4GO1A

Crystal structure of full length transcription repressor lsrr from e. coli.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
297
Chain Sequence
EQGMCEEEQVARIAWFYYHDGLTQSEISDRLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYETQLRRQFSLQHVRVIPGLADADVGGRLGIGAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIGQLNAACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAADVAIVGIGAVSQGEQLMIGRKGAVGDILGYFFDAKGDVVTNIKIHNELIGLPLSALKTIPVRVGVAGGENKAEAIAAAMKGGYINALVTDQDTAAAILRSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator LsrR
publication title Structural Basis for Phosphorylated Autoinducer-2 Modulation of the Oligomerization State of the Global Transcription Regulator LsrR from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 92
structure length 297
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04198 Sugar-bind Putative sugar-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4go1A01
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4go1A02
4L4YA 2EA2A 4IRGA 1FNNA 3UW1A 1G6NA 1UHWA 3BJAA 4IJAA 2GIVA 3CSSA 4JQFA 2F8MA 2RN7A 3W6KB 1MD0A 2EV6A 3U7JA 4NMLA 2EV5A 1HW2A 2QM3A 2ZNZA 1E17A 1H0MA 4KFCA 5DCFA 2PLYA 3IRRA 3RDIA 3I54A 1O7FA 5DV5A 4FT8A 1QPMA 2R3SA 3JSOA 1Z9CA 4N9IA 1R58A 4UVAA 4HLXA 1KU7A 1W7PB 5D8KB 3J80Z 1G3WA 1P2FA 2MH2A 5DUIA 4Y17A 1HW5A 2YSRA 4WXHA 1QGPA 1SD6A 3HHGA 4KA4A 3ZN0A 4A6EA 2LF8A 3KLOA 3E3VA 2VOOA 1HKTA 5ILSA 3KV1A 2M8EA 1HORA 3HIFA 2M87A 1Q1HA 1OYWA 2PFBA 1O3SA 2FQ3A 2QWWA 2FXAA 1J75A 4N9HA 3MAJA 4G94A 2VODA 3MZHA 3PFIA 1O7LA 2NNYA 2IJLA 1LKZA 4I09A 3F3XA 3K9TA 2Q8KA 5BPIA 2HDCA 1U5TC 1FYMA 3GUDA 5K1YA 3WGIA 3E5XA 3CUQB 4PGGA 3DQVC 1VL1A 3RPUA 2VE9A 4EGZA 1YS7A 1DEAA 2XV4S 1RI7A 5LGTA 1K78B 1XB4A 1R1TA 1BI1A 4Q48A 2JPCA 5HJ5A 3ZMUA 3F22A 1HKQA 2EFNA 1IRFA 1FBQA 1WSUA 4Y13A 4YFXF 5KVRA 2HKXA 1PBTA 4S05A 3C1DA 1QZYA 2HEOA 4HX7A 3BROA 3NWPA 3BJ6A 3QP5A 4GXOA 3GFIA 1JT9A 5LEKA 2H27A 5DUKA 2LF7A 4HOBA 3ABUA 4ETSA 4ENNA 1YG2A 3CJNA 3GFJA 4UNOA 2AS5F 4ZZDA 2L02A 2XAFA 2P7CB 2NYXA 3DKWA 2RI1A 2IT0A 3DPLC 3EUHA 5ERIA 1J7KA 1OYIA 1S3JA 5H6RA 3I59A 2FF4A 5TJJA 3WTUC 4P96A 4OIQF 4A2UA 1P4AA 4ASNA 2BEOA 3WTTC 3DF8A 2HGCA 1D5VA 5DYMA 1K6OA 1Z05A 3E97A 1JE8A 2ZO4A 4M9ZA 4RAZA 4WWCA 5EEHA 3ENQA 1G3TA 2W48A 2R7DA 5E8IA 2JT1A 1M0SA 4KNYA 2P8TA 1KU9A 4WXDA 4HV6A 2EFWA 1CGPA 3N4MA 5HLHA 4LMYA 2UXXA 2Y48A 5BMZA 1RNLA 1IF1A 4IO1A 3NRVA 1W5TA 1U5TA 5AIPA 1KGSA 4OINF 2HYGD 4G7ZF 1SFEA 2OQRA 2VT2A 1XDUA 1FS6A 1UB9A 4TM7A 5ILVA 4KDPA 2HZTA 3L09A 2O6GE 1YYVA 2W85A 4QWQA 1XGMA 3KETA 3GX4X 3I58A 3MCZA 4LB5A 4UHTA 1U6GA 4M9SA 3Q9SA 2XHKA 2EFQA 1BJAA 1WKMA 3TOAA 4ESFA 1J59A 3ZMZA 3B73A 1I1GA 1RIOH 1YQAA 2E1CA 5E17F 1FBSA 1S7OA 5HOOA 4RB2C 3EYYA 4BHPA 3R0AA 3TQNA 1O8BA 4LD5A 3BY6A 3WU1B 2A07F 2HYFA 4HAMA 3ZP5A 3L00A 3TX2A 1IN8A 2FBHA 2LSOA 2DI3A 3HHEA 1LEBA 1FBUA 2PN6A 5AONA 4P9UA 4M73A 2DK8A 2J5PA 2DLLA 3E6DA 1LDKB 3REOA 1TQMA 4ZYGA 1DPRA 2HQNA 2DTRA 2FRHA 1DDNA 2ZKZA 2QBYA 2E1NA 3GWZA 4JBAA 1KA8A 1MDMB 1R23A 2X4HA 1E2XA 4M9XA 3BJOA 5CYVA 1IAWA 4FX4A 3TDZC 4OQPA 1B9NA 2A68F 1RUOA 4L51A 5L3CA 2A69F 5HDGA 3MZYA 3RPQA 4L18B 4BXUA 3IKVA 1S7AA 3GXOA 1KYZA 3KZYA 4UXNA 5L3DA 4G7HF 4U0YA 3DXJF 2KIUA 1JXSA 2E7WA 3HSFA 3RTRA 4I2OA 4WCGA 3T8RA 1ZG5A 4LLNA 2VOPA 4F7ZA 5BQTA 1STZA 3GZ5A 1IN7A 1PUEE 4IRHA 4LLLA 5HS9A 5DEQA 2YX4A 3M1EA 5F1RA 4ZYHA 3GW2A 3FMQA 5CVJA 5E20A 4OIRF 3J81Z 5A2QK 3MEXA 1T6SA 2DK5A 3E6MA 1CD5A 2VBXA 4DQ2A 3CDHA 3WTZA 3ECOA 3F23A 1MKMA 4KYWA 3WG9A 2P5LC 2ZNYA 2RI0A 1WQ2A 4U0WA 2RVCA 1FY7A 1LK7A 4MTDA 1LDDA 4A12A 4GGGA 2FBKA 1W4MA 2ETHA 2EFPA 3CH7A 4P55A 4L5IA 1WI9A 2H6BA 4IPAA 1S8NA 2XGXA 1T0FA 3ELKA 1B4AA 3Q5FA 2JPBA 2XROA 1D8KA 5HLIA 4CDGA 3C3WA 3E5UA 2MBFA 3BXHA 2JRTA 4WX9A 5FGMA 3ML6A 1IN4A 4EMSA 3IC7A 4EJWA 2OBPA 4G7OF 3BDDA 3SFZA 1QQIA 1KS2A 5A2QZ 2NNNA 3H92A 4NQWA 5HVQC 2KIFA 4GYIA 3CUQC 5IT9Z 4EV0A 2HS5A 5FFZA 2UWMA 1CF7B 4AVPA 4PCQA 4B09A 3CO7C 3Q9VA 3BXFA 4HX8A 2RNJA 3L7OA 1ZLKA 2BGCA 3LA2A 1PP8F 2LKPA 2O0YA 2Z33A 1DP7P 1LK5A 2FA5A 3N97A 1ZRCA 4G9YA 2O3FA 2DO7A 2K7LA 1TW3A 3B02A 4GCVA 1REPC 2GQQA 1XMKA 4EVIA 3RKYA 2ZMEB 1XGSA 2A6EF 4O5VA 1XCVA 1D8JA 5CLSA 1YS6A 2QYOA 2MA3A 2Z9OA 5DCMA 3JTGA 3KP3A 5HS8A 2P7VB 1WWXA 1F1ZA 3CLOA 2EFOA 5LRSA 5LGNA 1BI0A 2W84A 1F9NA 2YPRA 5AIQA 1MZBA 1K79A 2XAQA 5ICCA 2CQKA 3I4PA 1O3QA 3VODA 3IWZA 3BPVA 1FX7A 2CFXA 3KE2A 4ENMA 5K5RA 2M5WA 4GMKA 3WTYC 1FT9A 1I27A 5D5VB 2ESNA 3DFGA 3EQLF 4U0VA 1ZRFA 5E1ZB 3F8BA 2CG4A 2IW5A 1F4KA 2STWA 3FWEA 2HR3A 4WXCA 3GF2A 4JK1X 3DEUA 1ODDA 3KP5A 2WWYA 2ZFWA 3TKYA 1LEAA 2CWEA 2ZXJA 1F5TA 5ICEA 5BPDA 1FSHA 1BBYA 1SMTA 1DUXC 1TLHB 3I64A 5F64A 2VBZA 1XN7A 2VT3A 5BS6A 3R60A 3GO5A 1IZ1A 4LLGF 1ZLJA 2O61A 5K5QA 1D3YA 1O3TA 4L4ZA 5D6EA 4LJZF 2DPUA 2FSWA 2V79A 5J6XA 2HFHA 4Q5SF 1VTNC 4S04A 3CUQA 3JAMK 1R5HA 2STTA 4LB6B 4O3MA 5LHIA 2QLZA 2WTEA 4KT5C 2M45A 2BBYA 1BOAA 2VONA 5D8LB 5CVIA 2DQRA 4MQVA 5CJ9A 1FSEA 4AD9A 3IKTA 1K78A 4MQ9F 3W6JB 2MC3A 2P5VA 4U7BA 1FZPB 1WRJA 4YIIA 1NE7A 4I0BA 3S2WA 4KN7X 3ULQB 5LGUA 3BXGA 4U7DA 1QO0D 2XRNA 1FC3A 1R1VA 4L9VA 5L3EA 4A5MA 1HBXG 3HRUA 5LLQA 4P9FA 4A0YA 3LA3A 1ZAOA 1UCRA 2W25A 3LHIA 1H9GA 3QRFF 3O6BB 1IN5A 1Z1DA 3ERED 3OV8A 3NQOA 1B9MA 4EM1A 3JAMZ 3F8FA 1OKRA 2HQRA 2V1DA 4M8LA 4NB5A 1A04A 1RUNA 5ILUA 3G73A 5FB2A 3ZMVA 2DU9A 2J5OA 1XSVA 3WTXC 3OOPA 3ICOA 2F5FA 1R22A 5J8FA 3WGHA 3PQJA 1UJ4A 5ED4A 2LDUA 2X0LA 3I71A 4HF2A 4KIBA 2P5KA 3GLXA 4HZFA 3TDUC 3GVAA 3WTVC 3DP7A 1JGSA 3KP7A 3NEUA 1BIBA 2NAZA 2VN2A 3HHHA 3COAC 1ON1A 1YW9A 2PG4A 4RAYA 1LQ1A 4IVNA 4PDKA 3HSRA 3P9CA 4FHTA 1U5TB 4L0YB 1GHCA 2LNBA 3P9IA 2FEZA 2O8XA 1Y0UA 3WTSC 1U78A 2COMA 2DBBA 1L0OC 4ZZLA 1BC8C 4LG0B 5E1WA 1TQIA 3GEZA 3T5XA 2PEXA 5E1XA 4OMYA 1EH7A 1T38A 3ZMSA 1OMIA 1IW7F 5FLXK 2XAGA 4I01A 4I0AA 4EM0B 2CO5A 3QPTA 2ZBKA 3F72A 2F5DA 2K4BA 3HRTA 5D5XB 1UJ6A 1KQ9A 4KMUX 5LHGA 3HSEA 4FX0A 2L3DA 4OMZA 1UFMA 2G7HA 4BHBA 3FHZA 2GWRA 4ENKA 3F8NA 4M6YA 5LRRA 2KRFA 2TDXA 4XBFA 2G7UA 2PBIA 3M9AA 4I02A 4XSZF 2O03A 2ZJ2A 4KIFA 4OU0A 1SD7A 2GA2A 4AWXB 3QPHA 3DV8A 2Y75A 3IXQA 1KQ8A 4MEXF 2R7FA 2F5CA 1I5ZA 2OU2A 1PDNC 3GFMA 2QUFA 5FLXZ 2D1VA 1IXSB 2EJRA 1XTZA 2Z3YA 4PZJA 2QBYB 1T39A 1ZRDA 3K0LA 1R1UA 1DPUA 4A0ZA 2ESHA 2IA0A 3FX3A 1QZZA 2V9VA 1FWZA 3I5UA 1LDJA 3LSTA 4EJTA 4UUVA 3K1PA 5HDNA 1MDMA 1XSXA 1ZYRF 2VBWA 1SMYF 4KMFA 6PAXA 4RGXA 1KQ0A 1FS5A 5K5OA 4B8XA 3RYPA 4UV8A 3ZMTA 1EH8A 2FU4A 3EYIA 4A5NA 3L7WA 2V1UA 1ZARA 4RGSA 3M8FA 1IXRC 1USSA 4RGUA 2OKGA 3NZEA 4OQQA 5F6FA 2G9WA 2A61A 3LAPA 2M1BA 3J7AO 1TQPA 4N0BA 1FQOA 2MD5A 1OR7A 2XKOA 1KU2A 1LJ9A 3KFWX 2AXLA 1HW1A 2ELHA 4BAYA 3JSPA 3GYHX 1KU3A 3BOQA 3C18A 1FLIA 5TRDA 3HN6A 1W5SA 2IRFG 3QOPA 1XGOA 3CTAA 1FSFA 3U1DA 2GA1A 2PQ8A 2GZWA 2IA1A 5D5UB 4L9JA 4R79A 5KK1A 5DDGA 4L50A 4UV9A 4P5OA 4CGZA 4D0PA 4KN4X 3IHUA 3V8JA 2PJPA 3T0YA 2PI0A 1XCBA 4L5JA 2VXZA 2XUBA 2Y0MA 5HDKA 1P4WA 1P92A 4HQEA 3VFZA 3SHFA 5L3BA 2BKXA 2BE5F 2Z99A 2DW4A 3E5QA 3ENVA 4HF0A 3MQ0A 3M8EA 3OC6A 3ROUA 4R1HA 4AIHA 3PQKA 1YFHA 5HS7A 3KZZA 4ZH4F 4ON0A 1TNSA 4OOIA 4L9NA 5JHUA 2UZKA 2XAHA 1YW8A 1U3EM 2CGPA 3TGNA 4L9TA 2FOKA 2W57A 1SFXA 4YG2F 2H94A 2ISYA 5FO5A 4BH9A 4CYDA 1YW7A 1R5GA 2HKOA 2P6SA 1QNTA 1P6RA 2QQ9A 1G3SA 4RB0A 3VB2A 3LA7A 3TOBA 4KUMA 1J5YA 1PP7U 4M72A 5LBQA 4PGHA 3I0TA 3ECHA 3HYIA 3QP6A 2ACJA 1IXCA 2Z5UA 4HA8A 4BYYA 5D6FA 2GNPA 1GVJA 2EK5A 1NHAA 4BHCA 4HDVA 3HUGA 3BP8A 2K86A 3ZPLA 2XKPA 5ICFA 4Y15A 2WV0A 1HQCA 3RKWA 3K69A 2OZ6A 4EQQA 2EV0A 1USTA 3AAFA 2DAOA 4MEYF 2EB7A 3WGGA 3EB9A 2VE8A 1R7JA 3GFLA 4MTEA 4EJVA 3ZMDA 3LQQA 4LGWA 3O2PE 3KP6A 5H20A 5BOXA 2IA2A 1V3FA 4CICA 1GXQA 1IRGA 4LK0F 1XGNA 4RS8A 1Z7UA 3V8LA 4XLNF 2ADUA 4A6DA 1SD4A 2CSOA 1YIOA 4ZYDA 4YIFA 2JZYA 5JVTA 4EJUA 2GXBA 2XVCA 1W7PA 1UHMA 4HQMA 3SXYA 4L0ZB 1AWCA 2MLGA 2Q2EA 3I53A 1JHFA 2A3SA 3V7RA 3FXRA 3HRSA 4CZZA 4TM8A 3D5LA 2P4WA 1EH6A 3L9FA 2DQLA 1TNTA 2MH9A 3FZVA 4KIGA 3BZ6A 3ENWA 3HTUA 2B0LA 3HOSA 3FXUA 3R61A 2DT5A 3P7NA 3ZN1A 1KYWA 2D2WA 2MLKA 1MGTA 1YLFA 1Z91A 2WU1A 4EJOA 3FF5A 1K7AA 1S29A 2K4JA 3TO9A 5ICGA 5LHHA 2J0EA 3KLNA 5CVRA 3WE3A 1B1BA 1HXDA 2CW0F 1SFUA 1FOKA 2OD5A 3ABTA 1HSTA 3C7JA 2F2EA 4GYGA 2KJBA 1LVAA 3TO6A 2VC0A 2IPQX 2BV6A 5EEGA 3H3UA 2KIMA 2Q0OA 2KKOA 2QZ8A 1QBJA 3VEPA 3CUOA 3FM3A 2PMHA 3LWDA 3BXEA 1HOTA 3FMRA 2HWVA 1IN6A 1ZHFA 1G3YA 3MWMA 2V6CA 2YU3A 4MNUA 1YTYA 1Y89A 3KP4A 1S6LA 2ISZA 2L4AA 3F6VA 3U2RA 2HTJA 2OQGA 1FRZA 2IP2A 1O3RA 2A5YB 2R5FA 2RDPA 4IXAA 4HYEA 2UXNA 4WK8F 3E15A 2EA4A 1FYLA 1MJBA 4HF1A 1BC7C 3HRMA 4XSXF 3I59B 3WU0A 1SD5A 4CHUA 2RGVA 2BKVA 2BYVE 4U88A 3IL2A 2YR2A 1ON2A 4XLPF 4YFNF 4HLYA 3FM5A 2O0MA 2K02A 1GXPA 3LAJA 4TV7A 4M71A 3TO7A 4AIKA 1XMAA 1RZ4A 2ZCWA 3IRQA 1R00A 4HBLA 3WODF 4UVCA 4HX4A 4HV5A 3RJPA 3R4KA 4EGYA 5FFXA 2H09A 4G6DA 3F8MA 2NRAC 3DPTA 2PMUA 1XSDA 2EWNA 4HDUA 3EDPA 1U8RA 5JFRA 1OPCA 3KP2A 3F6OA 4LK1F 3RYRA 3ZQ7A 2KJCA 4QLCU 3RI4A 3V7CA 1ULYA 1B6AA 3HTSB 2RKHA 1IUYA 4OIPF 2HTSA 1TBXA 1ZG3A 2RC4A 4AIJA 2QQBA 2L54A 3K1MA 4R9NA 1Z6RA 2C6YA 1J0RA 3LWFA 4X84A 4CXFA 2OA4A 2M30A 2XASA 4XRFA 4BNCA 3F21A 3QAHA 4LG0A 1O57A 1R36A 2L01A 3E6BA 5DD4A 2HOEA 5IT3A 1C0WA 1OYYA 3D0SA 3RIRA 1HKSA 4UVBA 1T2KA 1ZN2A 4WF2A 2XAJA 1B59A 2FNPA 1AOYA 1SAXA 1L3LA 2GXGA 3L2CA 4Q4ZF 4BQAA 2NS0A 5J8CA 4R8HA 3H3ZA 2D45A 1TW2A 1G4DA 4RB3C 3WE2A 3JTHA 2QVOA 4GO1A 1JHHA 3P9KA 1MJAA 3BWGA 2CYYA 4YFKF 1ZGAA 5JI6A 1BM9A 2VBYA 1BN5A 4I7HA 2XIGA 1ONVA 1FP2A 5D4RA 3K1NA 1FP1D 3EFBA 3FXQA 2E7XA 2D1HA 2OAZA 1H9TA 1HSJA 3G3ZA 5FD5A 3J81K 1BIAA 4KICA 2F5EA 5D5WB 1ZH5A 4EM2A 4HW0A 2DPDA 3BPXA 4RB1A 1T98A 3QU6A 5CVUA 3WTWC 4ENJA 1BI2A 2DFIA 3JW4A 2FBIA 3KCCA 5E18F 3SQNA 4G8XA 2WC2A 4Q47A 4MHGA 4NHJA 4Z2YA 5H6QA 3T8TA 3F8CA 3K2ZA 1ZG1A 3V7SA 2H6CA 2VC1A 1V4RA 1Z6TA 1TTYA 4MGRA 1UJ5A 1MJ9A 1ZGJA 2JSCA 4OIOF 1I6XA 4CO8A 2W24A 1XD7A 2RQPA 3V4GA 5DD8A 3CO6C 5L3FA 3VOEA 1LNWA 4R7TA 1EV7A 4H0EA 5FD6A 2V1XA 3EETA 2GAUA 2P6TA 3MFKA 3E7FA 5IT9K 4K2EA 2L4MA 3FMSA 4ZYEA 3T1BA 3LQRA 3M7GA 2A6HF 4O6JA 4LFUA 3SZPA 3KEOA 2QENA 2RV8A 5LEJA 4I98B 4RGRA 3KWMA 1YO5C 1X3UA 2QQAA 4ESJA 4E70A 4A0XA 2IVMA 4IRIA 3RKXA 1BI3A 4M74A 5CVVA 1W7PD 4ESBA 3O3KA 5JR3A 3E6CC 5L3GA 2OZUA 4G6QA 4M6XA 3V8KA 3KEQA 3SZTA 5E8GA 1CF7A 1I1SA 1ZREA 3IWFA 1P4XA 1J9IA 3U9GA 4IHSA 4DNCA 3HOTA 2JTVA 2YX7A 4IHTA 1FYKA 3LFKA 3R6SA 5D4SA 2FNAA 3GZ6A 1XDSA 3R0JA 2FMLA 1LB2A 3J80K 3ISPA 5HLGA 1U2WA 1J2XA 5DCMB 2FMYA 2ZMEA 3QU3A 1FPQA 2FE3A 2K27A 4IF4A
chains in the Genus database with same CATH superfamily
3K4LA 1O89A 5FFMA 3ZCPA 1MZPA 1P74A 5IK2A 4NX2A 1A6QA 1KP3A 1UBOS 1XP8A 4C7XA 3U26A 3DKYA 1ZGHA 1JI8A 4F6LA 4QAQA 3I54A 4MMYB 2C7BA 4P5PA 4GYJA 1EP1B 2ZATA 4MFDA 3V32A 2QIPA 4X1OA 4XWOA 1Z88A 3QODA 1NVDA 4QASA 5CB4F 1CZUA 3J80Z 2D1TA 5DUIA 3TIIA 2ORWA 3NCTA 2MSNA 3VTAA 2ZQZA 1ZNXA 3GUZA 4YRJA 1BS2A 2LF8A 3V6MA 1EAYA 1E58A 3IC5A 5K45A 2PIDA 2OO5C 4QWWA 4A0FA 1ZIXA 4NFLA 4QOFA 1XUOA 2XCUA 3I9MA 3QJYA 1TM1E 2JRLA 3CLUD 2ECCA 2L2QA 4LOHA 2J3EA 4DWVA 3UIEA 4RWZA 3WGIA 3E5XA 1TQ2A 1JHMA 1G3RA 4CMGA 3R0IA 2YUTA 1W47A 1GPUA 3BMCB 4KRYA 1Z4LA 2NO7A 3OX4A 1IGNA 5TLSA 2GZ1A 2V6IA 1TZJA 5KQGA 2NXNA 1WJ5A 2Q50A 3LWZA 2JPCA 1JKOC 3IR6A 1CZNA 3R8XA 2EFNA 3ESCA 1J7JA 4UULA 4B75A 3LIIA 5HUHA 4QIHA 4IKFA 3SOZA 2IH2A 4E7HA 1NVUQ 5EERA 1Z5NA 4HX7A 2BR3A 5LDGA 2AEEA 3W8FA 5G0VA 2XX3A 2PSFA 1GGVA 1FNDA 3UV6A 4U87A 1B8PA 2BFCA 1IJFA 2HPMA 3ABSB 1V26A 3GLSA 3IQEA 3GJ5A 4L7QA 5LMCA 3AUYA 4LXYA 2QRMA 4D8TA 2L02A 1EINA 4N3AA 4PHFA 3EUHA 3QFTA 1XZGA 1S3JA 3EXG2 3CJQA 5FOQA 1B74A 2HU9A 3W3AD 4MP3A 1U8FO 3D6AA 4B32A 2P65A 1GLVA 2ZKLA 3CSUA 3M1LA 2FQXA 1O08A 2HXIA 2FOWA 4UZSA 3EGEA 4DS3A 4JITA 1FTYA 3CIOA 4CFYA 3AHIA 2YVLA 1G19A 3N8GA 2O3SA 2JCYA 4X0EA 2XTMA 4KNYA 5FTLA 2I4IA 4AK9A 2BH2A 4H1HA 2IHYA 3HY4A 4BLRA 3QE3A 1CIPA 4ZU1X 2B5VA 2HBZA 3DCJA 1IF1A 3G9QA 3IGFA 4Y6PA 3RFXA 2PBRA 3N6RA 3BTLA 1M7HA 1I1NA 2DC1A 2QNRA 2R8ZA 2NSDA 3KPJA 4JLUA 2J30A 2XHKA 4WCVA 1NMZA 3IXMA 1L8QA 4R31A 4PNHA 4F8YA 3S2UA 3ZBPA 3NHSA 1T0FC 2W6MA 1M1YB 1N25A 3T5BA 1L0BA 3Q3VA 3B1YA 2IE0A 2JFPA 3CLVA 4RB2C 2RHGB 2O1SA 4BHPA 3UV3A 3BG5A 1AH2A 4F92B 3TX2A 1MMSA 3FIJA 4XSHA 5BW5A 5FA8A 4U0KA 5CEFA 1F43A 4Q9NA 1VB3A 3OTIA 1TRKA 4GI5A 4PWYA 3AI2A 2DK8A 2I5PO 2IV2X 1JG1A 1MAVA 3K4KA 2W6IA 3D4OA 1KQGA 2PUDA 1DBIA 2WJJA 1RZVA 5H16A 4Q6BA 2HQNA 4AQDA 1Z7WA 5AOCA 1MQ9A 3ZQ6A 3WWYA 3BJOA 3DB1A 5JD4A 3QKUA 3AI3A 1G2PA 3CURA 1CZHA 1JNXX 3V97A 1ID1A 4R54A 3A7DA 3VYUB 1A2KC 2ZUTA 2D2IA 4F3NA 2R44A 4KR0A 3N8HA 4IFBA 3GVIA 2PQMA 2XVZA 3RUPA 3CNNA 2EBHX 1SXGA 5LQKA 5CH5A 4MIOA 1LZKA 5DS9A 4FFPA 1YQTA 2HVQA 1PUEE 4TKVA 4IRHA 1RWBA 3O73A 3PNTA 3ANNA 1JS1X 2O5EA 3M1EA 1PQWA 4HLNA 3GW2A 1GUUA 3FMQA 2WPDD 4OIRF 3J81Z 4BWGA 4BC1A 3E6MA 4PTZA 1H8HD 3RABA 3KJIA 5JC1A 1CK4A 5FBKA 2QKLB 5C3MA 3FYCA 4LJ4A 1XIVA 3REQA 5I9NA 4ECAA 4M7WA 2FBKA 5LYJB 2FZVA 5M5XJ 3A3PA 4HWKA 4YJ2A 4P55A 4JI5B 4GVPA 2IQIA 4XLHA 4IDEA 2VHYA 3JQBC 1NJSA 3JQRA 3LPLA 3IEPA 2KIQA 4TMFA 4TN1A 2JRTA 2YDYA 1ONBA 4ACAA 1O94D 4BX0A 1QQIA 1SZCA 2BOLA 2IL1A 3GLTA 3AMVA 1EESA 2RBEA 1U0LA 1Y42X 2AQFA 3M3PA 3WGZA 1P77A 4BLQA 4Q15A 4RY9A 3FMOB 1D7OA 5KUTA 4HX8A 2E2JJ 1L8AA 3L7OA 2BGCA 3N97A 2V4UA 2KI5A 2XCRB 3OSGA 4JEUA 1CE8B 1C1YA 3B02A 4O0MA 2QM0A 1VQKI 3Q85A 3OETA 4FR0A 4M53A 4ZO8A 3MGBA 4FS8A 5EPUA 2IXTA 5CLSA 1YI1A 3WB0A 2G08A 4R3WA 1WWXA 4HQ6A 3S32A 2PHZA 2IHBA 3DUWA 3NHLA 3ZZ1A 1MZBA 3U7QB 2WB4A 1ESNA 3VGJA 3I32A 4WRRA 4Q4JB 2HTEA 1U9IA 2OC4A 3VODA 4RDHA 1Q95A 1HQKA 2NADA 4JKYA 3RRMA 1HTBA 1GLGA 4UMFA 3TE6A 3IAS2 3N7UA 1P7WA 3VO2A 1TQDA 2QZZA 5KTNA 1RRKA 3KUDA 3VJLA 1SELA 3BSWA 1A9PA 4DQDA 2GD1O 3CG0A 2QTCA 1P4SA 2J7PD 3ZZNA 3CMMA 2ZFWA 2WABA 3TKYA 1U8TA 5KKCA 5CHYA 4KDEA 2PFSA 2HNHA 2FMIA 3GC6A 1TOAA 3D2BA 1L5ZA 4XTCS 3ETEA 2Z43A 4LLGF 4ZVMA 5ALDA 1ICEA 1B8IB 5L3RA 1YZVA 4OH1A 2WQZA 1DMRA 3AOEA 2XBUA 1Y1TA 2FSWA 2FR8C 1N5IA 3CRZA 1TQ8A 1QBKC 1Z45A 3I5XA 1YL5A 4BO1A 3PRYA 3O8OB 2OQ2A 3HN7A 2WTEA 4JUDX 1QHIA 3KZIC 5KYTA 2DQRA 2JIQA 2AE1A 4P1WA 1FZPB 1BSVA 1PZEA 3JWJA 5U9CA 4A0SA 3GDGA 3THWA 1IQRA 4NBWA 3VHRA 3L2WA 3JD2A 5LGUA 3UC9A 2W2NA 3CNBA 4PWZA 4ENRA 1HNZB 4MPTA 4G85A 2CL7X 5J9FA 1PJ4A 1YWGO 3RYIA 4JBHA 3OX1A 3FDZB 1I5RA 5ECGC 3FMPB 3QRFF 3ERED 3NP7A 3MINB 4A8JC 5KYYB 3SX0A 1XPXA 4EM1A 2QRGA 5TMPA 3KSDO 1RETA 1NG9A 3DU5A 4R6WA 1R8QA 4DJDC 3IPXA 2ZIAA 4TSRA 1WJAA 2OQIA 4HGNA 4MV3A 4IHVA 2AG6A 3KQQA 3O3NB 2G0TA 5K0BA 1U3WA 4KMRA 3WTXC 1GZUA 1R6BX 3EAFA 3PD1A 5IS2A 2EX1A 2PX5A 1DBRA 2QYTA 2QUBA 3PHJA 3AF2A 2JD2A 4QDOA 1MQAA 4EO9A 2F1KA 4L6AA 4X1KB 3QG1A 3R5TA 4NP6A 2PG4A 3IPAA 3DZDA 4MYDA 1MO4A 4DBLE 1XHEA 3LI2A 4MRMA 5KB3A 5AW5A 1WOMA 1K6XA 2BY4A 3ROEA 1GHCA 4C2AA 1X58A 4B74A 4RGVA 1E64A 1GL9B 3UPUA 2JUCA 2IEIA 2NU9B 3DYBA 3BC8A 4QBHA 1SCJA 1AIPA 4RVFA 5D7BA 4HQOA 4KXMA 3FK6A 3RF7A 2VP0A 1HYEA 4IVQA 2HSGA 4V0SA 3F5MA 3ELWA 3FPKA 1Y5MA 2K4BA 5CBKA 3D3WB 1M9NA 1RPJA 3OECA 1YL7A 2JD0A 2BFAA 4ZYXA 4P5EA 5B58C 3GUVA 4Q3NA 2RGNA 2JBWA 4F3KA 4IIUA 4ES6A 3FDYA 1ESCA 1MORA 3RU9A 1VQ6I 1PW7A 5DW0A 5IJWA 4CM1A 3IUMA 1G3IA 1DRWA 1OGJA 1QFSA 1RLTA 2GA2A 4ZT5A 1MNDA 2Y75A 5LQNA 1YRAA 2BZSA 2FCAA 2KDZA 2K2QB 2JFVA 1JJBA 1G7SA 2QKMB 2FZGA 4WESB 2VPRA 1K7YA 2I34A 2XNCA 1Q6ZA 1MAHA 4PZUA 4KO2S 1T6ZA 4BO2A 1T39A 2ZRKA 1ZRDA 3K0LA 3BCSA 4MQEB 2C88A 2VPTA 4BNVA 1L7EA 2HMWA 5CG1A 5KNBD 2E7ZA 1MX1A 2J5XA 3IPRA 2PH7A 5IJ0B 4B2PA 4OMCA 2BVNA 3BZBA 2BRUA 1Y6IA 1ML3A 4E5SA 1Z5ZA 1GPKA 1M0WA 2OKGA 2H1KA 2G9WA 1S8OA 2GH1A 5IFKA 2PX3A 4KCGA 2HXGA 3ROTA 1ZCJA 2YJZA 1YFKA 1Z39A 2APJA 3EGDB 1E18A 1AZTA 5DCUA 1TL8A 2GA1A 4BJ6C 3DKXA 5FOUA 1P9WA 4RD4A 1A7KA 5EP2A 5IK2D 4E32A 4CGZA 4D0PA 2GLUA 5IAGA 1CP3A 1XA0A 4X92A 4Q19A 1P9LA 5HJEA 2IRWA 4JYKA 1KFCB 3THYB 3CF4A 2H85A 5LB4A 4AYWA 1KTIA 1NBME 3MB5A 1FLDA 1RLMA 1MR3F 2CYAA 2QD4A 1SOUA 5DWDA 5JSKA 1NOIA 4YO7A 2WI8A 4M0DA 3SEZA 4TGLA 2DFTA 3H9JA 4RDCA 2XAHA 1KMHA 1U3EM 2NVWA 2UYGA 1RWOA 3KEMA 4JV5B 1KJYA 4YG2F 2H94A 5FO5A 2ILVA 4IRUB 2DPGA 4J4TA 3MJCA 3TSYA 2WD8A 2WIFA 1G18A 1N3IA 3SZUA 3VB2A 3LA7A 3DQZA 1JQDA 2BY1A 3AUJB 2YNMD 5HM6A 3FPLA 3D59A 2QLBA 1JXOA 3PR1A 1L1RA 1QMPA 1TAUA 1I13A 1Y3DE 1PVEA 4Z49A 4LBWA 3R6TA 1V41E 5AVJA 2J9RA 1T9GR 2YTZA 1KBOA 3A4IA 1XZQA 2DQ4A 1T5DX 3PYMA 2I2BA 3EB9A 1T36A 1ZUWA 3AUTA 2ECOA 2H2IA 3E0JB 1UXOA 3OZ7A 2JBHA 1V3FA 1WAMA 4MRVA 2AC2A 3KJQA 4MZXA 2YZ7A 2JLYA 2WHEA 4RPCA 3V4SA 1H69A 2VBFA 3VJRA 4HWSA 2OP0A 4XSGA 2OOSA 1KAHA 4KRXA 4DVJA 3P45A 3H0GJ 2RHTA 1HYQA 3HRSA 5BSMA 3RRBA 4CI9A 2AI3A 3U17A 3FFBA 3T3OA 4OREX 2VZ0A 2VN8A 5ADUS 2G63A 5CW2A 3A4TA 2GAIA 4JJ7A 3F6BX 4C7OB 3PC8A 3SE0A 5LQAA 1YZQA 4PYQA 2AX4A 3ABKH 1Z91A 3S5UA 2W7TA 1QGUB 5CJPA 2DCEA 3PHLA 2R68A 5IH7A 3TJZA 2J0EA 5CVRA 3JY6A 1FOKA 5E3LA 1RZ3A 3H04A 1HSTA 4DMHA 2WILA 3H2IA 4QQNA 3TO6A 4JD5A 2ANCA 3FI0A 3H3UA 2IEAA 3SHQA 1XVUA 2QE6A 2IHZA 3AZQA 3P52A 5CFZA 1Y1LA 3GFTA 5IABA 3L6OO 3LG2A 1MBHA 3HDDA 4E7ZA 2D1RA 3LJKA 2QAGB 1J5PA 2WZBA 1LNSA 3WRXA 3RPEA 3HY6A 2X1LA 2JI6A 2ZIGA 2D1FA 2OCXA 1D0ZA 4XK4A 3IAS1 3VDNB 4I6GA 4M88A 3BLYA 5DTMA 3WMRA 3HUDA 1Z17A 5A5FA 4HF1A 3DBRA 2WKQA 3H2HA 4OHFA 4Q1AA 2B5OA 4IDAA 4W5WA 5IAOA 4OKSA 1FXWF 1YH3A 3OEWA 4D3SA 4WOJA 1O6GA 1JWBB 3Q7QA 2VASA 4IGAA 4FHCA 1ACLA 4C0XA 2CHEA 4AZSA 3WYGA 1CY6A 1L4FA 1PJ8A 3QPUA 4DL9A 2XB2A 4EGYA 2YW2A 4GIBA 3ZY4A 2NTNA 3THOA 4FHGA 2NZYA 2PMUA 1RWXA 1Y1QA 4LHYA 3I1YA 3EEYA 2D5BA 1WVGA 2KJCA 3DR5A 4CLOB 2QG9A 2OAQ1 2GN2A 4MWZA 2R7KA 5JXJA 5KPDA 2ERYA 4BV3A 2BKUA 4FDLA 3QMMA 3WXMA 4R9NA 3IFSA 3TW7A 4M1EA 2J1LA 4MV6A 1VKJA 1DHTA 2FX5A 2PYIA 2OA4A 3ZX4A 2JKYA 2GPJA 5H4HA 5KQMA 2NU8B 2PT6A 2GF0A 3F21A 3PFBA 1CDOA 1GU0A 5EUCA 1QCZA 5B1AH 4MWTA 3GLQA 4QU9A 3GEMA 3AH8A 1R36A 4MUEA 2HIMA 3LBFA 2Q3JA 3P0EA 3GJQA 4KRFA 1K9SA 1NJ1A 3A05A 4IDCA 1E2NA 2MSYA 2BTOA 4ZRMA 2VK1A 3AXTA 2HPVA 1T24A 2CFOA 3NONA 3IS3A 4ZEXA 1SAYA 1EWKA 3PPIA 3U9SA 1ORIA 2ZFUA 5M3MJ 4OX9Y 1L7OA 4B3FX 3H8VA 3KJEA 5B4TA 4XFJA 4EG1A 2M7BA 4B3TB 3QEMB 4FHEA 2MD0A 5KSOA 3BWGA 5JATA 1AA9A 2AOUA 4RK1A 2AQHA 4ODIA 4OHBA 3BB1A 5D4RA 4KQHA 5COQA 2HCRA 5ALSA 5FIUA 3C6XA 5IP6A 2PTGA 1JVNA 3HE3A 1Z2CA 2HLDD 3OIFA 2HFKA 2VF4X 1EZZA 5EY5B 2DPDA 4KO4S 3Q6NA 3DBIA 4KBFA 1FVOA 1XCPA 4M8KA 4Y6OA 4LBVA 2ZQYA 4QU5A 5C37A 1GT6A 4UTPA 4J9VA 3NEYA 3DTIA 1E3LA 2KMLA 3M4ZA 4AUKA 4D1QA 4FW8A 5HIKA 1J0EA 2BSQA 1ZQ1A 4N9WA 3HXQA 3HI4A 2A59A 4UXIA 2X13A 2C7PA 3DA8A 4GYYA 1IEQA 4YXWD 1S9HA 1IG0A 5L9AA 1Z68A 3SC6A 3A6EA 1EBUA 3F6EX 3ZCQA 4UFPA 1UJMA 1CJCA 1WHTA 3LSHA 1NRWA 3UAOA 2M4KA 3WBBA 4AROA 2JBAA 5CEEA 1HE8B 3M4YA 4ZYEA 4CVNA 1EDDA 2CXUA 2Z04A 4YCLA 3TE7A 2NZ8A 3Q2OA 3R7SA 3RAPR 4O6JA 4LFUA 2FB9A 2VKDA 1E0DA 2QA5A 3R9IA 1GPJA 3HVKA 3EVFA 2PRYA 4HYQA 1PEKE 2F59A 4KUHA 1CF2O 4QVGA 2QROA 2IVMA 2YJ5A 1UUFA 2VP2A 4QE3A 2A4MA 3LGAA 5HIMA 5J2TB 1XTSA 3ND6A 3CX3A 3EXFB 1PJBA 4NJMB 5JR3A 2XRZA 2BGTA 4UHHA 3NM6B 1KYIA 1ZR2A 2UAGA 1Q2UA 3RK4A 3SZMA 1DTEA 1K4SA 4TTPA 4TZ0A 4J2TA 2RKOA 4PYRA 1UZMA 3CX7A 2Y0BA 3M2TA 5B3JA 5FUXA 3LMMA 2EFJA 1BX0A 1CIVA 2ODPA 5EWLB 1ETQA 3B3AA 2C20A 2IHVA 4MYHA 4RAOA 4NCIA 2VF7A 1P1IA 3I72A 2RN7A 1ZZEA 2ZBDA 1TMGE 4AKHA 3GLFA 1D9XA 3VHXA 2N42A 3G8BA 4PIVA 3W8EA 3O8DA 3EUHC 1ECCA 3CW2A 4FMDB 2R3SA 1YJ5A 3J7ZI 5G1PA 3ABQB 4EFLA 1U0RA 1J2EA 5TIIA 4ZU6X 4Y2TA 2VJNA 5F1YA 3A2MA 4MAFA 2YSRA 2WC1A 3GROA 5KNCD 3E23A 2QE7D 2JH8A 2VOOA 2P3SA 5HHTA 3TG8A 3NTXA 3NAGA 3KV1A 4G0XA 3HIFA 2PFBA 2K3FA 2YMQA 3D1NI 3CF4G 4ISBA 1INLA 4NH4A 1O7LA 3GP8A 2L9RA 3DE7X 5LA6A 3SGLA 5AJHA 1Y9AA 3MBIA 2LTAA 1BJZA 2EJVA 2PU7A 3NBFA 4LOAA 3LZ6A 1WPRA 4A3SA 3I37X 2OGZA 3ADOA 3DQVC 1V45E 4CM8A 5KYUB 2BHYA 3QLJA 1OXUA 2AKAB 1KARA 1XZAA 5JVDB 3X2FA 5LGTA 3SYLA 1UJCA 5JNSA 1HT3A 2XZTA 2XKJE 4ZOEA 5IZ4A 1HY3A 3RIYA 1KMQA 4GM4A 4YDRA 4R81A 3B5EA 2CW5A 1NURA 1IRFA 3BGIA 1NBMD 3FG9A 3QU5A 2TS1A 2VYQA 1M2HA 4BCBA 4CCLA 3M89A 3W3CA 3ILHA 3PIRA 4OQLA 3WNQA 1DTWA 3H4MA 4LAFA 1J06A 3VR5A 3T38A 2FWRA 4PLZA 3FM9A 4MLCA 5JMWA 2XNJA 3D1JA 2NO9A 4ETSA 4JQCA 3QXHA 3T7CA 1JA1A 4KXQA 5FLXA 1YFJA 4YY3B 3DKPA 4CQMA 3VXKA 3JZIA 4FMCF 4PU0A 2P7CB 4D3FA 4Q1CA 1HO3A 4GWKA 5BQ3A 5H82A 3GL9A 2QLMA 3QBEA 3ZWCA 8LDHA 1RXEA 4O4LA 1GV0A 4BCCA 4WUVA 4QKQA 5CT5A 5DYMA 5GIPE 1FBTA 1J97A 3OTQA 4F46A 1KEUA 2WQ7A 3DF9A 4AZ3A 3GLFE 3PUFA 4OK5A 3H1CA 3TFQA 2P3LA 2ZLBA 4HGZA 4GZMA 4YT8A 3GEEA 5M5BA 3BGVA 5AKKA 3A0RB 1LQUA 1UZLA 1S4MA 4NJEB 3UTDA 4YONB 1N7HA 2PUHA 1CDDA 3S1AB 2V7UA 4ZZIA 3BXXA 4GBGA 3OYNA 1U5TA 2FW7A 3CLSC 2ZT5A 1E3QA 2K9MA 1QQ6A 1U6KA 5FL7D 3IOEA 4QM6A 4CIDA 2OC9A 4TXMA 2QAIA 4EPVA 1IXKA 3QTTA 4HAUA 4BEBA 5BN5A 5LP6A 2KL4A 4IQ8A 1QF7A 3KETA 4PYJA 2C95A 4OHKA 2K4MA 1YITI 3K1YA 3FH0A 4MWCA 3DEJA 2QTGA 1WLYA 4F2WA 2CLCX 4PZDA 3WOVA 2OXCA 3GZNA 4DN6A 3B73A 1KFEB 3U3RA 4D5GA 1VQPI 5AI8A 4AM8A 3G4SI 1FBSA 1RQLA 1Z4OA 1AQLA 2HXOA 2H8RA 2B4YA 3V1NA 5BWMA 5LBIA 5D00A 3DAPA 5IWCA 3A1UA 2X9DA 4H77A 2GLTA 3LCUA 1Q7EA 1H1LB 4PPQA 3WSVA 5HQ3A 4X9XA 3UJNA 3WL8A 3ENZA 3NIGB 3WFJA 1M6VB 1FBUA 2UZ1B 3ANLA 4KN9S 1FTZA 4M73A 3ZEIA 2BM0A 3CC4I 3REOA 4B9EA 3ZNQA 3L7IA 4IV8A 3M6WA 4KXUA 4JP5A 1DDNA 3L4EA 2HPAA 4JBAA 2QUKA 4Q00A 4BDYA 1EEHA 4IS3A 4FSXA 1E2XA 2W83A 4FX4A 1QSGA 4AJIA 4W5RA 4M0KA 1M3SA 3T61A 2HRQA 5SV2A 1EE1A 2X9VA 3VGPA 1UWVA 5DULA 2BF4A 2W58A 3I34X 5EMMA 4PSVA 2B25A 4FD2A 1UJBA 1PNRA 2Z56A 3EGWA 4BOYA 5KAMA 5C9ZA 1QCYA 3CZCA 2JDID 1JXSA 4XDYA 2IEKA 4XEHA 1NLMA 4NESA 1G0OA 3UB2A 5TV2A 4YJ3A 3PDIB 1OH8A 1IN7A 2PK3A 4K9QA 1U2TA 4DBLC 3ZJ5A 1GHTA 2XBMA 2A5JA 2ZQ5A 4EP1A 1QRSA 1T34A 2H3EA 3OKCA 2DZDA 2RQQA 1T6SA 4JUFA 4XM2A 1OPXA 1GSIA 2VSYA 3HA7A 4AVYA 1FP4B 1OTHA 1QORA 3QYBA 3HADA 4ZAFA 3U40A 5E38A 1BTOA 2EGUA 3F49S 4Q4DA 3S28A 4MICA 1XAIA 3IHTA 3X3HA 2YS6A 4FVTA 1Q5PA 4P3NA 3TZHA 4DF3A 2WMOB 1XRJA 1W36B 2XROA 5TX7A 3LX5A 2BY2A 2EZIA 3VV2A 3BYZA 2V7XA 4XUDA 1IN4A 4TYMA 2Z8ZA 2CFRA 4EJWA 1EVIA 3AOEC 4IHKA 4U9IS 4TZTA 4N0QA 3OIOA 1JG3A 4AN0A 1Z7YA 1WUIS 3BQYA 3EF0A 1CF7B 4KDFA 1IEVA 1UKVY 1OAOA 1POWA 4L02A 2J9FA 3ENKA 5DDIP 3ESBA 3PDCA 2ID6A 4GSLA 2V5VA 2P2CA 4LDZA 1ZRCA 4OXRA 2RGGA 1I94B 4F45A 1IOZA 4AY4A 5G4KB 1I2CA 1YJQA 4A10A 1BFKA 3D7SA 4WTOA 1RRPA 2Z6UA 3SXUA 4TQGA 3AI7A 4DIFA 4O5VA 4JSTA 1ZWLA 1EZ4A 3GOQA 1U63A 2UZ3A 4OHPA 3THXB 1TUIA 2W6OA 2K2WA 4X3OA 2FP4B 2GKOA 2P90A 3HBLA 5AIQA 3TGPA 3UGKA 2P8SA 1YA6A 1Z4MA 1I6KA 3HH8A 3L46A 1FDVA 1OIVA 5DNAA 1U94A 4A4DA 5LWQA 1OSNA 1EX7A 2BBTA 4BAUA 4HUQA 2FUEA 2IXFA 2ZCJA 3U0VA 1M2OA 1AF7A 1EUCA 1GTG1 1DWOA 2EJTA 3S3NA 5DM6F 5KHAA 2BVLA 1BCSA 2L19A 1UPUA 2H00A 4BFTA 3MAAC 4OBEA 1EFPA 4D56A 1DLJA 3X43A 4MW2A 3WYFA 3KP5A 3FSEA 2WWYA 2QAJA 2W6QA 2P2ZA 3BCUA 2FSIA 3ZBTA 5K3FB 5BPDA 4ME6A 2FE4A 3L1PA 4ITUA 3DOOA 5BSVA 4XFKA 1Z6QA 2H8KA 5KTRA 3GO5A 2ZZKA 4R4JA 1H2RS 5A2GA 1WMFA 1ZLJA 1IY2A 5JSYA 3JQ8B 1XZEA 2RGWA 1MJFA 1SU6A 3ZNPA 1X3WB 3RZOJ 1T1GA 5E1OA 3GN1A 4M6VA 3M6LA 1G21A 2BOVA 4Q7MB 2YDXA 3I39X 5CDHA 2J6HA 4C4PA 2MYPA 4JC5A 5HVNA 4J16A 2SCUB 4UHBA 5F5XA 4OLFA 3VPHA 5J5AA 4ML3A 1VPTA 2G70A 1CQXA 4M87A 4RK7A 2PKQP 3A2KA 1Z47A 2RGNC 4M55A 3Q5DA 1KC1A 2WIGA 2F67A 4PGMA 2X9GA 3S2WA 1DG1G 5DTEA 3HG9A 1VBMA 3BXGA 5AK4A 3DC2A 3O4JA 1WCMJ 3USCS 1X7YA 2I9PA 2WSSD 5L3SB 1TM5E 1YIJI 1HBXG 1XCOA 4MCIA 1DSSG 1VLHA 2CNOA 1ZAOA 4YP5A 3TP0A 3AKZA 4P3PA 3SR4A 1H9GA 4XOIA 1FUKA 2I8CA 5KYVA 3PT5A 4WD3A 4QGFA 2DB3A 2HQRA 1ZOOA 2H63A 3Q3IA 2HWYA 4C4YA 2FSVA 1B6GA 4MR9B 5LCXA 2Q62A 1T4CB 1J5XA 5FB2A 3DXYA 2HU8A 2J5OA 4N47A 3BL6A 4L9AA 2AFVA 2F5FA 4PZ0A 4WNCA 5J8FA 3G8CA 2CXPA 3H99A 1ECJA 4JJ4A 4HF2A 3LT5A 4PZLA 2BRUC 4HZFA 3TDUC 3GLGA 3IPLA 3O95A 1T8SA 3KP7A 1BIBA 1D0VA 1YW9A 3BTJA 4GOKA 4RZIA 2K5CA 1GV1A 1FDWA 4PTLA 1WIWA 2I1VB 3EXHB 2R7OA 2HK8A 2JGRA 1BFDA 4M3FA 2AA3A 1W4CA 4MLDA 2HQOA 4RJTA 3T1VA 2FEZA 2O8XA 4IR7A 2QX8A 3WLQA 4ZC8A 4OXIA 1W19A 3QFSA 5MFPA 2XUKA 1T9ZA 5J2UF 1S2DA 3E61A 3M4NA 4TQAA 2PX2A 2II6A 1H42A 1HTWA 1NNLA 4CM3A 3WWEA 4L8LA 1R4ZA 1KXJA 2CXHA 1Z28A 3D8RA 3TSWA 2G7HA 4QAJA 3ESRA 3DSRA 1FNBA 1H1TA 2FTKE 5FUBA 2CHFA 3ITKA 4YCDA 4ND5A 3FMFA 3R8CA 3MGKA 1XEWY 1WXDA 2EDAA 5ES3A 1K63A 1FBNA 2Q4EA 2FRDA 4F2HA 1GV5A 4NOKA 2ONYA 2FSFA 2EILH 4K9SA 4BJHB 1KOGA 3E0XA 3BHMA 4O2BF 3KXPA 4JX9A 3RTCA 3OZXA 2R1ZA 3DVAB 4IF6A 3D0QA 3LY9A 3KOZA 4OBWA 1V7QA 1KK2A 5AKXA 4ZI7B 1RPAA 1OB5A 3RTGA 4ZEWA 1U6IA 2OUKA 1NRJB 2ON6A 4EMTA 1E1RA 2DDBA 4KXVA 4PHCA 1JA9A 1FS5A 1MFPA 1V16B 4CQLB 3ZMTA 2AN5A 1N2BA 2D1QA 4RGUA 1ZNWA 3D4BA 4JP1A 1Q7RA 1J33A 2F9LA 3C1UA 4S3MA 1YR9A 1LNZA 2XKOA 4DCOA 3F7TA 2PX8A 4KDRA 3OZUA 1KDZA 2QM7A 3R41A 5AXAA 1RE1A 1L5NA 2WBMA 5KC9A 2B6HA 1R0XA 3DZ8A 4CU5A 5CA1F 3MC1A 2QEXI 3OYEA 4D3YA 1IULA 4YRBA 5EKSA 3QUCA 1XF9A 1ZH6A 3GLGE 5F5NA 2A4KA 4F72A 4P33A 2FUG1 3IV5A 3VFZA 3HGTA 3E5QA 4UUQA 1E96A 3BSFA 2VJ5A 5LU9A 2PMCA 4BNWA 3PC8C 4FJ1A 4X6LA 3K4CA 2JJ2D 3H5TA 1KHHA 3H7IA 3UJCA 5HS7A 4TRNA 4MGEA 1P3Y1 4L9NA 5KAFC 4I4CA 3AZOA 2QF7A 2VCYA 3BJIC 4DKXA 2BMDA 1RYHA 1QYWA 4F6RA 3KKZA 5DNDA 4DZZA 4QDTA 1P4GA 3O3MB 5GMOA 5DYNA 3F9RA 1WXQA 3NEPX 2SICE 3C1TA 4LV8B 3OFVA 3PLAE 3WMFA 1CDEA 2WHPB 3DB2A 1ETXA 2B4KA 2K7FA 5DTIA 2BFOA 3JZDA 2Q41A 1GKLA 4X8HA 1J9ZA 4HGOA 3WRXC 2H7CA 4RGQA 2H6EA 5ICFA 2WNHA 4QPQA 3L07A 1E2GA 3A14A 5AIAA 2YJTD 1J22A 3A1SA 3RKWA 5B58T 3KLPX 2OZ6A 1KONA 4HLCA 1X39A 2QW8A 2ZI4A 4IYJA 3D0RA 4QHSA 3M3YJ 4HQ0A 4K81B 4D80A 3M6MD 4TZKA 4LGWA 4DQLA 3HDQA 1Z13A 3KC2A 1W0KA 2FE1A 4PSDA 4LYGA 4N76A 2WPNA 2GCOB 4FCYA 1EBBA 4BDZA 2NVTJ 4ZYDA 1RJGA 3VR5D 3D0OA 1UHMA 5FWDA 4L0ZB 2C4NA 3A3YA 4S1WA 1SQ6A 3ECSA 2DWQA 4HDAA 1FU8A 1YRNA 1M0TA 4MDYA 3KOYA 3FXRA 1E1KA 1Y6RA 1PBNA 1SHKA 5A3JA 2J3JA 2ZU0C 3ELUA 1VYTA 1CEXA 2JIOA 4PG7A 3V7YA 3SZLA 3AEUB 5JEDA 3ZN1A 4US2R 4IOMA 1MGTA 3MCUA 2WU1A 4DV5B 4GNKA 2QQ0A 2L0XA 3CP8A 3BRSA 4FTWA 2XJ4A 3EGIA 1S29A 4FR2A 3FWNA 3IVCA 2CGEA 5GONF 1B1BA 3B13B 3REGA 3PXAA 4GZ6A 4BNIA 2OD5A 1ZNQO 4O59O 4ZCIA 2XGMA 1QH8B 1KP2A 1P19A 4RAFA 3ZQ4A 4G4JA 4MXDA 4V1CB 1CQZA 2WJGA 3FMRA 3IT2A 3G6EI 2X3UA 4A6XA 4H4EA 1U8XX 3ZGZA 5AR1A 1THZA 3D6MA 2XE4A 1T0HB 1HPLA 3OOSA 1YIDA 4QATA 3WWOA 1H1DA 3LSYA 4F2GA 5IXJA 3A0UA 2Y68A 4HG2A 5AXBA 2ZB7A 4B83A 4WK8F 1ZM3A 1FYLA 2ZRIA 4HXEB 5C4IA 5JO0A 5SYAA 4IJ5A 5EMJA 2W2TA 4GHWA 3GVXA 5C8YF 5AW1A 3WHKA 2RGVA 2QV7A 2I2DA 4JL5A 2IP1A 4U88A 3O8BA 5G40A 2QQEA 3DU6A 2K02A 4LJ8A 1MJHA 3ED5A 1G4AE 4IPTA 5M5YJ 1QG2A 3C3EA 3E9QA 5T57A 4EGJA 1C9DB 1P2BA 2RHWA 5EG0B 1WBDA 1TCUA 4LI3X 4RD0A 3DYIA 4ZMRA 3WO0A 2YQZA 5I8PA 1OPCA 3HVHA 1Z5PA 1SXIA 2PKCA 2GEDA 2ZPTX 2CMHA 1NDHA 3UO8B 1N2SA 3C7AA 4Q3KA 4XDGA 2IBTA 4FWTA 3VNAA 2AQKA 4JP2A 3HCPA 1UBUS 3HPQA 4V0OA 1G4UR 4E15A 3GGCA 1EU1A 1NW8A 2WUDA 3TECE 1I2ZA 3BBLA 4C4TA 2ZXUA 4N0EA 2PY6A 1Y33E 2Z30A 1EX9A 4A8PA 4E5KA 4NBLA 3KFLA 3KEGA 4K9KA 3V8MA 1J56A 2PXCA 1Z36A 1X7WA 1GTMA 3VSLA 4WQMA 3FKJA 1CYEA 3B70A 2XEXA 1CUFA 3D02A 3NARA 2DUUA 5IT3A 2GIZA 4K6HA 3D0SA 2NXWA 4F56A 1JLMA 1N5JA 2FPSA 3QF7A 3CNEA 1IMJA 4PRZA 2J6IA 3LFUA 5FKJA 2IV7A 4Z4QA 5AW9A 2FN7A 5ICSA 4NC9A 3UUGA 3AJ8A 1T2UA 5IT9A 2QVOA 1E5TA 4D3ZA 4B82A 1PUFA 4CYMA 4YFKF 4RACA 4KDCA 4X7MA 1QNFA 4NBSA 4W63A 4GP9A 4LIVA 2H1OA 1NY5A 3TTXA 2BTQA 1I1OA 3KPUA 1KFKB 1F8YA 4LS3A 2FEXA 2C7QA 2BUBA 2HGZA 1JYSA 2JUGA 4IIJB 4TRRA 4MB2A 3DVQX 4AO8A 2YYZA 2G4LA 2CNKA 1B8NA 3OTGA 5IUKC 1GNPA 4Z4CA 3NWBA 4IP0A 1PGQA 4ZT7A 4M7PA 2JLRA 2QQ8A 3OLWA 2FBIA 1H94A 1WETA 4HYTA 5H70A 2GHTA 1VC2A 4G84A 3HGYA 1QG4A 4OU5A 2YWEA 5H3CA 2ZULA 2WF9A 1NXPA 4LZLA 3I30X 3ZV5A 3A36A 4KZPA 3SR0A 1ZG1A 3PJEA 2EJUA 3CG4A 3TZKA 4MGIR 1OWNA 2BGLA 2B99A 3B6AA 2BMJA 1I6XA 4D02A 1PQUA 1U1DA 1XD7A 2JGMA 1JKJA 2G28A 2HW8A 5A06A 3DDZX 3G7NA 2YWFA 1B42A 3HB5X 1UANA 2EIMH 1P60A 1ZIOA 3UICA 4IXDA 3V4PB 2J33A 2C07A 5BNWA 1SFOJ 3DE4X 3G1UA 4TV9F 2IHJA 4FT2A 1QIHA 3MGGA 3ORQA 1B3RA 4X97A 4F7DA 3DO5A 1MG0A 3N8DA 4GQBA 1X87A 4J0FA 2KPMA 2C4MA 1LW7A 3TLCA 3L7BA 3RNOA 1XVTA 4ESJA 4BBPA 3NDPA 2PLFA 2AG8A 1GGKA 5L7WA 4FE7A 1Q1NA 4MPJA 4Z0PA 2GAFA 4WXRA 3GJ3A 4TWRA 1T9DA 4R1SA 2TRSB 1UMKA 4E33A 4CMIA 1OVMA 4KAAA 4J2HA 3K71B 2PUCA 4NZPA 3K0AB 3K4BA 1M6EX 3AB7A 1A4XA 2RGUA 5EP3A 3PNSA 4F7WA 5CA0F 1FFSA 3JD3A 4JKIA 3FRJA 1W8IA 1X1CA 1L6IA 2LIPA 4DV7B 3ZRGA 2I6QA 1CE8A 2CMGA 1NW9B 2GF9A 4JC0A 2ODWA 4B1FA 1DGQA 2QP9X 5BWOA 4IRGA 2M1XA 4QTTB 3QPLA 2COEA 3M6FA 1WPGA 3WBFA 2G3YA 2EV6A 3H18A 3FOEC 1G2OA 4EECA 1HT0A 4LYEA 1XRLA 4MNTA 4AW9A 5DCFA 4Z54A 3UH1A 1DAFA 3U7QA 1LSSA 3FNGA 1JTYA 3D5EA 5IYZA 1E2MA 3RQIA 2IU0A 1M2EA 3OCUA 2VUIB 4EMBA 1A9YA 5IKPA 4R68A 1AKUA 2E5LB 4P0PB 1VI6A 1PFKA 4WE3A 2NGRA 5A9RA 2QTLA 5TJ9A 3HSSA 3NGMA 5KWIA 2J87A 2C03A 4W8HA 1YU6A 3HKBA 2YJ4A 3E8SA 1RAHA 1XD9A 3PQ2A 3ONNA 1L8OA 2E1MC 1PWHA 3AUKA 4A23A 3MS2A 3GH3A 2VDJA 3W79A 4R2JA 1Z7EA 3K9TA 2GCPA 1U5TC 2CBZA 5FAXA 3G2LA 4KWEA 2FWMX 4GL2A 1HEUA 3LP8A 3O9MA 2XMDA 1TTHA 5KOHA 3VR4H 4RC9A 1VHWA 3RPUA 1VKZA 3X1MA 4DUZB 5LP6C 5CXSA 5LL6P 2ZVDA 3TWOA 1AUVA 3EULA 4PCAA 1RIFA 4R1UA 3GTQJ 2HWKA 2XQIA 4YUVA 5CLJA 5HRCA 1ND6A 3WGKA 1ISSA 4UUAA 3ZWXA 4OQEA 3MLEA 1SANA 4B4KA 2HJHA 1A8QA 4DBRA 1USWA 1CQIB 4S05A 1OUMA 4N65A 2LGJA 3CMEI 1CJVC 3OZDA 4NONA 1Y6QA 3EQ8A 4CMAA 4KLAA 1JT9A 2YZKA 3R4VA 3DFFA 3RJZA 3OD5A 3ABUA 1D1BA 4ENTA 4QGAA 2WIBA 2UXCB 1EUYA 1X0VA 3T95A 5ENDA 3VI4B 2HJRA 3MINA 1Q7GA 3Q1KA 2E35A 4M9CA 3GXBA 1QHNA 1R5JA 4ZJYA 4K86A 2B1JA 1AT1A 1L6RA 1HL7A 1YB7A 1JR3A 2IT0A 2HEIA 3G88A 4JJ8A 1GNRA 2Z6VA 2C4WA 1UPTA 1XF1A 4B79A 4UD2A 1KI1A 3NNDA 4RGBA 1VP9A 4OQXA 4LRQA 1ZUHA 4QGBA 2YX1A 3FFXA 3LSJA 4HDMB 3TI7A 3WWCA 1KDYA 1Z05A 4P3OA 3JSAA 2JCBA 5AK5A 1M33A 1RAIA 1HNWB 1I4DD 2E82A 3E81A 3CZ6A 2CEAA 2E89A 1T4DA 4YP1A 1VCHA 4G23A 2QMOA 3IJ5A 2A6PA 4RQAA 3WKDA 1VRWA 2JH3A 3LCCA 4JHXA 1X42A 1HC8A 5T4BA 1QTIA 1Q3HA 1RXVA 2HYGD 5IDVA 1G7RA 3CUYA 4KWCA 3AJ9A 1NZFA 1KZ7B 3PUIA 1FFWA 4UD6A 4Y0AA 2MSDB 4KAXA 4PCVA 4MA4A 3LX6A 3L09A 3U4QB 1RYBA 4JEHA 1THGA 1XBTA 3OOWA 3M34A 2DHRA 4QT4A 4LB5A 2OTJI 4M9SA 1XPOA 1V8OA 5GAGJ 3QW4B 2XDAA 5IBCA 3C1AA 1MJGA 1R18A 4EHAA 1RIOH 4DIDA 5KU7A 1AJEA 4WCFA 5CIQA 1PJLA 4JVMA 1HMYA 4Y98A 5DYWA 4DMLA 5LKRA 2CCGA 4OG2A 4TMKA 3QKTA 3TQSA 3T6KA 3OYKA 5BVHB 3EXG1 1NT2A 5DGTA 3ZY3A 1PQYA 1L5VA 3CH4B 4E7LA 3T9EA 4ZDOA 4KGVA 4BAZA 4PQGA 5M5WJ 2LKCA 2LNDA 4P9UA 1YBAA 2OD2A 1OAOC 4Q1EA 3C2QA 4EB8A 3WWPA 3ZWOA 3T99A 2ZTSA 4WESA 5E6UB 4FOPA 4MUKA 3UJPA 5JJKA 4DDKA 3RD5A 2Q6TA 3D2LA 4RGYA 3EPRA 4I1IA 1TVEA 2H1FA 5HDBB 4MK4A 3PU6A 1FRFS 4RZXA 3P1JA 3EC7A 5JMPA 4MFEA 3TZEA 1CF4A 2OORA 1NW4A 4LOKA 4LCJA 3SLGA 4L5YA 4QRHA 4JL6A 2C5BA 3O8CA 1TRHA 2ODNA 4L8FA 4JIGA 2IS4A 2ISSD 1K3UB 1IRXA 1JR3E 4RTLA 4QEKA 1EWTA 5FWXB 3UMGA 2WJYA 2NVUA 3FRIA 2QLFA 3E9MA 3GZ5A 4HQKA 3C1OA 2HZDA 3WRYA 3N7TA 1ULBA 2O1EA 1FE8A 2IOQA 3AHEA 2OYCA 2Z2JA 5CVJA 4JZYA 721PA 4KQJA 3FI9A 4RH3A 3MWLA 4MO7A 1SBHA 4GS5A 3HGMA 1CD5A 3EISA 2WD9A 4JGGA 3CO5A 2DJIA 4Y1GA 3F23A 2C5GA 4KYWA 3NDRA 4H4DA 3SYNA 1GNLA 1AKHB 4OVKA 5IDYA 2HU7A 2CDRA 4OK3A 3ZQKA 1T56A 4L27A 4GMGA 1JIQA 2D5VA 4CCMA 2QX9A 2CCKA 2Q5OA 4M1YA 1S8NA 1BGXT 4CCSA 5J43A 2HZBA 1C9MA 3A1WA 4XJTA 2VBCA 4PLGA 2B21A 3WLHA 4CCNA 4ZVVA 4GGMX 1AOXA 2E1PA 1YOVA 4WLEA 3UFXA 2J5RA 4G25A 2HRRA 1L4MA 3ICVA 1Y80A 3X1JA 1NLFA 1MXFA 2O2HA 5KVQA 3PEYA 2PZ8A 1MRNA 3CO0S 3S1RJ 3M6IA 4GOJA 3JALB 1Q74A 2Q3EA 3ZHXA 3M6AA 4J16C 1AN0A 1PYDA 2ERXA 3TSZA 3BXFA 2NV6A 3G2PA 5C7LO 4EA6A 2L2OA 3ZBQA 2WKRA 3GW8A 3LCMA 4GR4A 5FI3A 1YTLA 4FYJA 3NXKA 3PZRA 3OEYA 3M4XA 1RWWA 2R7QA 2EP5A 4IGFA 4EPWA 3TLBA 3ZHRA 1BXGA 1H9AA 4I2VA 1SC7A 3BRCA 4RCZA 1FYEA 1J0DA 3BUSA 3MMYB 3BWXA 4CODB 2Y2UA 4RNCA 1WJGA 2GZHA 1BI0A 3U1KA 4COOA 2HY7A 2QW1A 2XAQA 1VSQA 1AS3A 3RJMA 3P2MA 2FSVC 4BO9A 2DT8A 5K5RA 2ZSUA 3NEJA 3NJ8A 4GDMA 4DNFA 1JE1A 4ZC1A 2GEJA 4U0VA 1RQ2A 2YVUA 1JIKA 3H8SA 1G5RA 1HYHA 1YRBA 2STWA 3LSGA 1U90A 4YRPA 1H2ZA 4JK1X 2HYDA 1SEVA 5BNGA 3MSCA 2HR1A 5CAEB 1F5TA 4AS2A 4D8YA 5ITZB 1B8UA 1OBOA 1FOYA 5T8KA 3L1UA 4FONA 1GXSA 2R7XA 1PG0A 2MG4A 5EPOA 2F4IA 1H2WA 2N0SA 2XE6A 1WOYA 3A03A 1V1MB 1GM5A 3S29A 3ZVNA 2NXCA 1QK5A 4QOSA 3AG6A 4DABA 4LSMA 4EB3A 1XRMA 3KD2A 5GADl 4F1KA 3G9TA 3I2HA 2XCOA 1VQ7I 2C04A 2HHCA 1FZQA 5DBHX 4DCJA 3CCUI 4MQVA 1A7JA 4QTRA 3HJBA 1WABA 1I7SB 4HNTA 1I3CA 4NNJA 4Y9TA 3A1FA 3SY8A 3AEZA 1KOLA 2XJ9A 3G7SA 3RAEC 5TRTA 2I8AA 2CYBA 3GBPA 5CP8A 5AW7A 4MKIA 3A3OA 5ITVA 3A6DA 3TUJC 2KISA 2PO7A 5BT9A 4BNFA 5EIEA 3DEIA 3L49A 3A31A 3QP9A 3II6X 1WDKA 2VF2A 1GZVA 3THRA 4C89A 2W6JA 4EUSA 2LW7A 1N0UA 2BL4A 2EQAA 3INGA 1Q91A 3G5LA 1U80A 3Q8MA 1UG0A 4ZYAA 2IYTA 1P0FA 3FHLA 4CIYA 2Z4RA 3PNOA 4LQCA 1TC3C 1YVPA 1XSVA 5JNVA 2UZ0A 2IYFA 4KTTE 4NIMA 3H11B 1HLVA 1L7AA 2OR3A 1E9DA 4HAWA 3G1WA 3H65A 3R5FA 1ULTA 2AJBA 3PHBE 4IQGA 1ZSYA 3ETLA 4LDAA 1PFGA 4KYUA 4XDHA 3OMWA 1B0ZA 2O50A 2AIRA 3A6GA 2VH1A 2RMKA 4RAYA 3TBHA 5BOSB 4PDKA 1PCXA 2GYWA 2W6ID 1JZTA 3PQEA 4UU8A 1BVRA 1VQ1A 5IYCJ 3OQ6A 4XX1A 5KQLA 2XCIA 2D59A 3MT0A 1Z7BA 3QJGA 3BM5A 1U9JA 2XEDA 2O57A 3QLTA 3MD2A 4BUPA 4LTDA 4IJMA 4DMKA 2NU8A 2R8PA 1DIHA 2XAGA 4NYIR 1ZW6A 5K7ZA 1XKTA 2CO5A 2F5DA 1Q0SA 2XVXA 1C8KA 2W42A 3CY6A 1FU4A 4KR2A 5KSZA 3FHZA 1BR2A 1GNVA 2IGOA 4J0KA 4F04A 4RTRA 3KHUA 3LXXA 5FLVA 5TF0A 3OEEA 2QRPA 1UC9A 3S16J 2VPQA 4PS1A 3CEMA 2PWAA 2N1MA 2A94A 1LPOA 4DBVO 1S2LA 1FUYB 3DG9A 1E2DA 3CLSD 3JQ9A 2OCIA 4QOJA 3OM8A 2VHXA 2O8EA 1Y9EA 1Y8RA 2HUNA 1IYZA 3SPXA 2OU2A 1ORDA 2XOEA 1ZJ6A 3T15A 3GFMA 5BNZA 5I4BA 4PAGA 4C29A 1O9HA 3URMA 1X7ZB 1XTZA 4YJHA 4EKNB 4F60A 4EEFG 4HDKA 3QELA 2PRKA 4NAUA 3WADA 1EA5A 3UPDA 1AGNA 3RT7A 2AI2A 5JZSA 4IHWA 1NSTA 1XN1A 1YR1A 1PU2A 5FLEX 1KQ0A 4B8XA 1PT7A 2AX3A 3WBKA 4ZVOA 2WAQN 4J9UE 1IXRC 1ZJWA 1UT6A 1U0JA 5FQNA 3CWZA 4NPAA 3J7AO 1TQPA 5AM3A 2MD5A 2O19A 1WF6A 2M34A 2GSDA 4BVEA 4ZJUA 3D4PA 1E4OA 1HW1A 1SUWA 1DX9A 4L7VA 4OF4A 2GZSA 3LZCA 1W5SA 4UFNA 4E14A 2IPOA 4FU0A 3QYJA 2Z8YA 4H0NA 2AJDA 4JEIA 1PVVA 2PT7A 5HKBA 4EVQA 1SUSA 2G9VA 3SZGA 1C4OA 2Y0MA 2I6UA 3ZLTA 2QGUA 4BPRA 1R3DA 1U3CA 4QO7A 2BE5F 1VTKA 3T4PA 2ZI3A 3MM4A 2Z6AA 2DPLA 2A30A 1AO3A 1U8YA 3ROUA 1TC2A 4R1HA 1AQUA 2YN0A 1YDMA 2J9XB 3CE9A 1IHUA 2I4LA 5D2CA 3RAJA 3OIGA 3BB3A 3EJWA 5THXA 4LF7B 2LR0A 5ECWA 2XZOA 1K86A 1EG2A 1IHYA 5J2TA 4BX2A 1J1ZA 2ZSAA 4NCHA 4YP7A 3HU2A 2NTEA 4HH4A 3U4CA 1D7AA 1P29A 3MMXA 2L9SA 4K9DA 2QTFA 4I50F 2R86A 2CY0A 5EVJA 2Y6VA 3HCOA 2OZEA 2ACJA 3OF5A 5IY5H 3CZAA 1GA1A 4U7TB 1OREA 3NOQA 3W2WA 1XA4A 5KYNA 1P4RA 5B7PA 3EGOA 4TRMA 3NWTA 1WUTA 1WBJB 2WAFA 3LAWA 2K86A 2A5LA 3DTEA 3RS4A 2JVGA 4GSYA 3HQ4O 4B6JA 4D6XA 3AY0A 2ZSJA 3FUVA 5GP9A 2WJIA 4MEYF 3GI1A 2AOTB 3EPLA 2HI3A 1XTJA 1WJEA 2XB5A 1ADCA 4ACBA 4CICA 3MCTA 3JRHA 1NLYA 3UHFA 1Y8CA 3FX2A 3MMSA 2CFTA 1QIFA 1W29A 3OQOA 1DINA 2Q1SA 2Q1WA 1BD3A 5DJ5A 3RR2A 1U31A 1JUDA 3ZGXA 4YFYA 3NHZA 1BO6A 1MBGA 3G0BA 4ZXPA 2Q29A 3CX6A 1WU8A 2I2AA 1XQ1A 2AB0A 3L9FA 2BV3A 2GAOA 2ADMA 1A4UA 1C3JA 1RVV1 1S89A 1E62A 2B2CA 2NUPB 3B85A 4W1RA 1XWIA 2B0LA 1K9VF 3HOSA 3JXEA 2ONKA 4F06A 3P2YA 1W8DA 3OZVA 5K8IA 3IESA 2Q5HA 3HKDB 1O0CA 2F1OA 4RK4A 1VOTA 3LKZA 3WMGA 4BB6A 3GRZA 1FFYA 2K4JA 3GZJA 4RABA 1BW5A 3KLNA 2Y9YA 1VJCA 1EDZA 1MH1A 2J07A 1W5FA 5LWHA 4XN0A 3CEHA 4J75A 4FBMA 2ME0A 3M6UA 4P31A 1QF9A 4B45A 4REQA 5JVDA 5FKLA 1J24A 4AZVA 4MAMA 1QVAA 1XKQA 2QRZA 3E2IA 3KS9A 4F3YA 2CLMB 2YQ5A 2LCQA 5L7YA 1UBLS 2ZYDA 5K1ZA 5TEVA 3RHFA 5AUPB 1MF7A 1E7RA 3A7EA 5KTPA 4YMUA 1G3YA 4GPIB 5FOVA 3NLLA 2B0JA 4ZYZA 3UATA 2COKA 5AOAA 2Q99A 4GPBA 2R25B 4RAQA 2PD3A 2ZVJA 3DV0A 4WKNA 1MJBA 4I5IA 3EMDA 4XX0B 4XSXF 2WT8A 4H0CA 2OHOA 5A3SA 1FMWA 2ZUUA 3NV7A 5AM5A 4TXNA 1OBFO 1D4OA 4M71A 1K2VN 3G02A 4OSPA 4HBLA 3H6KA 3KTDA 2WWVD 2D4AA 5B2ZA 1E5QA 2Y77A 4UHFA 3SVZA 4EPYA 4Q82A 4D45A 2FZLA 3CPSA 5JFRA 5DXAA 3RYRA 1JPNA 1Q16A 4RZQA 2QV0A 2XT9A 4YMVA 2ZRHA 4JLOA 4OIPF 1HYGA 3IMCA 2CW8A 2WVAA 5DM70 4BRUA 5D1NA 1P18A 2PX6A 1NY6A 4AYBN 1MB4A 1AXRA 3FRHA 1IY1A 3KV3O 2XOXA 1EXWA 3Q5EA 2ZRQA 4PR0A 3QE2A 3V4VB 3V8QA 4XMYA 5I5GA 1JTEA 4GM1A 5AW3A 1MH3A 1P1HA 3F3SA 3A9VA 3GELA 1I3LA 4NU5A 1YKFA 1GILA 1MB3A 4IM7A 3P96A 3W90A 4W5OA 3R5HA 2CF5A 1DBSA 3AWIA 3DCIA 4LNHA 4KQ9A 2OMKA 3T5CA 3DS8A 4RSHA 2ICWG 3R7AA 1OWPA 3QVGA 1WCV1 3M1YA 4G0NA 7MDHA 2N75A 3LKBA 2CXXA 1SAXA 3QVXA 1BWRA 1C4KA 1O96A 5DSXA 1TA0A 2XNDA 4L0MA 2JC3A 2BFDB 1R0LA 4QDZA 4WZBA 4JVSB 1H1LA 3AKCA 1JBKA 4FDVA 4Z7OB 1T3ZA 1RKXA 4MKHA 1CEYA 4FUTA 4WZAB 2GS9A 1I24A 2CYYA 5REQA 4TTVA 4UAVA 3Q3JB 1OOEA 2EARA 3URKA 3L6DA 2I65A 1RESA 3ROKA 2MMCA 2ID9A 2YWHA 4QX6A 4X94A 3ODGA 2FGKA 2OCKA 4X7BA 1JAYA 3CVYA 2BFEA 3N1UA 4NZYA 2HX1A 4IO9F 4FGJA 3IE2A 1H5NA 5L3QB 4HW0A 1RXWA 4G8BA 2X14A 1A88A 2PRSA 4EYQA 4RB1A 3LPAA 4UU1A 1AGPA 5KU1A 2M9HA 1YVDA 2HDOA 1MQ8B 4I1VA 3TAHA 1LFDB 2FEMA 4MHGA 1UWLA 1F4PA 5T6BA 1U9IC 2O3JA 3NT5A 1RP1A 3K70B 1FIUA 2CK3A 1Y5IA 5K9ZA 5FF9A 4R01A 3DM5A 2BLLA 2VDPB 2C3PA 3EIOA 4L2IA 5FEUA 5KBYA 5M7EA 4EKIA 2PSJA 3NW9A 3LQRA 1LFUP 4MUHA 3TQIA 1HFEL 3Q10A 1IU9A 2HHLA 4K88A 4R9VA 2W37A 5H0IA 2ZWVA 1JH9A 2GBCA 2R7RA 4EM6A 4GE0A 5LP1A 4PJ0C 1CJSA 4H7EA 2FH5B 3FW1A 2GPWA 2FU5C 1OCCH 1ATIA 4YRIA 4QPNA 3U09A 3CDLA 3GTOJ 1U7DA 1I5OA 1A9SA 3QPVA 3BK7A 5L3GA 1KI2A 2OV4A 4BBAA 2JK3A 4WVFA 4V0LA 2RJNA 3ZKWB 4BFWA 4F2DA 4BQPA 3KSRA 1Z3IX 1E2PA 5E8GA 3D1LA 1CF7A 1P73A 3ZWMA 1UAGA 5FDFA 3OC0A 1TT5B 2Z2IA 2PSHA 3BFKA 1LDYA 5G4KA 3LC1O 4WZBE 2M0CA 3ISPA 2Y0PA 2HQAA 1HF3A 2Y9MB 6NULA 3DP9A 2CJFA 4RTJA 5FPPA 4UUPA 1X77A 3QWFA 4E3WA 4L4YA 2XSJC 1YL6A 2BGJA 4Q3OA 3THXA 2QN7A 5CT9A 1KY5A 1CX9B 5FKMA 1FQWA 1NVGA 2RH5A 3FB4A 1NI3A 4IWYA 1PQ4A 2QM3A 4FUQA 5IFLA 5FJ8J 3H13A 1LW6E 3DHVA 5BR7A 3RDIA 1ZJZA 1U8CB 2DHDA 3E05A 5LQRA 3ZH2A 1LWOA 1RU3A 3T8YA 2JLXA 4AJ2A 5C0OE 2YV4A 3KSZO 3ORFA 2KZGA 1IG7A 4OXKA 4KR6A 4RKWA 5KJCA 4L8WB 3ZV6A 2CQXA 1OW3B 2G09A 4U6SA 1QGPA 2VNHA 2XPUA 3U4AA 1OTYA 1IBCA 3CXRA 5I51A 3E3VA 3K2EA 1RM3A 4MV7A 1O77A 3T7RA 2M8EA 2HB6A 3VAZA 4OMFG 3A6LA 1QTNA 2QWWA 2LRDA 2Q5LA 1L7QA 1EFRA 4EZIA 2HA3A 3O8QB 3FVRA 1XI2A 1U7PA 2XTJA 2Y05A 4DT1A 3G89A 2OC6A 2P6UA 3KQKA 3H86A 1U0BB 4ZN6A 3O4GA 1C9YA 4AP5A 5K8UA 1RBMA 3GUDA 3KOMA 4G97A 4AKIA 3TL4X 4Q9AA 2ZC2A 1R9MA 3EJ6A 4OP3A 3N2KB 1OXBB 1A2BA 1KVUA 3L1KA 1UKCA 1U7TA 4B2YA 2R7NA 4BNUA 1VECA 4F1WA 4WOPA 3V7WA 2J0VA 4PBSA 2FD5A 1BC5A 1LV7A 1J1IA 4HRXA 1GUZA 1ERDA 1FBQA 4WCFC 4TLDA 4OCZA 5A0FA 1C3LA 3GR6A 1WB9A 2O8DA 1A35A 5SICE 3EQ9A 3BROA 1P7ZA 1D1QA 5L3SA 2Y0EA 3K72B 1V1RA 1E66A 2Y99A 3RTDA 3WQBA 3PQFA 4YPOA 5H4GA 2PJRB 2UDPA 1AGRA 3NRCA 4ED9A 1ZFNA 3LYHA 4I4TA 3DOFA 1QB7A 3HNPA 2GILA 1D0XA 4E0BA 1RPTA 2YINC 3CONA 1BW9B 3V1LA 5NULA 5TQ2B 2DVMA 3NWOA 4UE3S 2AJLI 3OY9A 5DU2A 2ZXIA 3LNTA 2PKYX 1DJMA 4MS4B 3G7UA 2KLOA 1AGYA 3PPXA 3C16C 4AG3A 2WG2A 3VOBA 3O83A 1JZQA 4G3XA 2DBYA 1WV1A 1HT1E 3W5IA 4LZWA 2QA4I 1VP3A 5EUBA 1KFBB 2JT1A 4Y0NA 3HZOA 5LIRA 1OF1A 3VPAA 5DMXA 5H3LA 3FZGA 3C8DA 1CGPA 3R5XA 2PUBA 4PYIA 4WJKB 1VKRA 4NDAA 2DA5A 1KDOA 3LOCA 2OHXA 1RNLA 4COKA 1N57A 3EXHA 3WRYC 1DXYA 4IO1A 1Z38A 3OPVA 2VATA 3D4IA 1JG7A 3OUUA 4G7ZF 1S5LC 4ND4A 2Z3VA 1FS6A 1ML4A 4MW5A 1XD2B 4NSNA 1IE3A 1YYVA 4FYWA 2ZUCA 2A14A 4GMDA 3SLKA 3LLCA 3QVWA 4UVGA 3AINA 1OLOA 3BTUA 5BO5A 2J3DA 5D3KA 3GU3A 3PSIA 3GDHA 3G79A 4HGRA 5JS2A 3PT9A 4B47A 3RC8A 4C0JA 5DI3B 2WYHA 5B6IA 2HSDA 4FYPA 1V8FA 2DBRA 1IM5A 4I7EA 1WUKS 3COZA 3QQAA 5TNXA 3EGCA 3R0AA 4KJXA 3QBDA 1ES9A 2NTVA 3NEAA 1NWCA 1G21E 3CRVA 3NAMA 4D4KA 1ZGCA 1QU2A 2PN6A 4V2IA 3B8EA 2X1HA 1KJIA 2XSZA 3A28A 1EMDA 1XS9A 3DBLB 2QORA 3DAHA 4P4SA 3ULKA 2FMXA 3DVAA 1N8KA 5AVQA 3U3MA 3U39A 1AS0A 4N8DA 5LOVA 1USGA 2NVYJ 4AZTA 2JJ7A 1RI1A 2H18A 3TOSA 1N7GA 1EUZA 1LBEA 3MZ8A 3I5AA 2ROQA 4PXYA 4CQLA 5K3SA 2CXNA 2R8RA 2A92A 3P0HA 5IT4A 1RJ9A 2QSJA 3C3JA 3V2IA 4EUFA 3AEYA 1EH5A 3ND5A 2Q7OE 2GZRA 1DUIA 4GBJA 3M4OJ 4ZQIA 3I8XA 1TJYA 2FEPA 4PTYA 3U3JA 1SFKA 1CUUA 2DHQA 3I4CA 1NONA 2AS0A 4UUSA 2IEZA 2X4LA 4GU5A 3DAOA 2G1UA 4KE6A 2HUPA 4ZT2A 4GNRA 1QRAA 1Z63A 3CUTA 2NSJA 1QAQA 4OSEA 3CZ9A 4B3CA 1Y6GA 4ERXA 1JHXA 1K7EB 2P9YA 1E61A 3PIDA 1Z7LA 2AK2A 4AT1A 4WECA 4CL2A 2CLLB 1F0PA 4FGZA 4XKJA 1VYUA 2BSXA 3RWOA 2OUMA 1Q15A 2FW9A 2VQ3A 1BOBA 4WXYB 3A6FA 5T8KC 4YRQA 4LN1A 2X0JA 1GZ5A 4RS3A 3KR1A 1IIRA 4A7PA 4DLWA 3IC7A 3NPAA 3W8NA 4YGYA 4FDMA 4MYSA 1KO7A 4KRGA 4JC8A 5JLJA 4ZZ3A 2IP4A 4CSWA 1TWFJ 2WF6A 2O2YA 4YCBA 3DQPA 4MLZA 4RL4A 4QXQA 2OECA 1D1SA 3QPSA 1MGOA 4IHJF 3AEQA 1T0PA 1VCNA 2IT1A 2ORYA 2ZMEB 1GTL1 1ZD8A 2N8GA 2CEKA 4IKOA 5TQ0A 2AFHA 1ARZA 2YOFA 3FNBA 2Z2SB 1AHNA 3U3DA 3ZGKA 3CLOA 5C53B 4URZR 1C8LA 4HSTA 3LSPA 3AFNA 4UY8I 2QSFX 2AJ8A 1UDBA 3AVVA 2WT4A 4PNZA 2VP5A 5AM0A 2XH8A 1E2FA 2MSEB 3PQ6A 4CIAA 3KLMX 3ILVA 2CQKA 1U6JA 4HB2A 4ZKEA 4DEVA 5E95A 1PV4A 1JDBB 3UQYS 1KVSA 4DDWA 4C2MJ 2R6HA 5FOTA 5CVTA 4D9JA 3CJRB 5D5VB 1DOHA 2Q2EB 4LJ6A 4YP9A 5JFOA 3S2FA 5KAPA 2VO1A 1ENZA 1ZL2A 4I55F 4JWKA 1K08A 2DQZA 5EOVA 5B64A 1Q12A 5AMXA 4N0PA 1QTRA 5H2FC 3SWWA 2VXBA 1SUPA 4I5EA 4NMWA 1QHHB 4HSRA 4RF3A 1TD9A 3LT4A 3CUUA 3NANA 4CQMD 4AJ4A 2ZANA 2CUKA 2QN8A 4DGWB 4OQZA 1LX7A 3I64A 1I7PA 5BUQA 4Y2VA 4UMVA 2A0FA 3NBMA 4IWNA 4IGKA 4N3CA 1C30B 2BJWA 2C00A 1PJAA 3IOCA 2QPLA 3DE6X 1Y9JA 5IW8A 1JHQA 3NTOA 1NYQA 3PNYA 5A5VA 3LS2A 4BVKA 3BMCA 1N9ZA 2HDDA 3B1FA 1E92A 5GAEJ 2BBYA 2PWBA 3H1GA 1M54A 2JGDB 2MC3A 1KEZA 1DC8A 1T25A 3CZ5A 4YIIA 2O7QA 3FTCA 3AX6A 3IMKA 1Y5NA 1P5JA 3GP3A 3SDBA 3OZRA 5FUQA 2FFAA 1OX4B 2XRNA 1R1VA 4PJMA 4L9VA 3SQWA 1BNCA 2A78A 5A3RA 3R7LA 1TIBA 1YBVA 3JQ9C 3ZHZA 1C7RA 3T5TA 2PZBA 4QM7A 2IEYA 2IEDA 1B3BA 2NPOA 1Z1DA 4KYIB 2QZJA 1W9HA 1PWEA 1OKRA 2WP0A 4GKJB 5DLDA 2OV1A 4WDRA 3AG2H 3RKSA 4KUEA 1CUGA 1BH6A