4GO1A

Crystal structure of full length transcription repressor lsrr from e. coli.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
297
Chain Sequence
b'EQGMCEEEQVARIAWFYYHDGLTQSEISDRLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYETQLRRQFSLQHVRVIPGLADADVGGRLGIGAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIGQLNAACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAADVAIVGIGAVSQGEQLMIGRKGAVGDILGYFFDAKGDVVTNIKIHNELIGLPLSALKTIPVRVGVAGGENKAEAIAAAMKGGYINALVTDQDTAAAILRSLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator LsrR
molecule tags Transcription
source organism Escherichia coli
publication title Structural Basis for Phosphorylated Autoinducer-2 Modulation of the Oligomerization State of the Global Transcription Regulator LsrR from Escherichia coli
pubmed doi rcsb
total genus 92
structure length 297
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04198 Sugar-bind Putative sugar-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4go1A01
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4go1A02
2STTA 1DDNA 2H6CA 1XGSA 1USSA 3VEPA 3WTTC 3WTZA 4Y15A 3BY6A 3R61A 1C0WA 4GO1A 3M1EA 4M8LA 4RAZA 3L7OA 4ESBA 4TM7A 2G9WA 5K5RA 3KEQA 5L3FA 1UCRA 1STZA 5DD8A 2A07F 4K2EA 1T2KA 3ENQA 2O8XA 2LDUA 2ETHA 3HOTA 1D3YA 1SD7A 3IHUA 1AOYA 4Q5SF 1EH7A 1FC3A 2P5KA 3HHEA 2M87A 1MKMA 2V1XA 3ML6A 2XVCA 1LK7A 4L4ZA 5CVJA 1IF1A 2BYVE 4YG2F 3VODA 1T6SA 1A04A 3ABUA 5HDNA 3F21A 1TTYA 3P9CA 4BQAA 2OD5A 3F22A 4BYYA 3NRVA 3BXEA 4OIPF 2DTRA 3I54A 1R1UA 4KNYA 2MA3A 2DO7A 5E17F 3F8NA 2Q8KA 4OQQA 1RZ4A 1ZARA 2HQNA 4UUVA 4DQ2A 3I4PA 1REPC 2H94A 3B02A 5LHIA 1LB2A 1O57A 2X0LA 3I5UA 4HAMA 3I59B 3JTGA 2B0LA 4B09A 3WE3A 4EM1A 4ENNA 2G7HA 1B4AA 2F5DA 3TGNA 5J8CA 4L0ZB 2WC2A 2YSRA 4WXHA 3V8KA 1G4DA 2Q0OA 2OAZA 3K0LA 3E97A 1FBQA 2IRFG 1J5YA 2EV5A 5D4RA 1FZPB 5HJ5A 1QZZA 4FT8A 1PDNC 4PCQA 2OBPA 2OA4A 2F5CA 1Z05A 4P96A 3AAFA 5ERIA 3ZPLA 1ODDA 1W4MA 1XMAA 4XBFA 3L9FA 1ZAOA 5E8GA 4WXCA 3K9TA 5BPDA 4EV0A 4QWQA 2IA1A 2RGVA 3IXQA 4KA4A 4EJOA 3FMQA 2FMYA 5BMZA 2VBZA 3QRFF 3BXHA 1OMIA 1R1TA 1ZG3A 2JRTA 2RNJA 2O6GE 4HF1A 3HN6A 2O03A 3R0AA 2RVCA 1DEAA 2J5OA 1AWCA 4HV5A 2AS5F 2OZ6A 2WWYA 2OQRA 3J81Z 1BIAA 4IHSA 4KIGA 3TOBA 3L00A 4O5VA 4MEYF 1ZRCA 4E70A 4G7ZF 4G7OF 1NE7A 1S8NA 4I01A 2FMLA 2H09A 2NRAC 2Z3YA 1P2FA 1X3UA 1YW9A 4A6DA 4EJWA 3OOPA 5LHGA 1IXSB 5TJJA 2WU1A 3ZMTA 1J7KA 1JHHA 3ENVA 3HHHA 4ENJA 2YX4A 1XGMA 4HQMA 3MCZA 5L3GA 1G3SA 4ENMA 4GYGA 3GUDA 4LLGF 1Q1HA 3SHFA 4KDPA 1QO0D 2BBYA 4MQVA 2CQKA 1IUYA 1UFMA 4HQEA 2A68F 2VXZA 2QVOA 1B9NA 2PQ8A 4XSXF 2J0EA 2DAOA 1R00A 2R5FA 2VOPA 1HXDA 1WSUA 1O3QA 2UWMA 5BS6A 2HFHA 1G3WA 4IHTA 5DCMA 2EFOA 1SMTA 2VBWA 2R7DA 2XAFA 3O2PE 3OV8A 2W85A 1U5TB 1S29A 1LDDA 3F8BA 2QQAA 1TLHB 2UXXA 2XIGA 2OQGA 4OMYA 1B6AA 1IN4A 3WODF 2ZFWA 3RYPA 1XN7A 3MQ0A 2L54A 3T0YA 2WTEA 1J75A 4CICA 3ZQ7A 3GFJA 2V1UA 1MZBA 2QLZA 1U5TA 4L0YB 3RPUA 1IZ1A 3KFWX 2GXGA 2HOEA 3WGGA 1LEBA 1HW1A 4LG0B 1ON1A 2CSOA 2CO5A 5F64A 4UVBA 2EV0A 5L3DA 3CUQC 2VT3A 4TM8A 4A0ZA 2FBKA 2OKGA 1SD4A 1XDSA 2YPRA 5D5WB 5FFZA 2JT1A 3S2WA 1XGOA 1KYWA 2O3FA 1MJBA 3ZMSA 3WGIA 3ZMVA 3WTUC 2GNPA 3FXUA 2V79A 3FXRA 4MGRA 1D8KA 3RYRA 3DQVC 5D8LB 3H92A 1U8RA 3GWZA 4EM2A 2C6YA 4M73A 3SXYA 2CYYA 1TQPA 1R5HA 3CO7C 1K6OA 4I02A 4N0BA 1FYLA 4A5NA 5D5XB 3V7CA 4I98B 1I6XA 3Q9VA 5H20A 1FOKA 5DCFA 1GXPA 5HDGA 3FZVA 2QUFA 3C18A 1FWZA 2A6EF 1BC7C 1FP2A 1HKSA 3GFMA 1BOAA 4ETSA 4LLNA 1FX7A 4ZYGA 2QBYA 5DUIA 3T8TA 4I0BA 1XTZA 5EEHA 2JTVA 4MTEA 1YO5C 1DPUA 3K1NA 3E5QA 1MDMA 4CHUA 5FLXZ 3TO6A 2PBIA 1ZG5A 2FBHA 3CUOA 4ESFA 2IPQX 3KP6A 1FSFA 1RUOA 5E8IA 3EB9A 5IT3A 2KIUA 5F1RA 3RKYA 4AIKA 5K5OA 4UVAA 3CLOA 3ZN0A 3VFZA 2ZJ2A 2MD5A 4HYEA 5DCMB 3WTSC 5JVTA 2M5WA 2V1DA 2R7FA 4KMUX 3L2CA 1DPRA 5BPIA 3MWMA 1CD5A 3BXFA 3QPTA 4G9YA 2PMUA 1O7FA 5ILVA 3R60A 1QPMA 1P4WA 1KU7A 4A6EA 4WWCA 3TDZC 5K1YA 1R23A 4OU0A 5TRDA 1SAXA 3LAPA 4L9NA 1HQCA 4UHTA 3GZ6A 2KKOA 2DK8A 1XD7A 4L9TA 1R36A 1ZGAA 4RB1A 1QGPA 2EFPA 1MDMB 4RGXA 3N97A 4WCGA 1P92A 2XHKA 1OR7A 1YFHA 2MLKA 1I5ZA 1H0MA 2Q2EA 2GXBA 3F6OA 4LB5A 1MJ9A 5JFRA 3Q9SA 5J6XA 4HOBA 2PG4A 4P55A 1K78B 2KJCA 2COMA 4WF2A 5L3CA 2BKVA 4UVCA 2FU4A 3DXJF 4ESJA 1XCBA 2P7CB 3FMRA 2NNYA 1PP7U 4LD5A 1W7PB 4M6YA 2EK5A 2ZKZA 3C3WA 2KIFA 3KV1A 2V6CA 3BJOA 4KFCA 1EH8A 2ELHA 3F8MA 4LB6B 2YX7A 3DEUA 1SD5A 2VBXA 2W57A 1YIOA 2VE9A 1F4KA 4O3MA 2RKHA 1GHCA 1IN7A 3BOQA 3TO7A 2UXNA 3R6SA 2CWEA 3HTUA 5CVUA 3O6BB 4M9ZA 2MC3A 2LF7A 2P6SA 3TKYA 4NQWA 2HQRA 2GA2A 3CUQB 2XKOA 3RI4A 1KA8A 5ICGA 2KRFA 3EETA 3TOAA 4YIFA 3DFGA 1EH6A 1XMKA 1WI9A 3DV8A 5FLXK 4BHCA 1FY7A 3QAHA 1OPCA 3WGHA 1OKRA 3BWGA 2CG4A 4AD9A 2MH2A 3E6BA 3HRTA 3VOEA 3WE2A 2JSCA 1Y89A 3ELKA 4UV9A 3Q5FA 2VONA 1LK5A 2VBYA 3K69A 3GFIA 3O3KA 3QP6A 4RB3C 4MHGA 3R0JA 3K2ZA 2MBFA 2OZUA 2L4MA 1BC8C 3ISPA 2H6BA 1Z7UA 4GXOA 5LRSA 2EA2A 3ZMDA 1B9MA 4HX4A 2ESHA 3JAMK 5HS7A 4YFNF 4A5MA 2FEZA 2PLYA 2VT2A 4PZJA 3OC6A 3C1DA 3CJNA 1S3JA 1TW2A 5JI6A 4EJUA 2KJBA 2HTJA 3KZYA 4QLCU 3K1PA 1FS5A 2QENA 1JXSA 2HDCA 3ZN1A 1YG2A 5FB2A 1R7JA 4KN4X 1JHFA 1B59A 2D2WA 4CDGA 1FBUA 1R58A 4OIRF 2A61A 2L02A 1LEAA 2A69F 4N9IA 5KVRA 2K27A 2HTSA 3ZMZA 3DPTA 1YS6A 2GIVA 1D5VA 4ASNA 3EYIA 3ULQB 1ZG1A 4KUMA 1HORA 5FGMA 3ABTA 1WQ2A 2XAGA 3DP7A 2HEOA 3I58A 2DPDA 1J0RA 5KK1A 1K79A 4R7TA 1BI0A 2DT5A 5FFXA 4I2OA 1L3LA 2EFWA 1VL1A 3FM3A 1ZN2A 1BIBA 3E6CC 2DFIA 4HLYA 3HTSB 4BAYA 2M45A 1I27A 4HDUA 4GMKA 3FF5A 2RV8A 4LFUA 3IKTA 1TBXA 3V8JA 3LFKA 4A2UA 1HKQA 4RB0A 3IRRA 2LSOA 3VB2A 5E1ZB 3GXOA 3E6DA 2DI3A 3G3ZA 4KICA 5LEKA 3KZZA 5JR3A 4EGZA 1RI7A 4L5IA 3EFBA 2P5LC 4EJTA 2CW0F 5DUKA 2FXAA 2YR2A 2VN2A 4EVIA 5D5VB 4KYWA 4IO1A 3KCCA 4RS8A 3HRUA 1I1GA 5DD4A 4M9SA 3U9GA 3LWDA 2ISZA 2E1NA 4LLLA 3RPQA 5HVQC 2ISYA 4M9XA 2EB7A 1I1SA 2FBIA 2BV6A 4EGYA 4Y13A 4G6QA 2NS0A 2H27A 4IRIA 1FBSA 4PDKA 1TQIA 1JGSA 5HLGA 4OMZA 5LLQA 4FX0A 3WU1B 4IRHA 4MTDA 3EUHA 4G94A 2A6HF 3EQLF 2Z9OA 1MGTA 2DPUA 3BP8A 4Q47A 2O0MA 4CGZA 4CO8A 3FHZA 1KU9A 3KEOA 2HWVA 5FD6A 2STWA 2NNNA 4HX7A 4O6JA 3M7GA 1R1VA 3F8FA 3K1MA 4LMYA 2LKPA 2UZKA 2RI0A 2HR3A 4U7DA 2O61A 2IW5A 5D4SA 4U0WA 1LNWA 4L50A 1U78A 3CUQA 1D8JA 3BJAA 4OINF 3HYIA 5CVVA 2IA2A 1U5TC 2ZMEA 2PEXA 1TQMA 4A0YA 3NZEA 1O3RA 1IXRC 3T8RA 2EA4A 1SD6A 1ZH5A 2RQPA 3GZ5A 2ZBKA 3D5LA 1XGNA 3WTYC 4BNCA 1BI2A 4S04A 3LHIA 3GFLA 1F5TA 1U6GA 2E7WA 4LG0A 3IRQA 2Y75A 4BH9A 1VTNC 4DNCA 1J59A 2KIMA 1FSEA 4LJZF 4F7ZA 1O3SA 3RKXA 3LSTA 4ZYDA 3QPHA 4OIOF 1TNSA 2M30A 4IXAA 4EJVA 1QQIA 4AIJA 1YW7A 2ZNZA 1KQ0A 1Y0UA 3WTVC 4L5JA 2FNAA 4HV6A 1S7AA 2QYOA 3TO9A 1T98A 3WU0A 4ZYEA 4L51A 1IXCA 3BROA 1IW7F 3H3UA 5ILSA 1LKZA 3QU3A 3ZMUA 1WWXA 2EWNA 3MAJA 3WTXC 2QWWA 4LK1F 4L18B 2XAHA 5ED4A 5BOXA 1QBJA 5HDKA 1BN5A 2ZMEB 3NEUA 4UV8A 2QM3A 1LJ9A 3E6MA 5L3EA 2VOOA 3ZP5A 1FYKA 3MZYA 1YQAA 1U3EM 3PQKA 1JT9A 1FP1D 1IN5A 1EV7A 3CO6C 3FX3A 5ILUA 3JTHA 3TDUC 2W84A 3HRSA 1J9IA 2E7XA 1YLFA 2XASA 1IRGA 3SQNA 2DK5A 3ICOA 1PUEE 3W6KB 3SZPA 5FD5A 4CXFA 3MZHA 4IVNA 2TDXA 1KU3A 3EDPA 3PFIA 3WTWC 1T38A 3G73A 4NMLA 5DYMA 4MEXF 3E5XA 5CYVA 1OYYA 4R1HA 2GZWA 3F8CA 1ZRDA 5DEQA 4WX9A 2P7VB 1T39A 1M0SA 4Y17A 3U7JA 3KP5A 3LAJA 3REOA 3T1BA 2V9VA 1K78A 2MH9A 2D1HA 2FNPA 3ERED 2XV4S 4OQPA 3F23A 2F5EA 1IN8A 1USTA 2BE5F 4Q48A 4B8XA 3MEXA 1V4RA 5E18F 1S6LA 3IKVA 4R8HA 1HOTA 1UJ5A 2PI0A 3EYYA 1IAWA 4G8XA 1P4XA 1JE8A 1YS7A 4GGGA 2MLGA 2FSWA 1UHMA 3ENWA 4ENKA 2D1VA 1KU2A 1HW2A 1TW3A 4KT5C 1OYIA 1YW8A 2XAQA 1KQ9A 3FXQA 5A2QK 1UB9A 4YFKF 4P9FA 1LQ1A 4H0EA 4A12A 3T5XA 4Z2YA 3JW4A 2PJPA 2ZNYA 4GCVA 1R5GA 3CTAA 1RNLA 5FO5A 1DUXC 4CYDA 1RIOH 2G7UA 2W25A 3GF2A 3IC7A 2BKXA 4L4YA 3P9KA 3F6VA 4IRGA 5D6EA 2QQBA 2ZO4A 4HA8A 4JBAA 1R22A 2L01A 1W5TA 4FX4A 1ZLJA 1LDKB 4OOIA 3KLNA 4HF2A 2W24A 3V8LA 1K7AA 2DBBA 5HS9A 1SFXA 2LF8A 4R9NA 1FT9A 3L7WA 2K4JA 3ROUA 3P9IA 1J2XA 3NQOA 4N9HA 3F72A 3E5UA 2FE3A 4MQ9F 4RB2C 2XAJA 4YFXF 4XLPF 1WRJA 2XROA 2FF4A 3QOPA 1B1BA 3NWPA 5F6FA 2XRNA 5DV5A 2RDPA 3KE2A 1FPQA 5ICCA 1XSVA 1O3TA 2GAUA 1L0OC 4IPAA 4G6DA 4KN7X 3CDHA 3GEZA 4PGGA 3COAC 3KP7A 1G3TA 5BQTA 2Z99A 3W6JB 1XB4A 5E20A 5J8FA 3N4MA 2BEOA 3GVAA 2GWRA 2P6TA 1GXQA 3HSEA 4KIBA 4I09A 1HSJA 2JZYA 2IA0A 3I71A 4GYIA 1ZREA 1TNTA 5H6RA 1ON2A 3KP4A 3BPXA 2VODA 4HDVA 1G3YA 4U7BA 1MD0A 2ZCWA 3E7FA 1O7LA 2HZTA 4IF4A 2W48A 5L3BA 5IT9Z 2HGCA 3P7NA 3FWEA 4JK1X 2RI1A 3CSSA 2NAZA 2WV0A 1FSHA 4BHBA 3I53A 3FM5A 2ESNA 1IN6A 3I64A 1FRZA 1CF7B 3E15A 3PQJA 2VC1A 4I0AA 1LDJA 1H9GA 1P6RA 3BPVA 3RJPA 3RDIA 2Z33A 5CVIA 3BDDA 4UNOA 1XSDA 4XSZF 3DKWA 5EEGA 3KP3A 5LGUA 1BJAA 4NB5A 5LGTA 5JHUA 4LGWA 3GO5A 3I0TA 3BZ6A 2DLLA 2IT0A 2K86A 3F3XA 2YU3A 5D5UB 4P9UA 2EFNA 1E17A 3KP2A 5HS8A 1BI3A 5CJ9A 2HS5A 1U2WA 2M8EA 4ZYHA 4U0VA 1P4AA 4MNUA 2QZ8A 2L4AA 3HSFA 4M6XA 1ONVA 4HLXA 3QU6A 4M71A 4WK8F 2IVMA 3TQNA 2XUBA 5D6FA 3H3ZA 3JSPA 1RUNA 1UHWA 2RC4A 2PMHA 3ECHA 4AWXB 5A2QZ 1ZGJA 2ZXJA 2P8TA 3R4KA 4HX8A 4TV7A 3GYHX 1W7PA 4EMSA 4BHPA 4OIQF 3J7AO 4M72A 4L9VA 2ADUA 1PP8F 4BXUA 4ZZLA 1W5SA 3HHGA 1H9TA 4HF0A 4LK0F 1KQ8A 5LRRA 5K5QA 4G7HF 2EV6A 2XKPA 1ZYRF 2CGPA 1YTYA 1QZYA 3J80K 3JAMZ 4R79A 3WG9A 2FRHA 2A3SA 2DU9A 1HKTA 5LGNA 5E1XA 3IWFA 2A5YB 2FQ3A 4UXNA 2M1BA 1G6NA 5HOOA 3QP5A 3U2RA 2F2EA 2HYFA 1OYWA 1T0FA 1Z6TA 1HW5A 1FQOA 1MJAA 2DQLA 3HUGA 3DPLC 1KYZA 2ACJA 3C7JA 2VC0A 1S7OA 4Q4ZF 4YIIA 2GA1A 1GVJA 2PFBA 4HW0A 3LQRA 5ICFA 4AIHA 2JPBA 1V3FA 3FMSA 4L9JA 1ZRFA 1FLIA 3GLXA 3TX2A 2IJLA 2HKXA 1HSTA 5LEJA 3CH7A 5IT9K 3BXGA 2NYXA 4P5OA 4EM0B 2K4BA 3J80Z 3KLOA 1UJ4A 5HLHA 4KIFA 1CF7A 3LA7A 3M8EA 3I59A 3UW1A 1Z9CA 4EQQA 3GW2A 1XCVA 4U0YA 4RGRA 5CLSA 3BJ6A 1SFEA 2QBYB 3HRMA 1ZLKA 3KETA 4NHJA 2FOKA 2DW4A 2CFXA 3LA3A 1Z6RA 1SMYF 4D0PA 5AONA 4ZZDA 2Y48A 4X84A 1BM9A 2D45A 6PAXA 3M8FA 5AIQA 4XRFA 2HYGD 2K7LA 4IJAA 5DDGA 2P4WA 4KMFA 3U1DA 1WKMA 5H6QA 1W7PD 1Z91A 1CGPA 5LBQA 1ZHFA 1KS2A 2Y0MA 2E1CA 1XSXA 2BGCA 1DP7P 3ECOA 4XLNF 3B73A 1IRFA 1HBXG 3SZTA 3GX4X 3LA2A 4PGHA 2QQ9A 2Z5UA 1QNTA 3V7RA 5E1WA 1O8BA 2LNBA 3RTRA 3KWMA 3E3VA 1F9NA 2EJRA 4I7HA 1E2XA 2J5PA 3SFZA 4FHTA 2F8MA 3IL2A 5LHHA 3LQQA 3HSRA 5HLIA 4AVPA 4U88A 5CVRA 3RKWA 1BI1A 4RAYA 4S05A 1KGSA 3L09A 4HZFA 5AIPA 1YYVA 2PN6A 3MFKA 3IWZA 2DQRA 1BBYA 1ULYA 3DF8A 4HBLA 4RGSA 3HIFA 5ICEA 5D8KB 2R3SA 2EFQA 1FS6A 1Z1DA 1SFUA 4M74A 2P5VA 1FYMA 1FNNA 2JPCA 2F5FA 1F1ZA 2IP2A 2AXLA 3M9AA 2X4HA 4RGUA 3LWFA 1PBTA 2OU2A 2GQQA 1LVAA 4CZZA 3JSOA 3HOSA 4ZH4F 2O0YA 2VE8A 4ON0A 2RN7A 3V4GA 2HKOA 1NHAA 2XGXA 2FA5A 1UJ6A 4WXDA 3J81K 1XDUA 3RIRA 2L3DA 2K02A 4JQFA 3D0SA 3V7SA 4A0XA
chains in the Genus database with same CATH superfamily
3I2FA 3NKVA 1GNRA 1KIAA 1O77A 4DXDA 1JA9A 2PAAA 3U7HB 5A5EA 2MD0A 3VSEA 2XAAA 4KQKA 1USSA 4PZDA 1CQPA 1TM5E 4Y15A 3HDYA 4PV7A 5LYJA 9ATCA 5MDHA 4U7FA 2BZTA 3L5OA 4UTNA 3OFND 3BCUA 3M1EA 4BN5A 4M8LA 4FI3C 4ZAXA 3RK0A 4D81A 5BN4B 3LQ1A 4UDXX 4EM6A 2EAUA 3CCFA 1GL9B 1BGWA 2CVZA 1CCWA 4JVSB 2R7KA 3ASYA 3G5MA 4OH7A 2JJ7A 4JB3A 3KYCB 1E3WB 1S7CA 3D4IA 4LDPA 4XIYA 2V98A 4CMIA 2VH5R 4EHHA 2ISCA 3KR9A 4ZU3A 3N76A 4Y18A 3PIOF 5EIWA 1N8SA 4O0LA 1ZJYA 2O8XA 1J09A 1AG9A 4WJKB 1NOKA 4BNVA 2LDUA 4G0UA 2COKA 1FFCA 2PY6A 3G2HA 3A70A 2X0JA 3MTGA 2ZJRF 1B8IB 1V95A 1XXHA 1YHZA 1OBOA 1WDLA 2BHLA 2J08A 2NAPA 2VNJA 1P6UA 1HURA 1N3BA 4GGMX 4RK4A 1YJCA 4MKGA 3HO1A 1Z21A 2OV6A 1S2MA 1JWAB 3Q15C 2VATA 3VZBA 3L0SA 2A5LA 3CR8A 2ZTSA 4NMWA 4URXR 5DP2A 1YCFA 1PFYA 2R48A 3INTA 1W4RA 4MDHA 4DN6A 2ZUTA 1UG2A 1L4HA 4OHFA 5A4AA 2QRVB 3ET4A 3L3BA 3QUTA 5EZ6B 1FC3A 4B3AA 1ORRA 1V9CA 3HHEA 4L9AA 3PJEA 4MPDA 2FN8A 5EP1A 1BX1A 2ICAA 2JH9A 3FB4A 2DTXA 4H16A 2VK2A 2MSKA 3RREA 3ANNA 5AI8A 3CPEA 1WUIS 2JJ2A 3IR6A 4L5CA 1JFRA 1DL5A 3ICPA 2GAFA 2BDUA 2QMZA 4PZ0A 2W82A 3MF4A 3QXXA 3TW8A 3ZWYA 5DM1A 1IF1A 2BYVE 4BGDA 2PH5A 2VAWA 1U6IA 3AI1A 4XPIA 4ARZB 5JVDB 4PAMA 4CIBA 4L74A 1WEHA 1UKCA 4WZAE 3JALB 3I56I 1T6SA 4JX4A 3L6CA 1PYOA 4LXGA 3Q5GA 5HDNA 2HU7A 4NDAA 1R0WA 2YHBA 5E9QA 3IHKA 3Q0VA 3AOEA 4R9VA 3RGGA 2Y30A 4UPEA 2BH2A 3BTVA 4N8DA 2M32A 3HTXA 1B76A 1T35A 2I1QA 2GFQA 2WMYA 3LSHA 1DG3A 1IFXA 1NJGA 1E2GA 2B30A 3CBQA 2VZ8A 1SR8A 4GUAA 2L2QA 3AEKA 5BUSA 2Z2XA 1FNBA 2GO7A 5ALIA 4JI8B 1SG0A 2LD4A 5HRAA 3T38A 2DFDA 4LQLA 5HQ3A 4B34A 3BXEA 3MTEA 2MG4A 3AUJB 2UZAA 2XUOA 5IP6A 2YJ4A 1XOIA 1ZIOA 3WK9A 4FB5A 5B12A 1XCOA 2BGUA 3AETA 1P0MA 1R1UA 1FBNA 2PBLA 4RBOA 3OO1A 4D02A 4NXMB 4Y1GA 2VSOA 5CKTA 1OT5A 1Z2AA 2F3QA 3QE2A 3QE0A 3VV3A 3HVKA 3NBXX 3QPSA 2Y1OA 1JE0A 1HM5A 3IE0A 4OY3A 2J67A 1YV9A 3K0BA 2W71A 4AVYA 3QITA 3SYTA 1RZ4A 3WJ1A 1C7FA 4I8IA 4U4AA 2DODA 4IYRA 2ERYA 3D7NA 3MINB 4UAVA 4XIGS 1BW6A 1ZARA 1C7QA 4RPKA 3A26A 5ALGA 3WKEA 1JH9A 4PNEA 4HN4B 2CUFA 4A8JB 3BCRA 3D3WA 2W90A 1W9HA 3PSHA 3OWHA 2LIVA 4DQ2A 1LDBA 4N7JA 4DSTA 1MG0A 5IT9A 3ESZA 4EBFA 1JDPA 3UJ9A 1REPC 3EIHA 3O8LA 3CZPA 4GXQA 3L1VA 4Z4GA 1CVRA 1NNI1 5DBEX 4TS9A 3I59B 3JTGA 3F5SA 3AJEA 3N2GB 3UQYS 3MYRA 3L82B 3PWTA 4IBOA 3R76A 4ENNA 3H36A 1FS4A 4B3TB 5LMNB 1OX5A 1VXOA 1OXMA 2RGNC 1GPDG 1K0UA 3JQGB 5DEIA 3S7ZA 2F5DA 2FCRA 4R5MA 2HA6A 2K3PA 5CDFE 1Z2NX 4XIJA 2QM0A 2BGRA 4JSYA 5KSWB 4M3EA 2WC2A 2YSRA 2A05A 3V8KA 1G4DA 2JVHA 1U2ZA 1QVTA 2Q0OA 2KSQA 3BKWA 4E1BA 3EZ6A 3LNTA 3LC7O 1ZH4A 4O1HA 3AB8A 1QIEA 2W98A 1XGKA 3LUJA 4UUMA 5ITVA 5EFZA 5BPFA 2Y9YA 3MRSA 5EUMA 5JPCA 1QRSA 1Y8CA 3O91A 1WI3A 4BUJA 1M2FA 3HP4A 2GASA 4RSGA 4BP3A 2HRCA 4D41A 5JQGA 2HU5A 1IY2A 3HO6A 4Q4JA 3QY9A 3ZHTA 5D4RA 1VHDA 3KE8A 4NU8X 1XR3A 4U7HA 2QAIA 1QZZA 4QWWA 5FPKA 1PDNC 2LZ0A 4LY0A 3MBKA 3RUDA 3UPDA 2OCLA 4PCQA 1M2OB 5M2QA 1A9XB 2VA8A 2OBPA 3NIFB 5K0BA 2GTHA 2M6LA 2ZCJA 4Q93A 1GRNA 2FPGB 3CLUC 1T9GS 4HNVA 1U9CA 2V7EA 2V7UA 2WR8A 3H2ZA 3RTAA 3TO5A 4P96A 3WMRA 1YE3A 2AXQA 3V9AA 3A6ZA 2V6EA 4HQKA 3G5UA 5CLQA 3CJTB 5G4KA 1A4UA 2FMXA 3GRPA 4HJRA 4I36A 4A10A 1XMXA 1ONBA 4LC0A 1G21A 4XBFA 2BMJA 1TT7A 1WA5A 1A7AA 1M67A 3CH5A 4BJ5C 4E7HA 5E8GA 2HLDD 2QE6A 3QM1A 4NE9A 2VL8A 5H1YA 2BFBA 5CBKA 4ECAA 4FWBA 1Z0SA 3ESRA 1YU9A 4GQBA 2BGMA 2PR2A 4MR7B 1UJBA 3RRBA 2R1VA 1JPUA 3HSKA 3FOWA 5BPDA 3VYWA 4EV0A 4CV2A 4A2CA 3CNNA 1X2EA 5LQJA 3PEVA 3DE0X 2RGVA 3CZ5A 2WD7A 4RZ3A 1QHHB 3MRXA 4MLZA 5AFSA 1JX6A 3R6WA 2FMTA 3KSRA 4TROA 1DIAA 5B7GA 2Q1ZB 3NRBA 2VBZA 1VE7A 2UYYA 4IKFA 2FPRA 1LK0A 3OFJA 4B2LA 3T9BA 3A9SA 3RJMA 1ZG3A 3PFYA 3X3HA 2RNJA 1Y1RA 4PO1A 4N4NB 2I8LA 1EFDN 1W76A 2ZU0C 3OTGA 5FKMA 4QGHA 5GM2A 3W5UA 4B85A 2H2WA 2GYWA 1J2UA 3Q7EA 2O03A 3K0FB 4QDUA 3RRYA 3UEOA 2X6TA 1DEAA 3CC8A 1P4RA 3VPFA 3VHRA 4CR8A 2GF2A 3M4XA 2GZAA 4N0DA 2PYZA 4M7RA 2AS5F 4DT1A 1CZHA 3K96A 3WL8A 2OQRA 3OVMA 4P22A 5F2KA 3ZGZA 3EIWA 2OUMA 3RJ9A 3KZOA 2FFBA 3C45A 3K0AB 3HL0A 1TTQB 2GYUA 5DMHA 5IF9A 4MQEB 2ZIZA 2R5YA 5B37A 3VU1A 2PUCA 1KKUA 1SVMA 2O2XA 4QYIB 3UJDA 3PIPF 2W6IA 5DGDA 5B66C 1Z6ZA 1ECCA 3DLTA 3LX4A 3IOEA 4GD3Q 1EBBA 4H18A 4RMJA 2SICE 3WNQA 4I1PA 3KHTA 3FJOA 3CCVI 1SU6A 2B2CA 2W4QA 4LJ4A 2HK6A 4D5GA 1OSNA 5FR2A 2XQKA 1S8FA 2X0FA 4PHCA 2NRAC 3EOZA 1D2EA 2C0CA 3PNKA 4YP0A 1QO0A 4XD7A 5CW1A 1WKVA 4GXRA 4PQEA 5IFKA 3IE1A 4GPZA 1Z3XA 1V5IA 1ZESA 1JHRA 2Z57A 4M9RA 4IICA 3OLZA 2EVWX 3NYRA 4OF4A 5KWVA 4O4HA 4U39A 1TRKA 4ZOBA 1EXMA 1DAFA 3O3OB 5KYTA 3X1YA 4ZCIA 4L02A 1MH3A 2WMOB 3CF4A 3LRTA 3T3HA 2ZAGA 1DTEA 1Y7TA 2RH5A 5LHGA 4FE3A 3DWLE 4O1IA 2PL5A 4WZBB 3TSWA 4URVR 3CGGA 5CQEA 1AHHA 2J5KA 2ODQA 1OV4A 3O94A 1RHKA 1X7DA 2RHTA 5FUXA 4XWYA 4IV0A 1JHXA 5BYAA 3CGWA 5L51A 1Z7EA 1E79A 1Z6GA 1Z7YA 3RBVA 2OLEA 4DCJA 4BLSA 3I9V6 1LF0A 1RM0A 4RKFA 4UBMA 5C5DA 3R4CA 2WY7Q 1B16A 2IHJA 4KFRA 1WR8A 3SC3A 4ENJA 3K2IA 2Z43A 3ZQJA 4HQMA 1R4NA 3FUUA 3GH3A 3FZGA 7MDHA 4HXGA 4C9BA 4F1WA 2VJIA 1T1RA 4V0QA 3U7IA 1VBFA 2P11A 2ECPA 3DXYA 3GCXA 2Q99A 3LT0A 3O3NB 4Y2SA 2C61A 2H1WA 4YAJA 4TL7A 2DCUA 2ZXHA 3GUDA 1CPYA 3HPQA 4PX3A 3ZTWA 4RE5A 4OMDA 1WDKA 5FR1A 2HTFA 1WIWA 1LKXA 4FEGA 1JMYA 3ONFA 4XQ0A 3SHFA 2QJFA 4B73A 4KDPA 3PDIA 3ZCQA 1J0AA 3MS2A 1CY4A 5CA0A 2TECE 2CQKA 1ODSA 2IUFA 1K75A 1G9XA 1OZAA 1QPBA 2D0IA 2GBLA 2LPMA 2PGDA 2PGOA 2VXCA 3IUQA 3PP8A 3FD8A 3PQ3A 2YRWA 1WPQA 2OBBA 3TRIA 2Z3VA 1TQ8A 2QA4I 2CK3D 3JR3A 1UP4A 2A68F 1VLHA 1MORA 2Y8EA 2ZJ7A 4ZVVA 3SPXA 3S81A 2D5CA 3KYBA 2R6R1 3HJBA 1S4QA 3O8QB 3F6YA 2IX3A 2LY1A 5THXA 1B9NA 3ZDEA 4CG1A 3NEPX 2A88A 2ORYA 4W1QA 1Q1EA 4Z3OA 3BCAA 4XKCA 2J0EA 3PUFA 1IV8A 2XR1A 3CKLA 4K6CA 4LV5B 4NBNA 1SFKA 4EW6A 1DO0A 2DAOA 4IHXA 4FW8A 4BNIA 4JUDX 3GLHA 1RKBA 3OMLA 2X6OA 3K4PA 4FHCA 2HDDA 2A7XA 4JXZA 2DJIA 1SVUA 3JQQA 2G7ZA 2HU2A 4TWRA 1HXDA 1Q21A 3R3ZA 4DVJA 1WSUA 2NVQJ 1M6VB 2WF6A 3BK1A 4B3XA 4QTRA 3EIQA 2UWMA 1FMVA 2R86A 1S96A 3IMFA 5FOTA 5G0WA 2Q1WA 4OU5A 1I51A 4EJ6A 4XR4A 2VFAA 3EDRA 4RMGA 4NZYA 2FF7A 1T1SA 2I3GA 2WAOA 3DNFA 5DK6A 4MI1A 4EVSA 3LE8A 3H1TA 4JB8A 4R81A 2ZANA 3TFOA 4IEFB 4HRVA 5JS2A 1AKWA 3D3KA 3H2KA 1G7TA 2ZYGA 2VK8A 2XAFA 1ISHA 4I1OA 4WZAA 1IHPA 4V1CI 3O2PE 4M3BA 2R1TB 3R5HA 1DT3A 5LZ8A 2W85A 3WIOA 1W30A 3MJEA 1OI7A 3WGVA 2KBFA 5CIQA 1U0HC 1S29A 3TIVA 1SBYA 1HG1A 1WQ3A 1P45A 2VJ5A 4NAVA 1RR8C 4RVNA 4GPEA 1A8QA 1J0XO 1WDTA 1VGQA 3DQQA 4MXDA 2UXXA 1NQVA 3OE5A 1P9QC 4PFSA 4YAEA 1SM4A 1V4NA 5HFAA 4EHDA 4JODA 1J49A 2C9DA 5M5WJ 2CNNA 4CCYB 2LP0A 2W00A 2H2HA 3CRVA 4OMYA 1RRKA 1K4TA 4HWRA 1C7IA 1G5TA 1DU4A 2PSJA 3IQDB 3DKYA 5KYXB 3AJRA 2H2GA 4GBED 1IN4A 4FHFA 4NYJR 3WODF 2MSLA 3OECA 5AT1A 4UHEA 1XN7A 4Z6YA 5GJCA 3V3TA 1EXDA 3MQ0A 3BFXA 4J1QA 5I7FA 2AIRA 2E4YA 3UO8B 1N5DA 1YSCA 1CRPA 2VP0A 1WO8A 1J75A 4CICA 1OR8A 3M89A 4B79A 4ABYA 3IOBA 4NV1A 3FGZA 3EA0A 3FAKA 4XJTA 2QT1A 5CLGA 5DLDA 3TXXA 2VAXA 4UCWA 2NSLA 1CR6A 1PQYA 1MZBA 2R92J 3OHMA 2CS3A 5I9BA 4AMGA 3KJHA 4MGKR 4FZRA 4NDNE 3RU9A 1MO3A 3E9NA 4DEVA 4B6EA 2FWIA 2Q2NA 2WYHA 2QRHA 3ICWA 7ADHA 1D4ZA 1I10A 3PM1A 3MILA 4EVRA 4QRIA 3MKZA 4NZZA 3EGCA 1K2VN 1TPYA 1W94A 4I9NA 5CP8A 2ISQA 4E7OA 3WGGA 1NC1A 4CQJA 2QPLA 4FZ3A 4LXXA 1HE5A 4Y6GB 4GXNA 1TJPB 3W7BA 3ASVA 1U1EA 4CUJA 1BD3A 1HW1A 1DIRA 4DJJA 1M6YA 2CZQA 3I72A 2YVUA 2BI7A 1ON1A 5DM2A 1W581 1F48A 5FV4A 4LJ5A 3Q6NA 3ZJVA 2EBUA 2YY6A 4LRQA 2VTBA 1H6AA 5K3AA 5HKAA 3KHUA 3BC1A 1F0YA 4G1FA 1DC7A 3ABRB 4X24A 3EMDA 2AZTA 3LLVA 2X9NA 2VJMB 1IEVA 2QRPA 1KO4A 2H2FA 2W6ZA 1IHDA 2OKGA 1SD4A 2ZYRA 3H2HA 3HBAA 3O2NA 4ZVMA 2AXNA 2UAGA 5J47A 3PXGA 4BC1A 2DUMA 1TWFJ 2H07A 5T4HA 5J4VA 5BV2P 4LYEA 3A4VA 4YIHA 3GRAA 2YPRA 1J21A 5D5WB 2WYOA 1A8HA 2J45A 3EW7A 3WTCA 3WLOA 4M0CA 3S2WA 2PTGA 5L3ZA 5BN5A 2I6SA 3NXSA 4AZSA 4C4AA 4WBNA 5BQFA 5BURA 3D31A 2I80A 1JVBA 3VR0A 4QE3A 4CG0A 5CIYA 1KYWA 2HA3A 3HXTA 1JJ6C 2RGWA 3G0HA 1T1GA 1QRUA 1JQKA 2XIJA 3VI3B 3ZMSA 5CA0B 1QPIA 1GPYA 1XCJA 2IKSA 2VDVE 3DNMA 3ZMVA 2ZVQX 4MLDA 1V6SA 3I1YA 1CU1A 4RD1A 4XEUA 1FTWA 2NS7A 3RASA 1E2BA 3CVXA 5JLXA 5EEAA 1B2LA 4D45A 6AT1A 4OHYA 4HLNA 1LPBB 4DPKA 5EJEA 1ND5A 2FPIA 3FXRA 2G40A 1H4TA 3LHDA 2CJJA 3AK4A 5CT8A 5B1YA 2EGHA 3OYFA 5K05A 2B37A 2MYSA 5D8LB 3H92A 1DB3A 1VSTA 2VBCA 3G2IA 4CYCA 4RANA 3EVZA 1Y8QA 5DGIA 4REMA 5A62A 2JUGA 2YIMA 1OC2A 1UBEA 2EC5A 2LRHA 4IXWA 1UJNA 2I22A 3OPVA 4IX7A 2IV3A 1LFUP 2X4DA 3KB8A 3OOEA 4M73A 1S3FA 1FZTA 1MP0A 1TKAA 4MUNA 4KX3A 2C4VA 3BD9A 4M83A 3UVEA 4D8XA 2OHGA 1GDTA 2XWSA 3ZHQA 3SXYA 1ZHOA 4Z0HO 1TQPA 1R5HA 4CCMA 3C3BA 3HCEA 4HH4A 1QRTA 2XZOA 1K6OA 4B7AA 2EP7A 1QGED 5EKXA 4WK2B 4N40A 3BE8A 3N7TA 3N8KA 3V7CA 1G2QA 4PBRA 5LMCA 5FLEX 2CVHA 3K70B 3L6DA 2NYAA 1FUEA 3Q9VA 1CEQA 2HUNA 4WCFB 1TEZA 2JH3A 3CUSA 1FOKA 1VJCA 3K30A 4MVYA 4DQKA 2GZMA 4TRJA 1BC7C 3EZ2A 4IINA 5IJZA 1LC0A 1T25A 3ADOA 3D8RA 4LY9A 3GFMA 2R5ZB 2GLTA 1BX3A 3IV5A 1NR1A 3GUZA 5JAHA 1UJMA 5EMHA 3GELA 1JR4A 4XA8A 3H7IA 2J5BA 3IODA 3PRYA 5DUIA 3AUXA 3FCEA 2LXNA 2P6NA 4B4OA 1G9SA 3T8TA 4I0BA 1OGJA 2OEPA 2O59A 1XTZA 3ZI7A 4A03A 1UPTA 4RQUA 2VHVA 1I3QJ 3PVSA 1WH5A 2QMHA 4RPHA 2ZITA 3FXOA 2MHCA 3OL3A 1N1DA 1TCCA 4RMHA 4TKZA 1DUVG 4KPUB 1RMTA 3BA6A 3ROGA 5EEHA 3V2IA 4IWXA 5E9AA 1II9A 4M99A 4Q6WA 4UNSA 1NV9A 2H7XA 3QVMA 1MDMA 4RIIA 1L4LA 3TUJC 4D4MA 5E79C 3LT2A 4QQKA 5BQOA 1D7OA 1ZVKA 4YUVA 1XRMA 4AYWA 3S15J 1Z68A 1I9GA 2BEJA 2RKBA 3E53A 2C88A 4DCOA 3GGJA 4ZTZB 3KQLA 1O8CA 1NQUA 2IPQX 3KP6A 2OK8A 3HBJA 5J63A 2HLHA 1RUOA 4DIKA 1KYQA 3R9IA 2O05A 4C3OB 3PUJA 4PSDA 9ABPA 3EBPA 3BXPA 1G8KA 3CX7A 4XGQA 5IT3A 3R7LA 2A1UB 2KIUA 1NXWA 4PJNA 1AHNA 1NBIA 1P2DA 2APJA 3AINA 4YR9A 4C30A 5M5YJ 2YV1A 2VSFA 3ESCA 1K3TA 2Q2WA 4RHTA 1GA1A 4UZSA 5JRJA 4M3DA 3TZLA 5BWOA 2MD5A 5C4XJ 2AFIE 1OPRA 1B0UA 5KCMA 4HYEA 1DWPA 1N0WA 1UC5B 3GHYA 4RKQA 1J06A 2VPPA 4U7JA 5DCMB 1E92A 1D03A 1F0KA 1TU4A 4KMUX 3KVVA 4TXMA 4WZAB 3ANMA 1NLYA 5HK9A 1DPGA 1DPRA 2L82A 2H5EA 3L1IA 5H8WA 1IVSA 5FD8A 4Y2XA 4D6XA 3FIWA 1H1DA 1HEYA 3IVXA 2JIBA 4HGNA 2EF1A 3WNVA 3QPTA 5C7YA 4TZ6A 3HYTA 2F9FA 1UG0A 1X92A 2PM8A 4LSZA 4B3GA 3T4XA 5ILVA 4XLLA 2WF5A 4GL2A 3LRXA 1X58A 4NJEA 1AKNA 1GR1A 1L4KA 2QJWA 2ET6A 4XFDA 2DFHA 5H70A 5TF0A 2R4UA 3BTCA 1IPEA 1R4MA 2OO5C 4R1MA 4KH0A 4WWCA 1J5EB 2VJYA 1U3CA 3NARA 3JREA 3LF2A 4JXXA 1GGHA 2FUG2 1M2OA 3JWPA 4RVDA 2X1CA 2QPAA 3W2VA 3VR5D 1U4SA 3KL2A 4ZC1A 4ZK6A 1WAMA 5AVZA 1R23A 2FRDC 5K7HA 2P2YA 3HA7A 4OU0A 1NRJB 2JFPA 4IY1A 2JAXA 4X0EA 2BCGY 3R6GA 3T61A 5BW8A 2C97A 3ZQKA 2O8EB 1EG7A 4DWJA 1REQA 3KV3O 5EGNA 1D1CA 1HQCA 1R37A 1U4NA 2C20A 3ND8A 3PVZA 4Q1VA 3WBJA 3QKRB 1QH8A 1E7YA 2BGNA 2KKOA 4ZT7A 4JQCA 4DSNA 2BBWA 2DUUA 4H7EA 2DK8A 2C95A 3HG7A 4NBUA 3BEDA 2ZROA 5KKAA 5KNCH 1H69A 2ZG6A 1PT7A 5KREA 1ZGAA 3SC6A 4KO1S 3O4JA 1XPXA 1MDMB 2Q6TA 5HGJA 3WMEA 3EBOA 4D0NA 3BXXA 3KL4A 1OR7A 3OI7A 5HRCA 1I5ZA 1OREA 3LT5A 3OAAD 2L7MP 2AFHB 5MN6A 3G1UA 2PWAA 1OBFO 5IDVA 3FVQA 1TMYA 3CB2A 3FTCA 3OWXA 3NJRA 4OGFA 3NEYA 1ISFA 1DP3A 1C0PA 1KVQA 2GXBA 1XZNA 3B13B 3KK0A 4JCCA 4KBGA 2GJSA 3ZUGA 4B31A 3Q88A 4BTEA 4RQBA 4LB5A 3ZVRA 4C3VA 2JCGA 1NGSA 3K0HA 3ECAA 1IBSA 1OGIA 4DV2B 1ISJA 2PG4A 4MV3A 4P55A 4LV8B 1UWLA 4UTOA 4Z7JA 1O03A 4O2RA 1X6VA 1MTOA 4EI7A 1KAGA 5L3CA 1QGAA 3AKEA 3GP3A 1WMDA 2SNIE 3OQVA 2I71A 3P0RA 4LHVA 4WUTA 2FVXA 1VXRA 2FU4A 2Z08A 1GZ4A 4TS1A 3TEMA 1OFTA 1ETXA 2BW3B 1JJ8C 4N5MA 5LZ4A 2FFRA 2FZKA 1I4EB 1SHJA 3S2GA 4D8UA 2YJTD 4HSGA 4Z5XA 3VVLA 4K0RA 1SC4A 5LWQA 2P7CB 3LY9A 2NNYA 3O26A 4RTQA 2WMDA 3Q8LA 3DOCA 4BWYA 1W7PB 3VYRB 3AOEC 5DIFA 4ZDPA 2XADA 3UA4A 1N6PA 3JQAB 1IBKB 3P0FA 4HMQA 2XI4A 1TQDA 1THZA 3WR5A 2HW8A 3T9EA 4KFCA 5IEJA 4FE4A 3INGA 1NMYA 1PJCA 3K09C 3IJEB 3BZCA 3WP1B 2PSHA 4LB6B 1RQXA 1HE8B 3C5WP 2C42A 1YIJI 4BVHA 5HZGA 3AXTA 2FPKA 1J8FA 4S1WA 3HA5A 1IULA 3NONA 3HJTA 1UINA 3D8UA 4NL4H 4XB2A 1FYEA 2F90A 3DTVD 4IGIA 2FEXA 3U4GA 5EZYF 3W06A 5B6PA 3OYHA 3W2FA 1YIOA 2WADA 1QQAA 4DV1B 2W42A 3Q0IA 4LOHA 3ZHVA 2OP1A 3FZNA 3PL8A 2IPMA 1X9IA 2RKHA 2WUWE 3LY7A 4LWQA 1OAKA 1WP4A 2VDKB 2H8GA 2HF9A 2JA6J 3OA2A 1AKHA 2IKQA 4FX5A 5D1HA 5GGXA 4B8ZA 3E3AA 2FK7A 3GOQA 4QGSA 5J40A 2P40A 1TZCA 3UOGA 3QWLA 3C4JA 1YE9A 3K9NA 3LCVB 4GBGA 4U7PB 1KE1A 5M34A 2FPSA 5J1RA 1QZTA 2ZJ4A 5L3RA 1H1TA 1IEWA 5FUMA 4P3OA 4UD2A 1ZPDA 3O6BB 1PHRA 2LF7A 1OYVA 3SF0A 1JEJA 4HF7A 1Y8RA 1FFBA 2E2IJ 4QAJA 4XYEA 4OLBA 3TKYA 4H0NA 4CODB 2PD6A 4L6IA 1X13A 3U9SA 4OVKA 3AR4A 1YDHA 4LDJA 2DQYA 3IHWA 4GW3A 4ZRMA 1BH6A 5I9SA 1H3FA 2O23A 4G1CA 3TLMA 5ICGA 5EGSA 5KOHB 2I9KA 3HKDB 5IJ0A 4ZVKA 3TYXA 3UFXA 1QFSA 1SO8A 2P2CA 3HB0A 5KWSA 1NG1A 3Q7SA 1HMYA 1TLFA 3DKIA 3FMVA 3G23A 4ND3A 4C7BA 5IXYA 1EE9A 3RYHA 5FUBA 3WQHA 2DJNA 1XALA 4G0MA 3UR3C 3K6SB 5FLXK 2ORED 3WLMA 1JKOC 1IQPA 3ITNA 9LDBA 2XUPA 2R1VB 4IDDA 3QAHA 4HSTA 3PNLA 3WGHA 4OGWA 4EYEA 1PVDA 5L6MB 3BWGA 2FPMA 2CG4A 2VJOA 3JVDA 4AU7A 1D5YA 2HMAA 3VHXA 1L5LA 4ALJA 2WZDA 1XTBA 3G71I 3Q9NA 5AM1A 1ZISA 6LDHA 1KBZA 3EVTA 4KE8A 5LVAA 5LYYA 2AOXA 4FYYA 4NFSA 2RGYA 5FT9A 3RKUA 3ZDXB 3E6BA 2VP5A 4GICA 4QUEA 3K70D 1HF3A 2NX2A 3TIIA 3V00A 2Z6QA 6REQB 3DZBA 4DZJA 3KR1A 2FW6A 3QNUA 4X7RA 5FAKA 1BL0A 1AY0A 4FOSA 4M1ZA 4EYOA 3QNWA 3VH1A 2HK7A 3ZDAA 1NNLA 4UV9A 4EK9A 1ENPA 2Q5LA 2Z8XA 3T7AA 3BT7A 3RW9A 5BV7A 2W2MA 5ARDA 3OETA 3OZFA 3K69A 3NBYC 3UCXA 4CTMA 5JAOA 3RT1A 4DV3B 3QP6A 5EWJA 1SIOA 3H1FA 3U1KA 3JD2A 1A5AB 3JVUA 1W96A 2P9YA 2IOQA 3GIWA 3EMKA 2KIQA 3R0JA 4MHGA 1IIBA 3MERA 1JALA 4PAOA 3WZMA 5I4KA 5KYXA 5AOCA 1EF4A 4G9GA 3CIFA 2MBFA 2QTVB 1RLJA 4QGAA 5DCYA 1RCUA 5CFPA 2G0TA 2H6BA 1OISA 1UMQA 3CXRA 3UPTA 3MIZA 1ZITA 4CEJB 1IRIA 2V6JA 3L9XA 3EWAA 3Q3EA 2EA2A 1IY9A 4LYAA 1H22A 2HMWA 1GQFA 1FOYA 4QVGA 3I55I 4DTCA 2AKEA 1WKCA 5KTOA 3ZWBA 2X0RA 2QMEA 4P32A 2Q7XA 2X6XA 4GP7A 1LDEA 1KR2A 1Z62A 5D00A 4UHKA 2QRGA 4BO2A 1GYRA 3MJFA 3M6IA 4J6FA 2WWGA 1S1CA 2VDJA 1M6NA 3K4HA 2FEZA 2PLYA 3GEMA 2VT2A 4RC9A 3VOBA 5JHHB 3OC6A 3C1TA 2KDOA 1R16A 4YCJA 2I99A 4LY3A 3PX3A 5FBRB 2QRLA 1YQQA 4IDPA 3CJNA 1KY4A 2ZIFA 1S3JA 4MI9A 3RJ5A 2F17A 3AJAA 4E4HA 3RIGA 1RPJA 2YUTA 1R50A 5FADA 2V58A 4D6YA 5FUWA 3D3WB 4OJTA 3TGLA 5LN1A 3CF4G 5JTTA 1L5SA 2LKSA 1L7MA 1TCUA 3EAQA 4EJUA 3O4HA 4PGAA 1GG5A 1JHYA 4W9NA 1QO7A 4U6NA 3OEYA 3QPBA 2WU3A 4KPYA 1L5VA 3KZYA 1AGNA 4H7JA 4XVHA 1JLMA 1P73A 2V9ZA 5D3ZA 3ZXXA 7MHTA 3AEQB 4ZHQA 5B3JC 3GR6A 4XYBA 4YELA 3I1IA 3IDQA 1JXSA 1BE8A 1QZUA 2KB0A 3PNSA 4KWCA 4S0ZA 3IR5A 5IXSA 2ZXFA 5J2TA 1YRBA 1UM8A 5E1OA 3KUXA 1XD2B 3W8RA 1OTXA 3ABIA 3I6MA 3EMBA 5K0FA 4OHMA 4HAVA 3AERA 3TKAA 4BNMA 2D74A 4QASA 3EXEB 3ZOKA 5FB2A 4DLPA 1YTUA 1OI3A 2I3DA 1HC8A 1CJKC 2ZRNA 4QFBA 4REOA 4UBNA 4I9GA 3CTMA 3HSSA 4JENA 1JHFA 1WXFA 5B2ZA 3P5BA 4MS1A 2UXBB 1B59A 2NUAA 3IURA 2L0XA 4BWGA 1J0EA 2OILA 4Q05A 2OK7A 2ZUDA 5I4CA 5T3UA 3UJCA 2B8EA 4EA9A 4JA2A 4FQGA 121PA 2ZYVX 4FOLA 4TLEA 2TYSB 2JIDA 3NKFA 2Z2JA 4JLDA 4OIRF 2PD4A 1QMPA 3O4FA 5T8KC 3M6AA 2DLDA 1HNWB 2L02A 1F2DA 2AN3A 4ALIA 2XD9A 1CJCA 2WPDD 3AM5A 4IV5A 4N9IA 3V48A 4BVJA 4IQJA 5CFMA 2CJYA 4F3KA 3JRHA 2RKWA 3PC3A 3L84A 4J7UA 2XH8A 2K27A 1DXYA 1RYBA 1HO3A 5ECGC 1TC3C 3EWNA 5H0IA 5L7YA 4YLYA 1V39A 4BXOB 3WNZA 1JEQA 2GMWA 5JC8A 2WJGA 3ZMZA 3AY6A 4JELA 4AJJA 4E5DA 5FHRA 2W2OA 1D5VA 3O1IC 4H4KC 4G6ZA 1PJAA 2YWXA 1TQ6A 3OUUA 3P9RA 4FHZA 4KQIA 2B6HA 4PLTA 4XCVA 5DXAA 1VLZA 3EOBI 2OYRA 4DA0A 4I76A 5AIBA 1ZG1A 1ADYA 4BPBA 2YH2A 4FC7A 3DFZA 4F92B 4J76A 3X0DA 3V7NA 1PG0A 1P4JA 4KUMA 3CCBA 3RLFA 1HORA 1DFGA 4E1AA 2CU7A 3ZCPA 2QZZA 4ENRA 4OYYA 1PX0A 3OPYA 2WJAA 3WQSB 2A3RA 5AVOA 2GCNA 3M0EA 4QTZA 4HQLA 3U3DA 4X0GA 3DE1X 2ZT7A 3SJZA 1U8TA 1V3UA 5AXBA 2GD6A 2PX0A 5FPSA 4W5NA 5DM4A 3ZDZB 4W5WA 4NMXB 2CL0X 3N53A 4GX1A 3RRFA 3LK6A 1A71A 1IUKA 3I09A 2AJCA 5C80A 3L7JA 2PE5A 2WAQA 4Z4CA 3GJ5A 2ME0A 3I9JA 4HVAA 4NZPA 3FHOA 1SULA 3G13A 1X14A 3LC1O 3HDHA 1HTTA 2M1XA 1KJIA 3T41A 2Y66A 3E4CA 5FFXA 1UOEA 3FUTA 5F08A 3OUTA 4G2NA 1SXJE 2VUMJ 1A95A 3M2TA 1ZLXA 4S1PA 5KHAA 2EFWA 2H2DA 3W9YA 5JSUA 3FM3A 1ZN2A 2HVSA 3OCWA 1M7BA 3OYKA 3E6CC 2DFIA 4AG6A 4CYCB 1A35A 3HXOA 1GTRA 1K68A 4CHGA 1NVEA 4Z4QA 4P92A 2E5ZA 4XLFA 3GFQA 4UNPA 5AM5A 5B53A 3U5ZB 1XXLA 1BVRA 3HEBA 1IQUA 4HVLA 5FB3A 5K7FA 3DHVA 3UPUA 2E4WA 2GXQA 2YL2A 3ADPA 3IA2A 4PC1A 1SH7A 4W82A 2RV8A 3V80A 4BMVA 1CW2B 3PUYA 4LFUA 3V8JA 1TWCJ 2LW7A 1FNDA 2R00A 5HIMA 4ZDWA 4BN4A 4JNCA 1NG9A 2REXB 2V97A 2Z2KA 1OVGA 1HKQA 1W4ZA 3G3EA 3GRUA 1NW5A 2F4NA 4WL0A 3V33A 4HTFB 3HFGA 2LSOA 2FSIA 3E9MA 5EIOA 3VB2A 1O6GA 4ZU1X 2NUBA 1MBEA 2XQVA 4S0XA 5DBHX 3VNSA 3SR0A 4CN8A 5J2UA 1GLVA 1PX2A 3E6DA 2R6JA 2QPTA 3GGGA 3H0CA 3OKCA 4IILA 4M4SA 1HBJA 1UPXA 4RS3A 3UV3A 2EFYA 4JYPA 3P2MA 4OHKA 2Q21A 3LSJA 1QB8A 2ZBQA 3VA7A 3T3PB 5B64A 1DSSG 4N47A 4EW3A 1J5XA 4L5IA 1WL8A 3KZVA 4JJ8A 1TT0A 4LI0A 3GMSA 2CWWA 1N7IA 4EJTA 1V9SA 1VFPA 1Z73A 2HMYB 3IEIA 3NH9A 4DA9A 1E2UA 4LXQA 3R9XB 4PZAA 2Q4DA 2ZJ1A 2XGEA 2VN2A 3H05A 5D5VB 2WTAA 3W7VA 5I7RA 4F1KA 4R1UA 2PMDA 1W0CA 3AL3A 1DJOA 2VKEA 1JFFB 2F43A 2IYWA 3E61A 5KWEA 4QUDA 2PRYA 3M07A 3UAWA 3U5TA 2R8ZA 1XJCA 3BK2A 1RXVA 1RPZA 2P91A 4K1LA 3VVMA 1FF9A 3B8HA 3RABA 3L77A 3VNAA 3WE7A 3KCCA 2VT7A 1VF9A 1UWKA 3SJUA 5C5CA 4C08A 3EWIA 3IUBA 4IGEA 3U9GA 1ZD2P 2D5VA 5CB6A 4KNWA 4WINA 4X62B 1B8UA 1X7ZA 2E1NA 2XCIA 4HX5A 4J16C 1TUIA 3F6EX 4DFDA 2HDOA 5I5GA 2BKEA 3PT5A 3FYTA 1AQNA 4A3GJ 3T9FA 2CE2X 1TYZA 2GEUA 1JVNA 3P71T 1OXUA 3AG4H 3IIKA 1EX7A 4WECA 4ZXPA 4E09A 3UK6A 2EB7A 5IDWA 4DUYB 4LW8A 2QD4A 2P5SA 1XVUA 4ALMA 1DBQA 3TSAA 4EGYA 4Y13A 2D2IA 2FSPA 3BCSA 3HU3A 2FX5A 2NQTA 4LHEA 1FBSA 2X7XA 4DQLA 2RGXA 1M2EA 2P7IA 3CLRC 2I34A 3OA0A 2TRSB 1RAFA 3LLUA 4DW6A 1AS2A 1FSGA 4HPWA 4YT8A 2DG2A 1PV2A 3ZLUA 1F7VA 1TA0A 3DOJA 3L40A 5F76A 1KK2A 1RYEA 1BMDA 1JGSA 3MWYW 4N5NA 1AHPA 3NHJA 2H4WA 3V2UA 1K4KA 3DL2A 3FDZA 1R0SA 3JVVA 4WKNA 3CUUA 4MUFA 3WDSA 3CYFA 3HOVJ 4XE5A 2VHYA 1HDXA 4ND1A 4MTDA 3EUHA 4BKPA 3AF3A 2A6HF 1BVYF 2J0UB 3EQLF 3J7TA 2H8RA 2Z9OA 3CX4A 2PNJA 3QHAA 2XXAB 2G08A 3KQWA 2UXCB 1MGTA 3W6ZA 2PS3A 4ZMRA 4CHTA 2R6DA 1T1EA 2QNBA 3MT0A 1MIHA 4KQWA 4A3EJ 1AE1A 5LJIA 3SZMA 2Y0BA 2H00A 5L3SB 5LKRA 3VO9A 2DOKA 1J56A 1E66A 2AB0A 3KEOA 2VQ3A 5G1NA 2HWVA 2PMEA 3QVOA 1R5BA 2RHWA 5GMOA 1J70A 2NNNA 4DIUA 1O1YA 4O6JA 1G63A 5HNHA 1YBVA 3E0XA 3PUWA 4OGLA 4KFTA 1D6NA 3CQZJ 3OCJA 4HNAA 4D3ZA 1EUQA 3DEHA 4I5GA 5IJ9B 3NNNA 1T33A 3DZ8A 4CYMA 4QDXA 1B7GO 4MMZB 5C52B 4ZEOA 2M7BA 2VTDA 2RI0A 3GLHB 2GK7A 4BE2A 3AR7A 1Z13A 4IJMA 1NPTO 1QQ5A 2H7CA 5DE3A 5BXQC 2JKZA 5A03A 5LOVF 2IC5A 4U7DA 4GT1A 3PU6A 1G21E 4OMUA 3HL2A 2H1LA 1QGUA 4U0WA 3P0HA 3L7DA 2KFDA 3AF0A 2JGNA 2BKAA 1HCRA 2EX4A 4QGGA 3RKRA 1AGPA 1T2NA 1VQKI 3HB7A 3KOYA 4BNHA 2P4SA 3CUQA 5AW2A 1UODA 1Q14A 3ZUPA 4JEUA 2JAPA 4EZBA 4BNGA 3W79A 1U8YA 3ZCSA 4CF5A 3C7KA 1O9BA 4Q3LA 3ZHZA 5CU7A 3DTEA 3TQIA 4DDHA 1W75A 1TD1A 3HZOA 4HQ0A 4D4LA 3Q6IA 3FPAA 3I9V1 4DABA 3CF2A 1R5NA 1WMFA 1MAUA 1Q50A 2QXTA 2DXIA 1J4AA 4XM1A 4RCVA 1C9DB 4NATA 2AYXA 2ATVA 3W5SA 3BTUA 3BR6A 1KJZA 2HV9A 1MU0A 4Q3AA 4DJDC 3A6HA 5IRCD 1D0SA 4JLOA 4LRXA 5JZOA 4MARA 2V7QA 1BWQA 2JGFA 5EQDA 4KQHA 1C9KA 3GA5A 2VUHB 3BRQA 4TYMA 1VRCA 2V7QD 3HUTA 1XP5A 4WFIA 3AJ8A 1E2MA 1U8UA 3SCZA 4YPVA 1JMKC 1T9HA 1GZHB 3WHBA 1C3JA 3WU2C 4W1UA 4IJQA 1DLIA 3LHSA 2R7TA 1K66A 1ZJ6A 2R2GA 5TDHA 1N8TA 5KNDH 2GRJA 1DOAA 4ZO6A 2FSSA 4ITUA 1G3IA 3UGQA 5BMVF 1RU3A 1U5BB 4XX1A 2EA4A 2VKHA 3GN2A 4M86A 4A3BJ 4YJFA 4MFDA 3LKDA 4B4VA 4QHTA 1BHSA 5DTRA 2RQPA 2CXTA 3A4IA 1UK7A 3LBAA 4DEYA 3UGTA 1YI0A 1FQJA 3WTYC 2VPQA 1YH3A 4EHLA 2CDRA 4L75A 4PPGA 1BI2A 3O8HA 2VWHA 1A2OA 3L18A 1LFPA 4G8DA 4MW7A 3A0HC 1Z82A 2ZREA 4PO9A 4S04A 4R8MA 4BPRA 5BQ3A 2VQHA 1F5TA 1U6GA 2E7WA 1B3BA 1GEGA 2NU6A 2GD2A 3TSCA 4BGEA 4E7PA 3GDOA 3TNYA 5JROA 3BGIA 1CZNA 1CX9B 2VHXA 4HRXA 3SLGA 2RCYA 1XKTA 3TN7A 1LBSA 2ODAA 1GM5A 1R0XA 2HA5A 4ZO4A 4EKNB 1MOPA 3DYBA 3ZG6A 4E5NA 4Z2AA 2GYYA 1K63A 3FVTA 4LY6A 1YBFA 3IA7A 1HLDA 2PZ8A 2WAXA 4JBHA 1TAUA 4HAYA 2IBDA 3N6VA 5AOVA 4ZKDA 1ADGA 1XRJA 4JL8A 3TW7A 4F7ZA 2HBRA 3KDPA 3QVKA 4BBZA 3GLTA 4A8TA 3A6KA 5MFZA 4G0VA 1KO5A 2B7CA 3ROEA 2WYIA 3LSTA 4YV1A 4G0OA 5B2EA 2GPAA 3OX2A 1OYOA 1R27A 3L2OB 4E4RA 3A6GA 4TT8A 1CZUA 1WQ4A 4ER7A 4AMBA 2QDXA 3E8SA 2ODPA 1DTSA 1TNSA 2M30A 2GVZC 2OCPA 3O8NA 1Q95A 3ONDA 3ZK7A 4F11A 1R66A 3K9FC 4OQEA 4EFDA 4BE0A 1GA6A 1TZKA 2EW1A 2X9LA 4YS6A 1SD2A 2ZRKA 1ITYA 1QQIA 1Y4DE 2FEMA 4FBLA 1OLOA 2Q28A 3GCZA 3HLTA 3Q9LA 4AIJA 2GJ8A 3B53X 2XNDD 1J00A 1JH8A 1XE3A 2FWRA 1L5FA 2WKRA 1O97D 1NY5A 2N1MA 2XLCA 1KQ0A 3B1XA 4AX4A 4YUXA 1HNZB 2O8BA 2H5JA 3T3NA 3ZDFA 1EBFA 2P0YA 1N0IA 2F3UA 2A9RA 4FYVA 4DCTA 2BFPA 3IPLA 1E3DA 4IUBS 4ZAYA 1MEJA 5HIIA 3SVLA 1Z29A 4HXEB 1LRKA 2OC6A 2PG3A 3N0TA 3TBFA 4CDMA 4C05A 2DQ4A 5K4HA 1H93A 2ZOSA 2YV5A 1MIJA 2QYOA 5I3ZA 2ZTUA 3UJ3X 1PGNA 2GGSA 1E9SA 2FLWA 4ZHQF 4UOZA 1UBGA 2NTJA 3BM5A 4OBEA 4X41A 4FGLA 1FYDA 1H8EA 1V54H 1S0UA 2HF8A 3DDWA 3KKNA 1CUZA 1HA3A 3B1JA 3IMCA 1VM6A 5EYRA 4XL9A 3H3UA 1BMFD 2BFBB 2JK1A 2AD5A 2WE8A 2ZETA 4G6TB 2P6OA 4L73A 4ARIA 4EO7A 5CYPA 2EL9A 2O3SA 3UFXB 1OKKD 1ODKA 3IQGX 4NV0A 1GSAA 3UV6A 3PLRA 4HR7A 2EWNA 2OY0A 3QTTA 5SV2A 3D1NI 1CY8A 1WFXA 3LLCA 4LK2A 1Z7WA 4BTLA 2Q8PA 3ZVKA 4NCBA 3ONVA 1LPAB 3ETLA 2WV7A 3FSGD 2QROA 5F35A 4EJ2A 4LK1F 3FDIA 2UYQA 5LL6P 3RAEC 5EIFA 4BAZA 2XAHA 5ED4A 1A9XA 1QBJA 1UKEA 4YRAA 3OX3A 2QJTA 3W3AA 1M8FA 4UV8A 4L5AA 2HHCA 2DFLA 2EERA 3EH1A 3G1TA 2G9VA 3FMPB 4FHDA 1LJ9A 4HLQB 5AW7A 1IRZA 4PC3A 3U6KA 1OH8A 5L3EA 3PL1A 4RK5A 3QOYA 1IWBB 3VNBA 1SUSA 2GZ3A 5ICMA 2QG6A 4ID3A 4BFSA 4UTPA 2UYOA 3O3MB 2GZHA 3NBMA 3EVBA 2FSHA 2JGRA 3D0KA 1THTA 1F0NA 2QM7A 2AK3A 2JARA 3A7DA 3QPVA 4DA8A 2FFJA 1RI3A 3PXAA 5TIIA 4BFXA 1UQUA 5CM2Z 5F51A 3A2KA 2L0KA 3CY6A 2X6QA 3DA8A 4JVMA 1JDTA 3DPIA 3VRHA 3IBFA 3KLMX 4RXUA 2BSXA 3EXHB 2W84A 4XM2A 1S6YA 3DDNA 1J9IA 1GVDA 5FOWA 2VQ6A 3BSSA 2DK5A 4P4SB 3N0RA 3LGSA 5LXTA 2O7VA 4EX6A 1WJFA 3TI7A 4P5EA 1O94D 1F8GA 1VKNA 5BR7A 4P0PB 4OEHA 4O4IA 1A98A 1N0UA 3MZHA 4IVNA 1B73A 2ZBGA 5EY5B 2F00A 1U28C 2PRIA 1TIBA 1XCMA 3IDOA 5IZCC 3WTWC 1VKHA 3BZBA 3GQBB 2VPXA 4H7IA 3VJLA 3IVMA 1LF5A 2QQ5A 3KQSA 3FVVA 1L6IA 3BJEA 3P52A 4AJ2A 5GADl 1N5MA 1E5TA 4EB0A 1HNNA 2YYAA 5HF6A 3ETGA 2VXOA 3ZIAD 2R44A 3I8XA 2REOA 3ERMA 1G4AE 3K94A 2C0QA 2FE1A 1E6MA 4IMIB 4IZ6A 4QLAA 1M5RA 1KYXA 2XXAA 2CSUA 2IDMA 4GSYA 4M46A 2PGXA 4NBLA 2C9OA 2P7VB 4X66B 4YGXB 4YB8A 3FCXA 5JSQA 4Y17A 3I12A 4K2HA 1Y6JA 2R6GA 2ZJ5A 4BQQA 1RXCA 3KP5A 4LV6A 3U7JA 3CNOA 2RGCA 3FDZB 1NBMD 3QVTA 5ISMA 10MHA 3LYLA 2BZSA 1K78A 2XDQB 4DNFA 1YQTA 2D1HA 1OCEA 4ZVPA 1U63A 2J41A 3M3PA 3MUEA 1WU7A 4LRYA 3ZE0B 4CGYA 1HK7A 1T2AA 4ZQEA 3SFVA 3ENKA 4RHCA 2C78A 2EOAA 3D3NA 1IN8A 3CLHA 4IM7A 3D4BA 4KP7A 4HL6A 5TB5A 1EFRA 3HB5X 2NZJA 4MRSA 3KZCA 4TTIA 4ZVTA 1ZJZA 4M6WA 1F38A 2CEKA 4MMXB 2FJUA 3QV2A 5J3JA 2X1LA 2XIQA 1S6LA 1BKYA 1RJEA 2BFOA 3IQIX 2I3BA 5LP6C 3KCNA 4TYPA 4I50F 5CTJA 5KNDD 3A9UA 1C8KA 1N6RA 2UKDA 4TV9B 2ZBVA 4YIKA 3LLMA 3VJMA 2YHUA 1QH9A 2AGVA 3LXXA 2HIGA 5CTAA 2FN3A 1HA8A 4S35A 3UXEA 3E5HA 4QXOA 1USWA 1P5RA 1V7QA 1T6YA 3AM4A 3QPCA 3U2QA 2KPMA 3CH6A 2GTPA 3PLNA 1YQXA 2FUKA 4ID9A 2HPIA 4ENKA 1K4SA 2I91A 2D1VA 3DE5X 3VC7A 3KQKA 2CD9A 1K3UB 3KLBA 4NWIA 4QU9A 3O83A 1J23A 3SHWA 3EE6A 2YW2A 3KHKA 4OHXA 4WBNF 2D1QA 1NVWQ 4E22A 2ZZNA 1JFFA 3RE1A 2R87A 3ZHSA 3WHKA 4LRSB 5CBPA 2C5SA 2LKCA 4AC9A 1YW8A 2I7VA 3CX6A 2CW7A 3QOFA 3UG6A 5A0FA 3FXQA 1YS9A 1ZH2A 2GPYA 3CRW1 2XWPA 3CUTA 4YFKF 3F8TA 3H2SA 3TDKA 4B7UA 4P9FA 1N9GA 3L2RA 1I6WA 4LJLA 4LVNA 1NKVA 2NPIA 2VN8A 2YUIA 5IPAA 2GBLC 3QI2A 4I7EA 3HGGA 3EGEA 4TVKA 4CMJA 4DCUA 2PUFA 5K3SA 1IUOA 3ZS9A 3FBWA 2X5KO 3GFFA 1Y1PA 4QX6A 3JW4A 3IULA 3JTEA 5B4UA 4EQ6B 3URMA 2O8CB 1IOLA 3HQ4O 3O2JA 3HM9A 1VMIA 1RNLA 3ZW9A 3EX7C 4X20A 4ZTUB 3NT5A 1DUXC 1R8XA 2GM3A 3KJGA 4TQAA 5IT0A 1E8DA 4DARA 1ZMTA 3RR2A 3GF2A 2E18A 5EIAA 2H54A 1KU0A 2XCQA 3H19A 2FEPA 3GRVA 3KM0A 1GWNA 3D8NA 3GPDG 3KUUA 3H8WA 4G5QA 4QOFA 3JQ8B 3R7DA 1NY6A 2DE0X 4YYEA 2B4RO 3WGUA 2P9BA 4N39A 2OCXA 3GJ8A 5ARCA 3WO0A 1IE3A 3F6VA 1L5MA 4FMDB 1GCAA 4YDHB 1GTZA 5ILGA 2ZAYA 3BFPA 5A02A 2YBEA 1JEYB 4WEOA 3VSLA 2PX2A 2OO7A 4QO8A 4Y9TA 2JFVA 1R22A 3BE5A 4ZQBA 3AU8A 721PA 3QQAA 1BW5A 1NTRA 1W5TA 5HQTA 3TW4A 1W36B 3V1UA 3KQMA 3PIIA 4JJGA 1G4UR 3S32A 1JGGA 2PX9A 4HYYA 3KLNA 4M8IA 3CLQA 1K8ZB 2QTRA 4ZQFA 4INJA 3N2EA 2X1VA 1N5RA 2AG5A 2XB9A 3E9EA 4QODA 3DFMA 4IS2A 2H08A 2LE0A 4EA8A 3I01A 3A58B 4YRBA 3OHSX 4DR3B 5P21A 2KWIA 2FZGA 4EPXA 1NK2P 4YT5A 3K1JA 1LTHR 2LF8A 4BS9A 1W4AA 2E4UA 2EKBA 2VPIA 2VR1A 3ELWA 4WUVA 1K9VF 3LI2A 2XTJA 3LOQA 4M8SA 2YWCA 3WLRA 3COVA 3P9IA 2IYLD 2Q49A 4I1SA 1JE1A 4QNMA 1XRLA 1UBRS 2Z1NA 5I47A 1PFUA 3GMDA 5D7NA 4BO6A 1AH2A 5LQMA 3ZXIA 2GSWA 1SIWA 3ORFA 3E5UA 3G9QA 1PCXA 2FZCA 4EF5A 3K32A 3O8DA 4GC5A 4TSRA 1CKEA 1R6BX 1UT6A 4YUYA 4B0PA 4UU7A 1XA3A 4S12A 2XROA 2FF4A 1LS6A 2KZVA 1N5KA 5H83A 3HJAA 3RD5A 3WJ7A 5JD4A 1M0EA 3JX9A 3QG5A 2PZGA 2PXCA 1NBOA 4Y52J 5F6FA 1KEZA 1GZSA 2HA4A 4JA0A 2QGNA 4NBKA 4MVJF 1G4HA 2QZ4A 4YLEA 4B47A 4G25A 1ONSA 2CNKA 4UQLA 1PV4A 3KE2A 1NWHA 1BDIA 1H0HA 4C87A 3E22A 4F9GA 3EC2A 2PLFA 1RJ9A 2BCJQ 2GAUA 1KZ9A 2RHHA 3AB3A 2GDZA 1FDVA 3E4DA 1JHAA 5A6SA 5L6LB 3AKDA 3EJ6A 1UZAA 2C54A 2YR0A 3DFUA 4H6XA 4ZVQA 2IZ1A 2J3QA 2CMHA 2VTVA 3MCVA 1KS9A 1ZNWA 4AN0A 4Y9UA 3HU5A 5L7WA 5JZ9A 3KP7A 1Q74A 5AKEA 3F6SA 1D0YA 4KMOA 3ROKA 1KEUA 1O96B 1OXVA 3I05A 3W6JB 1XB2A 3GFGA 3VU8A 3UAOA 3TXYA 1XB4A 1B0AA 1Q19A 5J8FA 2AJBA 2CBZA 3INNA 5EP3A 3S1AB 4AWBA 4D9GA 3THYB 3AVTA 4JOCA 2GNAA 5ITZB 1PDVA 5K7SA 1TRHA 3R9WA 5KYWA 1POGA 3EUFA 4YMWA 1VE6A 2W6JA 3OCCA 1E2QA 2XRFA 4L0CA 1R12A 1RQLA 3IJPA 4QBGB 4RA2A 5BN5B 3IOMA 3DQPA 3O7WA 4TTSA 1SU4A 2OORA 4LVOA 2IA0A 3IAFA 3NEAA 2J59A 4GYIA 4W5HA 1ZREA 1B1AA 4BQFA 1Q0QA 3HP1A 2H0RA 3EK2A 2IFTA 3MTAA 2B9VA 1BMTA 3K1AB 2VODA 4YGYA 4HDVA 4K9KA 1C1XB 1PL8A 4E08A 5FBVB 1G3YA 4H1VA 4U7BA 1OIXA 2Q8NA 4J2OA 2RGUA 4EB8A 2KMUA 1HE4A 4HGYA 4IX9A 4RL4A 3OZEA 3H75A 3OT1B 3WA6A 4I99C 2QW0X 3HFRA 3UOAB 1LPOA 5L4NA 2BFCA 5EKUA 1NULA 4JGBA 4PG7A 2XBLA 1XN1A 4X45A 3K5PA 4U9UA 4XYGA 5JDIC 5C44J 1TQHA 3SEZA 3NTLA 3FWEA 1G291 4R83A 5HQJA 3F9CA 3DOFA 4RAFA 4RTSA 4NUBA 4MS3A 5A0TA 2NAZA 1Y5LA 3F4LA 4G0PA 1QOQB 3T1TA 4F6CA 3FFBA 2FPUA 4FS8A 2QOEA 3MVPA 2OORC 1JQJC 1JZQA 3RKSA 3I53A 3K9GA 3TOSA 2PCJA 3FM5A 2PJZA 1PEYA 3WGOA 4XD2A 2J9FB 3JZIA 5EZSA 4ZWNA 1FE8A 2VOJA 3L06A 1CF7B 2VC1A 1ACIA 3F4BA 1VZ0A 1C5KA 1K4MA 1DELA 4G09A 3OQPA 3OP4A 3LUDA 2BSAA 4IH9A 1H9GA 4IF6A 2QTVA 4LXUA 3MWKA 4J3NA 1DDGA 3HY4A 3PNQA 1EFVA 1VJGA 4TPKA 3BDDA 4DRZA 1JI8A 3C7AA 1OXTA 4G41A 1FRFS 3RI3A 4F72A 3D43A 4D8YA 1F43A 4PWZA 6YASA 4WNIA 4I08A 1FPMA 3CRMA 4DC0A 5FORA 1L7OA 4JFAA 4ZEXA 2V74B 2GN0A 2B83A 2XUGA 2WP8J 2OZEA 1QC5B 3FUVA 3ZJ5A 2O3UA 4A2WA 5KTPA 1XFDA 2FR0A 3H5TA 3QVGA 1IDZA 3HDGA 4GYJA 2MFZA 1AN0A 1DHTA 3DCYA 3M7IA 3N2KB 3OLVA 4NVRA 5FYDA 4EPWA 3AI2A 2OLJA 1D4AA 1D5WA 5JHUA 1J2JA 1Q6ZA 1YZHA 4MDFA 1KDOA 4LGWA 2ZRIA 4ML3A 1UK8A 3I0TA 3LSIA 3LSRA 1RHJA 2FMHA 2WLSA 3BRCA 2CXNA 2R9VA 3GVCA 1WCYA 4YHBA 1PYVA 1YVUA 2VTKA 3DEIA 3FTNA 4QSMA 4BFWA 3H5NA 1CJSA 1K5HA 2BZGA 2BFFB 2ZYWX 3OIVA 4P5DA 5CVDA 4CNBA 4Z4FA 2YU3A 1IIRA 2IUSA 1VSUA 1B41A 5D5UB 2JH8A 3Q8XB 3AILA 4FGJA 5GOTA 3UKOA 3V1MA 3ZWPA 5GTDA 2H4XA 4L22A 1MTZA 3D1JA 2C9BA 1TVCA 5ALVA 3FOAA 3NM6B 3J81A 1QU2A 1U3DA 1Z56C 2JFNA 4G12A 3F7TA 1U1GA 1P5ZB 1G8YA 1I3KA 2I1LA 2Q5FA 3ACCA 4U0VA 2PWYA 1DC6A 2L7ZA 2AX3A 2I2XB 3DF9A 5ALTA 3WDKA 1OZGA 4XAQA 5H5JA 4ZEVA 3C3DA 3HR8A 3E7LA 3K1YA 2Z09A 5DIZA 2VPYA 4Q3BA 5CT9A 1NK3P 3FPFA 1VI0A 2G5TA 3RC3A 2I4RA 2DYKA 1T5LA 4R71A 2F9MA 3IVGA 1V45E 3FCCA 1MO2A 3IIMA 4ZYUA 4QXQA 3RU3A 4KODA 5JAIA 5KNCA 2R79A 4WY2A 4F60A 1MNAA 4WK8F 4IHJB 2IEZA 1OLTA 2R00C 4UDOA 3RRZA 2HXGA 5T6BA 4PG4A 3TNLA 3ZOBA 2CRGA 1ST3A 1Z5WA 3AHEA 4KAFA 4OHRA 3TFQA 4QPZA 2XUBA 3EF0A 3KQPA 1QF7A 3K9QO 4OXNA 4W9MC 1YMQA 1ZMBA 3SHTA 5L53A 3AUYA 2FZWA 3PUIA 3ZD9A 2TRTA 1YDEA 4X44A 4Z0PA 1AF7A 2X3FA 3HDJA 1N2ZA 4F4JA 3GMEA 2GILA 3BQ9A 3DFIA 1ZJWA 1GPH1 2CN1A 3E2IA 2XV1A 1JFLA 3JQAD 1WABA 3ZQHA 1R2QA 3E58A 5LQSA 3RADC 1W88A 5ALUA 1XF9A 3N86A 5IULC 4HX8A 1JAYA 3VPGA 3KT6A 4E5UA 1DCMA 2XMPA 3JQAA 4EKIA 1W7PA 1YI2I 4EMSA 1PQPA 2IBMA 4LE0A 4MEAA 5E7JA 4AO6A 1HT3A 1W1UA 4TVOA 4UKDA 2V0NA 4W5QA 6GPBA 1H6BA 3PCXA 1K7SN 3M9WA 1U2SA 1GKYA 3AL0B 4HGQA 4DNOA 4D74A 4K9RA 5E7MA 4NYIQ 1EB9A 2ADUA 4FZ5A 3WGJA 5J43A 1RSZA 2XC7A 3SIRA 1JDZA 2AZXA 1ZGGA 1RXYA 3DVAB 3HCPA 5HGXA 4K26A 5GTIC 5HTKA 4CKBB 4D2IA 2L18A 4MA4A 2D62A 4LRUA 3D1VA 4ZI7A 3A9CA 1KQ8A 2ZQZA 2BRUA 1Y5RA 3V8BA 3WFJA 4HAWA 1E2NA 3B3AA 3B3GA 4WEQA 1NR7A 4CG3A 2P35A 4KQ9A 4QYIA 1ULBA 4G7HF 4FCVA 1VQ5I 3HBMA 2Q3HA 4NS4A 4YACA 1ZYRF 1QB7A 3M4YA 2CGPA 1U1DA 2O0KA 4ESOA 1SAYA 1QP8A 3J80K 3DLLF 3EUAA 1N9KA 4QPJC 3T7CA 5IF3A 5JZVA 1MQAA 2ZJZA 3KJXA 4BO7A 1QDUA 3X1MA 3QFRA 4UU1A 5GV8A 3PQCA 4I50A 2EKDA 2ZJFA 2DAPA 3DBLA 1GNLA 3D5TA 1R9MA 1Q20A 3KKEA 5ENVA 4DT1B 1HSOA 4IP0A 4HLCA 2H1RA 3V4OA 3WK8A 2Q3LA 3PR2B 2E1PA 4R16A 2Z3ZA 1I3AA 1LU9A 2C1EA 4G26A 1I32A 1ONOA 1X3LA 2JJQA 2QTBA 2WLTA 1BOBA 3L2WA 1GNPA 2BGTA 2XSZD 4B80A 4E5KA 1BDBA 3NRJA 1RC9A 4YMHA 4EW1A 5A4DA 3D6AA 5AUQA 2A5YB 3RIYA 2EFHB 2OXFA 5LDHA 3GT7A 4LSWA 2Y2VA 3VTKA 5DHSA 4ZI5A 4OA5A 2M1BA 3PVCA 5TGTA 4PR0A 1G6NA 4ZYYA 3JU3A 3DDOA 3QMWA 7GPBA 4L4SA 3WHPA 3DTVB 2F2EA 3CWZA 2HYFA 5DT9A 2WQ7A 3DMFA 1FQOA 3A6LA 3EXIB 3K0CA 5K3CA 2OZLB 1XAJA 3LNCA 5K20A 3R23A 4UM5A 4YUWA 4Q4HA 4BTVA 3AFMA 4BQIA 8LDHA 3QELA 2RSLA 2QY9A 3GJ0A 4RJLA 5KYUB 3HNPA 4EKEA 2X2OA 3KKQA 1SEUA 5CDYA 4ABZA 1BQ3A 2C4TA 1M7GA 3ZWMA 4QM7A 2NTVA 2XRMA 5A9TA 3BMQA 5KCZA 2WUFA 3VZDA 1T56A 2QEXI 2IIPA 1TCAA 4Z53A 2HQAA 3AH8A 2ZVDA 3GH1A 3GRCA 5DDIP 3RK4A 1G1AA 4KVZA 4B17A 1E2JA 3B5IA 3JQ7A 2PMZA 3LSKA 2HSGA 2WNHA 2QTHA 3AUTA 4OOEA 2ZE6A 4YPFA 4HW0A 4Q9KA 2IY7A 2QL9A 4ON9A 4BLOA 1F36A 1EZ4A 2ZATA 3W1EA 1W19A 2JPBA 3EGWA 2UVQA 4O2BF 2VQFB 4RO0A 4Z3KA 4HUQA 3MELA 1C1HA 3EEIA 2VDUE 4KXVA 2Y9MB 4O08A 3RLIA 1NXVA 3RTBA 4X6LA 2C92A 2KP6A 4CCNA 3DO5A 2GBCA 4R1PA 1S9HA 1JWLA 3B3FA 1XZHA 1WMSA 5FNZA 4QYMA 5CCXA 2K9NA 3CH7A 3IQHX 3T7JA 2WUDA 3CKKA 3BR0A 1JU4A 2X77A 2AYYA 4UU8A 5DLPA 4YCNA 1F6BA 3ORSA 1IG0A 3U7QA 4ABTA 1RCTE 1PT6A 3KLOA 2W6QA 1MHTA 3J80A 4ACAA 1Y6RA 3GZTB 4FMCF 2O7QA 1UP6A 1NI5A 1ENHA 1RDFA 3M8EA 3I59A 4LZNA 4EQQA 2VHTA 1UPAA 3FNHA 4RGRA 1KL7A 2NZWA 2V96A 2WWRA 3HACA 3K9BA 3B7PA 4ZAWA 2AE1A 2X1MA 4UUTA 1Z0JA 1H8AC 4CIDA 5I7SA 1XDDA 1CQJA 4MKXA 3UBTA 3TOZA 3G82C 1WV0A 1IVYA 1RI4A 3C39A 4EJSC 1ZLKA 4NHJA 1O5TA 1VIAA 4MPJA 3MSXA 3T52A 2CLIB 2A35A 3WWYA 3PPWA 4DJEC 1N6NA 2DW4A 2IEKA 1K83J 4EG5A 4KTTE 3VR3A 1QP0A 1Z3YA 4D0PA 1J0CA 2CVFA 2F4MB 4KIWA 4UNQA 3ULKA 4DR4B 4LIVA 5AONA 4EPVA 5LU9A 5A5VA 4DYHA 3BDIA 3H4IA 1OZ0A 3VNUA 4Q9JA 4X84A 1LDYA 2V6FA 1N4AA 4X90A 4CMAA 4W5TA 1U8ZA 2FMIA 5BUCA 1AA6A 2Q8QA 1S8AA 2H1CA 2ZJYA 1BM9A 2D45A 4BEVA 2ZZKA 4U0KA 4XCQA 6PAXA 3MCUA 3M8FA 4W99A 2C9MA 1JPNA 1E20A 1AXEA 1BXGA 2GD0A 2HPVA 3I01M 3PGLA 4X1YA 4YRDA 3TH5A 7AT1A 4J7AA