA 5A4AA 1CF4A 2WA0A 1TOAA 4N9IA 2QRKA 4M3GA 1G5FA 1NUAA 4PYKA 3TUJC 3D0KA 3HDVA 2JK3A 4MO2A 4DJJA 3E7WA 2NP7A 2W2XA 1EFAA 2PHZA 1EHCA 1NQTA 1R8SA 1LQ1A 1NY6A 3SIWA 3WYBA 1NG9A 1QQBA 3OX1A 5FB2A 3FJ1A 4RFLA 5EINA 2RB5A 2IV7A 4L8LA 4FLFA 4DC9A 3TIGA 2NS8A 1SZDA 4FDUA 3JYOA 1ZUNA 1ZNXA 1CD5A 2FG5A 5K03A 2Q9BA 4A3IJ 2FF5A 1D3AA 2B3DA 3A1NA 1JL3A 3LQ1A 1GUYA 5IZ4A 1JR2A 3HRSA 1UBRS 1ORDA 2QVGA 3M6UA 1ULBA 4R01A 4WUTA 4UBMA 2WWWA 1VI0A 1AC5A 4IMRA 2VF4X 4NE9A 2XUHA 1UF9A 4XSZF 1GU0A 1UQRA 3IJ5A 3GUZA 1GU1A 3W6JB 3E61A 3MJFA 4PTZA 4TPKA 3QW2A 5FRMA 5AVUA 4G12A 4EA9A 1JLHA 1UANA 3SEZA 2XB0X 2DX7A 1BX3A 3I2YX 1NGSA 1RPTA 4UAUA 3GT7A 1RRJA 5JWRA 2BF7A 2MJLA 2A3SA 3AK4A 4MR8B 1Z8DA 3JW4A 2ZUDA 4LGWA 2IY7A 4ZWNA 5IPFA 2H29A 1SMYF 2CUJA 2ZI9A 5ERXA 1F8FA 1ZH6A 3BAFA 2Y4OA 2M7BA 3GRAA 2ATXA 1F2TA 1Z77A 4WK4B 1O1YA 2ZIAA 3KD2A 4G9EA 3TMYA 1N0HA 2EJWA 4B2LA 4J7CA 3BORA 3ZDAA 1U7OA 4EJFA 3LNCA 1WV1A 2Y9MB 3ZWWA 2R7AA 4LD5A 3CO5A 3SF8A 5EJ6A 5CNIA 1QWSA 2JJ2A 2ZSBA 4UFPA 2ONCA 4M3EA 2AFIE 1UPXA 2FR8A 1JXOA 5FKLA 5F1RA 5EHXA 3Q3VA 2BGWA 1EP2B 1E1NA 4A0ZA 1Y48E 2CLCX 3AGPA 4M6XA 2I87A 4QX6A 3UANA 4ZCMA 2PLAA 1EQ2A 3D6TB 4KP7A 2AX4A 3EARA 5ITZB 5KK1A 5E3LA 1ZLYA 3BWXA 3TAHA 4IJQA 1DKOA 2M4GA 4PSWA 5GJVC 3HSSA 3KYCA 3STVA 2D0IA 2XVZA 4KXYA 4WBSA 5C46F 5DNCA 1JAHA 5F7OA 3E15A 3UA3A 5CYGA 3OM8A 5DEOA 1SXPA 3LA7A 4WV3A 3R5TA 4PCAA 2NM0A 3VJMA 4BMVA 2OZPA 2QRZA 5E7QA 1BI3A 4R0MA 4D0PA 3QNMA 4G4GA 3ZQHA 2UUBB 2KLOA 4NK4A 3ZD9A 1KK1A 5LZ7A 5AW0A 4B3GA 5B1EA 3KQMA 1HO3A 4ZVVA 4ZT3A 4DC1A 5I7RA 1AX9A 3PU6A 4QPZA 1OE0A 4TVOA 1N2GA 3IC5A 1R9MA 2C0QA 2D8MA 3M7IA 4JYPA 4BJ3A 5IUNC 1PKXA 4LCEA 1EM8B 4J1TA 3U16A 1M5TA 1VPWA 5FROA 5FD6A 3U7FB 3K1ZA 2W2KA 1TT5B 5E9AA 3RSZA 4WCGA 1K5PA 3P2MA 4Q1CA 1YF3A 2WHQA 1FK8A 4K03A 3HDDA 5ALXA 4D6XA 2DGDA 4JA2A 3U2QA 1R8JA 5EZ5A 4OP2A 2GPJA 1HTWA 2MLKA 1RYDA 4I9UA 3MILA 3AVPA 4E1VA 1ZM2A 3VJRA 4GRIA 1CRQA 1EZZA 1VSQA 2VRCD 3IAEA 4PLZA 4EJMA 1J0RA 4HGNA 3V2UA 3N2GB 1FC0A 2FW6A 2FOLA 4EMBA 2DR0A 3FI0A 1ZXLA 1GZ3A 4IIFA 4TV8B 3FOEC 2E18A 2PTGA 3K1TA 5D6EA 3KKQA 3N07A 1CDOA 3X2FA 2HDCA 3S93A 2PZBA 1LB1B 3BF8A 1W581 1IIBA 3A14A 3D3WA 3HLTA 2BM0A 3OIUA 1FS4A 5C3UA 2DFDA 3WO0A 4PO9A 1TF7A 3A04A 2I6TA 3PHGA 2XECA 1P72A 3C70A 1HOMA 2IW1A 3A3PA 4KEAA 3IR7A 4Q7JB 1Z08A 5L3QB 1PR9A 2DMTA 2OGUA 4XVUA 2B0CA 1J6UA 2PUTA 3KLBA 3OKAA 4RVSA 5B30A 2NWQA 3BT9A 2C3MA 3KJHA 4MCHA 1RKWA 4GKVA 5I7UA 5JSQA 4MJXA 5J47A 2B78A 4EHKA 4Q4AA 3G79A 1C41A 2W6ID 2QG4A 4MS1A 5EP4A 4DYDA 1LK7A 3B20A 1IU9A 1ZIXA 4YT2A 4UTVA 1E2MA 3KQSA 4YO8A 4IVPA 4TT3A 5BQ5A 2GAJA 4WEOA 4J01A 1KP9A 4MV3A 3EUHC 4WACA 3J81A 2CW5A 3L02A 3M4JA 3H75A 1RMYA 1WZEA 2CNBA 4JBHA 5BT8A 3BZWA 1KY3A 3HQ4O 3QYEA 1RZUA 2ODAA 5COAA 3ZQGA 2D1RA 2MT9A 3IT3A 4BLWA 1V6SA 5D3QA 1ISGA 3MK31 3R5SA 4W8GA 5EQDA 5JAHA 2DU9A 1R4ZA 2NSHA 3IEMA 3ZCVA 1CRWG 4M86A 5HIMA 5K8IA 3OCJA 4JK3A 4WVLA 4Z6YA 1WPQA 1Z4OA 3ZD6A 1M75A 3PCXA 1COZA 1H05A 3LOQA 3RYFA 4DJ5X 2DFVA 1H9BA 2XIGA 1AXEA 1V11A 3L7KA 5HDBB 3RS0A 1L7DA 1E2QA 3P4XA 1ZESA 3O2JA 3PDIA 4E31A 2BFEA 4G0QA 1NZJA 3DEFA 4ENWA 4AROA 2ST1A 4K9NA 5BSVA 1QORA 2X5KO 1SMKA 5IP9J 2IXSA 4LYHA 1DLJA 2C2MA 1JS1X 1JFSA 4CFSA 2VL8A 5COBA 2EG5A 3OQVA 4L28A 4ESEA 1OIVA 2NU7B 3EDMA 5DYMA 3OIGA 2EINH 1T36B 2EZ4A 3U3XA 2C3PA 3N0TA 1CUEA 1XG5A 1ZMXA 4L76A 3LPMA 5B2ZA 4AJIA 1CE8A 5A02A 3OP1A 2IV2X 3GFRA 1FB5A 4INPA 2IYNA 3DT8A 5G4KA 1FZQA 5EIEA 2FX2A 3VSBA 3QBEA 2P0WA 4IRMA 4CKWB 4EO9A 2UXXA 1F7VA 5EY5B 3FVWA 2K2QB 3GJZA 1DJQA 3D6VA 4XYMA 3KOWA 1JNYA 2Q5HA 4LF5B 4Q3DA 4R3UC 1D0IA 4FR2A 3TINA 5KB3A 1X3WB 3HCOA 1ISSA 2W22A 2ZPAA 5DCLA 4HQRA 3BSWA 9LDTA 5JFRA 1GCGA 3NCHA 5DASA 3AILA 3W6PA 3R41A 1JQJC 4KIBA 1PUJA 2AMYA 3BLYA 2GQQA 3WNVA 2QB5A 4TTSA 4LPKA 3V8QA 1Z4MA 4W6QA 3M9AA 3FZEA 3OYLA 1BL0A 1JAIA 3BSFA 3KB6A 4M7OA 4C2TA 5CLSA 4IHYA 1BE1A 1W0CA 4R2MA 3CF5F 1RADA 2HX1A 2NIPA 4A3SA 4BLRA 3S3TA 4YP5A 1VOTA 2ZIUB 3GVXA 1OVGA 2R9VA 3PR1A 3BAZA 3FHJA 1GYPA 4AJJA 5BOXA 1WTAA 3KC2A 2ADOA 4JJ8A 1YR1A 2YMLA 5KHAA 1EK6A 2IUUA 1F5TA 4V0MA 4D6PA 4OQZA 1DXYA 2AR0A 3O74A 4YTEA 5JH7F 2CN1A 3O82A 5IT9A 1J07A 1OHHD 2PH1A 1OCEA 4EYOA 1LY1A 3WWOA 3DV0B 1F9AA 1XDUA 3AP2A 4DWVA 3ZD7A 1U2GA 2F43A 3EY4A 2HO4A 4HRAA 4LTDA 4XGQA 3SE7A 2BW3A 1BCRA 3M8FA 3OJWA 4UVGA 1A8QA 1TK2A 5TMEA 3IUEA 1ORTA 4LOKA 4QNMA 3BA1A 4INJA 4AICA 3WYEA 4QVKA 1XAGA 5JXHA 2GBYA 1X0VA 1XMXA 2WAOA 1AKNA 3M83A 4ER3A 1IY0A 2CJFA 2AXTC 2L9NA 5IRCD 5LPNA 1XKLA 1JUDA 1QMGA 3JQEA 4MS4B 3EOZA 2A6PA 4HXYA 4KG7A 5ED0A 3ZWKA 4QYIB 1XZEA 2J9FA 4Y4RA 4BU2A 1EE1A 4F3NA 4RY0A 3DTVA 3SPXA 4EQZA 1T56A 3PVSA 2ZTUA 3WL6A 2KWIA 3SSOA 4UM7A 3TMAA 4Z9FA 1R64A 2CLMB 2Y2ZA 7MDHA 3CVWA 4Z4GA 3VZPA 2FQXA 3WL4A 1IHUA 2GA9A 5JLXA 2RQQA 1VTKA 1UMBB 2L42A 3COZA 4J7XA 4KFSA 4QWWA 2QKMB 4HLQB 5CTAA 1TC1A 3M4NA 1STOA 2VDUE 3VGPA 1EIZA 4HY3A 2BUCA 2KB0A 3RIGA 2YYZA 3V8PA 2PFKA 5B57C 4F06A 5KJEA 2JUGA 2GXSA 2GAAA 2BXZA 3DQZA 5AW8A 5I4KA 4LVNA 1NNEA 2O23A 1GL6A 1L7MA 1GKKA 5HVQC 3DVLA 3U17A 1LS6A 1N6OA 2HHCA 1ZH5A 5K5EA 1QKIA 3D7RA 1EI9A 2VDWB 5ITSA 2RHDA 4DKXA 1KMHA 3C1UA 1EJ9A 4BVBA 1JHRA 2IF2A 3KOUA 3H8JA 3CY6A 3DNFA 2JTVA 4L22A 3ETNA 3RJPA 3GUYA 1UXGA 4TGLA 3SYKA 2HQ5A 2QR2A 1H1LB 1P31A 4DIMA 3WSVA 4X6AJ 4QJIA 3LWFA 2REQB 4KREA 3K9QO 1UXIA 4HAMA 1XPUA 4NMMA 3PE6A 4JB2A 4F45A 5C53B 3W9BA 4R6WA 3WP0A 4BN5A 3B3QA 3HRUA 5A7GA 4N4OB 2ZJQF 3BBLA 4ND8B 3GNSA 2CXQA 2Z9CA 2GIZA 1W75A 1POGA 2WYHA 4CG3A 5DS9A 1JIXA 4F71A 1ZI8A 2OBNA 1HKQA 3E9MA 4YCLA 1QO0A 4BMPB 4DIEA 3QWBA 3U60B 1QHFA 4S0XA 3H36A 4YLGA 4Y1EA 1GKIA 1H66A 1TJ5A 4E09A 2Z6QA 2ECKA 3G5MA 5EMNA 1R8YA 3TKYA 3SSNA 1OCOH 2QL6A 1E2DA 4RHXA 3K6KA 5ERGB 5ELMA 1YT5A 2I8CA 4ZEXA 3STTA 1LI4A 3GTMJ 1U6KA 1P81A 1U1IA 3HYNA 3LHDA 3FFBA 3MS4A 1I8TA 1M1UA 1JDBB 1ETVA 3OEHD 1IB0A 4ZOEA 4LY3A 1FFCA 5EHZA 1H4VB 4HTFB 2AQKA 2Z6VA 4G8JA 2G40A 3FIUA 4B34A 5FFMA 1MOPA 3PGA1 3UGJA 3CUQB 3U80A 1DRUA 3QX7A 1KEUA 5HF6A 2H4FA 2G08A 3LVRE 4E5VA 3AI1A 3I3OA 3F5MA 3GUVA 2VBGA 2FDRA 3LK7A 1GAXA 1ADJA 1U0BB 8MHTA 2XAFA 3LFHA 5IM4F 1VG8A 1G9XA 1II8A 1KP2A 4Z2YA 4HPXB 4LJYA 3K1YA 4EGZA 3JTMA 1G3TA 2F4IA 3ZU5A 4H18A 4QXRA 2APJA 4L5YA 4OH7A 1ABFA 4OLJA 1K06A 2DOFA 2QQ0A 5B5EC 4R8KA 4TSKA 2KIQA 5SYAA 4P82A 3K2AA 3T8TA 5K01A 3NHWA 4DLYA 1XTAA 4MITA 5LYJF 1GZ7A 2FN9A 4PNEA 2PUCA 3F5QA 3W8RA 3WK4A 3HVRA 4RLHA 2I6XA 1SBTA 4MA0A 2VPWA 4CM3A 3KBBA 2BJVA 5KQRA 2R6CA 1V8OA 1EFVB 3D6MA 4P7JA 2VBCA 3FXOA 4WX2B 1C1DB 3ADOA 3RK0A 2ZBFA 4CM4B 5BMZA 4W5QA 4TVSA 3WDKA 4MYUA 1A2OA 4ARUA 1KWGA 1QS0A 4H31A 3SHFA 3QRFF 4QUBA 5AVQA 1JBKA 1DC3A 2EQ5A 3EFEA 1KK3A 4BEHA 2OO5A 2DRIA 4I99C 3QLUA 3WYAA 3CDLA 4X6LA 3SVZA 1MV5A 2R1TA 2CVHA 5L3CA 3OTIA 4OWRB 2WU3A 4O33A 3T0IA 3ZXUB 2BYTA 1TP4A 1ZVJA 1V4BA 1SXJB 4HRXA 2M30A 2HSEA 3CH7A 1UK8A 4RPLA 2DKOA 3IRQA 3LOPA 5CGZA 5EMHA 1YBVA 2PLNA 1V1MA 2WRZA 1ZKMA 3PGXA 4H4EA 3DHWC 1ZK2A 1YAHA 4PGAA 1ZH0A 1DJLA 5ITVA 4YYZA 4A3DJ 1ECBA 2DFIA 3SF0A 4MRPA 2DH6A 1T5IA 3TAXA 2J09A 3OIDA 2KJBA 2FUG6 4K8OA 5E1OA 4BGUA 2R6ZA 2OCAA 3HB4X 1VP9A 5JMPA 4L9RA 121PA 1QUEA 4US0R 3L7CA 1MD0A 1BS1A 3SLGA 2AOVA 4R7GA 4AQDA 3MUNA 1KGDA 4NC8A 3BE4A 3PFNA 1NUPA 3V7FA 3V4PB 1N5MA 3DU5A 3L2OB 5LYYA 4Z9XA 1R3DA 2IHVA 1V7PC 1NXQA 1T3ZA 4OKIA 4UCXA 1QQTA 5ITZA 2WKSA 4MV7A 3Q40A 4MO7A 4JBAA 2PMWB 3QHPA 3SR3A 1X9GA 2JCBA 1IJBA 2NU9A 5DBGA 3RFTA 4KK3A 4YDQA 1IYZA 1QP7A 2DMNA 3O1JC 4TTTS 4GKAA 1I4TD 1NUUA 1Q84A 1TF2A 3FAZA 2LCIA 4FMDB 3PC2A 2VDOB 4RTPA 2ZO4A 3RVRA 1KAHA 1E2LA 1TQDA 1Y0BA 2VC2B 3E9ZA 4G8DA 3ZDQA 5KMGA 5KAFC 3FF1A 3G2QA 2IEDA 1ZIOA 4TLCA 4CKBA 3HKEB 4YJ3B 2CJYA 1WG8A 2CHEA 3BXHA 4KXVA 3ONQA 4H4CA 3WZ2A 4CL8A 1VDZA 1YJ8A 4DQVA 1AO0A 3L1UA 1I6HJ 3M6IA 3C5EA 1KC1A 2GYWA 2H1RA 1DUVG 2VYFA 4OM7A 4B8ZA 3PXDA 2PUHA 3VNUA 1PT8A 2OXIA 2LBFB 2HWYA 3MKWB 1MH3A 1YYVA 1U0RA 3CE9A 3EDOA 3N75A 1H89C 3OUTA 4Y2QA 5HDQA 4BFYA 2QEQA 1FXSA 1P1CA 3BRWA 2B0LA 2O6LA 3DOUA 1C7FA 3OMXA 4MJLA 4BUPA 1HEYA 3V1LA 5CB6A 3P9NA 1RQNA 3JAMA 4CEHB 1EFDN 2CQQA 3FFAA 4NK5A 3ZK8A 1F1ZA 2IYRA 2BTOA 5CIQA 10MHA 1VHJA 4QUKA 1I3NA 3FG9A 2Z6AA 4WCDA 1KO5A 4LA4A 2GZDA 4Y2JA 4I5EA 4F4FA 4CQJA 2K86A 3AZQA 1TZKA 3I39X 3QNUA 5FBVB 3G73A 3VOBA 5K6AC 2P69A 2RV8A 3UMJA 1GKYA 2AS5F 1L4FA 4IKPA 4XDYA 5F3RA 4ZYYA 1XQ9A 5B1YA 5LQAA 2AYYA 1RC8A 5A7FA 1OH5A 2WTUA 1V7QA 1B59A 1AUXA 3GLGA 1B2LA 3B1ZA 1IDYA 3HTXA 4G0XA 2J1LA 4CBVA 1NXSA 4DA7A 1BDJA 1T91A 1KHTA 1QZ3A 3O4HA 4PE5B 3G02A 5GAJA 5FAXA 1OY1A 1GJRA 4AZWA 4MV5A 3IVRA 2ID4A 1QIMA 2DT8A 2F90A 3V8MA 4HF0A 3Q0WA 4U7FA 3KT8A 5DW3A 5BV8A 1N5DA 1ZL2A 5BW8A 1MRSA 1T0JB 4BB5A 2YU9J 2XCIA 2E36A 3IALA 4PIVA 2VDQB 5K0JA 1Z36A 5KJCA 1X1AA 3CVVA 4CDGA 2XYPA 2JVKA 4ABYA 5HNHA 5L45A 1TCCA 3SHQA 1EUQA 1E3JA 2CNKA 2R1TB 3S81A 1NUSA 3GFLA 1RAEA 3LX8A 4KLCA 4J2TA 5BPFA 1WQ2A 4ARZB 5LHHA 2EJTA 1XMIA 3VKHA 5TGTA 3KUXA 4CUKA 4F1JA 1M0EA 3HBMA 2A2ZA 3W2WA 3DTVB 1TB4A 3RSSA 2BPOA 5IVIA 1H42A 1ENPA 1BO6A 1TAQA 3IOEA 4EF5A 2E60A 1CGPA 1CF7B 3AL2A 2O3SA 5CEJA 4UU8A 3SICE 1ZD5A 4W1UA 3WK6A 1OFIA 1QHHA 3LHFA 4TSFD 3CHYA 3P2EA 4QXMA 2VZ0A 4ZVKA 2FPPB 4I5DA 4HDKB 4UNIA 4C78A 1Y6RA 2PCJA 3BIFA 1U4OA 2WFMA 1CU1A 3E7PA 4LG1A 3F0TA 4NDAA 2YZGA 5DN9A 4OUDA 4PZZA 5AM1A 5JAUA 4OIOF 1DFGA 1M9NA 1USWA 2IA2A 1H1LA 2D2XA 2QQFA 2ELHA 1BGVA 1NJ6A 1VHDA 2REQA 3I52A 3UTCA 2QXTA 2C54A 2HDOA 1PFVA 2ZSFA 4G0NA 3OYKA 2HKIA 4BUJA 5LMCA 2OCIA 1VIMA 1TFRA 4G5HA 1E5DA 1Z5UA 3ON5A 4UXJA 4G2TA 3FA2A 1HLVA 4NYMQ 3OMYA 1FDUA 2OPBA 2WG1A 3E7XA 1P6RA 4CMIA 3K70B 2W6JD 4EGYA 4L4XA 5BT9A 1FSZA 1FIPA 3GCWA 3GLXA 4I01A 1IBSA 3EUHA 1UBCA 1ZOIA 2CC2A 4DANA 1VQ6I 6YASA 3AEQB 3HSFA 1P75A 5B12A 1NTCA 1FLNA 3A31A 1KRHA 2BVMA 4WNAA 1UP4A 4TQAA 3WE3A 1T4GA 2XYQA 1P2VA 2HYGD 3I1IA 3I9V6 3ERCA 2RGNA 2LNBA 4S3MA 1CZHA 3DZDA 1SVOA 2GB4A 4QQKA 5AM4A 4HDSA 4M38A 4G0ZA 1OUMA 2EB7A 3EZXA 3OX3A 4ZTJA 4I1RA 4R5HA 2PXAA 3FTQA 3IXMA 5AK3A 1QAMA 1KVTA 1T2VA 3QU5A 2B3TA 5GVSA 3ZU4A 2YRFA 4EDHA 2VP6A 1KSHA 3BGWA 1GPBA 4CN8A 5L3VA 2W0MA 3M5DA 5JC8A 3RLIA 2LYCA 2PUVA 2EX4A 1O2DA 1PQUA 4I66A 3T5AA 3F96A 2NO1A 2Z16A 1I3QJ 3TTYA 4HQ0A 4XJXA 1PG2A 1RJ9A 2D59A 4J07A 3THYB 4GPZA 4LJ9A 3ZIAA 4F38A 1GZ6A 4ZA2A 3A01A 2C4MA 5HF9A 2QV0A 2ZUSA 3ZCXA 4C43A 4NXNB 1SB9A 3FRHA 1XHFA 3H1BA 2B25A 3GU3A 3RS4A 1MDBA 5C7OO 5KZMB 1VRWA 4K2EA 1JWBB 3H6HA 2IRFG 2WIGA 3LC1O 2VHTA 2KRCA 3AERB 4FLEA 3N1UA 4GWGA 4JODA 4DM7A 1I7DA 3U1KA 2CZGA 3FJYA 1Z83A 2GZ1A 2IU6A 3IBTA 3T06B 5LIPA 3G7NA 2C5BA 4MZDA 1X2BA 5C8XA 3HSKA 1EIWA 2WI8A 5AK6A 3L2RA 1VBFA 2N9UA 4Q15A 3RRYA 4A6EA 1SBZA 3H1FA 3NI2A 5EZYA 3WK7A 4A23A 4EKGA 3X1XA 4U39A 3W5AA 4DLWA 5AVYA 3R24A 1MHTA 1D2NA 2PZMA 5H6RA 1M10A 3B6CA 1K6MA 1J9GA 4Q19A 2IC5A 4CKYA 1UL1X 2Y99A 1FP6A 1AWCA 2JJ1D 2PWAA 3DXZA 2W25A 3UAZA 3UXEA 3FXRA 3TGPA 2RH9B 2H16A 1J1ZA 2HRZA 1U3DA 3RSFA 1D4FA 3AFGA 4QLAA 3BFXA 4UQLA 4A3BJ 3H1TA 4DUYB 4OX9Y 2NG1A 4HQKA 4AYXA 4PGGA 1M1EB 1UHSA 3BFVA 1OIWA 3D1VA 3JW8A 3RASA 3FYSA 3ZVNA 1L3BA 4MMZB 4O5OA 4EGSA 1A5JA 1T24A 2WABA 3GLVA 2HH9A 3NZEA 1MCZA 1C7QA 1FRQA 1GNQA 1RUNA 3CUEF 3LECA 5DM2A 1VCHA 1Z6RA 1FOKA 2UYYA 1RLTA 5JO9A 4ZAWA 4F4JA 2M1BA 4CSWA 4BBJA 3PTAA 4DRXB 5DKFA 4MKGA 1GDHA 1KFBB 2I2BA 3HI4A 2GN6A 3U4HA 2Q5CA 2CXHA 2ZRIA 3VPGA 2F00A 3BB3A 2PBZA 4DBLC 2I7XA 3FRIA 1TM2A 2ZBEA 4OBWA 4YASA 2O61A 3BL8A 1PZMA 3L7OA 1S7AA 5ARBA 4X7RA 5EFOA 5B3SH 2E5NA 3ZP5A 1T4DA 2QD1A 3BJRA 3BPXA 1PFQA 3G7UA 1CR1A 2FLWA 3K4KA 1L4HA 1RW4A 4D0NA 1TYAE 3LBIA 4JJ4A 3T52A 3TI7A 4XLHA 2QTCA 1VZ0A 3LLUA 3PWKA 3SYMA 4G3XA 3ZNQA 2R4GA 4EEZA 4CKBB 2P0EA 1FSPA 3D5SC 4LXQA 1VHTA 1YI1A 1B3RA 3C2BA 2PBIA 3J81K 2EL7A 4PG7A 3E84A 4WNAB 2YWDA 3JZIA 5EC8A 4IHTA 3K53A 1YE8A 3MCTA 4A9AA 1L5RA 2DPHA 2O5VA 2VQHA 3KQQA 3WMFA 3U6KA 3EPJA 5U9CA 1AJEA 3JAMK 3K9CA 2Z3WA 4HOBA 5FFXA 3QPVA 4CRWB 5L3ZA 1SUIA 1BQEA 4CNBA 2Q2VA 3LYLA 1DMRA 3KTAA 2R93J 3P96A 3QJGA 4CTJA 1A98A 2WNSA 4PRYA 1PLLA 2CV0A 3DTYA 4QTZA 4OAZA 2Z5VA 4M1MA 5CAEA 5J4LA 4GE0A 1XTZA 3WKAA 2H52A 2CUFA 2JH9A 4WZBB 4RK6A 1JT6A 2JBAB 2WJWA 1U6JA 3VR0A 3TLGA 2XT0A 1K9SA 2O5CA 4B6SA 4ETMA 4S0ZA 1PQYA 2ZROA 5BUZA 3KP4A 2MHCA 3U9GA 1AHHA 3DO5A 2X3UA 3NG1A 1QG0A 2G0TA 2OV4A 3DF7A 5EQFA 1DXQA 1FDOA 1Z2PX 1P6QA 5AMXA 3RGGA 3OFND 1XCMA 3R1IA 1X4OA 4KMSA 4RHCA 2ZXFA 2OHJA 2FF4A 2GO1A 2YR0A 2G76A 2RG7A 1TYEB 3A01B 2RHGB 4J90A 1Y5LA 5KYTA 2X1CA 3ZE0B 2QTMA 4BVHA 1A4XA 2OHVA 1MV8A 2X9GA 2A1UA 3L0IB 2I2FA 4GLFA 4RMIA 5AJTA 3TZEA 1XRMA 3UAOA 4DLZA 2XCSB 3NRJA 4G5XA 3GPBA 3H7AA 2H7XA 1H3FA 1Y5MA 5M5WJ 4N1AA 1I0LA 4YUAA 5L3EA 4FOPA 3MTAA 2FU5C 3WODF 1R00A 2AVDA 2FK8A 1ZREA 2IYXA 3FVVA 4HDMA 4JJKA 4V0OA 5LFAA 3V8KA 2IZ0A 4O5VA 2WE7A 4K6FA 3MQFA 2RCYA 4MKIA 4NC9A 5AJHA 4B3IA 3C3DA 2BEWB 3H35A 1DI0A 2EWVA 4YJ2F 2WPDA 1YRNA 3SDSA 4CDNA 1LJ8A 3ZHYA 4FX4A 3ETJA 2G06A 2VHQA 4HPWA 5KINB 2FQQA 4E6EA 3UMFA 2JA2A 3SYNA 1RKBA 4EBFA 1QO7A 3A2MA 3O26A 3ODPA 1NNUA 2ZYHA 2RAFA 3HP7A 3UMCA 1L4KA 1CQZA 3ZOBA 3LUJA 3NDJA 4QDJA 3ACCA 1TWCJ 4XKVA 3RIHA 3RT9A 1KQ0A 1LLDA 2WAMA 4QJ4A 4EB6B 2VJDA 2C95A 2AMFA 2XADA 3REQB 2WQ7A 4W7SA 4DSZA 2PUBA 3LFKA 4O8ZA 3EPKA 3KP7A 3MXTA 4U7TB 2QW8A 3RG2A 3BZ6A 2HSZA 2Z2XA 4L08A 3CH6A 4F11A 5B1SA 2G9QA 2YASA 1IO2A 5JVTA 2BHRA 1MJ5A 4H7DA 5FBWB 4COKA 1XZKA 4KGDA 3A7EA 5EJEA 4YFNF 2VNJA 4PIMA 2W4SA 2HXSA 1I9CA 1YJCA 4R7ZA 3SLRA 3S17J 3U5TA 1FFEA 2NUTA 2C2GA 3RC7A 2AX3A 5JIBA 2NVWA 2O9LA 2CEAA 2J3JA 3A1FA 4YAJA 4F6RB 4QYWA 1PWYE 3H8SA 4BGEA 3ASOH 2HYJA 2YDXA 2UAGA 4HEA1 1KXJA 3ABZA 2J0QA 1UIMA 4Q4LA 3L05A 4MOWA 2HYFA 1R10A 1QPBA 5AUNB 3ADCA 4W8OA 3O8RA 2PUGA 2IZ5A 2DFEA 3KZVA 3R2JA 4KFRA 3VC3A 2VKVA 3TSWA 3SBOA 4F5ZA 1L7OA 4KNWA 3GBSA 4GZ5A 2PKCA 1J2XA 3WQSB 3KEYA 5KTOA 4JWTA 1AA9A 4UHHA 4DAEA 3VODA 1CP2A 4NYJR 1EFKA 3GEGA 1A9SA 1WMFA 2AFRA 2FG6C 4ND5A 1OZAA 2XGMA 4Y2SA 3KD3A 3ZQFA 5FGMA 1OILA 4NZZA 3ZUPA 5EHGA 4M1EA 4E94A 3DEUA 4HWKA 1XGKA 2Q4OA 1ZD3A 4LXXA 4PHTA 5JI3E 2QVXX 3UBTA 5ILGA 1HG1A 1NVGA 1EQUA 1ETOA 1MH4A 1Z7GA 1B8IB 2XNDD 3JAKB 3H65A 5T5QA 4TT8A 2HJRA 4C3HJ 4H59A 3RBVA 2PG4A 3K0HA 4CKWA 3KLNA 1S8FA 4JJGA 2O8XA 4RPJA 3EMKA 1QM5A 5AKJA 4L18B 2WD7B 1OQAA 3OYDA 2GYUA 1Q0ZA 1ELOA 4EI7A 3NAMA 1Y1SA 2WA1A 3V7WA 3RC1A 2CXOA 3JPYA 2I1WA 3W06A 4POOA 4XLTA 3WQHA 2BFFB 4DILA 3VU3A 3K0SA 4PANA 1XBTA 3GEZA 3I76A 3JALB 4JP5A 5ETJA 1I7QB 3OTQA 1ZN2A 5DCWA 4WNCA 1EBFA 1YVEI 2ZTMA 3DULA 4BFCA 1BJAA 4REMA 3V46A 1PTKA 4UDOA 5KHLB 3MWYW 4WDQA 1SHJA 2PWBA 1OKKD 1AB6A 1GGVA 3T1BA 1LJ9A 1KEPA 1HSOA 1KETA 2XGDA 1QYCA 3A6ZA 2MD5A 3B12A 3GEEA 3IUQA 3NTUA 3Q7RA 4UE3S 3ED1A 4OIPF 5BNWA 4KJZA 1AG9A 2JDID 1PR5A 2Y68A 5CB4B 2ONYA 3LHKA 4UUQA 2WY8Q 2Y0MA 1C1DA 1PFUA 3AJRA 3EH1A 2FCRA 4F46A 1UMDA 4M6VA 4ALKA 4LIVA 3ZZ1A 1WMDA 1JKOC 4Y8VA 1RZRD 4KT6A 1DDNA 1JJIA 3PEVA 2XA9A 4MGHA 4D9NA 3QAHA 2WTXA 3RS9A 1ZRFA 2A1TR 4BNIA 4V1CI 5EZGA 3Q7PA 4ID3A 4OQMA 4E4HA 5C2JB 2JFFA 2YV2A 1NVEA 4BJ5C 2OAEA 2QG9A 3PWSA 3SXUB 3AM1A 1YO5C 1SA0A 3CO6C 3DZFA 5LBIA 1WXWA 1JKJA 3NC0C 5TVGA 3WV4A 1O6BA 3LXMA 3ZVMA 3M6MD 2YC2C 3NP9A 2DPDA 4CM9D 1HX7A 3FSJX 6REQB 5CA0A 2OUKA 5A6SA 2VXOA 1CJTC 4IDEA 4FI3F 2ZS7A 5HIIA 2FZWA 2LFBA 1HT3A 1NYLA 1TGYA 1OLTA 1AKHB 1VBMA 2DPYA 1CDEA 2P41A 3I2IA 1N4DA 1A6IA 1NV8A 3L01A 4N0BA 5AXDA 3HJGA 5C80A 5JI6A 2PZKA 4DRYA 1RXVA 2P6OA 3DR3A 1KDOA 1W6RA 5DK6A 1FDWA 5B4UA 4HLUA 4BAZA 2C2ZA 1SBQA 4BE1A 3BFJA 4CV1A 3A4NA 4BHBA 1VI5A 3ZRGA 2HQOA 2YXDA 3ABRB 3C43A 4FISA 4ANFA 1Q7TA 3D5LA 1HFJA 2ERCA 2F9MA 2QL7A 1LV8A 2QHXA 1K7CA 3OJLA 1MBJA 5BNFA 1OXXK 5ALNA 3MBIA 4WOPA 1PVOA 3W9YA 1JQ5A 3D31A 2X6TA 2HDNB 3KLPX 1B4DA 3QMWA 4UTZA 2DBRA 3HRTA 6PFKA 4PJ0C 2W2KB 4UUPA 3UIEA 4HX7A 4XLAA 1IOZA 1MBZA 5LBQA 4X1IA 4N8EA 3HKBB 1N2EA 3T5PA 5HKBA 1A4UA 3MSXA 4N48A 2GXUA 4C1BA 3D3QA 3RV4A 1ZX1A 3SZLA 4N7RA 2OHIA 2A88A 4DCTA 1F14A 1W25A 4IDCA 4NICA 2VT3A 1Z6YA 3L92A 4XKBA 3LBNA 3CUOA 2G82A 3FUWA 1FJLA 3MTEA 5EVCA 1CUJA 2I6QA 3HKEA 1UWVA 3E05A 4LGCA 2K3PA 2DWCA 4JJ7A 5FA6A 2XXJA 1BJZA 2ZMEB 4ZCQA 3KM0A 5A0FA 5IAGA 1O5OA 2JFHA 2ZYAA 5AKXA 3SE0A 1FLVA 1KH2A 5CP8A 3VAAA 4DJEC 5KYYA 1TWGJ 1XEFA 3VO2A 3FLBA 4HUJA 2GZMA 4RLSA 2E6KA 1W36D 1ISFA 2ZBDA 4XD7D 1PWZA 2AI3A 2FRXA 4Y33A 2IUEA 5HCNA 2Q4BA 4FHCA 1Y8QB 1KU9A 4X95A 4ZTUB 1ZO8A 3G9QA 1HCRA 4TXNA 5C7YA 3WB0A 4ZI2A 5KBYA 3IOCA 5LYJB 1JJ6C 3EUKL 1EEXB 2EXXA 2GN1A 3FWNA 4IXMA 1UFKA 5H02A 5JD3A 3A36A 4JOCA 2W37A 5GPBA 2I2WA 5CAEB 2R62A 3MTIA 3W8FA 1R3UA 2XDWA 4L9JA 2Q1UA 3WY9A 3AM3A 3OJCA 3PVCA 3UM9A 2CFOA 1ABEA 1PBNA 2J6IA 3DWLE 1LB2A 1W85B 2XB6A 4WFIA 2FXAA 1CQIA 2HNKA 2GERA 3OE5A 3WGJA 3ANTA 1MQSA 2YZMA 1N0VC 5AHOA 3PQEA 5DXAA 5JADA 5JAIA 1ADCA 3IUJA 2IVZA 2RIRA 4YNBA 2BZGA 4ALMA 1G2IA 2V3VA 2R5FA 2C9OA 3DLBA 3M7GA 1HZZA 1ML3A 4D1QA 5I48A 4BX9A 4UXIA 4JC4A 4RULA 4NC7A 1BHSA 1BRMA 2G07A 4X44A 1DWPA 1LSOA 5TRTA 2ZJ7A 1QGDA 1BC5A 1R16A 1QZZA 1FOEB 3N8IA 4IMPA 4NZYA 4NV0A 1XTBA 3D8HA 3TLYA 3DE2X 4RA2A 2I65A 4JB0A 3OMLA 4G6TB 3BGDA 3DEIA 3KOOA 5EP3A 3I9JA 3TW4A 5HR5A 5LSAA 2NVTJ 2XOXA 5CA1F 2IXFA 1DZ3A 3RIXA 4MVYA 2KFDA 3MFYA 2A68F 5B5SA 3X2EA 3C39A 4R98A 5K3FB 3W5VA 1QO9A 4KR3A 1CUDA 1E5XA 5LZ8A 5F4BA 5EEGA 4D5EA 4GP9A 5B7PA 5KTTA 3RJ9A 5CDHA 2CMHA 3DAGA 1Y3HA 1MABB 2AZTA 2GCOA 2HSWA 1QQ6A 2JIDA 2XE6A 4PN3A 2VQDA 1N6IA 3V8BA 1JFTA 2GRJA 1M6VB 4OQLA 4RTJA 5K7ZA 5TQJA 1USKA 4Y18A 4Y15A 2GAFA 1O94D 4O0MA 2C31A 2F1HA 4D42A 1KTVA 2ISCA 1SCUB 2L82A 4OGKA 4E08A 3HNRA 5KQMA 1I36A 2I76A 3ETEA 2UUOA 1WO8A 3EJ6A 1H85A 2DP4E 3VKWA 1BEUB 1Q7GA 4BKPA 1UK9A 4R54A 1OWMA 3WKBA 2NTEA 1OAKA 3R20A 1T9CA 1VMEA 4XSGA 2YNMA 5AKYA 2BC9A 2E1MC 1GSOA 2WOJA 3GRKA 2XMBA 3L4EA 3ZH9B 4UU7A 1XE3A 5EZYB 3UNXA 4B79A 2PX8A 2YVUA 2K3FA 3EGEA 3KQPA 4OD0A 4C03A 4BXOB 1OIXA 4FC7A 3RIYA 1FL9A 3CSDA 5HFJA 4ZVOA 3OETA 4YP9A 4QPQA 5E3IA 1JEYA 2YJ6A 2HVQA 1A36A 4JX9A 1Y4UA 2G9NA 4HA8A 1Z4QA 1TCVA 1C0PA 2JFGA 1TD9A 2VDKB 4YAOA 1V8BA 4QQ8A 1JDUA 3RG8A 3P9KA 2C7VA 1FXWA 1GPNA 1HDGO 1YQEA 2QRGA 3U7EB 1KMIY 1R4NA 2R2AA 4LSZA 5C37A 2CJJA 4HRYA 1VPTA 4MWOA 1EU1A 4RB2C 4ACAA 3ZJYA 3FZQA 1EVEA 2V9PA 4GXNA 3OCWA 1RC1A 3P9YA 1MNMC 4XPIA 2O50A 4JGGA 4WWHA 2H2WA 1NBMA 1WB5A 3LD9A 3MMXA 4R2HA 4TTJA 4F6LA 1ZNYA 1YU9A 4HB4A 2X77A 2YICA 4PZAA 2B7EA 2J3QA 1CY2A 1DQYA 1G17A 2VYCA 4Y2UA 5FOTA 5EJ8A 1G38A 1P61B 4NBUA 4Y0AA 5FBZA 3DZGA 4YXFA 1AB5A 1OLSA 1X39A 2OZKA 5BNZA 4HZUA 1O0CA 4C3VA 3AUFA 1ZHFA 1XD9A 2F43B 4F5WA 3UEOA 2DBZA 1NMSA 1ZK8A 4U6SA 4UDNA 2W6CX 3RVQA 5KOYA 1V2GA 3RUAA 4V2FA 1MEEA 1WCIA 1KGSA 1GL9B 1MHPA 1THTA 3OLQA 3U81A 1JDZA 1N3YA 4ZI7F 3T95A 2YNMD 4I19A 4IEJA 1YO6A 2QAJA 3KJNA 3PQ4A 3T3NA 4C2MJ 1W4LA 4MRNA 4YMVA 5BVGA 1QIKA 4CXFA 3GEHA 4E5UA 4GSYA 1TCUA 2Q8PA 4C4ZA 2KX7A 4B3FX 4J7AA 3GLHE 1O95A 4X1KA 3HN7A 3GP8A 4NOKA 2IXTA 2X0KA 3EC1A 5F52A 4MWGA 3JQGA 4R2IA 1NQOA 3EUAA 3DO8A 1BE6A 2GCGA 2NYUA 3FXUA 1AOXA 2JIQA 5AM3A 2EG9A 3GH1A 1S4QA 1B6SA 4H15A 1ETXA 2CW0F 3GYHX 3ET5A 1Q14A 2JH8A 4MVXA 4FP9A 4NTZA 2WMNB 5I47A 4RH0A 1RACA 3JATA 1DPGA 4C0JA 2WU0A 4DXHA 4RK5A 3GELA 5KQSA 3GD5A 4LIUA 2FZ5A 4HS4A 4NI5A 1YZFA 1KOLA 3ZGOA 2H2GA 1MB3A 4KR0A 3UJPA 2BH2A 3CLRD 2JCSA 4BWGA 4DPMA 2XSZA 3FWZA 1OXSC 2GZAA 1LF0A 3FHNA 2FOIA 2ZRAA 3TNDA 2HMYB 1FUKA 3HR8A 4PBSA 3RJMA 3F3XA 1WX1A 4A5OA 3ZBPA 1EP1B 4NG5A 1SQ0A 2VAPA 1A7UA 3DAHA 1THZA 4D5CA 2VUMJ 4ND2A 1CQJB 5EFZA 3G88A 4HLXA 1QRAA 3JRIA 4MWZA 2HA0A 4J76A 1AHDP 4L7QA 2VJJA 1I6WA 3SZMA 1DKRA 1Z4JA 3I45A 1Y5IA 3QXGA 3I6IA 2LG4A 2CDNA 3HDYA 3FPSA 3VVLA 1E3WA 3OR2C 3FR7A 1B0UA 3CNHA 3K1JA 3EVBA 1V1RB 1EAMA 5AOAA 3SEAA 4J1TC 3TEJA 3TFQA 3WI7A 2WD9A 3ZUGA 2D6FA 2JQ7A 4J7UA 4IG9A 4BAGA 4YRQA 2E1OA 1G19A 2EKQA 3ZIDA 4YRBA 4NDNE 2FEAA 2YZ7A 1F8XA 2EFGA 5IDWA 4H35A 1X2EA 4IF4A 1A9QA 3TW0A 4LVOA 1UUFA 5EXEA 1HG0A 4JT2A 1G4DA 3NEYA 1EA3A 1PD0A 1WVIA 3K0BA 4RGBA 5JT1A 5GZ6A 1QVAA 5LM3A 4B3JA 4I55A 2FX0A 1AKHA 3BPSA 2WMOB 3GYBA 4R9SA 3TX6A 4ZCPA 3E6CC 2C88A 1A8UA 1SAYA 4A27A 1P1KA 2QSFX 2MR5A 4G1BA 3A27A 5JBQA 4RZ2A 2QUAA 3FYCA 3O6VA 4N0MA 1J8QA 2G88A 2EW2A 4CMJA 4F60A 4N01A 3LSMA 5HKAA 5GGXA 3T1