4GO1A

Crystal structure of full length transcription repressor lsrr from e. coli.
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
297
Chain Sequence
EQGMCEEEQVARIAWFYYHDGLTQSEISDRLGLTRLKVSRLLEKGHQSGIIRVQINSRFEGCLEYETQLRRQFSLQHVRVIPGLADADVGGRLGIGAAHMLMSLLQPQQMLAIGFGEATMNTLQRLSGFISSQQIRLVTLSGGVGSYMTGIGQLNAACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAADVAIVGIGAVSQGEQLMIGRKGAVGDILGYFFDAKGDVVTNIKIHNELIGLPLSALKTIPVRVGVAGGENKAEAIAAAMKGGYINALVTDQDTAAAILRSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator LsrR
publication title Structural Basis for Phosphorylated Autoinducer-2 Modulation of the Oligomerization State of the Global Transcription Regulator LsrR from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 297
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04198 Sugar-bind Putative sugar-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4go1A01
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4go1A02
4AWXB 1QQIA 5FFZA 1JGSA 2P5VA 5LHGA 3F6VA 4JBAA 3EYYA 2M30A 1K6OA 1NHAA 5D8KB 4HF0A 3HRSA 1S29A 2Z9OA 5ILVA 3I54A 2RDPA 1KS2A 2A6HF 2WV0A 3V7CA 3N4MA 3K1PA 3O2PE 1FBSA 1K78B 3IXQA 4MEYF 2K86A 2MLGA 3HTSB 1H0MA 4IRGA 3ZN0A 1IN7A 4MNUA 2FSWA 1B4AA 3QU6A 5IT9Z 1RUOA 3MFKA 3UW1A 4KYWA 4GO1A 1S8NA 3COAC 2GIVA 1ZN2A 2IA1A 2G7UA 3CO6C 3EFBA 3CSSA 4AVPA 5HJ5A 2HQRA 2PBIA 1KQ9A 1BI0A 1FP2A 3J80K 1FSHA 3RTRA 2EB7A 1TLHB 3G3ZA 1AOYA 5HLGA 2M8EA 2MBFA 2PG4A 3ZMUA 3ABTA 2BEOA 4JQFA 2BKVA 4WX9A 1Y0UA 2V1DA 4RGSA 4D0PA 2V79A 2W84A 4B8XA 5L3CA 2W24A 4R9NA 2QQBA 3CJNA 1W4MA 1B59A 2BKXA 2X0LA 2JPBA 1ZRDA 5FFXA 3IWZA 5DV5A 3L00A 2FU4A 1RI7A 2ESNA 1MKMA 3WU0A 4EJWA 3VODA 3G73A 2VC0A 1ULYA 5HDGA 3TGNA 4YFNF 4M6YA 4PZJA 1ZRFA 1HKQA 2MA3A 3BROA 4U0YA 3WTZA 1ONVA 3M9AA 5ICFA 1XGNA 3C3WA 1MDMA 4I09A 2IPQX 5BPDA 4A6DA 2FBIA 4IO1A 4OQPA 3KEOA 1E17A 3LA2A 2F5CA 2Y0MA 3BXFA 4MGRA 5CLSA 4QWQA 4KUMA 2VT3A 3Q9VA 4RB3C 4L9NA 4PGHA 4UV9A 4L4ZA 3QOPA 3L7OA 1W7PA 4CXFA 3WTYC 4R8HA 2GA2A 3JAMK 4L0YB 2PEXA 3RIRA 1LEAA 2EA2A 5LGNA 3BJAA 3E7FA 2LKPA 4FT8A 2QYOA 2L4AA 3JTHA 4O3MA 4G6DA 4AIJA 1Z7UA 4IXAA 5KK1A 2CW0F 2UZKA 3I59B 2JPCA 4GGGA 4KMUX 5LHHA 2VE8A 4ZH4F 4EJTA 2NYXA 2WWYA 3SXYA 4UHTA 1QGPA 4ZZDA 4JK1X 1IUYA 1X3UA 3U9GA 5LGUA 2F5FA 4ENMA 1YG2A 4L0ZB 3DF8A 2EFPA 3V8LA 1DUXC 3DKWA 4I0AA 3I71A 2QWWA 3QPHA 3T5XA 2IRFG 5EEHA 1R23A 1BI1A 3LWDA 4XLPF 4LLNA 5FLXK 1SFUA 2GXGA 3FHZA 1LK5A 3R0AA 4WWCA 1T98A 5J6XA 1P6RA 3DXJF 4KIBA 3ZMZA 2ADUA 5HLHA 1ZREA 5BMZA 3TO6A 4EM1A 3WTWC 4FX4A 3ROUA 3HUGA 1WQ2A 3LAPA 4M71A 5CVUA 4KFCA 3D5LA 1O7FA 1KU2A 4ASNA 3T8RA 3F8CA 4G8XA 1MJ9A 3OC6A 1XMKA 4RAYA 4IRIA 1AWCA 2P7CB 3F3XA 2XAFA 3F8BA 1TBXA 3RI4A 2M45A 3CO7C 3NZEA 3KEQA 1YQAA 4IJAA 2M1BA 2YU3A 5HDKA 3EYIA 2R7DA 3MZYA 3GEZA 4U0VA 4O6JA 1IRFA 3GWZA 3J81K 1D5VA 4E70A 1GVJA 4OIQF 4Y13A 3MZHA 4UXNA 4ZYDA 2PMHA 1XSDA 1RIOH 2Z33A 2ACJA 4PGGA 4HBLA 4HLXA 2E7XA 4HDVA 4IVNA 2OD5A 2EV0A 1STZA 4CGZA 1IXRC 3KFWX 4H0EA 2OAZA 4RGUA 4O5VA 4A5MA 2HOEA 3IHUA 5K5OA 3ZMDA 2L3DA 1U6GA 4KT5C 5F64A 4OINF 3F8FA 1I1GA 2XKOA 4LLGF 1OMIA 1EV7A 4ON0A 5JR3A 5BS6A 5JI6A 1P2FA 4WXHA 3GYHX 1BBYA 2HKXA 2VN2A 5DCMA 4Q48A 1SD6A 3IL2A 1HSJA 1XD7A 1HW2A 3GZ5A 1LVAA 1ZARA 5DUKA 2DPDA 5ILSA 4A0YA 2VODA 1IN4A 2PFBA 4LK1F 1F5TA 1K78A 2AS5F 2GNPA 4GXOA 3SZPA 2O61A 1VTNC 1ON2A 5HOOA 1BOAA 5E20A 5K5QA 2ZMEB 4M73A 2M87A 4L5JA 2MC3A 5L3GA 1Z6RA 1U5TB 1D8JA 1G6NA 4UVAA 1U78A 4M9XA 3LA3A 2XKPA 3GX4X 2J5OA 2FOKA 5DYMA 3CLOA 1S7AA 5IT9K 4G7OF 1L3LA 1FPQA 2Y48A 2P5LC 2KIMA 5L3EA 2F5DA 3GFMA 4G94A 1F1ZA 4LGWA 3FM3A 2STWA 4A12A 3HOSA 2KKOA 1GXPA 1CGPA 2DAOA 1MZBA 2LF7A 1XSVA 3HSEA 3WGHA 4BQAA 1IF1A 4OQQA 1JE8A 4RB2C 4Y15A 2ETHA 3E3VA 2FXAA 4A5NA 4EM0B 5FB2A 4WF2A 3E6MA 2IA2A 1ON1A 3HHGA 3QU3A 1OR7A 2JZYA 1S7OA 2YX7A 4EMSA 2PLYA 3WODF 2UWMA 3ENWA 1KQ0A 5A2QZ 1TQPA 3ABUA 3GVAA 4HAMA 3S2WA 1T39A 2P6SA 2XASA 2F5EA 1G3YA 3W6KB 3TDUC 3EUHA 5HDNA 2Q8KA 1LJ9A 2G7HA 1O3TA 5AONA 3GO5A 1IN6A 2Q2EA 1QBJA 4BXUA 2STTA 3IWFA 3QPTA 3ZPLA 2XROA 1XDSA 3NWPA 2H6CA 3JSPA 4NMLA 3GW2A 2R7FA 1HBXG 3ZMSA 4K2EA 2FQ3A 3R4KA 2IVMA 3RKXA 1QNTA 3KETA 1TTYA 1RNLA 4L5IA 2NNNA 2HYGD 1XCVA 2QBYB 4M9SA 1HW1A 3R6SA 5E18F 3EDPA 4PCQA 2HDCA 3M1EA 2D1VA 4P9UA 2D2WA 4KIFA 1XSXA 4IHSA 1FYLA 4HDUA 3MWMA 1PDNC 1R36A 3KE2A 5E1XA 2IJLA 1WKMA 2DK8A 1UJ5A 3ZMTA 2VONA 5ERIA 2GXBA 2FNPA 2RC4A 1Z9CA 1W5SA 3F8NA 2DBBA 4LG0A 4I0BA 2R3SA 3WGIA 4YIFA 2DQLA 3I5UA 3E6CC 3ISPA 4I98B 1P4XA 3BDDA 4XSZF 2HFHA 4BHCA 3WGGA 2XVCA 4FHTA 1ZG1A 1FYKA 5LRRA 1RZ4A 2ZNZA 3BOQA 4L50A 2C6YA 1XN7A 1UFMA 4P5OA 3TOBA 3QP5A 4IF4A 4AD9A 4LMYA 1EH6A 4KNYA 1WWXA 2WC2A 2EFNA 3HSFA 3E5QA 4EJOA 2HR3A 5ILUA 2JSCA 3SQNA 3NEUA 1PP7U 4EGYA 1PUEE 3FMRA 4ENNA 4LLLA 1P92A 2H94A 3HOTA 2KJBA 2W85A 5LEJA 2ZBKA 3FM5A 2WTEA 3F6OA 1G3WA 2XAGA 2A3SA 1F4KA 1M0SA 4TV7A 4CO8A 3CUOA 1IN8A 4KN7X 3VEPA 1J59A 3GFJA 2WU1A 2K4BA 2MD5A 3GFLA 2K02A 2RGVA 5HS7A 1XCBA 1WSUA 5LGTA 1FX7A 3U7JA 3V8JA 1KU3A 3H3ZA 5LRSA 2J0EA 2F8MA 4NHJA 2B0LA 2QUFA 3L2CA 1RUNA 1U5TC 2V9VA 3LWFA 3KP6A 2H6BA 4GYGA 1MD0A 5CVJA 1SMYF 3HRTA 4Q4ZF 2CG4A 1OPCA 2KIFA 2CQKA 1ZLJA 2JTVA 5D5UB 5K1YA 2ZNYA 3CH7A 3KZZA 1FBUA 4BYYA 3SZTA 1D8KA 2K7LA 3HN6A 2LSOA 5EEGA 1ZG3A 3FF5A 3OV8A 1G3TA 3I53A 2EK5A 3P9CA 1XMAA 1MGTA 2ZO4A 4S05A 1KGSA 5TJJA 4MHGA 3KP5A 2DI3A 2HKOA 4OU0A 4UVCA 1YIOA 3FMSA 3GUDA 1LKZA 2V1XA 2KRFA 2VBZA 3M8EA 3DPLC 3E6BA 1FBQA 1SD7A 1UB9A 2HTJA 2XUBA 1C0WA 2CO5A 1S3JA 1IRGA 4EGZA 3WE2A 3LSTA 1S6LA 1WRJA 3ZN1A 3EQLF 4GCVA 2NNYA 3F21A 1Z1DA 1QZYA 2DO7A 3H92A 3V4GA 3VB2A 3REOA 4R79A 5J8FA 1CF7A 4TM8A 2HQNA 1FOKA 3TX2A 2QVOA 5CYVA 3ZP5A 2CWEA 3HSRA 1P4AA 1QPMA 3LAJA 2J5PA 3LHIA 3HYIA 2UXNA 3I58A 1ZYRF 5H6RA 1GXQA 4PDKA 2A6EF 1XGMA 3L9FA 4U88A 1OYIA 1GHCA 1UJ4A 4R7TA 1J7KA 1I27A 5H6QA 5FO5A 5LEKA 3BP8A 3R0JA 1I5ZA 3C1DA 4CYDA 1ZGAA 1FSFA 2EA4A 1J2XA 3RPUA 2ISYA 2HEOA 1LEBA 3RYPA 4OMZA 3L7WA 1PBTA 1O3QA 1KU9A 5A2QK 1HW5A 2V6CA 4L18B 3BXGA 3TKYA 1Z6TA 4MQ9F 1USTA 2PQ8A 1UHMA 5E8IA 1H9GA 3KP4A 1O57A 1ZH5A 2R5FA 2VBWA 3ZMVA 5HVQC 3IKVA 5L3BA 4Z2YA 3JTGA 2FNAA 1MDMB 4S04A 1T38A 2RKHA 5CVRA 4OOIA 4N9IA 4L4YA 3TDZC 2FMLA 3DQVC 4M6XA 5HS9A 3HHEA 4XRFA 2Z99A 5KVRA 2P6TA 3BXEA 1OYYA 4HOBA 3DPTA 2DLLA 2VC1A 2A69F 1W7PB 1Q1HA 2ELHA 2ZKZA 2L4MA 3D0SA 3W6JB 4I7HA 4HX8A 1YLFA 1R58A 1YW7A 5LLQA 1CD5A 3ENVA 3FXQA 5JVTA 2K27A 3TO9A 3ZQ7A 3LA7A 2ZXJA 2FMYA 4KDPA 4ZYGA 5ED4A 4ESJA 3WTSC 3HRUA 1JHFA 1TQMA 3NRVA 2DTRA 2GA1A 2OA4A 4B09A 3IRQA 3T8TA 1G4DA 4KA4A 1I6XA 3VOEA 5TRDA 2ISZA 4TM7A 4HYEA 3RKYA 2VOOA 4LD5A 3VFZA 4L9VA 6PAXA 2P5KA 1B9NA 1BM9A 2XAHA 3IC7A 4A6EA 2MH2A 2BV6A 4ENKA 1UHWA 3U1DA 2LNBA 4ZYHA 4HX7A 2NS0A 2P4WA 1FS5A 1FLIA 2IP2A 1J0RA 4HQEA 1HXDA 3P7NA 3R60A 2A61A 3ECOA 4NB5A 3F23A 1G3SA 3TOAA 2A07F 4EM2A 4EQQA 3PQJA 3M8FA 3SHFA 2QENA 5LBQA 5E1ZB 3RYRA 4AIHA 3WE3A 1OYWA 4HV5A 1IW7F 1YTYA 3TQNA 3MEXA 2DFIA 3E15A 3JW4A 3E6DA 5J8CA 2HS5A 3KP7A 5FD6A 2EWNA 5D5WB 3WU1B 2JT1A 2BBYA 3K0LA 4ETSA 2EFOA 1QZZA 2FA5A 2VXZA 5DCFA 4UVBA 2E7WA 4M72A 4R1HA 3EB9A 2OQRA 2M5WA 1HOTA 4EV0A 1MJBA 4HF1A 1VL1A 2BGCA 1SD4A 1HKSA 2QM3A 2OZUA 4HV6A 5F6FA 3FXRA 3FMQA 2FF4A 1YS6A 2VBXA 3DP7A 4YFKF 2CFXA 1U3EM 2XIGA 3LQQA 1DPRA 3V8KA 1FSEA 1JHHA 1O3RA 4MEXF 1SFEA 3B02A 1TW3A 4GYIA 5E17F 5DD8A 1SD5A 1DP7P 3WTVC 2BYVE 2Z5UA 3I59A 3RJPA 3BWGA 1YS7A 5BPIA 1UCRA 2HWVA 4F7ZA 1XGOA 3PQKA 3QAHA 3FX3A 3OOPA 4XBFA 2DW4A 2CYYA 1J75A 1LDKB 4UV8A 4WXCA 1HORA 3CDHA 5DCMB 1WI9A 1V4RA 3T0YA 5BQTA 4ESBA 1LQ1A 2FRHA 5BOXA 4OIRF 1FYMA 4ESFA 4WXDA 5FD5A 5D6EA 2LDUA 5E1WA 4MTEA 1V3FA 2KJCA 1R1UA 4XSXF 4LB6B 4M8LA 1B9MA 2CSOA 4RB0A 4KIGA 1PP8F 4G7ZF 3E5UA 4Q47A 4HZFA 3FZVA 2AXLA 3U2RA 3KLNA 2A5YB 3GZ6A 3IKTA 5CJ9A 2H09A 2L02A 3V7RA 4EJUA 1BIBA 4BNCA 3HTUA 1A04A 4GMKA 3WTUC 4MTDA 1LNWA 2OQGA 3I64A 4RGRA 5DDGA 1IZ1A 1O7LA 4I01A 1USSA 3KCCA 5K5RA 2RQPA 4ZYEA 1L0OC 2IA0A 4UNOA 2IT0A 2O6GE 3MQ0A 3IRRA 2VBYA 5CVVA 4G6QA 2E1NA 2PMUA 1FS6A 2FBKA 1KYWA 4CHUA 2YR2A 2OU2A 1LB2A 1FQOA 3LQRA 3EETA 3ECHA 1YW8A 4NQWA 2K4JA 3HIFA 5ICCA 3R61A 1MJAA 3ERED 4HW0A 1LDJA 1ZAOA 1KU7A 2KIUA 3M7GA 3ML6A 1J9IA 1FC3A 2XGXA 1DEAA 2Q0OA 3KWMA 3ULQB 1T6SA 5L3DA 2L54A 4HF2A 2W57A 3CUQB 4BHBA 4OIOF 2P8TA 1R5GA 1BJAA 3ICOA 2XHKA 3Q5FA 1FZPB 1LDDA 3LFKA 2YX4A 2O0MA 1BI3A 1QO0D 5CVIA 5DD4A 1U8RA 2H27A 1R1VA 3JSOA 5HLIA 4HLYA 3KLOA 1YFHA 3DV8A 2D1HA 3F72A 2OBPA 4CDGA 2PN6A 1SAXA 4HX4A 1JXSA 3RPQA 5E8GA 1B6AA 4KICA 1TNSA 1T0FA 2YSRA 4IHTA 4LG0B 1K79A 3RKWA 5FGMA 2GZWA 2ZMEA 4LB5A 4M74A 4IRHA 2L01A 2IW5A 4QLCU 3K1NA 2DQRA 1U5TA 5DUIA 3O6BB 3C18A 1R22A 4YIIA 4DNCA 2XRNA 3GFIA 3GXOA 3MCZA 1SFXA 4YG2F 3E97A 2PJPA 3J7AO 2OKGA 2UXXA 3ENQA 3Q9SA 4CICA 3J80Z 2RVCA 1ZRCA 4OIPF 4L9TA 3F22A 1K7AA 3BJOA 3B73A 3GF2A 3L09A 2EV6A 2Z3YA 1E2XA 2VOPA 1YW9A 3P9IA 1FY7A 2TDXA 4OMYA 4CZZA 1IN5A 2GAUA 2RI0A 2O03A 3K1MA 2XAJA 2GWRA 3H3UA 1BIAA 5AIPA 3KP3A 1YO5C 3AAFA 2EFWA 4L51A 4X84A 2FEZA 2QQ9A 3KV1A 1B1BA 2F2EA 4LJZF 2CGPA 1XB4A 1HQCA 2DT5A 4Q5SF 4RS8A 2DK5A 1HKTA 3BY6A 3C7JA 2OZ6A 3CTAA 5IT3A 4A0ZA 1U2WA 1W5TA 4G7HF 1REPC 1IXSB 2LF8A 1ZGJA 3BXHA 3I0TA 4P9FA 3F8MA 2QQAA 4L9JA 2ZCWA 2VE9A 2PI0A 1DDNA 3SFZA 4FX0A 1YYVA 4LK0F 3RDIA 4BAYA 3I4PA 1HSTA 2QBYA 3WTTC 2QZ8A 3BPXA 3JAMZ 5DEQA 4XLNF 4ZZLA 2FBHA 1BI2A 4I2OA 5ICEA 1P4WA 1FRZA 2FE3A 1DPUA 4Y17A 4G9YA 5L3FA 3QRFF 1TQIA 1NE7A 5ICGA 4BH9A 4RB1A 4MQVA 1BC7C 1EH8A 4I02A 5D5XB 4EVIA 1F9NA 5H20A 4U7BA 2XV4S 2V1UA 1J5YA 2P7VB 4HQMA 3E5XA 5AIQA 1FP1D 3KZYA 5D5VB 3O3KA 3NQOA 2RNJA 1FWZA 2ZFWA 1ODDA 1Z05A 1UJ6A 3DEUA 2GQQA 4U7DA 1Z91A 2QLZA 2VT2A 1KYZA 3K9TA 3FWEA 2XAQA 3MAJA 3WG9A 5FLXZ 4RGXA 2Y75A 1O8BA 1O3SA 3BJ6A 5JFRA 5F1RA 1TNTA 2EFQA 4N0BA 2MLKA 5D4SA 3CUQC 3ELKA 3T1BA 2EV5A 4LFUA 2RV8A 2HZTA 1ZG5A 2O3FA 2BE5F 2ESHA 2D45A 4M9ZA 1CF7B 1SMTA 1IXCA 2NAZA 4UUVA 3TO7A 4HA8A 1T2KA 2A68F 3HHHA 3QP6A 2O0YA 4WK8F 4BHPA 2YPRA 5D6FA 2E1CA 4EJVA 1XTZA 1XDUA 1LK7A 2RN7A 2HGCA 2JRTA 2DU9A 4ENJA 5D8LB 1R7JA 2RI1A 5JHUA 1ZLKA 1D3YA 1R1TA 2MH9A 2W48A 4AIKA 4WCGA 1ZHFA 3KP2A 5HS8A 3J81Z 3FXUA 1I1SA 1JT9A 1W7PD 2NRAC 2G9WA 1XGSA 2EJRA 3HRMA 1EH7A 4IPAA 3BZ6A 3PFIA 4KMFA 2HTSA 3BPVA 2W25A 3K69A 1FNNA 3V7SA 4N9HA 3WTXC 4DQ2A 1H9TA 3GLXA 1Y89A 4A2UA 5LHIA 2O8XA 1OKRA 2COMA 2X4HA 2ZJ2A 1FT9A 1KA8A 1KQ8A 3CUQA 1R00A 1BN5A 4P96A 4KN4X 2HYFA 3P9KA 1IAWA 3K2ZA 2DPUA 3N97A 4P55A 5D4RA 4RAZA 3DFGA 1BC8C 4YFXF 1R5HA 1TW2A 4U0WA 4A0XA
chains in the Genus database with same CATH superfamily
1NBWB 4QRHA 1UIRA 1FNMA 1J0BA 1TF7A 1Q0LA 1KVUA 4HXGA 3STVA 2PV7A 1U2QA 3UYLA 4TYPA 3JVIA 3HZHA 5C3MA 3ICWA 4MGZR 3V7CA 2LR0A 4R5MA 1MAHA 3H7AA 3FRJA 2GPWA 3ZE1B 1GNLA 4IWYA 3KZKA 4RO0A 3WSVA 4WECA 1XHEA 3M4NA 3I8SA 1QFYA 2P75A 1KQ3A 1T8IA 1IHOA 1RI3A 2JEZA 4HLNA 2PXAA 2R6ZA 2ZUVA 2NX2A 4IMIB 4X20B 3FPHA 4KDRA 1YTLA 1TF5A 4G1UC 4PRLA 2PQ0A 2YMLA 4MW9A 4B1FA 4QOIA 4XEUA 2Y0EA 2MSYA 3L4BC 4EATA 1Q16A 4L1KA 5K3DA 1WBJB 3LSHA 3Q88A 1MQ9A 2L7KA 4KGVA 3KPVA 1SHTX 4CM8A 3WBJA 4NI5A 1XYYA 4G1BA 1NFFA 3AVVA 4DJFC 3ESWB 3RASA 1YQGA 4B40A 5DV5A 1MKMA 3WU0A 3AI2A 5HYVA 5KX5A 1T2AA 3QF4A 1W1WA 1D1AA 2XF8A 5CLGA 1HKQA 3BTIA 1TVKA 3UENA 1SFOJ 2LPMA 1XZNA 4JQZA 3M9AA 3G2NA 2ZCJA 1E6LA 4QQ8A 3LY8A 4RD6A 3PIIA 4O6VA 4RXTA 4BACA 4NG5A 3G4SI 4X0EA 3DLLF 1XQ9A 4DLWA 2E5NA 1U2GA 2HSDA 4IILA 4F72A 3Q3VA 3ZW7A 5K3OA 3OTWA 4YUVA 2B63J 3KELA 2BEUB 1T4MA 3CF4A 4YRSA 3PNPA 4PWZA 3N7TA 4FT8A 2X9VA 2GBPA 3L0IB 2D1QA 1GRRA 3H11A 3X1MA 1ETOA 2F4NA 3C3KA 5LZ2A 1I3NA 4Y2GA 1Z0AA 4R8LA 5FUQA 1Z22A 3OAAA 4BFXA 1VTKA 4KUEA 2B5OA 4QGAA 2ZRAA 2G1JA 2WC1A 4JYCA 3S2ZA 5ALJA 1IUYA 1Z5OA 4QTUB 2XVYA 1JLLA 3DAYA 3WWCA 2YMQA 2ZDHA 4MWSA 4QRIA 5DTDA 1RD4A 2DFTA 3EPZA 4LTDA 2IW1A 3QBVA 4YT2A 1ODIA 4FDTA 4E12A 1QMPA 1G59A 4DDWA 2GHRA 4KLZA 3R0AA 5DCLA 4IDFA 3VU3A 2NQ2C 3BG3A 3IOCA 3W7VA 3KJQA 1C3LA 5LA6F 1PUFA 1GGHA 3I6ZA 3LGAA 5DYNA 5GV7A 4J76A 1E5VA 5GMOA 1A9YA 4PG4A 3UGJA 3LAPA 2QTTA 3BD8A 4LHSA 1AQJA 4YT5A 1S4QA 1KYTA 3L77A 2R2AA 4G8XA 4E6PA 4FB4A 1D0YA 2FEWB 5KOIA 1VKNA 1XLWA 1MIOB 1WQ1R 2DMRA 1C9NA 2QVCA 3U4CA 3C6XA 1SQGA 1BYUA 5EUMA 3BJRA 5E95A 4TVSA 1GVJA 3MYYA 5JAIA 2XGJA 2RH4A 1R4AA 2YWHA 4YXWD 1P0MA 2GVDC 2Y1CA 4BDTA 3WNBA 3ZVLA 5IRCD 1WJFA 2OBNA 4G1FA 1ZIXA 4LN1A 3KFWX 2EW8A 3JWJA 2LP4Y 1LF0A 4L5AA 4WACA 3C1AA 1GTL1 3VR6D 2XHEA 2Y9YA 3MTAA 1U3WA 1W4LA 3LYLA 1BKYA 3G0IA 4JUIA 4L0CA 4IVQA 5JZSA 2QN2A 1MNDA 3WHCA 4N3GA 4RTOA 1A7UA 3ORHA 5A06A 1LVAA 1B0ZA 2Z1DA 4XKWA 5IW8A 3FWPA 4MVWA 4EF4A 1GPKA 3T1VA 1QVVA 2JBAB 1K78A 3GLGB 4QVIA 4Q01A 1O77A 4MYRA 1Z06A 4KR9A 4WNAB 4LK2A 1GPH1 3T5AA 5ADUS 4DCNA 1NP6A 4YMIA 5DHUA 4PO3X 2QAGB 4LZZA 1OI4A 1S7AA 3QOFA 2EL7A 2P5LC 3PQ4A 4X6XA 3O6VA 4R3NA 3DDOA 4URYR 1ZL2A 3OO0A 3QVMA 1FJLA 1QX3A 1ZMXA 4FQ7A 1EIZA 1L7MA 1E3OC 1JG7A 3GRRA 1TK3A 3K9FC 1VECA 3R75A 4RB2C 2ETHA 4L02A 4JI2B 4X7BA 1UJ8A 1ON1A 3HBLA 2HMUA 2JZYA 1PP4A 4BMSA 4UU7A 3W0LB 3DOFA 4V24A 2PX8A 3FXAA 1JIVA 4HAMA 4IOKA 1X2EA 2DWQA 1T1SA 3OZVA 1J2JA 1N3LA 2P79A 3W5CA 3MT8A 2Q8KA 3V8BA 3DU6A 1XEAA 1HCRA 3GO5A 4JKIA 4NY1A 2BONA 1Z8DA 4O2BF 1OI7A 4JBWA 3BZCA 2W8BB 2FN7A 2LW7A 1M1XB 4K2EA 1NN1A 1PR0A 3GI1A 1QNTA 2P4UA 4WKNA 2XV1A 1Z26A 3IR6A 3DV9A 3QE3A 1XCVA 1BL0A 3OETA 1M0EA 1SKYB 2Q5HA 2EX4A 1RRVA 3C14C 3GVCA 3RBAA 1A9TA 1OXSC 4MVJH 4RSGA 2IGNA 3H2GA 3AUJB 1MSEC 4HS4A 3HJTA 4BCDA 3AFMA 1PYDA 4YPFA 4BKXA 1Z3IX 3PNTA 3AY0A 2AX4A 4XSGA 1QHIA 3FDZA 4Y6OA 5KWVA 1ZC3A 1SOVA 2JAUA 5ALLA 3RSLA 2VHQA 2XGOA 3I5UA 4BFSA 1E6CA 3S8MA 1SH7A 1FYKA 4D9CA 2ZNZA 4GBMA 4X62B 1TJ3A 1TKRA 4ZAZA 2QL7A 1R1DA 1RXUA 3SLRA 2ZYAA 2YQ4A 4LMYA 1U9CA 4PPFA 4F6RB 4H7IA 4BVLA 4TVBA 4MYUA 3IT0A 2ODWA 4B82A 4JI8B 3V4ZA 3UAVA 3MC1A 2C4WA 1K5GA 5K8UA 4G0PA 5KQMA 2JLQA 1L5HA 3IODA 4K6CA 1IRXA 3DMPA 2XODA 1Y7HA 3FMRA 4R7GA 2V96A 4G8BA 2RIPA 4XM0A 1U98A 3PO3J 1E5LA 5CK4A 2G77B 4TV7A 2ADMA 2HHHB 1QB8A 4FC7A 1SU4A 2EX0A 1V96A 3IOEA 4CLEA 4QO7A 4IQFA 3CLTC 1UZMA 3QUSA 2XVZA 4DIUA 3A9CA 2PLWA 1HQYE 2XOEA 4M3BA 3EDMA 4ZRDA 2ZYVX 4H6WA 1SMYF 5D51S 3TEMA 1U28C 3AR9A 1H0KA 5CB6A 4LDJA 3V4LA 1YJAA 1D8KA 3BFVA 2XZLA 5FIUA 2ZVQX 2DFEA 2A59A 3BILA 4CKCA 1UZCA 2H1SA 2BC9A 2R47A 1G2QA 3EIEA 1V54H 1M2VA 3EVGA 4F2WA 4Q4AB 3FSEA 4HZUB 3HB0A 1NP7A 4KXUA 5IC5A 1IQPA 4M3FA 4XPIA 3L49A 2QXYA 4OQXA 1YMVA 1LWOA 4HRXA 4X8LA 2CO5A 3OYLA 1R0RE 1DPFA 1YFZA 5EPUA 4EGZA 2OILA 2DMTA 5DGDA 2NNYA 4J29A 4NAHA 1FMWA 3JRCA 3V4GA 2W90A 2C4VA 2PZLA 4RPGA 2CMHA 1MV8A 5HGJA 1R12A 4G0OA 1FOKA 4KDEA 2ZYDA 2HJWA 4MROA 721PA 2CWEA 4WPGA 5TLSA 5JXJA 4D4HA 2P4SA 1W0TA 1IK4A 4PSCA 3HYIA 4TTIA 4NDAA 2TMKA 3L9FA 1BWRA 4MVCA 4U5XA 4UPVA 1RIFA 4XUGB 1J1ZA 1PSDA 5EUCA 3UJDA 4OHCA 3ZXUB 2FUEA 2NS8A 2CHUA 1L6RA 2IYNA 3EBLA 4BB6A 3T3HA 10MHA 1XZPA 3BIFA 4R2HA 3QTTA 3HM9A 3DZKA 2E2IJ 4ZZ3A 4B35A 3ZE2B 5HILA 4B3JA 4HQRA 4H18A 3O7WA 3PJGA 3OOUA 2ZKLA 4NCKA 2ZXHA 4IDBA 3BHIA 4KO3S 1OLUA 1H2ZA 5EIAA 1EFVB 5D8DA 1PJRA 5ITSA 1KVTA 4TWRA 1VLLA 2YN4A 1YE3A 4YMGA 4NDNE 2ZTLA 4YDSA 2RKHA 4H6PA 1EGMB 4G0QA 2OL4A 1VHWA 1FA9A 2W2VA 3TDZC 3LM8A 4P81A 1VPWA 1T3GA 5FPQA 2W2TA 1W36D 2WM2A 1QQ5A 1P74A 3AHJA 3ANXA 5HS4A 4CR8A 2BFOA 3U17A 4JLKA 4F4FA 3OLQA 5H2FC 5J43A 1E7QA 3KX2A 5FADA 4DQDA 1PHPA 4GF5A 2XNDD 4BMOB 3B12A 3KKZA 4P0TA 1GNTA 1QLHA 5ED4A 1I4EB 3P7MA 2E5WA 2ZE7A 2ODEA 5H1YA 1PL0A 1O96B 4WEOA 4X8MA 2PH1A 1W44A 2QAJA 1SXJE 1B23P 1ONOA 3O4FA 1GPUA 2Y9MB 1V3QE 4TM7A 2AGVA 3LPNA 5IHPA 2I9PA 1IBCA 3SNKA 4YMUA 2GBIA 1UMKA 1USWA 2I7XA 4C08A 2DLCX 2JLCA 4ZYHA 4PCLA 2P5SA 4HQEA 3QBDA 3DQPA 5M5XJ 2A86A 1JTXA 4DBQA 3AZOA 4PNPA 2H7VA 2VF4X 2AFVA 2IS4A 4X9XA 2QD4A 3IUBA 1GTRA 4EM2A 2UYQA 4LJ7A 3K4BA 1CRQA 4XDYA 4BNMA 3NHKA 2Q0XA 1PJCA 1YBFA 4L08A 3KG2A 4HV5A 2XQJA 2EG5A 4NFHA 3MWJA 3OVMA 5PGMA 2F1RA 1O5OA 2VQGA 5B1EA 4NXNB 5BN5A 1ZFNA 5J8CA 2OA0A 3DULA 4DILA 3VNAA 2PMKA 3ZOZA 4H7KA 1B1AA 4OXKA 2GN1A 3JZFA 2FA5A 1JPNA 2WWTA 4PRZA 2CL7X 2VQSA 3MVPA 4NAUA 1DINA 2OTCA 3TW0A 2BFBA 3OEEA 5H4HA 5BSUA 2D13A 4KWCA 2VP9A 1DEOA 4R2XA 1USUA 5CW1A 2ZULA 2B4QA 4B6EA 2VDMB 1CR2A 3DO5A 4RLFA 1PZEA 4KLRA 4KH1A 1R15A 2O8KA 5ARDA 4WLOA 2K7FA 2E1MB 3GMEA 1M6WA 1IQ0A 3OZAA 5TF0A 3VVCA 4K9OA 4R8SA 4AIIA 1SVNA 2OESA 2QSUA 3H86A 2RIRA 4Y7NJ 3OBBA 3OOPA 4F4UA 4TQ9A 4MV5A 4UV8A 2IDMA 3NTQA 1WSBA 4M99A 1W30A 3U3KA 4C0AC 3ZE9A 2P41A 2BZGA 2WSMA 5BQTA 1Y1WJ 3TW6A 3TPFA 1UWVA 4PANA 3TIGA 3G17A 1IN1A 3EXIB 5GTDA 1A9OA 1U3VA 3SNHA 3RS2A 1K4KA 2DT6A 1DO2A 3ES9A 4JU9A 3RU3A 2DUWA 2V9ZA 3RH0A 1K08A 2WNIA 3C8MA 2AXLA 5IP9J 1AC5A 2A5YB 1Q7GA 2PMDA 3IKTA 3ROFA 1K63A 2H09A 4PFJA 3LCVB 4BV9A 2X1MA 4RMJA 3FVVA 3NWEA 3S8EA 3RJZA 1ODTC 2EJCA 5LXTA 3V9PA 1HL7A 1YBHA 3ZQFA 1Y7IA 3ZJ5A 1N1MA 1LLUA 2W42A 2PH3A 3CZCA 1WB4A 4G6QA 1ZOOA 4XLFA 4OAPA 4LDAA 2Q4OA 2YJ5A 2HK8A 4J1NA 1AV6A 4JVSB 1XT6A 2JFZA 4OHBA 1RZRD 5DLYA 2YQ5A 4J1SA 4ND1A 2J6CA 3S3TA 3OMLA 4RDCA 3S2GA 3HIFA 3E22A 4HW0A 4BQEA 1FC3A 3ULQB 4WZAA 1LPPA 1JJIA 2R5YB 3AY6A 5IVKA 4NE9A 4LYDA 3PENA 3RVBA 1IDOA 4LI3X 4PZZA 5C5DA 1G8FA 1RRFA 4C7KA 2CK3A 1AA7A 3HOVJ 4INPA 2GKOA 2ZS9A 3KBBA 1W5CC 3MUNA 3VGJA 4EFDA 5GM2A 3TO5A 1UKZA 1S4MA 2IYFA 4JX9A 3TTXA 5KEIA 2D1HA 4MP6A 5H8WA 3A2NA 4HAIA 1H9AA 1N8SA 1R16A 4XUDA 4B75A 1C1DA 3AONB 2CJFA 4DWJA 3UPUA 2IWRA 5AK3A 1T4BA 3IT2A 1UEXC 3PXCX 3B6EA 4EB0A 4XRGA 4C88A 3C18A 1NY6A 3L8YA 4NYMQ 1A5TA 4YIIA 5ALDA 2P9QA 1FJGB 3E7LA 2JHAA 5IH3A 3RRJA 2NZYA 1LY1A 5J58A 3DBLA 2ZIXB 3ZWVA 4V1CI 1AZTA 4J6FA 1V7CA 3INYA 1V1RB 3DD5A 1QA6A 1F0KA 2Q7OE 3K2QA 3KEYA 1FY7A 1NR5A 1DBIA 2Q9CA 4G6ZA 4F86A 4JVMA 1I3OA 3PGJA 2CEAA 3SEFA 4YAJA 3K4KA 1MAUA 1ORWA 3O82A 1ULBA 5KQSA 1EFPA 4X84A 2WJ3A 2C07A 4LYJA 4CLHA 3FKSD 3ODGA 1X8KA 4LJZF 5DXFA 3HRIA 4IL6C 1DAKA 3GEPA 1HQCA 4FXOA 5KX5B 1WEHA 2DT5A 4FCWA 3S55A 2VAVA 3UGTA 3PUHA 4Z3DA 3ZHBA 3IE0A 4G7HF 3IOYA 4H7EA 3SYTA 3UBTA 2ZATA 4IMJB 4GZ5A 1CXZA 4OO3A 2OTJI 2GZHA 5AVQA 1P19A 4OK6A 5J59A 2E6KA 3A4CA 1PZNA 1N34B 3DPIA 2V8BA 3K4QA 5ESDA 2QKLB 3ZHOA 3AWIA 2HNHA 1J8FA 5AW6A 4XLNF 1R5OA 1YRNB 1KAOA 3F5DA 1CQWA 4X7PA 1AM4D 5AP9A 1DPUA 4E5NA 3F9IA 2OTLI 2JLXA 2GLXA 4URHA 2EJBA 1NPDA 1BC7C 4ENQA 5D5XB 4IXMA 4ZT7A 1L7OA 3MTBA 3HG9A 5K9ZA 5CXXA 5D87A 3F74A 3GJQA 4IEEA 2FJUA 2XITA 4PN7A 2C9OA 2IW3A 1JI8A 2ZANA 3ND5A 5A05A 4H16A 4FETA 5CM9C 4RIIA 3WLJA 4JOCA 3BCSA 2I4TA 3UHPA 3H17A 3FMPB 1KK1A 3IRVA 1AHNA 4AKSA 2V7BA 4G9GA 1T8PA 2FK7A 1ZNQO 5KVQA 4F3QA 1PDVA 3CLHA 1Z5PA 4TS1A 2Z08A 1UBSB 3PSHA 4LFUA 1AOXA 2FWBA 4XNFA 4DCOA 5AXDA 1IXCA 2D6FA 2W2LD 4V2GA 3FFBA 2HLNA 3C0KA 1EGQA 2RHWA 4IOAF 1TUGA 1RLOA 1US8B 3V4VB 3CEJA 3FNBA 5HJ2A 4PQGA 4BNVA 4MPJA 4I0WB 5HRUA 3SF0A 4NCXA 1I2ZA 3I45A 2Z1NA 3KU1A 3HVIA 3T5PA 1OT5A 4IPAA 1EK5A 4LZOA 4IMRA 5GOZA 4KMFA 3ZVMA 1K6IA 5EXSA 1YR1A 4N47A 3UPDA 2O8XA 2BLNA 2H2AA 1S5LC 4U39A 1N2HA 4RCYA 2HLHA 3R41A 4Y2PA 4PSWA 3U26A 1UOOA 4A8JB 3BJMA 3EOAI 1DOZA 3W6ZA 3GLUA 2AUTA 1IO2A 5T6MA 1TT5B 4BB9A 1ZRHA 1JIKA 3TJMA 2WAYA 2REOA 5I6DA 1FVXA 4O2LA 4A15A 3O95A 3NDPA 4TV9B 5ERYA 1AHDP 4KXYA 2M6SA 2RDPA 3JRAA 1QO9A 4JBNA 1WD5A 3VSLA 2BI7A 1YKGA 3RIXA 1X7HA 2XRYA 4CI0B 3ESYA 3WA7A 1K78B 4AB1A 1DXHA 1RFLA 3HFSA 5CHEA 4CIBA 1H93A 3LOUA 1JILA 3R7LA 2UUAB 5LFAA 2QJWA 4IRGA 3HU5A 2KYRA 1RUOA 3AHFA 2O8EB 4KYWA 4PR3A 4DGWB 5E6RB 2YDYA 5C3EJ 2ZW9A 4EUKA 3V8PA 2YXLA 1TFUA 1P2TA 5JVGF 1COWD 1RBZA 4LJSA 4LOJA 1Q84A 1ID8A 4E2YA 1VRCA 5LOVB 2QTRA 4OGFA 5F3DA 2K87A 2BKVA 4CTOA 2FFQA 1CB0A 2H29A 2H11A 2W84A 2CE2X 3R3WA 4YJKA 2MSDB 1IJKA 1K1EA 1TOAA 1R66A 1WL8A 2IOHA 4DMCA 3E9YA 1KC1A 2O48X 2JPDA 2JGKA 4IH1A 4DDVA 2FW1A 5FFXA 1F43A 3L00A 2R6JA 4I55F 2NU9A 4GR4A 4X44A 1A5SB 3WV4A 3G73A 2VC0A 1ZQ3P 3W9UA 2AV6A 1P9LA 3A9RA 3SDZA 1CG6A 1UQUA 4E1AA 2MA3A 3BROA 4HTFA 1Z0KA 3BM5A 3SK0A 4C0LA 5L3ZA 1IBSA 2JI9A 3C3WA 2CVOA 1WDKA 3I23A 3OE1A 4I09A 2R44A 4U7TB 2LR8A 3DNMA 5L6LB 5BPDA 4CGYA 2PS0A 4MA0A 2ZT7A 1JHRA 2Q5EA 4Q7LA 2NXEA 2VPXA 1E9CA 4IMPA 4YV7A 2NV2B 4RORA 4G89A 2B5WA 2V4JC 3HO1A 3L7OA 4RTMA 5EGNA 2BFEA 2PD3A 3WV5A 4BP9A 2R7KA 4YDHB 3RWMB 1EFKA 4FTWA 3D3WA 1NNLA 2QYOA 2PUHA 1Z4JA 3ASYA 1T33A 2XTNA 2YJTD 2QLBA 3BH6A 4DDMA 1RR7A 5KYGA 3BCUA 1BD3A 4D5CA 1ZD2P 4M9CA 2WY7Q 1CUVA 3F3SA 4ZZDA 4V0NA 4JK1X 2FUKA 1GSAA 4L8VA 3L2WA 1SXJC 3UATA 5BRNA 4K3VA 3V8LA 1U0GA 3E58A 4J9VA 1OIVA 2Z8YA 4II7A 2IRFG 7YASA 5EEHA 3C85A 1QWOA 3G49A 3CP2A 2HWKA 3FNRA 1W96A 4HKTA 3NCHA 4ZTJA 3MVEA 4O2AF 3QPWA 2C7OA 4K40A 5SYMA 2O8BA 1U94A 2W22A 3LP8A 3TW8A 3CPHA 3HL0A 1KAQA 5BMZA 1AZLA 2AQIA 1LJ8A 4P5DA 5I3CA 2MJLA 3QQ5A 2Q3HA 1RHKA 1KU2A 4Z8XA 2IIPA 4R1TA 3Q8KA 1L5HB 4UQOA 4NMHA 3ND8A 3HGGA 1G7TA 3V1TC 4IRIA 4HAYA 1A98A 4DCCA 3F3XA 1UXGA 1FNBA 1TBXA 2H4ZA 1RAEA 4Y18A 5JYCA 4JMLA 1CC1S 2E0IA 3H0KA 3ILYA 5F98A 3J81K 4EFMA 4QGFA 3K31A 1XBTA 2W9XA 3GNTA 2Z33A 4PM4A 4ZMBA 2NW6A 4EQ6B 5T8KC 2QVLA 4HQ0A 2CWDA 4AZWA 2H92A 3CF5F 1DEHA 1UZNA 1MHPA 4F4HA 3O1IC 3GLVA 2C1XA 2O5EA 3H3XA 4UNPA 3HJCA 3QLTA 5ESXA 3R7FA 5K5OA 3HJGA 3UUGA 1YR7A 2ZJ8A 2Q0HA 1H2FA 4UASA 1QKJA 3A6GA 1UWKA 1I01A 2APJA 1A96A 1VQ5I 2XKOA 4F91B 1ZBQA 4GLOA 5JR3A 1VQOI 1LSJA 1CQZA 5JI6A 4CA0A 2AZDA 3GYHX 1OQAA 3EGXB 4P6VF 4WBNA 4Q48A 1MX5A 3M81A 2OEPA 4ERXA 4HFJA 5LJIA 2O8FB 5FNZA 4EAQA 4L0MA 2GNPA 1Y80A 3UV3A 2A1IA 2M4KA 2E3JA 5B1YA 3M89A 2FHPA 4RKFA 2NVOA 5HOOA 1CJMA 5KYUA 3HGQA 1JSRA 1Y4SA 4PLZA 3R3VA 1VJ0A 4LFCB 4QWMA 4Z4HA 1TQDA 2OCGA 3MWEA 1NUTA 2DPGA 1XLTA 5DYMA 2WYHA 4PONA 4MS3A 1H3EA 1D2EA 1NMEA 4X63A 3SX0A 4TV8B 1VQ9I 1GFIA 3VSCA 1MO3A 2QUKA 3PHIA 2BGWA 2OT3B 1U0RA 4Q0MA 3K70D 2HD4A 2LKSA 5J47A 1HEUA 2X58A 4ZVTA 5LQJA 1T5HX 1U9IC 4U2GA 2IIBA 1VI2A 3QLEA 5A2QZ 3OTGA 1DGWY 2ZG6A 4KSBA 2V97A 1KEUA 2PG3A 3D8HA 2FY8A 3MIIA 2EBUA 3DE2X 3NGMA 2Z5VA 4Z9BA 2ZSIA 4PYKA 2ZUEA 3CT4A 3EUHA 5HDNA 1WM1A 1UZLA 5HX7A 2ET6A 1G55A 5HK9A 2C7QA 1A7AA 1H8AC 2VAWA 4ARCA 4NMLA 3RRFA 4Y30A 4KVAA 2Z8YM 1X1DA 1YAJA 3ZGOA 4RHCA 2I9KA 1WD7A 2KT0A 2I2AA 1XRJA 3WWYA 3GK3A 3TWOA 4TMTA 1N0WA 2R7QA 1PT6A 4R0VA 2D1VA 4RZUA 4A23A 2NPFA 1A71A 2I65A 2NZUG 1EZ4A 1QYWA 2PX9A 1WBBA 2I2DA 1HPLA 3A05A 4YXWA 1AU7A 2B94A 1ZMOA 1QYRA 1WH7A 4YR9A 2FI1A 4OHZA 4BEBA 5E38A 3WGIA 2XEXA 3S1SA 4MVJE 1L8XA 2RGYA 3WO1A 4WLUA 4AY4A 4BO7A 2H9YA 2JATA 4Z6YA 5F7OA 2FR1A 1ZPDA 1RXEA 3MB5A 3VR6A 4JDPA 3AVOA 5JG7A 3DT6A 1IEQA 4DNFA 4NC9A 3PIPF 4R2LA 3ZJTA 2B4RO 3DMHA 4P92A 4CQLA 2WD8A 5KTPA 4X3OA 4IF4A 4DZRA 1L4NA 1YZUA 1VQNI 4BQFA 2WY8Q 5ER6A 5A9TA 3ZV5A 4CMKA 4TX1A 1FVFA 2OBBA 4M8IA 3NKVA 4HQ6A 3WLMA 2ZWMA 2FP4B 3L43A 4P80A 4FNOA 1TPZA 2EJUA 4QZVA 4Y2HA 2Y0SA 1N9GA 3BG7A 1PUEE 1GLGA 2QN9A 2BVNA 4JWKA 4OREX 3IEMA 2FPPA 4OJKA 2ZBKA 4KLAA 2PTHA 2WOJA 4NZPA 1B74A 4FHZA 5LQRA 3TXXA 5HS7A 2DMQA 3R0XA 2B2XA 1SGWA 1N5JA 3OJXA 1HT0A 5JARA 3U7JA 5FJ8J 3AEQA 5A6VA 2VKVA 4XICA 4HB0A 2HT1A 2A9QA 2W2KA 1O54A 1UEIA 4EY7A 1E9EA 4GPTA 4B7ZA 2TCTA 2XMBA 1ACLA 2X0JA 4GFDA 1G1MA 1BA3A 5AJUA 4C0JA 3BGOS 3FXOA 1ACIA 4UMVA 5EE1A 5SY9A 2FMUA 4YJDA 3RIHA 1LE8B 2VJAA 4RK7A 1VE5A 3GJ5A 3RS8A 4IHJF 2EU8A 1IPFA 5INTA 2AOTB 4QJ4A 4FE4A 1DARA 4ARVA 4LJ8A 1QGDA 1ILEA 2P3OA 3I53A 3TLGB 3ZU5A 4NIMA 4Y6QA 3A27A 3P9CA 2LDBA 1QHHD 4G8JA 3TE7A 5I45A 4QXRA 1PCXA 1UPUA 4F56A 5FLKA 3ZDAA 3FKJA 1W4BA 1E9BA 3L0BA 2XYPA 3ADCA 1QLJA 2J5KA 4QLAA 4LFAB 2ZRMA 2X7XA 4KWHA 4MVXA 2CXQA 4BAGA 1LVKA 2EIXA 1OH7A 2P9TA 4BJTA 2H8GA 3IQXA 3QBEA 1CVRA 2H3HA 1SCUA 5KTNA 4TMWA 3IAUA 1XP5A 3CKYA 5CPRB 4EW1A 4Y1EA 4JX5A 3FY4A 3EA0A 4JJEA 4EY3A 2QVOA 1JBQA 3LLMA 1OH5A 3NOVA 2PK3A 3VI4B 2F43A 4OHYA 2FFBA 2X4DA 3A58B 1E2UA 4N39A 4F84A 4F96A 5CNKA 3OFJA 2XY4A 3WDMA 3VYVA 5LYJF 2A6EF 4XW2A 1HETA 1FDOA 3H13A 1J7KA 3L6OO 2IXAA 3U3ZA 2ZIZA 3U09A 3ULKA 3CMAI 1PZFA 1G5RA 1CSEE 3BZBA 3GQVA 4V02A 1NU6A 3FSGD 1TZ2A 3U7IA 3PXEA 3W79A 3K32A 2ZAGA 2WIKA 4PO8A 1VBFA 4JR0A 2ZI6A 5H16A 1AKNA 3IDZA 1UR5A 3ABKH 2EKDA 2YJ6A 1ZK0A 3D6TB 4Q4JB 1VYVA 5DSTA 1J5PA 1JYFA 2L69A 1XD2B 2PWYA 4G85A 2Z99A 1A36A 3TNLA 3PEYA 2CFTA 3L6RA 3TLJA 2JZCA 1K9SA 2H9AA 4PR0A 3M33A 3SE0A 4N12A 2ZRGA 2GO7A 1SNYA 3PNVA 4EH1A 2Q4RA 4OXNA 3L2OB 4OY3A 5PNTA 3DG9A 4J1TA 4MJXA 1M1YA 5F5LA 3LA7A 2JGIA 5U1PA 1Q7BA 3P0RA 1P8AA 4DS3A 3G2JA 1PSWA 4ESJA 1JHFA 4QGHA 4RTQA 2WMYA 1XEWX 3RYFB 3GLKA 3VGPA 4JL5A 4OP3A 3B3FA 3PF9A 3MK31 4B09A 4DWWA 4JIGA 1I0LA 4WAUA 3HY6A 3N6VA 2JA5J 3KQWA 1OPXA 1KNXA 3OLZA 4FLMA 1MB4A 3VR5H 4BYMA 4DJ5X 2XAHA 1UDXA 2FMTA 1LPBB 3PTAA 4EAAA 2G5GX 5K2MA 1ENOA 4V2IA 4RQAA 4GPBA 3WXBA 4EVSA 2YUTA 1VP3A 4S1WA 2Q3MA 3P7NA 1W76A 2DQYA 3R60A 3IPLA 2ORED 1BE6A 2GPSA 1PX2A 4DQ0A 2FE4A 4XB6B 4P34A 1VI6A 5E1ZB 5EPOA 1YVDA 1HTWA 3WB1A 2DJNA 2I62A 3MEXA 1Y6JA 5EIBC 3V2UA 1P2SA 1DLIA 1J0CA 5D6OA 4TKZA 2DMPA 1XQXA 2NVXJ 1J25A 4LQCA 2QTHA 3K0LA 4JUAA 1SCJA 3EQ2A 5KCMA 3B1ZA 1RC9A 1E7SA 4S1NA 2QP3A 4TZ6A 2CVHA 4HF1A 1VL1A 1SD4A 1MAAA 4HH0A 3OYEA 3UG7A 1D2MA 2ZRPA 3TQTA 2OG2A 4AC9A 2P2LA 3B89A 1ZU5A 1N7GA 2BKEA 4FISA 1XZCA 3ANLA 3H5AA 1UH5A 3CW2A 2FN9A 2GYVA 3REFA 4MGHA 4BEVA 4LXUA 5EDNA 3G6KA 5LQSA 5DB4A 4ARIA 3O1LA 4EMBA 3LKBA 4OI0A 3UOGA 3TGLA 4URWR 3WY9A 4XBFA 3M83A 2FPGB 4HR7A 1W1UA 3HXPA 1VE7A 3KL2A 3ZHYA 5K6TA 1RVDA 2ZVDA 5DOZA 2RB4A 3PYXA 5DJ5A 1QWSA 1U6JA 1LQ1A 1KQOA 5BWCA 3ADDA 2RBKA 4RDHA 1G8MA 3DEEA 1XA0A 2ICWG 4K6HA 3QA3E 2KJCA 5C4XJ 4XSXF 1ZM2A 1IZYA 1ZM7A 2CSOA 2L2QA 2X2EA 1PP8F 1E20A 1MW7A 5FR2A 2R8BA 4GX2A 3FTCA 1LC0A 4LBVA 4FS8A 2ZYTX 1V0JA 4FZ3A 1VKZA 1N78A 2IF0A 2L02A 4HNUA 2XNDA 2BHLA 2QRQA 5AQEA 1A04A 1MLDA 4JGGA 2R7UA 4DLSA 2R4GA 5DDGA 2PQ6A 1K7XB 4ECAA 4RFSB 1Y3HA 4PFPA 4LJ9A 1JEAA 5JRZA 5LUBA 1BW5A 4N4NB 3V4OA 2RD2A 4C4XA 4EBFA 3CIFA 4MCAA 5E1OA 1GUDA 4GOLD 1DX9A 3RJTA 4L8FA 2O4UX 5DTMA 2XDAA 4BO8A 3HPQA 1R88A 4YCNA 2HADA 3THWB 3U39A 3OKFA 4C07A 2K4JA 1V6SA 2XB9A 1RHRA 3TZQA 3FMVA 3GUUA 4MARA 3FCEA 1JVNA 5AM1A 3D59A 5DDIP 3RFFA 4QT0A 4V0SA 4KN6A 1AHPA 2G4CA 4KLNA 2YINC 3RS7A 5HNHA 121PA 3WYNA 1HE1C 2WDZA 4BQQA 2UUZA 3MKYB 3I0MA 3P2KA 1R5GA 1WY7A 3SSMA 3UHAA 3IB3A 4NV0A 4KR6A 2X41A 3GGGA 1DL5A 3HP7A 3THSA 2OV6A 4FFDA 1E94E 3GFQA 3PI6A 4XOTA 3IPRA 3WZMA 1GHTA 1YFHA 2WAFA 2A9FA 2J6HA 2P2YA 4WFIA 1JFTA 4CCSA 2VK8A 1Y3IA 3AG1H 1B6AA 3DMFA 5M3FJ 4JX4A 1T9GR 4Q3EA 2CUKA 2D8AA 4C22A 4LG0B 3SIWA 1DTWB 1X9IA 3R09A 1RZ3A 1JRLA 3WK4A 5TMBA 5CR9A 1GUFA 1CQIA 1G21B 3HS3A 5NLLA 4WK4B 5B53A 3ZNNA 2NYVA 5F73A 3ZQGA 3RARA 2XMSA 1OH8A 2SCUA 1FOXA 3OOEA 3OY2A 4DCJA 3TGWA 4EA8A 5HKAA 1WXEA 4IG4A 3WE7A 4CZZA 1IHPA 1IPHA 1MT3A 2XCOA 5EKXA 1YE8A 2H18A 2M9HA 4ZREA 4KXXA 1YO5C 3V8VA 2EFWA 3RFVA 1PW7A 3T35A 1OI2A 3VJLA 4TKVA 2CGPA 4B34A 3AP2A 4OP2A 2G1UA 5M5WJ 1A69A 3ZWBA 4BP8A 1C9DB 1DE0A 3HJFA 4UU1A 5KTKA 3J7ZI 1IXSB 5IFKA 1QFSA 2WWVD 1CHDA 2QQAA 4TKMA 5FTWA 1GSHA 4BOYA 3FOAA 3LLUA 5KU1A 2QZJA 1HSTA 1UL1X 3CNQS 2QZ8A 4OBEA 4RXUA 4R3WA 4JXZA 3RIEA 1IY1A 4WY8A 1YDGA 1GJRA 4DANA 2R93J 4I2OA 2G72A 5GIOE 1IWOA 2NQTA 1R6XA 3KU4A 5F3WB 4Y17A 2RH8A 1RZRA 1CB7A 4MZDA 3FAKA 3HU1A 2NYUA 3SR0A 3TSCA 1F9NA 1E8NA 4U7BA 3EMBA 1K8XB 2Q1WA 3MTJA 4TTVA 4D46A 4ZIRA 2FPWA 1G3MA 1IOWA 3T8YA 1S2LA 3I4LA 5AIBA 3DVLA 2EAUA 3SZMA 3ZCVA 4Q00A 4I9GA 1Z0DA 4RM2A 2CCGA 2BWJA 1KJIA 4RGXA 4F3TA 3SZRA 3KYDA 5DTQA 2L18A 1OZAA 5C44J 2K9LA 4JP1A 1Q0ZA 4CM7A 2HZTA 2O8BB 4KWEA 2QKMB 3VKGA 2HO4A 3AHCA 3NWSA 2D45A 1CF7B 1NYQA 1S7GA 4JXKA 5IT5A 1ZMTA 5KJ6A 1YT5A 3SS8A 2O0YA 5AHOA 1Q0SA 2YVQA 2I54A 5AMXA 4HSEA 2YPRA 1J20A 3GLHA 1AKYA 3GLFA 4M9UA 2ZWIA 1FOWA 3ZUGA 3ZU3A 2CLSA 2VNSA 2VKQA 3MGBA 4CTNA 3AINA 5BNFA 1CR4A 4WCGA 3ORQA 1K8ZB 5AW9A 1UFVA 3B6IA 3CX6A 4TKUA 4IV8A 2WHPB 1G20A 2EJRA 5F1KA 3U0VA 2Z5GA 1E9DA 3PCTA 1OISA 2I2BA 3VPSA 2FPKA 4RWEA 3FUUA 5H3LA 4WXMA 2P9BA 5AJHA 4N9HA 1MVLA 3HA5A 2VQHA 1L7QA 1ONSA 4XLTA 3K6GA 3C74A 3N2KA 1MVOA 1VBMA 4YV1A 4ZP1A 5FJIA 4R71A 3GGSA 1FZQA 4QUAA 3FKSA 2CGEA 1UM9B 2XDYA 2D2VA 1J22A 4PPGA 2J0UA 4YMHA 1IM5A 1JTYA 1JGSA 3CF0A 3B6ZA 2AYXA 4Z54A 4UUAA 1KS2A 3KB1A 3G2HA 3ID6C 3S40A 3WRXA 4LGCA 3JD0A 3HXOA 2C83A 4K26A 3LPDA 3DDWA 4JLMA 3IXQA 1WCMJ 2CXNA 3T9CA 1DDOA 4FGWA 1XEXB 1KYXA 4EG0A 2UKDA 3LIIA 1N25A 2JGDB 3JQDA 4CUGA 1B4AA 1MC1A 3NV9A 1VHQA 3O3OB 5E2AA 3U1VA 1DQSA 1FFEA 1TWCJ 1T0UA 4ZDOA 5DYGA 3WZLA 2C5SA 5KQRA 3SBDA 1EYZA 1BI0A 5BNGA 1FSHA 2Q2QA 3RTRA 3PXDA 4TUYF 3KZVA 4FFBB 1ZM3A 3R6WA 4KI7A 1TP4A 3Q3EA 4D3DA 5KNBH 4G07A 2V1DA 4EKIA 4WLEA 3PRHA 1NVGA 4GECA 4HY3A 1TWGJ 4ESVA 3D5RC 4C4YA 2EQBA 3HR4A 5EZYB 4ZKEA 5DVZA 4FONA 3QMPA 4C4OA 4PO9A 3WICA 5HDGA 1DGQA 4PZJA 2W2LA 2C58A 2CYCA 4RHFA 1SOAA 3PR2B 1MBFA 1FYEA 2WTBA 3SEAA 4Q3CA 3SI7A 4PUSA 5L51A 2WMOB 2G7MC 1WFXA 3GCXA 1WMFA 4EA6A 2X22A 4PGFA 3TZKA 4BN0A 3ST7A 1CRWG 4TMVA 4CVNA 3IPXA 3MPOA 4OM8A 4W63A 3CU5A 1J99A 4MSUA 5F0FA 1P18A 3H2SA 3CCYA 4A2CA 3FOWA 2I55A 3I1IA 2L4AA 2XPWA 3FUWA 2W83A 4KSYA 3I4CA 4Z3KA 1JQAA 2H1FA 3GXBA 4GGGA 4G4JA 2B1IA 5F1JA 1UXIA 4PFOA 3OEYA 2OK7A 3SLGA 1F9AA 2AG1A 3IP7A 4HDOB 2I5PO 4W8HA 1O87A 4RA6B 4OL0A 1I4LD 4LF5B 5IY5H 3OOHA 2JSPA 5ECWA 3DKKA 4U6SA 4DYQA 3CO5A 1KSGA 1EZ1A 1SIBE 3BE6A 5E9AA 2IPLA 1WBDA 1SVIA 4PZYA 3DLAA 1T98A 1P6RA 1Y37A 5CFZA 3NVMB 4TSRA 2FVXA 4DC0A 1R6VA 3D64A 3IVGA 4FX4A 4JI3B 2BF7A 5KNCH 3WK6A 1HWYA 4A16A 1NLMA 4H6VA 4ASNA 1WUKS 1WCV1 4J00A 2MU1A 2J4DA 5M5YJ 1DCMA 1Q91A 2GDJA 2YFYA 5K20A 1VC2A 5SZHB 1F5NA 1W2GA 4PZ0A 4UHDA 2P1DA 4L2IA 1XZJA 3W2WA 3DAGA 4AN1A 4URXR 5FOSA 3SEZA 4JC0A 4F4JA 3A6DA 1XXHA 3CE6A 4Q7MB 3HOXJ 4IDCA 4UXNA 5AVKA 1WS6A 3S2YA 5KAMA 3AEQB 1LX7A 2D1TA 2A9KA 1COWA 1ZA2A 2IYXA 2V7GA 5K1ZA 3QPAA 1IVNA 4FFOA 3TZEA 4X3PA 1UMCA 2O7QA 1TM7E 2Y05A 4HUQA 1U3GA 1Y1PA 2VXBA 3M70A 4K6GA 4CGZA 1I32A 2Y2VA 2ONZA 2CDNA 2OV1A 3BIOA 2XF2A 4OHRA 1M73E 3UJ3X 2YWFA 3UMFA 1JBEA 3IQGX 1A2BA 1D1QA 5IP7J 2X42A 3SN6A 4IDOA 4GNKA 3K1YA 3X2QH 1V43A 1V6AA 2QUJA 5K05A 2BR4A 3KT0A 1HRDA 1OQYA 4OVKA 2K4MA 3WGZA 4LF4B 3RTGA 3LUGA 3S3NA 1ILWA 2KE5A 5AK0A 3CKMA 4XVQA 2JJ1D 4PG5A 4HFRA 2BGIA 2VDQB 4YGYA 5FLVA 1XMSA 4I4NA 3FTQA 4U2KA 3M8KA 2GILA 2HWXA 3DMNA 2PFBA 4L0DA 3KKMA 4P4SA 4P86A 1HK7A 1Z63A 2F1HA 3T06B 1EDEA 1GQSA 4O4LA 1Z2PX 4RAOA 3SZ3A 4PY2A 2VTDA 1W6RA 3FVWA 3OIVA 4NJOA 2IXBA 3VC7A 1XPXA 1C14A 4UVAA 1U78A 3GTQJ 3CJTA 3JD2A 4ZAVA 3NTVA 1WDMA 2FWJA 3HKDA 5LPNA 3AEZA 1BE1A 5FX2A 2IUFA 3EIXA 3T4UA 5K6AC 2C8JA 4A12A 2BXZA 3EWAA 3DTEA 4MKZA 1HNWB 4GMXA 1E2JA 3MUFA 3LL4A 4OQQA 3CW9A 2FMFA 3E3VA 4N0QA 4H4DA 4DVJA 5L7TA 1BD4A 2IA2A 3U49A 3EOZA 3CE9A 1MRZA 4AKTA 1B8VA 1DZIA 4Y1GA 1JXMA 2UWMA 1E1DA 1XIVA 5AJZA 3NEAA 1Z5UA 2PL3A 3ABUA 5F0CA 3LBAA 5L3SA 1G3YA 1OWNA 2IOYA 2ZZMA 3AUSA 3QLUA 1A7KA 1LVGA 1LJ9A 3SSOA 2VPIA 5CQGA 2QSHX 2DP4E 5FB3A 4OEHA 4IG9A 2XROA 4KNWA 5FBZA 3DP9A 4LNAA 1U80A 4K6OA 3QKRB 4BC0A 1XRSB 1VSVA 2ANCA 4PHHA 1KR2A 2EIHA 4JJZA 2FZKA 1NKTA 4M0KA 3RKXA 2ACVA 5B7GA 5HKLA 1TTYA 2HYGD 1L9XA 3UICA 2HF2A 2QBYB 2G04A 4M9SA 5I9BA 3HWWA 4OGKA 1Z0XA 4US1R 3M1EA 5MFPA 3P9ZA 2D2WA 1I3AA 3ZGKA 4X45A 4DR6B 1PK9A 1NIPA 1R36A 3UJ8A 3QW4B 3I2KA 2WG1A 1FSZA 5JMPA 2WHRA 1NW7A 5K0LA 2XE7A 4AECA 4BZXA 4MV9A 5KJCA 4LUCA 3QBJA 3R5SA 1RABA 4I0BA 1NWCA 1NVTA 3I2FA 3T41A 4RZHA 1YHZA 1WE2A 3OPYA 2TS1A 4Z4EA 4YS6A 3JS5A 4FOPA 2HMVA 3DLCA 4OYYA 2ZRCA 3LDGA 5DBEX 4M1KA 3TI7A 3SYMA 3M4YA 1GNRA 2JIZD 2JIRA 3IBFA 5LLSA 5EIXA 4ZYYA 3KYJB 2AG6A 2QRMA 1U63A 4E88A 4CCNA 4C4AA 3RPUD 4AX8A 1WWXA 2C2XA 2VOJA 1H5UA 4P93A 3EDOA 2HA6A 3ZZTA 3SY8A 2V3WA 1W73A 1THMA 3X1YA 5D3MB 2NSHA 1G9TA 2VJLA 1HUQA 3AF1A 4NBKA 2ZTVA 2FJ0A 4YQEA 2AH5A 4RHUA 2W6QA 1WPKA 3SQNA 1TEZA 3K1TA 4IX1A 2DA2A 4AYXA 3K09C 2VJ5A 5FKKA 5HQTA 5J4YA 1HKHA 4EHIA 1U0HC 3K2AA 4BB0A 2J3HA 3PPVA 3VDNB 3THXA 1HDYA 3G1TA 2K4BA 3KVRA 2AOUA 2RGVA 1APLC 4C2UA 3T9AA 2RARA 3IAFA 2IH4A 3SHTA 4XVCA 3E9QA 4ZI7B 3E5RA 4BNYA 1YR2A 2I67A 1GPNA 4HVCA 1ZCJA 2QNRA 1E7WA 4G37A 4B3MB 2YJ3A 1KR5A 3QVUA 1RI2A 4L0QA 1H8ED 4IKFA 1G3IA 1YZ3A 2OO5A 1YC2A 3CS3A 3QI2A 2L9SA 1N0VC 3VNRA 1V9SA 3IO5A 2OV2A 1NXWA 4LS3A 5A0VA 2GEBA 2X1VA 4PRKA 3HY4A 4IQGA 3ZZ0A 1QE5A 5AYVA 2JGAA 3OOSA 9MHTA 3O0TA 1RLJA 1XVIA 3FYCA 4PN3A 5E9JA 5H3HA 2LCQA 4IIXA 2ZJ4A 1LB1B 4QARA 1V16A 2YICA 2V1XA 4I36A 2NO4A 1DNPA 1DWOA 4K5QA 1ADGA 4JLPA 1S3JA 2KW5A 1E3SA 3LSTA 3KKLA 3NHWA 3HA2A 4BPBA 2WVHA 1BH2A 5IHXA 1U11A 1XK7A 3NYQA 2DO7A 2P4HX 3QXSA 3LSIA 1TEXA 2J3IA 1DO0A 3UC9A 5IXYA 2AF3C 2I6XA 3C3CA 4YC7A 3VXKA 2FLWA 2FPRA 1HYEA 1S2NA 1QPMA 3RVRA 3DEKA 2XKBA 5DXJA 2IZZA 4AZ0A 1TJPB 2NADA 1OOEA 5JSKA 3WGKA 3ONNA 5K7HA 5JNSA 3VV2A 2LY2A 1U1CA 2WABA 2AXEA 4G86A 1PZHA 5AI5A 4RMGA 3VO9A 5AI8A 3KVYA 3F0CA 1EVEA 4CM8B 3K0KA 1J2XA 4PZPA 5J1SB 3K0BA 2V0GA 1LDEA 1GPLA 3LRPA 3VHQA 2FX2A 1T26A 1Y1TA 2W2PA 5FOVA 4EJMA 3QF4B 3TKYA 1M2HA 1V3VA 2R5NA 3K0FA 3HEFA 3MGCA 1H9GA 2ZBGA 3B1WA 1FXWA 3GJ3A 3D02A 1TVKB 3LX4A 4DLAA 3ZMVA 2QU8A 5L3BA 2R8ZA 1Z2DA 3ZK9A 3ZN2A 2HQ1A 4BY9E 1KI2A 3QVTA 1WF6A 1T4CA 4BY1J 2KP6A 5HS9A 3ZI7A 2FPSA 1UF9A 2OBXA 4KBGA 3AR3A 5IWAB 2CY0A 1Z25A 1WETA 1Q1HA 2ZKZA 3RF6A 3FPCA 5CVCA 4IHYA 1DU4A 2QCOA 3N76A 1T91A 2F3RA 4BUPA 4K88A 3KOMA 1JVSA 4AKGA 5K3EA 3TE6A 2C8VA 1O5IA 3OCWA 2C7RA 3H11B 1FS4A 1USVA 4XIYA 1G8SA 4HDMA 3KD2A 5AW5A 2VS1A 2ZOSA 1X0VA 1LTQA 1J9EA 3FXKA 4KMMA 4XQEA 1JLLB 1KYYA 1PUXA 1F4PA 2DHCA 1Q21A 1TI7A 4LRSB 3KZNA 4ZV7A 1BHO1 1QHHA 5T57A 4WTOA 4NFLA 3CB2A 1XU9A 4D8TA 1PUFB 3PUKA 4RC9A 1FS5A 5KAIC 3V2HA 1GTZA 1BWSA 1P9OA 3A9VA 3A32A 4RM3A 1ZZGA 1UHSA 3CZRA 4H7HA 4XKJA 4YI3A 4E03A 4C7OA 3UB4A 1A5JA 3FHCB 1NW8A 1B1CA 2V6FA 3SHFA 2VDRB 3IR5A 3AHIA 4TTTS 5IZCC 4OXRA 1ES9A 2H16A 5A5FA 2IGOA 1OZ0A 1IZ0A 3HFRA 3DZIA 4G26A 3O21A 2EWNA 2D4HA 2ZTUA 4S24A 3VJMA 4I4TF 1TJ4A 2RHOA 2WA2A 4A3SA 1CEYA 1C7EA 5CEEA 4PS0A 3GV0A 3BTUA 2OPBA 1C2YA 3M6WA 1JKPC 5CKTA 4G81A 4YAKA 4FHFA 4U2FA 3UO8B 2I6SA 1SQ5A 3K5HA 2VJDA 3GIDA 4OH7A 4BQIA 3WNQA 1RVV1 1PV1A 3FSGA 1V6CA 1JEJA 3SKYA 1YZQA 1U7UA 4XIDA 3CB4A 3AUUA 1EDBA 2XECA 1P5ZB 4GAEA 3K4MA 1CZLA 2WFZA 1SOUA 3BWGA 4MQ5A 1KSHA 1HYGA 1Z6YA 1F20A 4XR9A 1T9CA 5C4IA 1I4OA 4TYWA 2DA4A 2KDZA 1JIQA 3AI3A 4DB4A 1G8YA 4ZIRB 5GINE 1SVOA 2EV9A 3WO0A 3TEDA 4YREA 3ZE0B 3EFOA 5IKOA 3C3XA 5AM0A 2BVMA 3HXLA 4ESBA 1N0HA 2A58A 3TX6A 5BN3A 4XUEA 4ZO6A 1Z47A 1PJSA 1N5OX 1CUAA 4RNDB 3ETEA 1K3TA 5B58C 5CTAA 3QWIA 3EF3A 3DT8A 5AKLA 1LPSA 3OM9A 4OHWA 2ZJ7A 3GJSA 1J0AA 1SHZA 4D0GA 3SPXA 1HT2E 5AUPB 1BDIA 4LCEA 5L4SA 4D9KA 3M9LA 3WTUC 4IJWA 2OQGA 4K03A 4LXYA 5CIQA 5L7YA 3GLHB 4O1MA 1RLMA 1SG9A 4ZYEA 2IT0A 2AFIA 4B8YA 3NHYA 4N03A 1Q2UA 1XN1A 3I30X 3T12A 5SYNA 1T6YA 2JW5A 4CHUA 1WXFA 2OU2A 3MT9A 2ATIA 2B83A 1YW8A 1GGNA 1NDHA 2IHNA 1E6WA 1NNUA 3H5LA 2R86A 4QHYA 5LDHA 3AF3A 1KOFA 3OS2A 1FLNA 1SBHA 3RVPA 4TYMA 4RV9A 2RG1A 1L4FA 2Q0OA 2G6BA 1I1NA 3ZJ4A 2PBFA 2W57A 2P67A 5CNJA 2ASVA 2DJ5A 3IQHX 1GZVA 2E71A 1RWKA 4DV1B 3WDLA 3G8DA 3Q4GA 2IP4A 4QQRA 4HC4A 5CVIA 2Y9ZA 1GT6A 5KQGA 5JCPA 3T99A 3H1CA 1T13A 5DNWA 2J48A 4HX4A 3ELDA 4GUAA 3FDZB 3KHTA 3A4TA 1M0WA 5B3JC 1KTIA 3H1FA 2YSRA 2FZEA 2X77A 4EKYA 2DKOA 1P9RA 4NJMA 1J8QA 4HGRA 1BX0A 1RIIA 1U5TA 1NBOA 1ZUHA 2VL8A 3BC8A 1LGYA 4MRSA 1Y9JA 3E97A 3ZCSA 2C9YA 1R37A 1Z6GA 4HS9A 2UXXA 5COAA 3L84A 2A88A 4PBRA 2FP3A 1NVUQ 2B5VA 5JNRA 4E7IA 4MO9A 2W6PA 1MMNA 4IGIA 5HNFA 3B73A 1V9LA 2QX9A 5B36A 4Q5IA 3GOQA 2RGXA 2VPLA 3LUPA 2BVLA 2F1OA 2J5RA 1H2EA 1R49A 4L8WB 3QJGA 3ETDA 3H0GJ 3OCYA 4YCJA 4MHSA 4O02B 3HCWA 2FEZA 2IOFK 1NYTA 3BRCA 1AS0A 2CC2A 1NMZA 1WZCA 5I51A 1AS2A 5HMMA 1M7BA 2P5YA 4S3MA 3VHRA 1QF9A 3O8BA 5FEMA 1A77A 2GPAA 4QUDA 4BP3A 4A0ZA 1RBYA 3ROTA 4MMZB 1JFRA 4Y2QA 2RONA 4RYLA 1U0SY 2X76A 3MJFA 1H0SA 3HXTA 1MDBA 2VSOA 2XMCA 2K85A 1WSWA 4LK0F 3F6CA 2ZS8A 3I5MA 5BR8B 2H2IA 1KVRA 3TAXA 3N8GA 5F51A 3LG2A 4MZXA 5BWBA 3CX4A 3H8VA 4RB1A 2UV1A 1TVCA 2A8YA 4JHLA 1SCAA 3V48A 5JSHA 1CS0A 4CKCB 3QPDA 4RCVA 5B1HA 1J5YA 5C1DA 1ZYUA 4ZC8A 5H70A 1M2VB 3DOIA 3HVUA 2NO9A 4TL7A 4RIHA 4BJ5A 1P9WA 4XPIB 5DULA 4WOKA 1ECBA 4UVEA 1FVOA 3QPUA 1N6PA 3P0IA 1GPBA 1NMQA 2D62A 3CH4B 3EPHA 5AKKA 3HOZJ 4YROA 3EHDA 1TNTA 2YASA 3CVYA 1LBEA 1L5WA 5IDYA 3DL0A 1NR1A 5JD3A 5JMWA 3EQ9A 1OFUA 3L02A 1QPIA 1T5BA 4OMCA 2PR2A 4RY8A 1CE8A 4QGBA 2AN9A 4UTVA 1U7WA 2NAZA 1MT0A 2ATEA 4UUVA 2DA1A 1IRZA 1S5PA 4IFBA 3A4MA 2DHRA 2VL7A 2WVJA 5AJTA 3U19A 4JA0A 2WTAA 1XTZA 2H85A 2RKOA 4LIPD 4EOGA 4ZOAA 1ONBA 5K99A 4IIJA 1JAYA 3ROZA 1Z0JA 4F6CA 2W48A 4AIKA 1SXIA 4F12A 4EVQA 3PUFA 3GUZA 3R3YA 3A6FA 3MHPA 2BUCA 4GGPA 4LKOA 3H5NA 5C1PA 4Q66C 2RE8A 2HMYB 4LMRA 2ZRKA 4Y2UA 2B8JA 1V8OA 5IJWA 2V98A 4ZVVA 3N9IA 2O1SA 1OLUB 5M3MJ 3WTXC 1CTQA 1XL1A 1PL7A 3W78A 5F2OA 5LQAA 1AK2A 3DDSA 4O1HA 2ZJ2A 1Q1QA 4TXNA 2EHDA 2OGWA 4ESHA 3BQMB 1BN5A 4OJQA 2FPXA 3TOVA 1LSSA 1TWFJ 2FD5A 1FMFA 4RAZA 1UWCA 1ZK3A 1GWNA 1E3TA 5FFZA 3UH1A 1Y3FE 1JHAA 4LOHA 1E2LA 2H5LA 4JZKA 4ZVLA 2Z9OA 4XJTA 1QF7A 2ZDQA 4N0PA 1RU3A 1GRQA 1VKHA 4B79A 2YJNA 3PNBA 3BLYA 3WK8A 4RJTA 4JEMA 2VHTA 3O2PE 3HV0A 4Y7CA 3M8JA 2HTEA 1AN9A 3HGTA 1RJFA 1IVYA 4TTPA 1F8UA 1HTBA 4ER0A 1SPBS 3HTSB 1ETUA 1SD1A 2UYCA 1KK3A 5CJ2A 4Z4GA 4JLUA 5ADHA 1IN7A 2FSWA 1A3CA 4KXLA 1ZD5A 3AY3A 4AD8A 3MFKA 3GPBA 1EXNA 3BWBA 2ECOA 1MNEA 3CO6C 3NBKA 2W6CX 1G2PA 3A3PA 2HQRA 4EX6A 2GNAA 4KWIA 4QXPA 5HLGA 2BGRA 3QYAA 2X2PA 1ZGZA 4BVBA 2Q49A 4F9GA 2FEOA 4YDRA 1Z07A 2Y69H 1KH1A 3HABA 3CRRA 3HCFA 4GOOD 4LK3A 4PZAA 3CRVA 3IWZA 2PA0A 4ZO7A 2FU4A 1Z75A 1K27A 1E0SA 2D5IA 3FRHA 3HZJA 3GCZA 5BN5B 4QBFA 1KETA 1BFKA 1EWYA 2F1IA 4OU4A 2VHZA 4E5DA 2WJWA 2OZVA 1X74A 2F5CA 1UBNA 2BFBB 3QPVA 1JMVA 4BVJA 4BJ3A 1CUBA 4F45A 4B3DA 1ITYA 1F06A 4YXFA 4FN4A 3PWSA 4R8HA 1MQSA 3HVJA 2XCRB 3ITEA 4QNRA 1TYCA 1FRFS 3TINA 1ORTA 4PZDA 4XM3A 3GMIA 1F14A 5KK1A 3L07A 5HOEA 4UPDA 3GTPJ 1PNOA 4E7LA 4EJTA 3TCKA 5M7EA 1UT6A 2RAEA 3Q6MA 4QBTA 3OPYB 2IHKA 3R7NA 3U9GA 2F5FA 2PNJA 2P9ZA 4PE5B 4B6JA 4CG0A 4J49A 1Z17A 3CUVA 1L3CA 2JUGA 1CQPA 3L8MA 2ID9A 2RHJA 2R1ZA 3V2GA 3BDVA 4OTZA 5K8TA 1YHYA 3KQPA 1QV9A 1Q44A 3UQZA 4RD2A 1DVRA 2ZSDA 1WQ2A 1E4VA 2X2FA 1SCDA 2YY5A 3KTAA 3R7WA 1Z4OA 1OXMA 3FDJA 1I5RA 1VCMA 4LHWA 5AOAA 4ZV9A 2P81A 1YH3A 4E0BA 2HBYA 5AVXA 3PQ5A 3ILVA 3PG5A 2AFRA 1K89A 4C0QC 1PI3A 1ST3A 3L0DA 3G0CA 4DGSA 5LXTB 3DCJA 2YU3A 1HLVA 5MGNA 1APBA 1QRDA 1HNNA 1C7RA 5J23A 4P4UA 4ZARA 1JWAB 4Z0HO 3B78A 2IYAA 4CLRA 1QFXA 5JDCA 4TRJA 4RGYA 4YRJA 4ILKA 1FLVA 3IEPA 1Z3CA 4UM9B 2X19A 3EEBA 2V5UA 5CDFA 3D2BA 4F3RA 3E22B 4ND2A 4UHCA 5JASA 2R2GA 2W0SA 4LW8A 5MN4A 1C81A 4WZAB 4Q1BA 2GN9A 2P9FA 1T1RA 3IDAA 3LH5A 5BW5A 2AR0A 5IG2A 2QN8A 1I1GA 4B6FA 3Q8XB 3A01A 2XVAA 1PT9A 4GC9A 1EDDA 4BLPA 5ITWA 3A6LA 5KOHA 3MFQA 2WW8A 1VKRA 4DW8A 3UCFA 1HYHA 4BUZA 3Q6NA 5ILSA 4F1JA 5AVOA 4X94A 3OM8A 2LLKA 2EOAA 1V16B 1C1DB 1JJ8C 4UY8I 4Z9FA 1QJCA 2RAPA 3I9LA 4HN9A 3JRDA 3GLRA 4ZCLA 4DN6A 4WUVA 1PGNA 2I6UA 3OZRA 1OREA 4BZPA 3DBLB 5FPKA 1NT4A 2PO7A 3F49S 1YS1X 1ZJ4A 3RQSA 2M7AA 3UR3C 2QMZA 2WRZA 2JVKA 2V6JA 5BSEA 4JP2A 4MV3A 3PC8C 2ME6A 2Y1DA 2DOAA 2JZOA 1KJJA 3UWOA 4YX9A 1Z82A 2LIVA 5FB2A 3IA7A 4BYGA 4DSOA 3NATA 2IYPA 3O3MB 1EFPB 1THGA 4FGSA 1GLNA 4HLUC 2OAGA 2YWBA 3QJ5A 3K4PA 1XX6A 1LFBA 2F5EA 1DBWA 1QYDA 4PRYA 1H89C 4F6LA 4IKPA 1EG7A 3LAWA 3LY9A 1IN6A 2YWJA 2Q2EA 3MD2A 2STTA 4RIFA 1XDSA 4FGKA 4H7FA 2HV8A 3OYBA 2XE8A 5K2OA 3HZOA 3F6RA 4W9MC 4D74A 3VR2D 1RNLA 4L5IA 2BI8A 2V1NA 4GI1A 2JH9A 2A67A 1N5LA 1FFSA 3G9ZA 3PNOA 2Y99A 3JARA 4IEFB 4CL0A 3P19A 3F4LA 4DYHA 2VH2A 4EB6A 4O8CA 2B1GA 5DZSA 1V5FA 3F8NA 3WFZA 1UK6A 5IAEA 3CQZJ 2B34A 3TL3A 1T1IA 1JZTA 4HWOA 1GN9A 3VSBA 5L45A 3H9CA 1CFZA 4HUJA 4A2QA 2FOLA 4MW0A 2XVCA 1E6MA 1Y3AA 1ZG1A 2ZUUA 3GBVA 1N2ZA 1EFHA 4M0MA 4ZXPA 2LZ0A 3DLTA 1U9JA 1TPYA 3DJFA 5K0SA 3E6AA 4G5RA 4B45A 5CFOA 4AIDA 4PZLA 2P30A 2GN0A 4FK8A 4AKEA 1SMKA 2JJ1A 4TLAA 1UBJS 2B4AA 3TL6A 3L0YA 2MR6A 3M2PA 1K2WA 3NEUA 4F55A 4KQIA 5EY5B 4XVRA 5IC6A 2PM8A 1KMNA 5KWJA 3R40A 3TQFA 5C8YA 4DQLA 4F5EA 1AX9A 1YQ9A 2W85A 3R24A 4AZTA 1YBVA 4C4ZA 2ZI3A 2Y0SN 3KAKA 4CO8A 4LHVA 5B58T 4DCUA 1VE6A 2JLYA 3SYLA 3UXYA 4HX9A 2POQX 3SZUA 4OXXA 4JT8A 4YAGA 1CPYA 1N5KA 5EHNA 2WZBA 2ZMEC 3LBHA 3CCLI 4LISA 2C9MA 3B9BA 3MCWA 1KJZA 3QPCA 3Q3IA 2CXUA 3MWYW 4TVOA 3NONA 4LXGA 3H7IA 2AQKA 1UOPA 1CCWA 2CXPA 3WQHA 4QYMA 3AG4H 3LYHA 1EJ0A 5B6JA 4BO0A 2ZNYA 5J2TF 1C8KA 2LD4A 1E64A 4MUBA 2IE8A 1NRIA 3LNTA 3SS9X 2O52A 2FFRA 4EZEA 4JUFA 4Z6KA 4BMPB 2FJ1A 5IH7A 3IKLA 5GONA 1T5LA 2IY7A 1NW6A 5DHQA 4M3NA 1RJGA 3I9KA 4Z4QA 1PJTA 4WQMA 4G2TA 3LXRA 3F7NA 2I2XB 1MGTA 1EVYA 1HFKA 3N3AC 4FJ1A 4LKRA 4Q6WA 5KJFA 3HJEA 4LZWA 5DLPA 2FRDA 2Q5JA 5CA0A 3E3MA 3L3BA 2QVYX 1SUPA 2P9JA 2HWYA 2YH2A 4N4AA 1OCZH 4N8DA 3HDQA 3GN1A 1QUEA 2H1VA 4AJEA 1TLFA 4KT6A 1OX6A 3NEJA 5AXAA 1BJZA 2JJQA 4S35A 1ZSVA 2E4YA 3HB4X 4MUEA 4DMGA 5ER9A 1FMVA 4K9LA 3R6DA 1G7CA 1ZXBA 3W5IA 4AWBA 5CG2A 3KYBA 1DAGA 5BNIA 3MWLA 3HSRA 2GRUA 3EG5A 1A88A 1QDLB 4A2PA 4D4JA 5CA1F 1U0BB 3DKYA 3LHIA 4WCFC 4YCSA 4JAVC 2ZYGA 5FOXA 2XZTA 1G7RA 2OHGA 1MAWA 2CQXA 2JIZA 2XGSA 5B1IA 1B8NA 5ALYA 3KJZA 3CF4G 2OG1A 1FSFA 4NDZA 1I7NA 3RPUA 1KJ9A 4OL9A 2CDBA 1Z74A 4OMZA 3LL7A 5CLFA 5H0IA 2FJPA 4GYJA 4QOSA 1RPTA 5K4GA 2ZWVA 2NU9B 3AL3A 3RVJA 3AERA 1DBRA 4R2MA 4HTFB 2QAIA 2VH1A 3AKCA 3I2JA 2C42A 3BZWA 4O4JF 3FWYA 4F7WA 3JTGA 1QQTA 5B2ZA 2IH5A 2W43A 3H3FA 3FYHA 2GK4A 4DYVA 5KJ1A 3P2OA 1X9GA 2SICE 4LZLA 3FN4A 1VQKI 4Y6GB 2O3TA 2V5AA 4E2WA 5CFMA 2VSQA 3ZI4A 1FMJA 3W8RA 1LD3A 3FZGA 1FXSA 2QWXA 5A5VA 2BFEB 4Q82A 2WJIA 2W71A 1MQ8B 1BVHA 3W6JB 3ER8A 5KWSA 1UBOS 2V4UA 3L04A 3ENVA 3D3WB 4DZTA 4HYTA 5BXQC 1MHTA 2B9SA 2Q07A 1O2DA 3C15C 4YMWA 3D7KA 3ZTYA 1YJCA 4KDPA 5FA8A 3KYCA 1JFFA 5U4XA 1H8EA 1EAMA 4XOPA 1RYHA 2JGNA 3OIUA 1I1HA 4QDXA 2ENUA 2Z2IA 2DTRA 3QXGA 4RULA 3OQVA 2PS9A 3UXHA 1MCZA 4QDOA 4F21A 3ZDDA