4GOKA

The crystal structure of arl2gppnhp in complex with unc119a
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
163
structure length
158
Chain Sequence
LRLLMLGLDNAGKTTILKKFNTISPTLGFNIKTLEHRGFKLNIWDVGGLKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor-like protein 2
total genus 53
structure length 158
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gokA00
3LW7A 4Q4AB 2F7SA 3OFND 3UG6A 4ZCLA 4KODA 4R98A 2ZRBA 3NDPA 5CIQA 2WHXA 3A58B 1G19A 3LQQA 4FCTA 3UMSA 4F91B 2C8VA 3QOFA 3QEOA 1KIMA 2HEIA 1NKTA 3GLGB 3CF2A 2ZYVX 2BC9A 4B32A 4Q48A 1E0KA 3A4LA 2FDCA 3LAWA 2VSFA 1NVXQ 2HDNB 2V4ZA 4P4UA 3ZVRA 2XNDA 1IN7A 3CONA 4XTRA 5JSZA 2ZIAA 5KPJA 5FOXA 1GZSA 4DEYA 1TNDA 2VTKA 1E2FA 3NBXX 4Q4HB 4LYAA 4QGHA 2IYYA 3W3ZB 4B48A 2ERYA 2N1BA 4BEBA 4LHZA 4FMDB 1TX4B 4JLPA 4V0OA 3R20A 1RKBA 3A6PC 1E6CA 4H1VA 3FYHA 4OQNA 1VPLA 5CIWA 1U98A 2CL0X 1S1CA 4IKEA 1H8EA 4WZAE 1XXHA 2O0JA 3QXHA 3RWOA 1AN0A 1DAHA 1Q1BA 2ASEA 1K6MA 1QHNA 3GJ8A 2ZUBA 1S1MA 4WW0A 1H65A 2OUKA 2QT0A 5AJYA 1G8GA 5C2JB 2AD1A 2BM1A 2ZJAA 4D0NA 4P0TA 5J40A 4Y0VA 1G8YA 4DC9A 3THXB 5EUQB 2NZJA 1ZIOA 2Z4RA 4TTQA 1II0A 4DCUA 1EG7A 1ONBA 2VIIA 1L2TA 1KI6A 2ZE6A 1E2NA 1E9AA 1G17A 3IIMA 4HDCA 4IVRA 3THYB 4Q03A 2BM0A 3VR6A 1VIAA 5EXPA 2O8CA 1Z0AA 4MGZR 5EQTA 4PFSA 3L0IB 1Z0FA 3T1OA 4V02A 1RC8A 4LGMA 3TIFA 3SS8A 821PA 2WMNB 3LO5A 3IHLA 2JASA 3TRFA 4QNRA 4L8GA 4D4KA 1P9NA 2IT1A 5FTNA 1VMAA 1OB2A 1NSTA 2NO9A 2XB4A 2QUZA 3OHMA 2W83A 4DLRA 5F9FA 3RS7A 1AKEA 521PA 1D2EA 2D2EA 3K8YA 3W6PA 2NO0A 1Z06A 4NBSA 3R8CA 3RRZA 2IK8A 3LVQE 4PTLA 1XEXB 3W90A 1XJQA 2EFCB 4JBWA 1P5ZB 3GFPA 3PFIA 1Z28A 621PA 3RHFA 1RJ9B 1Z0JA 2H7VA 2DWOA 1IXSB 3BFXA 3IGFA 4BRUA 5FPYA 4LJ4A 1E2IA 3A1SA 1OE0A 1KAGA 3BAFA 1KO8A 3B8HA 4DUGD 4Y0AA 2J1LA 1AQYA 1JPNA 2L0XA 4PHTA 1U81A 1R5OA 2ZRJA 2ZJ5A 3C8UA 2Z5FA 2PCJA 4I99A 4WOPA 2IXFA 3NBYC 3X1WA 2J7PD 4QM7A 2JLVA 1XCMA 3KL4A 2OZEA 1M6NA 4PHHA 3MMPA 3ZDQA 3NWJA 4KFSA 2FG5A 2I3BA 3GLIE 2XJ4A 1Z0KA 2AKAB 1XZQA 4A9AA 2G1KA 4LRWA 4MYUA 1E9SA 1XU4A 4ZCIA 3LXXA 4Q1EA 2BKUA 1S96A 2VHUA 3N70A 4HAVA 5D3QA 2WKRA 3SJZA 3TLXA 2ZXUA 5EXTA 1YR6A 3T15A 1M34E 1DG1G 1DG3A 3N2IA 2WIBA 4BFTA 2P3SA 2N46A 2ZU6A 1J8YF 1MOZA 1OIVA 2WVJA 1E3MA 3DO6A 2D2FA 4OQFA 2H57A 2Q9CA 2O8DA 1E79D 4GT1A 3WMGA 3EWSA 4NMMA 3QKTA 3PVSA 3FVQA 2R6DA 2XNDD 4JL6A 1NY5A 4Q00A 2RMKA 4C4PA 4M2LA 3KFVA 4D6PA 4HUQA 4LK2A 5BN4A 5FOWA 3MGCA 1E79A 4P3YA 1GM5A 4ERNA 3LX5A 1JALA 4GMXA 3HDTA 1ZNZA 5HZKA 2ZJBA 1E99A 2REBA 4L9SA 4JSTA 4IOMA 1QVAA 2FSHA 2ZR9A 5JBQA 4V0MA 1YR9A 4P32A 5SZKB 3TSWA 3UMRA 3L8YA 1UBGA 4D4JA 2AL7A 1SHZA 3HU2A 3U3MA 4AKIA 4URVR 2P65A 1WQ1R 2OXRA 3QF4B 1GRQA 3B82A 1XPUA 5JHGB 5AJWA 4Q4AA 3RDPA 5GJVC 3ZVNA 1Q3HA 3RS4A 1GKIA 4W5WA 2HJVA 4GP6A 3OE7D 4AKHA 2ORIA 2E9SA 2GZHA 1D5CA 3L0OA 2RGEA 2XOKD 5JSZB 3AF2A 1CXZA 3NH9A 2W2TA 2O8FA 1RJ9A 1ZUHA 3ZVMA 1AIPA 4B73A 4F92B 2EU8A 4YQFA 2QQ0A 2WPDA 1S8FA 4KBGA 4B3GA 1R0XA 5HCIA 1ZM4A 3ZVLA 2VHJA 2ZI3A 3LRPA 2BJWA 4DCTA 4M21A 5B2ZA 2R62A 3WRYC 1GWNA 3RNLA 3DMDA 4LPKA 1QHSA 1U2RA 3OEHD 3EARA 2DFTA 4RY2A 2JAQA 1IONA 3QBTA 5KO2A 2B92A 3WYAA 1KO1A 1GG2A 2A5GA 4M1KA 4XJXA 4DXAA 4F4JA 2HYIC 1ZCBA 1NN3A 2QE7A 2QT1A 4N1AA 3NVAA 3PV0A 1QHYA 1RYHA 2ZU0C 5JS7A 3IEVA 1Y63A 5K8TA 2EWVA 3EPJA 1TQ2A 1W0JD 4KSCA 4M8NE 4Q9HA 3HR7A 1KO5A 1JQJC 2F3RA 1Z6AA 2HF9A 3BE4A 3KTAB 1TU4A 2ZUDA 4NYMQ 4HZIA 1OXXK 2F1RA 3U61B 4PPGA 2J5XA 4Q9KA 5H68A 4JSYA 4HI0E 5GJCA 3EZ7A 4OI4A 4ZV4A 4Q1FA 5DO9A 3GJ4A 5KSPA 3LBIA 4TT3A 2WJVA 5DYIA 1HE8B 4HSEA 1IJFA 1T9HA 1DTSA 5L3VA 4RVCA 1WDTA 5EE5B 1IQPA 4AY2A 4KI0A 4IOKA 3OESA 3VR2A 1VG0B 3HJNA 4R2HA 4PQRA 4QHSA 2GBLC 2ZSFA 2GRJA 1J2JA 2JLZA 3UMFA 2W6JD 1KO4A 1MH1A 3QPUA 4B75A 4IXNA 4C0LA 4GFDA 4DB4A 3RC3A 2C77A 4V0ME 1P73A 2V6IA 3K70C 1XTJA 4HZUB 1DS6A 3KZ1E 4PR0A 1ZNYA 1GNPA 3JVUA 2DB3A 2WKQA 2I1VB 3GJ6A 3L82B 4N3NA 4I4LA 4IVQA 1M7GA 5EE0A 3B2EA 1U8AA 2XB2A 2BV3A 1CRQA 1UFQA 1OHHA 3ADCA 5B58C 1JEEA 2YHSA 2VP9A 3AVUA 2AWNA 3ONWA 1K5GA 1N0VC 1VDZA 2CBZA 4II7A 4PQYA 1GNQA 2FNAA 5CDFA 2CCGA 3SBEA 4YMWA 3LXRA 5J4KA 3FKQA 1ZCAA 2JJ2D 1FFHA 3BS4A 3EXAA 1QF9A 4LJ5A 4G5RA 5JMTA 4CW7A 1E9RA 3QG1A 4F4CA 1HA3A 3K0EA 4OKSA 2C03A 4CYMA 4C3ZA 5CLLA 2FV8A 3KXIA 3SHWA 1X3SA 2ZREA 3IKJA 3L0PA 5CYOA 1QHHA 2QTFA 1NBMA 3CRVA 3TNFA 4G5QA 2IS4A 3H2YA 3KB2A 1LF5A 4WBSA 1Z07A 1MV5A 1G3UA 5LB2A 3VNVA 1WP9A 2KBFA 3CZQA 1KK0A 1II9A 2GJKA 3HWSA 3ND9A 4LBVA 5EP3A 5FPTA 4OQLA 3C7KA 4TQAA 2BMFA 2F1JA 5FH9A 4EJSA 1CRPA 4LJ9A 4CEIA 2YOFA 3B78A 1PLKA 2A7QA 1G7CA 3MWYW 4IW3B 4M9SA 4NU0A 3B1WA 4TQUS 3NHBA 4DSUA 4PZZA 2FX3A 3QI2A 1UAAA 1W46A 4ZCMA 2IF0A 3D8BA 3GEEA 2NTYC 3OIUA 3QKSA 3RS3A 2REXB 2WWWA 4P4SA 5JZVA 1SXJE 4S35A 4TSFD 1KI6B 1X1SA 1HT1E 2BIFA 2ODBA 1UDXA 2A2ZA 1TQDA 3IPXA 1TUIA 1G16A 2A5YB 3KKNA 3R9IA 4C9BA 2XXAA 1E0SA 4L4UA 1KDPA 3UIEA 1M7HA 4QNMA 1SXJC 4KITB 3AQ4A 4RD0A 4LYFA 4TZ0A 2QE7D 3LW8A 1JXOA 2BMEA 5JJIA 1SVIA 1PLLA 2V1XA 2IYUA 1ESNA 4G0NA 5BQ5A 4ZIRA 4NYJQ 3TUIC 1SKQA 4RZ3A 5TB5A 4OK3A 4TMXA 4HDOB 2J46A 5TVKA 4EKDA 4ITRC 5A5GA 221PA 2D3WA 4A0HA 2GETA 3K0CC 1UKYA 1XBTA 4E07A 1LS1A 1Z47A 3QG5A 4MRVA 1DARA 1FUKA 1CP2A 3ND8A 2CLSA 1Z6YA 3V4FA 2B7BA 2XTNA 2IS6A 1SZPA 4GPTA 1IY1A 2BEJA 4CEHA 5LBIA 4NCIA 4TTPA 1RFLA 3RC8A 4D4MA 4IXMA 3QBVA 2FJUA 2ZANA 4U7DA 2O5VA 4OQMA 5UKDA 4GBMA 2G0NA 1UF9A 1W4BA 2A30A 2WJGA 2XEXA 3QE0A 1R2QA 5FI0B 3RRNA 2PMDA 721PA 1WRBA 2IEYA 1NLZA 3SNHA 4BASA 2IYTA 2OFXA 2VP0A 4GRAA 4RCYA 1XJCA 1FX0A 3NC0C 4LBYA 3THWB 1N5KA 3W6OA 1Z63A 2YNMA 1DE0A 2OLJA 2C5LA 2VPPA 2IYLD 5DGXA 1P75A 4JBYA 1I4DD 4RKEA 1TF7A 1N5LA 2OFWA 2JLRA 3FPAA 4POAA 5JRJA 4CGZA 1OHHD 4H1UA 3TAUA 2IYZA 3KXLA 4EJSC 1XTKA 1D9XA 1G8HA 4JZKA 5FUXA 2NGRA 3LH5A 3ZJYA 2PJRA 4ZI3A 1GNRA 2RCNA 2Q3FA 1A1VA 1EFRA 4ZDWA 5AUOB 1YZQA 4C30A 2A78A 4QJ3A 2RGNA 2JLQA 1KMHB 3GLFE 2IWRA 4KJZA 5EXSA 3IIJA 2WTUA 2WAYA 2ZI9A 2WIAA 4V03A 3K9NA 2QA5A 4HEJA 4KFUA 1RPZA 1OXUA 2HYDA 5B57C 1YE8A 2QM8A 1N25A 1T3SA 3MUFA 2G77B 3EPHA 1XXHB 2GK7A 1LNZA 3PUXA 4J0QA 1GP2A 1G18A 2PLFA 3TE6A 1ZC4A 3WYFA 4B2IA 2QPTA 1Z8FA 4BLTA 4RD1A 3MCAA 4Z54A 1A2BA 1NJFA 3QF7A 4CEHB 4B76A 1G7SA 1TEXA 2R6GA 2ZJOA 3X2SA 3CF6R 1CKEA 1IM2A 2PH1A 3P4YA 2GEUA 4EIWA 3AVPA 2ZRFA 4B71A 3ADDA 2KE5A 4FIDA 3VKWA 2EW1A 1VHLA 4KSBA 1E0AA 4EDHA 4CF7A 3ZQJA 1H8HD 2H16A 3EZ2A 5AJZA 4WVFA 2GK6A 3THYA 1Q3TA 4IFEA 3MD0A 5CM8B 5ELXA 1G21E 2IYXA 4LOAA 2F43A 3GLHA 3VNUA 2B6HA 2QBYB 3DZDA 1W36C 2VL7A 2QPOA 3CX6A 4Z8YA 4OI0A 4PSKA 5BWMA 3HYTA 3RS0A 2QP3A 4IDHA 4QKQA 2F55A 4HUQB 1DAGA 4I1VA 1JPJA 4IDOA 4URWR 2PX3A 3A4NA 2CK3A 3A1WA 3U6KA 1M2OB 4GSYA 4P31A 4K81B 5JCPA 1RRPA 1I4LD 2OILA 1ZRHA 3Q7QA 4DVGA 4OK6A 1JNYA 2FEMA 1EFHA 3GFOA 3EZFA 1KDRA 4Q7LA 2CCJA 3B9PA 1Z0DA 4KCGA 4DZZA 1SKYB 1I2DA 2CLCX 2HUPA 2H17A 4RFSA 1P72A 3K9HA 2AFHE 2XGJA 5K8UA 4IDNA 4UJ5A 1G6HA 1HURA 2PZEA 1U8ZA 4D4LA 3GCGA 3KJHA 2ZRLA 4R9UC 3IPYA 1RRGA 1KYIA 4XOIA 4JLNA 2YWHA 5FUWA 2OEPA 2UVQA 4BFWA 2PZFA 1AM4D 1E1QD 1SXJD 2KJQA 3KQHA 1NVWQ 5TDHA 1TF2A 1BMFD 1IAQA 1Z29A 3I5YA 2QENA 5KSZA 5JWOA 1W4RA 1FZQA 5FL7D 2JA1A 4IVPA 2QAJA 4FINA 3UPUA 3IBGA 1E2GA 2WKPA 3L0SA 4B2LA 4DCNA 1OH5A 4ARZB 3QKRB 2QI9C 3FTQA 4BFUA 4FCWA 2GCOB 2ECKA 2QNRA 5HTKA 4DT1B 1G7RA 3GLFA 2CMKA 4JLMA 3KKMA 2CNWA 4TTRA 3CF0A 4AURA 1FQKA 1PUJA 1U8YA 4DCVA 2IX3A 2WJYA 3K0CA 2C98A 4G5GA 1R8QA 5AJVB 3WBJA 4B3CA 4JL8A 3NTUA 4F38A 1YHNA 2VHTA 1JR3E 2CHGA 2ZAOA 1W1WA 2GAAA 3BFKA 4M1SA 4FI3C 4RFSB 2E87A 2GDJA 3B60A 4GOXA 4Q18A 4GI7A 1Z08A 1R0WA 2WOJA 4MKGA 3WHKA 4B3DA 4LHXA 1CJUC 3RWMB 4P33A 1KAOA 5IRCD 3A8TA 3DL0A 4RKFA 3GP8A 1Q44A 3ETLA 1F6BA 3N2EA 3BH6A 3BBPA 3AP2A 4L5BA 2ZRDA 2ZSDA 3AP1A 2IW3A 4Q66C 1D8TA 1VIYA 5JHHB 3BB4A 1XMVA 1OIWA 1P61B 1KSJA 1Q20A 2CDNA 4PAOA 1OXTA 5E7IA 2AXNA 1I4TD 3K0SA 5HKKA 4NONA 1E98A 4G01B 4Q9LA 3A1VA 3AH8A 3CZPA 2VHQA 2AWOA 3KQLA 1QHXA 2ZJZA 3IEUA 1Z6TA 2ORVA 1N6KA 3ASYA 1T4GA 2VQSA 4LX0A 5EXXA 1VYVA 4YXWA 5L3QB 1SVOA 3T12A 3FGNA 3HP1A 4JL5A 5AK0A 3ICQB 1AZSC 4LUCA 1YZLA 1A7JA 5AUQA 1UDWA 5D3MB 3U3RA 4E09A 1R0ZA 3EAQA 3PUYA 4L16A 2IYVA 3EA5A 4TLBA 2QRNA 421PA 2ZYUX 4QHYA 2X2EA 5GJWC 2IWHA 1XRJA 2QMOA 3OEED 1LVGA 1RW4A 2YWFA 2FSFA 3QXSA 1G4UR 2F3TA 3OEEA 5KPDA 4ZKEA 3TK1A 2X77A 2G83A 5J5CA 1RYFA 3QXJA 1Z22A 4Q4HA 3RRMA 3R7WB 3F3YA 5BXQC 2IEZA 3LD9A 3KJEA 4JLBA 1KSFX 2UZ3A 4UJ3A 1MO4A 2NMVA 2GEDA 1NIPA 3AGPA 2QAGB 2NO1A 4LZZA 1O3YA 4MYCA 1SVKA 2VLIA 4JLAA 5M04A 4C0BA 2GCPA 5EZ6B 1N6OA 4LV5B 2HJGA 1UKVY 2F9LA 1WE2A 3LV8A 4TYPA 4DJTA 1EWRA 4TYNA 4RZUA 2R6FA 4O2RA 4ASUD 2OE2A 3ASZA 1B0UA 4DSOA 5KUTA 1YR8A 4HZUA 2JEOA 4OI2A 4LJ7A 3OIVA 3C16C 2ANCA 2J41A 3B7GA 2IXGA 3GMTA 4QBFA 5FL7A 1PJRA 1S9DA 4WZ6A 2IL1A 1XP8A 5H70A 4URYR 4YONB 4A8JC 2W0SA 4B35A 1OFHA 2YC4C 4DUGA 1M8PA 1TQ6A 3CUEF 1YZKA 4KFRA 4X8LA 4TQ9A 3QF4A 5LD2C 3KQKA 4X8HA 4Q1AA 4HLQB 3QVUA 1FQJA 2J59A 4KBFA 2LKDA 2XITA 1T0JB 2FGJA 3AUXA 3NG1A 4TMVA 3OFNA 1CR2A 3EC1A 3AVQA 2Q3HA 4A6XA 3FWYA 3QJYA 1SQ5A 3EASA 3FDIA 4CZ2A 5FR2A 2MSCB 1NSFA 1MRSA 3VKGA 1WA5A 2DHRA 3DZ8A 1G3MA 1YKSA 2RGBA 1E2HA 3QKUA 1ZU4A 2C9YA 5FPKA 5KSOA 4FWTA 5JS8A 5P21A 3WNCA 4DLXA 5C18A 4DLUA 1CULC 5C4GB 1ZD1A 1N5IA 3CWZA 4JLKA 4JVMA 1NI3A 2VH5R 1R5NA 3KJGA 4AYXA 3OZXA 1Q1ZA 1E2LA 1KKLA 2QORA 1DVRA 2XSZD 1H8ED 1NF3A 3BGWA 3EW9A 3EA0A 2F6RA 4TN1A 2ZTSA 3L2OB 3BWDD 3U7FB 1JBKA 3SI7A 3CPHA 3WP1B 4IRUB 5FL3A 4TL9A 5FOUA 5DYGA 5HKKD 4Q7JB 1W7AA 3SYLA 1SVSA 1XD2A 2ODNA 4IEEA 4ESVA 4DCSA 4Z1MD 4PC7A 1FTNA 1MO5A 4NZYA 1FNMA 4B43A 1Q12A 1QDEA 3LA6A 1LS6A 2LCFA 3DEFA 2VF7A 4Q5IA 5IK2D 1YQTA 1HH4A 4KLZA 1RZ3A 1J90A 2FZ4A 1YR7A 5DSZA 2ZETA 3K9LA 1CJKC 2C99A 2EFGA 1Z3IX 3D6TB 1S2MA 3CR8A 2GXUA 5HE9A 2P6RA 4MGKR 1E4VA 2RHMA 1US8A 4HLUA 3P26A 4XSGA 3K70B 3MSXA 3PUZA 4OQXA 5LD2B 1NRJB 1F3OA 3DKVA 1KK1A 1F2TB 1NN1A 5TV2A 3QXXA 4B44A 4QOSA 1AS0A 2OT3B 4UXIA 3TSZA 1KK3A 3VX4A 4TWZA 2D7DA 1PUIA 2IHBA 3IDQA 1T0HB 3B6EA 2BJVA 1JECA 5CJPA 2CHQA 5CB8A 4Q1DA 3OAAA 4RD6A 1EFCA 2YYZA 1BYIA 3GQBA 4A2WA 4YDSA 4LI0A 4A92A 2C96A 1DBSA 3NBFA 1A4RA 3DMNA 3OAAD 3VU9B 5GVRA 5B30A 2F1IA 3OEHA 3CRRA 3NEJA 4AK9A 4W5JA 1FX0B 3THWA 2HF8A 4UNSA 4XIGS 3H86A 2BBOA 4WZBE 4C0QC 4HLCA 4CDGA 5EE3A 3PXGA 5G3ZA 4AIIA 2CXXA 5B64A 1R4AA 1GOTA 1HV8A 3NIBA 2PLRA 1UKEA 3B1YA 4QGFA 4DWJA 3EIHA 1GRRA 3I8XA 1IN5A 3QENA 4ABYA 1TMKA 4WAUA 4KHZA 2VYFA 4JKIA 4LHWA 4DDTA 4LJ6A 4NYJR 4AWXA 4R71A 2GXQA 1FPMA 3VAAA 5F9HA 1G9XA 1N6HA 2QY9A 5EUMA 3UANA 2PEYA 1NY6A 1J7KA 1L4YA 1DAIA 4I1OA 1AZTA 4MITA 1E2MA 1HQCA 2GA8A 4IOLA 2B21A 2J87A 1K8RA 4LSGA 3G82C 2GJSA 4N0DA 3EWAA 1WB9A 3CRW1 1GKYA 1HE1C 1ZM2A 1KI7A 4M9XA 5AJXA 3D7MA 2EFDB 2BBWA 1WBBA 4GL2A 4PC3A 4C0AC 4PHFA 5DI9A 4IEIA 1NL3A 4JJKA 2V6JA 3SZRA 1VCNA 1TTTA 1JAIA 1XEFA 1GITA 4JLJA 1FUUA 2FWRA 4MDFA 2QZ4A 2YZ2A 2NO7A 5DHFA 3A37A 1P2TA 4OYHA 5FTKA 4QG7A 3FOZA 3IUYA 2GXSA 1N6RA 2AD5A 3P27A 3VR3A 1RRCA 1CR1A 2WM9B 2W00A 4DLVA 4GMDA 3FKSA 2NPFA 5AUPB 4C0HA 4V0LA 3BIFA 3P1JA 5DNYB 3QQ5A 4O0MA 3P4XA 4DT1A 3GLFB 4XTCS 1UADA 5FTJA 3TQCA 4QGAA 5KNBA 1YVDA 2EVWX 1W2HA 2ZPTX 3FMPB 4O2LA 1ZD9A 4TL7A 3DDCA 1ANKA 3U3OA 2J9RA 4CVNA 1FP6A 5KU1A 3X1YA 1A2KC 2V9PA 4JKYA 1E96A 1PZNA 1E9FA 1UEIA 1W44A 2WOOA 3HU1A 4TMTA 2OCPA 3I4LA 5DH9A 2AN9A 2VEDA 5KYKA 2C9OA 1W36B 3SBDA 2FMXA 1NMZA 4HB4A 2GNOA 4RJLA 4GOJA 4X8MA 2QRZA 4Q7KA 2X19A 1II8B 2EYUA 3RAPR 5F3WB 4BZXA 2GXAA 2Q9BA 1QHHB 4F7WA 2ZE8A 1EFTA 1XEWX 4Q1CA 4E5UA 4NYIQ 4TSFA 2V54A 1B23P 4US0R 5DHAA 2QMHA 3UXMA 4MGIR 4GDFA 2ZI7A 4NE2A 3E5HA 2XZOA 4AI6A 2CL7X 3TW4A 1GIAA 4NCNA 1JXMA 4TLCA 4PXAA 1SVWA 1ZUNB 1BKDR 2BCGY 2CHVA 2XNSA 4FMCF 3MWJA 5IDVA 3MG9A 5J4HA 1MABB 2CJWA 2TMKA 3I73A 3V4RA 1RIFA 3QPVA 3U3KA 4B74A 4B3XA 3SEAA 1NNEA 3MJRA 2DY1A 4DDWA 1EX6A 4NYMR 5DE3A 2CL6X 4MYHA 4R2IA 2O52A 1BH2A 2Z43A 1FL9A 2JIZA 3SE0A 2V7QA 2ZVPX 3FMFA 4G1UC 4K46A 2D7CA 1JR6A 4HAXA 1KOFA 2IYQA 1GILA 3NDBB 1EK0A 1GTVA 2ZI6A 2R2AA 3C14C 2C04A 4X8OA 3ZZ0A 1KI2A 2J3EA 1JEDA 2OG2A 1XTQA 2ODWA 4ASUA 3IIKA 3EPKA 2J7PA 4W9MC 4WXPA 3MAAC 4URUR 4M1WA 4PHGA 5CYPA 5FBQB 3U3JA 5DN6A 2FSGA 1QHGA 1OJLA 5IHPA 2OO7A 4FN5A 3BORA 5G40A 3WMEA 1NBME 2PCLA 4BFSA 3KQUA 2PL3A 2YV5A 3CKLA 3QKSB 2GHIA 2DBYA 1X1RA 3KX2A 3K0AA 3WBKA 2ZI4A 1CF4A 5C4MA 3ZH9B 3K0FB 1UBFA 5SZJA 4QRHA 4JVSB 2AKYA 2FFBA 1P9RA 3AKDA 1J70A 3KTAA 4BGDA 1ZD8A 1HT2E 2G3YA 3H84A 1KSHA 3NC1C 3IBYA 3GJ7A 1CJMA 4EPVA 2V55B 4QJ5A 1G41A 2H5EA 1E9BA 3K53A 3SDZA 4R7ZA 4BE7B 4EPYA 5FBWB 3AVWA 3HPRA 4MRRA 1KDOA 4Q02A 1NKSA 2VRWA 3REFA 2B8TA 2QGNA 3Q85A 4GOKA 1IBRA 3I32A 4YDHB 1FOEB 3W5JA 2A3RA 4MQBA 3CM0A 4XH9B 1NIJA 3SC3A 2GVZC 1KNQA 1U0LA 3PENA 3CIOA 4B34A 2UKDA 3C4JA 2MSEB 1ODFA 3EPLA 5J4YA 1YJ5A 4TZ6A 1AKYA 3T61A 3PEVA 4HYYA 4A82A 1P60A 5EZ5A 4HUTA 5F98A 2ZRHA 4CEJA 2FU5C 2ZUCA 4FXPA 4BUJA 2RGAA 3GEIA 3I5XA 3OIWA 1W4CA 1Z2CA 2ZRKA 2C78A 2IYSA 3TBKA 1E32A 3T35A 2RB4A 1LFDB 1OH6A 4LBWA 4PPFA 4DIDA 4PX9A 4OK5A 1SGWA 3DOFA 4CEJB 2N42A 3E70C 1Z2AA 1T91A 2OFOA 3MLEA 4BFXA 4A15A 1OF1A 4MA4A 5E95A 1D2NA 2Q21A 1XTRA 1G4AE 4QBIA 4PC2A 4BEJA 2WMOB 4MRPA 4BLQA 1NVVR 3AP3A 2Q3MA 1NG9A 4GZMA 4NDZA 1R0YA 1JJ7A 4ARZA 4M9QA 2GCNA 3AVXA 3FHTA 4QM6A 4ZDKA 4BFYA 2Z6VA 2VP2A 2XOKA 4LWZA 4PAMA 1YU9A 2YINC 4PO8A 5CK4A 1P62B 2ZEJA 2BBTA 3KXKA 3LX8A 4JLDA 5FOVA 3GPLA 1YZGA 4M1YA 1G8PA 5E7JA 4H9GA 4EPXA 5J4VA 2A5JA 3NBZC 2QTVB 3WP0A 4Q4JB 3W6NA 3REGA 2JLXA 4A0FA 1NG1A 2IUTA 4AG5A 3U5ZB 3HR8A 2GF0A 3THOA 2PX0A 2ATXA 4UXHA 2HCJB 4C0SA 4O3MA 2G1JA 5JI2E 3C5CA 1L7VC 4EQ6A 1DO2A 2CEAA 2ZSBA 4OHXA 1OIXA 1WMSA 2IC5A 4PC6A 4NTZA 4P4SB 1KMQA 4FWIB 2J0SA 3SQXA 1W0KD 1T3HA 5DISB 3B5JA 1MKYA 3CX8A 2V7QD 4U02A 3SFVA 4TYYA 3KUCA 1AGRA 3FB4A 2J0VA 3O8DA 4UNRA 2PJZA 4O25A 5LB4A 5F2EA 4ILEA 4A8JA 4B6FA 5SZHB 1JI0A 1OV4A 2VO1A 1UBCA 1GVNB 5JRZA 1ZU5A 3E2IA 1XFAA 4QBHA 1CJVC 1L4UA 2QTHA 4UKDA 5EP2A 4OBEA 4HAUA 3WXMA 1T3LA 4DEXA 3GLGE 2X8AA 3BJIC 3ZD7A 2FGKA 1W0JA 1ZUIA 2F43B 3GLHB 2O8BA 3AKYA 1N6PA 2EYQA 1G6OA 2OCBA 4N0EA 1U0JA 4ACBA 3AGQA 2AR7A 2BWJA 4MUBA 4OJQA 1NN0A 4HAWA 4CIDA 4L9WA 1LF0A 2ZSEA 2WSSA 2DR3A 2ZE7A 2KSQA 3DHWC 2QP4A 1GL7A 1WF3A 3MRSA 1XX6A 2JJ1A 1NMXA 3KQNA 1SVLA 3T06B 4DSNA 1E9DA 1MO6A 4L15A 1TF5A 2QMUA 5JEDA 3LY5A 1V43A 5BYKA 5FR1A 4B33A 3FKSD 2O0KA 4XWKA 3B9QA 1D6JA 3VMFA 2BBSA 3TH5A 1W2GA 2CNWD 2QEQA 2G9NA 2AX4A 2DCUA 4IFBA 1P2VA 4RSGA 1TADA 1OXSC 3IQWA 5AR1A 1HTWA 3VHLB 4HDQB 1M7BA 1P9WA 2ZJ8A 3BC1A 2EQBA 1IY0A 4NCJA 2Z0MA 3IO3A 4UNPA 1OKKD 2WICA 2ATVA 3CPEA 4K8OA 5J4LA 1GAJA 3O8RA 4C2TA 4C0KA 3M4YA 2GILA 2JLUA 5KDLA 2WJHA 3WRXC 4RD2A 2QQEA 4YMTA 2WZQA 3T5GA 4OHZA 2FOLA 2QM7A 1UPTA 2GAOA 2PEZA 1II8A 4BZPA 2NQ2C 1KI8A 3B1ZA 2VSOA 4XWAA 3QNUA 4DSTA 3MWKA 5KNDA 4P4TA 2F1HA 4BECA 3GJXC 4RD3A 2XJ9A 3QIAA 2AK2A 3O8CA 4DB2A 2IHYA 3SR0A 5KTYA 1KKMA 1KSGA 2OM2A 2VP4A 1XMSA 1WXQA 2I4IA 2XZPA 4ZKDA 1Q0UA 1I2MA 1R5BA 2JJ8A 3C5HA 3H4MA 2FFHA 4JLVA 4Q1BA 1A82A 3SOPA 3H0KA 2Q9AA 5LPNA 1BS1A 1WBDA 4A0RA 2GJ9A 3CPJB 3ZS8A 3WHLA 1X8KA 5BW8A 5EP4A 2J0UB 3O8BA 2OLKA 3NHAA 1N2CE 3B1VA 5KSYA 2ZITA 3UKDA 3DM9B 3ZLJA 1FMLA 4TYWA 2IYRA 4EPRA 1YZTA 1VHTA 2BEKA 1KI4A 4S2EA 4UQOA 1CIPA 5HE8A 1GL6A 2R44A 3Q5DA 4B2PA 3CB4A 4KU4A 3MFYA 3A1TA 3AEZA 2WWGA 2DFKB 3TUJC 4Q4JA 5KNCA 4A1FA 1CJTC 4LHYA 1HUQA 4NH0A 2RGCA 1DAEA 5FUVA 3IQXA 1E9EA 1DEKA 1U9IA 2QG6A 4PC1A 1E1RA 1ZNXA 3SN6A 3TSOA 4AKEA 3I1FA 2XTMA 4CEIB 5DI3A 3Q3JB 4B6EA 4KVGA 4YMSA 4TLEA 4EJSB 4TMWA 2ZM5A 4IOJA 2JIZD 5FTMA 3VR4A 1S3GA 3T1VA 3Q5EA 3PG5A 2MSDB 1G7TA 5A0FA 4MH0R 3C41J 2B7CA 5HPYB 1YRAA 1KI3A 4LPSA 1ELOA 5CDFE 1IN6A 1EESA 1BMFA 2WJIA 4JT2A 3DPUA 2GCOA 2FPLA 1IN4A 2OV2A 2OCYC 4DRZA 2GVDC 2P0EA 3I92A 1K5DA 1DAKA 1F5NA 1BYUA 1TL7C 4XD7D 4LV6A 2WWIA 2ZQ5A 1E2KA 1UBEA 4BLPA 1P6XA 4DDUA 3U7HB 1XD8A 4XVQA 3RANA 3CR7A 2H18A 3MJHA 4JBXA 1BO6A 1VKJA 2FSIA 1R6BX 2R9VA 3BB3A 3WYGA 4V0NA 5KDOA 4UXJA 3F5FA 3AF3A 1VYUA 4M1TA 2ZE5A 4LC0A 3R9WA 3OIYA 3M1IA 3AUYA 1G3RA 2HXSA 1ZW6A 1SHKA 1ZM3A 1SVMA 2QL6A 3LNCA 1OPXA 1NVVQ 2WWYA 1JR3A 2GEVA 1KI9A 1P2UA 1WCV1 4NHOA 4Z51A 4M53A 4BLSA 4JIMA 3AVVA 1E0JA 1Q22A 4G5OA 1X8LA 4RFVA 3BFVA 3U7EB 4HLUC 1OB5A 4PPNA 1KDTA 1ZP6A 3KB1A 1VCOA 5C46F 4LV8B 1HEIA 1G5RA 4LC1A 4JVLA 1E2JA 3TQFA 4YMVA 3J81k 3EZ6A 4ZI2A 4IDQA 1C4OA 2NG1A 2WWFA 5DI3B 1T8TA 2FFQA 5L3SA 3BD9A 1G20E 4LY6A 2IS1A 3Q7PA 1X86B 1OFTA 2V8OA 4PZLA 2AXPA 2J0QA 5BYJA 2JLSA 3PEWA 1UEJA 2O8BB 3AB3A 4URZR 4MRNA 3NXSA 3CLVA 3ZZTA 3RRYA 3BH7A 3CNNA 3QEJA 1XJ0A 2HLDD 3CX7A 5L3SB 2DWQA 5KDDA 4ZPXA 1IY2A 4XVUA 2K5UA 1XEWY 3W8RA 2R65A 4OI1A 2QPAA 2HV8A 3SU8A 3W8NA 4NCKA 1AA9A 2W6IA 2YJTD 2NPIA 3BB1A 3IHWA 3PEUA 2P5TB 5K8IA 3U4QB 5H8WA 1R10A 2KI5A 3CNOA 3PIRA 2Q0HA 2QN6A 3CNLA 3SQWA 1ETUA 2P6NA 4EFLA 4D81A 1W4AA 1KHTA 5L3RA 1JJVA 2DFNA 3Q9LA 4D25A 4W5HA 1ZNWA 3GLIA 2JATA 2XX3A 1KNXA 2DWPA 4LJYA 1NBMD 3VX3A 5CM9C 4JT4A 2LKCA 3T34A 1AQUA 2EWWA 1DADA 4NP6A 3SJBA 1E2PA 3BERA 1TUEA 5FBVB 1T5LA 1Q1EA 3KJIA 3VU9A 2KWIA 4FW9A 2IS2A 1QVRA 2BMDA 2REOA 5A4JA 1ZJ6A 3LWNA 4KVAA 5JEEA 1F60A 1NP6A 2ZRIA 1DELA 3A1UA 1CU1A 3WNDA 2V3CC 1DOAA 2PMKA 2PT5A 3GLHE 5C1BA 1BIFA 1EX7A 1OFUX 4G3XA 4UNNA 1E1RD 3TKLA 3PR1A 1GSIA 4Q01A 1XXHE 1ZAKA 2ZS7A 3U44A 4NL4H 1KGDA 1F2TA 1G5TA 2I1QA 3WNBA 4OJKA 1OXVA 3CH5A 4PO9A 2R8RA 3LBHA 1CR4A 1VYTA 3AV0B 5BN5A 4HAZA 1OH7A 3U4QA 5GADl 3AM1A 2BCJQ 3P20A 4DLWA 4NYIR 1ZVQA 2HT1A 1LTQA 4GZLA 4D2IA 2AHOA 5H1YA 2IXEA 2O8EA 2GZDA 2BDTA 2YWGA 2WBLC 3BH0A 1N6NA 3I8SA 1GFIA 4LYJA 3SJCA 4TYQA 4D0GA 5CLQA 2BKEA 1XZPA 4NCHA 2RGDA 4F93B 2DYKA 2W0MA 3GFTA 3SYKA 4A0GA 2QSYA 5IF9A 4AG6A 2FFAA 2ZYWX 2CE2X 3TR5A 3AKCA 3ECCA 3TJZA 2BMJA 2Q6TA 1W36D 2YWEA 1Z5ZA 1QZXA 1U0HC 1RRFA 2GJAA 3VKHA 4MGYR 2CE7A 1ZMXA 4MUAA 3UATA 2ZROA 2IBMA 4KAXA 1E1QA 1SXJA 4Z8XA 5E7MA 1AGPA 2IA5A 5FFMA 4CT4B 5JFGA 2RH5A 4TT3D 1XMJA 4ACAA 2W2XA 1OFIA 2O0HA 3W5IA 2MMGA 3ICEA 4DIEA 2ZRAA 1JR3D 3RS2A 4JLOA 1R8SA 4M1OA 4TL6A 4QJ4A 3TUZC 1IOZA 1EFUA 2J0UA 1EWQA 1SKYE 1IXZA 2ZR0A 2W6JA 3IO5A 3KDSE 2V1UA 4Q21A 3U7GA 1XCGB 1W5SA 1N3BA 3SFZA 5G3YA 5G41A 1P2SA 1FNNA 1NVUQ 2P67A 4A2QA 4Q7MB 4BZQA 2ZYTX 3K0FA 2RKOA 3JVVA 3K1JA 4WXRA 2KBEA 2P2LA 2Z4SA 2CCKA 2OXCA 3O47A 4URXR 1CS4C 2ZAMA 4DLZA 1NMYA 4AKGA 2O8DB 1KJWA 2P5SA 5JWHA 3DOEA 1U94A 3TR0A 4EQ6B 1A5TA 1KTVA 3MWLA 4A2PA 1XTSA 2HLDA 4M9ZA 1CBUA 2JCSA 5BN3A 1GKUB 4DDVA 4M1MA 4DKXA 1XB2A 3GJ5A 1CEEA 1UKZA 1G64A 2VHCA 3CRMA 4C7OB 3PEYA 2PT7A 4FD2A 4RZ2A 4LCBA 3RSOA 3NEYA 1N5JA 1IXRC 4B3FX 2NZ8A 1XPOA 5IK2A 4YXWD 1E4YA 2WSMA 5FTLA 4MYTA 1NLFA 3OF5A 1Z6GA 3CO5A 4D26A 3A4MA 3GJ0A 3N5CA 2QU8A 2CVFA 1VTKA 2FE4A 5FOSA 3QUSA 1FP7A 1Z6XA 1G3IA 4QFMA 1UJ2A 3I3SR 5AWFC 3M0EA 4Q19A 1HY3A 1OT3A 2VA8A 1EXMA 1OYYA 2VSXA 3PUVA 4U00A 4OHYA 2GBLA 4GP7A 2QGZA 4QBGB 2WAXA 1LB1B 4JVNA 1VG8A 2ZRPA 4AYTA 4WIAA 1JAHA 2FPMA 3ZQ6A 8OHMA 2OESA 1MO3A 3EIQA 3T1QA 3QSYA 3AVTA 1E2QA 1GRNA 2QAGC 1VECA 4JMPA 4C2UA 4KLNA 4JJZA 1XPRA 2SHKA 1T6NA 4TMZA 1ZIPA 2FEOA 3BRWD 2A9KA 3D31A 3ZS9A 2H92A 4BWYA 2QMEA 3KFXA 3RVBA 3X1DA 5GJBA 1Q57A 1MT0A 4W7SA 2G0TA 3PUWA 4BQSA 4DBLC 3GD7A 4PPQA 1S3SA 5D3MA 4A8JB 4BPBA 4PQFA 2OBNA 5E4FA 4ESHA 3WMFA 4EPTA 3W3AA 5DN6D 1TPZA 6Q21A 2XZLA 4WA7A 3BOSA 1GUAA 1XCPA 4EAQA 3VQTA 2VP5A 1ZC3A 4LJ8A 2BOVA 3ZYCA 4HLDA 1S0UA 2ZJYA 2WJJA 1G291 3TGPA 5JI3E 3ZIAD 4MDEA 3UK6A 4EFNA 1FMJA 1P7CA 2GTPA 3L8ZA 3AF4A 1AK2A 1EGAA 2EFHB 4Q9IA 3LFUA 5ANRB 1DO0A 3LQRA 3LVRE 1F2UA 3DVLA 3EZ9A 1SULA 4TLAA 5JJLA 2GZAA 1CLUA 4OL0A 1VG1A 2XAUA 4QHTA 1Z83A 3EC2A 3I61A 3RABA 5FOTA 3TAHA 2BVNA 2XSZA 4PSVA 2D74A 4CT5A 2O8EB 2C95A 4G5SA 3WY9A 2YKGA 2UZIR 2NO6A 2FN4A 1TQ4A 2AK3A 5JLJA 1N0WA 1LV7A 2B8WA 4AC9A 4TMKA 3U60B 1KJZA 2YOGA 4F4IA 5TMPA 2LWIA 4OHVA 3B85A 3UWKA 3BXZA 5LDDC 1KJYA 1CR0A 4IDPA 2VP6A 4DHEA 2W6ID 4FCVA 3I62A 4D80A 1DAMA 1GL9B 1XDBA 2OBMA 2RAPA 2PZGA 2ZSAA 2RGXA 4UNQA 5HR5A 4YMUA 2ZJ2A 1XNJA 4YC7A 1NLYA 2EFEB 3F8TA 4RD4A 5FI1B 1XD2B 1MRNA 1ZBDA 3UG7A 5JJKA 3EG5A 3QPWA 2Z83A 4ZDIA 3GEHA 4XVRA 2JJ2A 4AYWA 2HT6A 2RGNC 2ANBA 3OE7A 1IHUA 1G1MA 1ESMA 1QG2A 3AF0A 1G5PA 1KI1A 3K9GA 1OSNA 3PQCA 3R7WA 1XTIA 3KKPA 5L3QA 3VFDA 3HPQA 1KZGB 4HB2A 1TAGA 4XSHA 1C9KA 4B3BA 2QROA 4D82A 1TU3A 5TXGA 5KOYA 5SZIA 3VTKA 2CLDX 5FPHA 3S1AB 3JZAA 1DAFA 1F2UB 3PITA 4DLTA 1FW6A 2GJ8A 5HZHA 2JDIA 2ONKA 1T8UA 1T5IA 2F9MA 3THXA 2W2VA 1KZ7B 3AF1A 4EPWA 2JDID 4BRWA 2ODEA 1HQYE 3GLIB 1RE0A 3PCRB 1BOFA 1H8HA 3CH4B 3K09C 4YLGA 5EJEA 1PVOA 3U6BA 1RVDA 1GDDA 1OYWA 1W0KA 2D06A 1OH8A 5G53C 4DLSA 4A36A 2CK3D 2ZRCA 3UWOA 1VCIA 1E94E 1ZM7A 5CK5A 1XD9A 1COWD 1LW7A 2HCBA 2ZS9A 5CJ2A 5FUYA 3G0HA 3TVDA 3SJAA 2WSSD 2ORWA 3C15C 1U9IC 4MKFA 4QL3A 4BLOA 4HAYA 2R6AA 3R9XA 2DFLA 4JYCA 1PV4A 3FMIA 1G3QA 1E2EA 2GKSA 4IJMA 5E3HA 2JGNA 2IF2A 2ZRNA 4Q4LA 1XWIA 2ZS8A 3LBNA 5GVSA 4QGGA 121PA 5IT5A 4ON9A 3B1XA 3TMKA 2FZLA 1AS3A 2IUSA 3L43A 2OAQ1 4U5XA 4US2R 1XEXA 1MABA 2CJWB 3GLGA 3FHOA 2H8KA 2JJ1D 4EFMA 2DPXA 1S4QA 1UM8A 1R7RA 3ZIAA 2VBCA 4M0LA 4PAQA 1NN5A 2D4HA 4M22A 1X6VA 2PBRA 3P32A 4PO1A 5DLQC 1E2DA 3W9YA 1YZUA 4C7OA 2C2HA 1HYQA 3SHFA 1JB1A 2OCAA 1JQLB 2W58A 2OBLA 2NOAA 2ZRMA 4TLDA 4B47A 2ZI5A 3ADKA 4I1SA 2RGGA 2ZRGA 2J45A 4QXAA 2JLYA 4E22A 3U44B 2HXYA 1S9HA 3FFAA 4HB0A 4KYIB 4RCZA 3T5DA 3CWQA 1EFRD 1L8QA 4KO8A 1LY1A 3IILA 2BHRA 2WWXA 3RSLA 2FH5B 4EUNA 2X2FA 1U90A 1M1YE 3DM5A 4FMCB 5L8VA 3KKQA 5EE1A 3DKPA 1AS2A 1W47A 3QVVA 5CB6A 2JLWA 2E1RA 1AJEA 3NKVA 1DPFA 5HCNA 4DLYA 2YVUA 1TEVA 4LYHA 4OHWA 1KK2A 3E1SA 4V0KA 2CVHA 4BFZA 1U99A 3R8FA 5JWRA 2H1LA 2VF8A 1OKKA 3K09A 5TARA 1N6IA 3EIEA 4LDJA 5EE9A 2ERXA 1CTQA 1QG4A 4LJAA 1XMIA 2FF7A 2FPKA 2A5FA 2YOHA 1KY3A 1V5WA 3TVTA 1Q21A 2RHDA 3I72A 2O8CB 3W34A 1Q1QA 1QHIA 3CW2A 4HB3A 1US8B 2FA9A 1G8FA 4KFTA 2OHFA 3VR5A 4BFVA 2MMCA 3KUDA 1QRAA 3GJ3A 3ADBA 1Z0IA 3FFBA 5FPSA 1SXJB 2QSZA 1J8MF 2GWHA 4A6PA 4KXFB 4MRSA 5TY0A 3FMOB 1OLOA 2X1VA 3X1XA 2D62A 2J7KA 3AVYA 1O87A 4FMBB 1ZYUA 3BK7A 3K0AB 3NH6A 3KKOA 3RYTC 4ZIRB 2QBYA 1ZINA 3G5UA 1M74A 4JS0A 1D9ZA 1YRBA 4Z1MA 3SYNA 2YC2C 2GESA 2KB0A 3CRQA 3VR1A 3H1TA 2G6BA 1YZNA 2R6CA 1IN8A 1C1YA 3FHCB 2WWHA 4IHQA 1XF9A 5AUNB 5JECA 2G88A 3TW8B 2XXAB 5FBLB 2A5DA 1P4SA 2IUUA 5K8LA 1FTSA 1OW3B 1KMHA 4LBZA 2P6UA 3HU3A 4RZXA 2WPDD 4LHVA 2OAP1 4JYBA 1X8JA 1N0UA 3AVOA 3D3QA 2IYWA 2NIPA 3VHXA 1COWA 4I1UA 3ZD6A 2QP9X 4QC2A 3QXCA 3ZGXA 2AFIE 2GF9A 3M6AA 3QKRA 4US1R 2XTZA 3V00A 5FBRB 3F0TA 3CBQA 3QY0A 1KY2A 3X1ZA 4XD7A 2WV9A 4D0LB 1F48A 5J47A 1ZM9A 1QBKC 3V9PA 4BLRA 4ZO4A 4CRWB 4PSAA 5EP1A 3B13B 4FMDF 4KYUA 4GNKA 1NJGA 1PLJA 1E9CA 3AKEA 3K70D 1P3JA 4PANA 3S1AA 4E03A 3FE2A 3RS5A 4AD8A 5KHOC 1IJEA 1VCMA 5CITA 1D2MA 4TL8A 2OSBA 2C9CA 3PJRA 4MKIA 2ZVQX 4M4SA 1J99A 1VG9B 4KV9A 5DIFA 2ZR7A 1W48A 1W5TA 2QAGA 3LLMA 3ZZUA 3T1TA 1N6LA 3LLUA 1E69A 3Q72A 4HATA 4NPHA 4MKHA 4A4DA 4ZDJA 4PZYA 2O8FB 1KO7A 3JZMA 4Q9JA 4Q47A 2ONJA 3Q8XB 4I81A 4C0JA 3LDAA 3HYRA 3U2QA 3A36A 4XWOA 5JCZA 3RLFA 3EX7C 4NKRA 1MR3F 2Y8EA 1Y3AA 1W49A
chains in the Genus database with same CATH superfamily
3LW7A 2G1UA 4I8IA 3H75A 3ED5A 5ESXA 4EG5A 2ADOA 3CEAA 2X40A 1FSGA 4ZCLA 4RV9A 2JFXA 3N86A 1SUBA 1RTTA 1KORA 3IELA 3PUJA 5CIQA 4TKVA 4OLHA 3LQQA 1EHYA 2FKNA 2AFHA 2C8VA 2QRGA 1JFVA 1C1HA 3OEWA 3QOFA 3RAJA 4HQRA 4BNHA 5L7TA 1V9SA 4XVHA 2TMDA 2ZYVX 2QZSA 4FZ3A 4OOFA 4B32A 1SZDA 3A4LA 1MFPA 3OLWA 3OU7A 4EJMA 1NVXQ 1UFRA 1UWKA 2XNDA 2NU9B 1JR4A 3CONA 4UM5A 1DQPA 3AG6A 3HN6A 2ORYA 1OAKA 3AEUA 3I5UA 3Q2KA 4NH4A 5FOXA 3WIEA 3E8MA 5JSZA 2PPVA 3LOUA 2QM3A 3ZU3A 2JI8A 4WLEA 3E18A 2A0KA 1W35A 4B48A 4BEBA 3LKDA 3R0JA 4ITVA 1KHHA 4LHZA 3TW8A 1AGNA 1Z0ZA 2X6RA 3RRFA 1G5HA 1RKBA 1P0MA 3G02A 3T3IA 1U98A 1ZH8A 5I9BA 3P71T 2CL0X 4PXYA 3KYCB 2RK4A 2BTQA 5EVCA 5JS2A 5K2OA 1XXHA 4RAOA 3Q5GA 4HC4A 4OQPA 2B36A 3R0ZA 1AN0A 1Q1BA 2ASEA 3KXPA 2CNDA 4QE3A 3UJBA 1K6MA 1QHNA 5F4BA 4AG3A 4DM4A 2HI0A 1FRQA 2OUKA 2QG9A 1E7QA 4DZTA 1RWQA 1U3WA 3TXAA 1Z5VA 5ABPA 5EUQB 2NZJA 2H9IA 3OIGA 4HP8A 2IDJA 4F11A 2C82A 4J43A 1FRZA 2BGJA 2IYEA 3HJCA 4RGVA 4IVRA 1E2NA 4CCWA 3NJRA 4F2DA 4CKZA 3PHCA 4D79A 4EY8A 4E2WA 4KW7A 2JRCA 3IP6A 3VGJA 4FIZA 5AVTA 4M3NA 5EXPA 4MGZR 2RHTA 5DP1A 1SCUA 5JAMA 1Z0FA 5JAOA 5JSHA 5B6PA 4LGMA 2ZT7A 3SS8A 2DERA 2F1KA 2WMNB 5JLAA 2JASA 3WQRA 3GXBA 4D4KA 1G4HA 3A28A 5FHRA 5BYBA 5EZSA 4AX4A 4FGUA 2F2TA 1ZQ9A 3AFIA 3KZMA 3QOYA 1NSTA 1XRPA 3UPDA 2XB4A 2P2CA 4X5OA 5A7GA 3RR2A 3VUFA 5F9FA 3DOUA 2WJZB 2G09A 521PA 4TZKA 2GDZA 1LSUA 1FP1D 2IQ5A 3K9FC 5ALIA 4ZVTA 1Z06A 5HUJA 3SVLA 2QM0A 1O6FA 4NAVA 4ENRA 1K6XA 1XCBA 2WHEA 4W8HA 2JVKA 3FWHA 3GFPA 3PFIA 4HNQA 2RD2A 1RJ9B 2PFKA 3PFWO 4Y2SA 2X2OA 4S1VA 3WOVA 2QVBA 1XJWA 4HQ0A 4YVFA 1RPAA 3ZX4A 3T5PA 5AP9A 5FPYA 1WLYA 4BRUA 5GONB 3H2HA 4F86A 1RBZA 3A1SA 1O5TA 3AG5A 1JGTA 1IIRA 3D3JA 3GRPA 4RL6A 2X9QA 5AXBA 2R79A 1YXMA 2L0XA 1U81A 3N28A 2QV0A 3I8OA 4R9VA 2YR0A 2Z5FA 2PCJA 4QM7A 2JHAA 2IXFA 2R87A 1JFFA 1EMDA 1JLHA 2KPOA 3UB2A 1X13A 1O95C 2EGGA 4I8XA 5B1HA 1IQUA 3ZDQA 2CNNA 4BTVA 3NAQA 3S68A 1CFJA 2FG5A 2I3BA 4J7UA 1SCAA 4HGOA 1EUDA 1AKUA 2GYYA 4X94A 3AR9A 3QWFA 3W5UA 4LY9A 4F56A 3OQNA 1N2XA 1QK3A 1E9SA 3G7NA 4Q1EA 2BKUA 1S96A 2VHUA 1RWPA 1GSHA 3D4IA 3FBWA 4HAVA 4WDRA 1OYVA 4E2YA 2PN1A 2ZXUA 3KPVA 4KWEA 3DULA 1M34E 4JB3A 4YAWA 3PDCA 2CFCA 1OU4A 2QTWB 4ZT5A 2QTNA 1JLRA 2P3SA 1MQSA 3LFTA 3OLVA 3ZE9A 3DAFA 3O21A 2GPJA 2NO4A 4ZYVA 1HZZC 2FLVA 1E3MA 1G6Q1 3DO6A 3GH3A 3J7TA 6REQA 4EGFA 3T3OA 5EMMA 5EQJB 3TGLA 2ID8A 4WQMA 3R0QA 3PF9A 1E79D 1QH8A 4UVHA 1XRMA 3HNPA 4NMMA 2OK7A 4EG3A 5F7XA 1NJ8A 1RQPA 4MW7A 1F8YA 1XZFA 2XNDD 3KOZA 1DBIA 3CN9A 1DWPA 2HO5A 4G4SO 4ILKA 2R85A 1F0YA 3IEPA 1F2VA 3LDHA 5E4JA 2RMKA 5JVDB 1ES9A 4E5VA 4TWRA 4TTAA 4ZOLB 3WQQA 2B2XA 4HKTA 2AYYA 2NT3A 4RPIA 3RTBA 1ACLA 4HUQA 4AZ3A 3MGCA 3T94A 3T9AA 1BZYA 2FSUA 4Y2RA 3VSBA 4EA8A 1ZNZA 3C3CA 3AZOA 1E99A 2REBA 2RG1A 3HCNA 4JUFA 4L9SA 1GRVA 4MR8B 4UREA 3ZY4A 5JQGA 4H0NA 1EQ2A 1JEQA 3OTWA 1DDOA 5BWLA 1M1UA 5JBQA 1PT7A 1T36A 3E9DA 5SZKB 3L8YA 4H6PA 3FR7A 2ONCA 1CHDA 1AY0A 1Y7TA 4O2AA 2AL7A 2WG1A 1EEHA 3K2IA 4IVNA 2OXRA 4LDZA 2CXSA 3GMIA 2ZW9A 1HQDA 2Y1CA 3V1YA 5AJWA 4Q4AA 1T15A 5JHGB 4RPHA 3ZY3A 1RI5A 2Q0XA 2HJVA 1Z4QA 2WTNA 4V0SA 4GP6A 3OE7D 1QH9A 4WLOA 3CLRD 2W2TA 3E1KA 4RVNA 4JEUA 3T3GA 2XCIA 3OPNA 3ZVMA 1AIPA 4B73A 1MENA 4P7BA 4M0DA 4PIPA 2P6OA 4DCOA 1YASA 3H1GA 2QQ0A 3MTBA 4MLDA 4BVJA 2WWRA 4KBGA 2V98A 4V3CA 1XRNA 2D1FA 4D3FA 3CJQA 3A3PA 1R0XA 4P4GA 5HCIA 3KP1A 2EBFX 2IUEA 1LLDA 1FS6A 2ISCA 1GL3A 2VHJA 3LRPA 2QZ9A 5KYUB 1CB7A 4GQAA 4DCTA 3DOHA 3KHUA 2C1XA 2R62A 3DMDA 4E2FA 3VKGA 2Y76A 1QHSA 4NAUA 3HVKA 4H27A 4AXBA 1GZ4A 2QW1A 3EARA 4JR1A 4L5CA 4C3UA 2VYND 2DFTA 4ZAGA 1GYRA 3R41A 3NNDA 4JMLA 3UPTA 2Z9DA 1ZGHA 1IZYA 2B92A 1KO1A 2POQX 1Z12A 4IUBS 4LE0A 3INRA 2I6TA 4NS4A 3RFCA 4M1KA 4NECA 2VHYA 4GSLA 4GI5A 5CVUA 2Y9MB 4C4RA 5SV2A 1Q83A 5ALXA 2Q5HA 2Y67A 4LXTA 4BO1A 2ZU0C 3TI7A 3IEVA 1N8SA 1DFIA 2QTTA 2IY7A 3CU5A 4GEKA 4P80A 2C84A 5CD9A 3U19A 5AOBA 3GRZA 4M8NE 3L0YA 4FNAA 4BO9A 4BL5A 1BNCA 3G0CA 3T7EA 3T7SA 1ID8A 1P45A 2HF9A 1QRUA 3ICCA 3WNZA 2ZVJA 4ALJA 4EEXA 3BE4A 5HA5A 3KTAB 1GTZA 3CH6A 4BE9A 4MV0A 1QAQA 5EESA 1TU4A 2ZUDA 3G8YA 4JYZA 3U61B 1M3SA 2DTXA 3C3AA 4JEMA 2J5XA 4JXKA 5AI5A 4B82A 4HI0E 5CYFA 4DHWA 5KSPA 3BCRA 5TNXA 4I19A 3BPSA 1X7XA 5ALPA 1NLUA 3E0XA 3TJMA 3UT5B 5CFMA 2Q8PA 3I12A 1NQOA 4G1MB 1IJFA 1NXOA 4GMHA 2EAUA 3BMOB 4RVSA 5FNVF 4DIFA 1E6LA 1KH2A 1SNYA 1WDTA 2B5WA 4GO1A 5EE5B 4JI2B 4AY2A 4FR0A 3OESA 3DCYA 2Y6VA 3HEBA 5HQ3B 4E6PA 5F7ZA 5C51B 3Q7RA 4GPD1 1J2JA 1KO4A 1Y6RA 2GBIA 4AS2A 4KK4A 4GFDA 3KLPX 4YFYA 3RC3A 2P9QA 3HCOA 4V0ME 1P73A 2JZOA 3K70C 3E7FA 3CIFA 1V95A 1DBQA 4GGPA 4FB4A 3KZ1E 4MR9B 1CYDA 4GYWA 3H5WA 1B74A 3EXEA 4D4HA 1IE3A 2DB3A 2QTAA 4N3NA 5FX2A 4MSUA 3LCCA 3QA9A 4IVQA 1SQGA 4P3OA 1LK5A 4QVKA 2IYNA 2QLTA 1KYZA 2X8BA 3ANXA 3ZUGA 1IMOA 5CT5A 3ZH2A 5AHRA 4CG2A 3EDYA 1XA3A 3SXUB 3DBIA 4EYGA 4JU8A 3G89A 5HM6A 2SCUA 4BMOB 2NM0A 2CBZA 1QTIA 4PQYA 1IFXA 1ZH2A 2C5EA 2GBGA 2ZBFA 3LP8A 4R2WA 2A9OA 3OX4A 1V8DA 2RB5A 4YRIA 1NFQA 1FSPA 2CNOA 3TR6A 1FFHA 3BS4A 1QF9A 4CLEA 4LJ5A 3ZK7A 1X7YA 3FCAA 3JQ8B 1MEEA 1JAYA 1E9RA 1NMSA 1HA3A 1XZEA 4N76A 2LXNA 4RMNA 4JP2A 4HK4A 2C03A 2NYAA 2P9JA 4C3ZA 5CLLA 2FV8A 4IWYA 3AUJB 3CTMA 3IKJA 3L0PA 3PGXA 4NATA 1QHHA 5CYOA 1NBMA 3NVMB 3H6KA 5T4HA 4Y18A 1KYVA 3BDIA 3H2YA 3IEKA 4FP9A 4C06A 1LF5A 4WBSA 4MP8A 2XNKA 1MV5A 1G3UA 1ONPA 3VNVA 1UJ6A 3W1WA 1L3BA 1FFXA 1WP9A 1TLLA 1II9A 4RTQA 3DFZA 5FPTA 3ITDA 2AC4A 5EP3A 5EEGA 4ZHSA 3DL2A 2BMFA 2F1JA 3I6YA 2NQTA 4CMAA 4RFLA 5L6LB 4MS1B 1SUEA 4PBTA 3GWGA 2BPOA 4G07A 3MWYW 1N5DA 2YCLA 3PLRA 2YZGA 4IW3B 3PPYA 1J23A 4PRZA 3SF8A 3ZWOA 2N0SA 4YPOA 2O4UX 1SQFA 1P77A 1RACA 1DXHA 1C9YA 5T67A 3SZGA 4BMYA 3QKSA 3RS3A 1YU6A 2EW8A 3RBZA 3EEOA 5K0GA 5JZVA 2YZ7A 1SXJE 3AFGA 3KYIB 1ULZA 2X5KO 4EX6A 1KI6B 4EY5A 2OOKA 5IVPA 5LXTB 1HT1E 2BIFA 3PIIA 3CCFA 1UDXA 5JVDF 3GUUA 3KR1A 1M8JA 1TUIA 2AFIB 4YJ2F 1R0CA 2DSTA 1PR2A 4HLNA 5AVYA 3HFSA 4QNMA 1LH0A 4CCYB 4OLBA 4O3FA 4V39A 1GPAA 2B3DA 3LW8A 4KN9S 1UBRS 1H6BA 1KR2A 1XN4A 3KLBA 1SVIA 2ZAYA 1MDBA 3LT0A 3P2YA 2ZB2A 4N7JA 4ZGWA 4QA9A 2XMBA 1GZ7A 5J5VA 2LNDA 2ZBQA 3FCEA 1X9IA 2X7JA 2CFRA 3UJ8A 3R5SA 4BYGA 3GVIA 5CMLA 3ZNNA 3WICA 5A5GA 3CT4A 5HUQA 4L3VA 3IT2A 2GETA 1H05A 4NU6A 1H2HA 1XBTA 5HEKA 3V5NA 5CFPA 1XL1A 4C6TB 1Z47A 2CL5A 1FUKA 2H5IA 1H0HA 4EELA 1Y8ZA 3ND8A 2X9NA 3COZA 3RIYA 2CLSA 1Z6YA 2IS6A 2G67A 4M37A 1Z8DA 2YUIA 3IJPA 2FZ5A 3EH1A 3Q8MA 2G4CA 4D9NA 1YNOA 1IY1A 1ZHHA 3AK4A 4CEHA 4H59A 3RF6A 1QG0A 4Q3CA 3QQPA 5AKXA 1S8NA 4IV8A 3TQIA 4W1PA 2YRFA 2P4EA 2V45A 4DYHA 1TT7A 1C0IA 1SOMA 2FLWA 4L73A 4YCNA 2YS7A 2BEWB 2ZANA 4RPCA 2O5VA 1RE1A 4CM4B 3CSUA 4LRTB 4DNFA 1TK9A 4IIDA 1PX0A 3JQAB 2BKXA 5H02A 2IZOA 5AHWA 3KAPA 1WRBA 5C8VA 4KH0A 2NV6A 2OFXA 1NXQA 1XJCA 1YBAA 1FEZA 3DOJA 4LBYA 4P54A 4Q39A 3W7VA 1S7GA 2O5RA 2P2YA 2C07A 3PFGA 3ZCQA 2Z9BA 2YS6A 2YNMA 4HN2A 3GT3A 4EX7A 2JIOA 1K92A 4ZHQF 3ROQA 1ZRMA 2VPPA 4YMIA 4ECAA 1Z6QA 1RHMA 2QJFA 2QRQA 4JBYA 2XE7A 1HFEL 4KL8S 3TM5A 4NV3A 4COKA 2I3GA 4DMUB 1H2XA 4POAA 3VZCA 1GY8A 4CGZA 4ZMBA 1XDGA 4Q82A 2QW0X 3KXLA 3P94A 4YPVA 4JZKA 1G8HA 2PK3A 4AY5A 2CJYA 2RCYA 3KS9A 1DMRA 2Z3ZA 4RHTA 4EB6A 4HADA 4L75A 4Y9TA 5BNZA 2ZPUA 2GRAA 1WUTA 4XCVA 4GBED 5AW4A 1Z4OA 4OFBA 1A1VA 3UUGA 3RFUA 2PD3A 4FEGA 1FLNA 1C4KA 1QZ3A 3BWCA 3KB8A 4QODA 1O5IA 5IJ9A 4ARIA 1LK0A 4G1EB 3RU9A 2HMYB 4KJZA 2PLAA 5F7OA 4V03A 3HXLA 3E27A 1KEWA 3SZLA 1LPNA 1HDRA 2QA5A 3WLAA 1VA5A 5CA1A 1RMYA 4WCFB 4CQMA 3MUFA 2RAFA 5C53B 1TQHA 3PUXA 1J0BA 1VP9A 1GP2A 1XZ8A 1YBMA 2R7KA 3N0XA 4J0QA 1X39A 5IYZF 4BQPA 1ZC4A 3KHTA 3WRVA 3WYFA 1T8YA 2H4XA 2JI6A 3R3UA 4B2IA 3OMXA 4BQOA 4BLTA 1VZ3A 2WPNA 4RD1A 3MCAA 3TWOA 4YUXA 4Z54A 1NJFA 3RQSA 3L79A 4CEHB 3PCTA 3H6GA 1G7SA 2R6GA 4QYIA 4B76A 3P4YA 1IM2A 5IBQA 1KFCB 4RX1A 2NUAB 4OYYA 4RTPA 3ENQA 1KA9H 3K5WA 5FI3A 2EW1A 5H82A 3F74A 1F1BA 1JYEA 4FDTA 3CC8A 2NADA 2EG5A 2NO5A 3ESBA 4IZOA 4OQYA 5AJZA 3RKUA 9GPBA 2DHDA 1YCDA 1XPJA 3MD0A 5AQEA 3WKBA 4EY6A 3LQ1A 3SSOA 5ELXA 1OR8A 3U9TA 2O3UA 1FFDA 2F43A 3G59A 1BROA 2QPLA 2B6HA 4D3YA 3DZDA 4INJA 3ZJVA 4FJ0A 1SCNE 2I55A 4L74A 3EAGA 3WV5A 1IULA 1NUQA 5IM4A 1C4WA 5BWMA 4XGNA 4RTMA 1WQ3A 4IDHA 3UO8B 3BICA 4AZ0B 3HVIA 2VYVA 1WU8A 4IDOA 1LFAA 4JLUA 3A4NA 4NXNB 1LC3A 4GSYA 4P31A 5CB4F 2EFJA 3OPYB 1P9LA 1I4LD 1GLVA 4CG1A 5EUCA 4CI9A 1ZRHA 3CKKA 1DKUA 5ELMA 3LA8A 3VKFA 3GGJA 4EF5A 1QGYA 3DE4X 3GFVA 4BRZA 2OHXA 2X5XA 4X97A 4DADA 4KCGA 1U7WA 3SR4A 1I2DA 2JFGA 1P72A 2PUHA 4IIVA 3PC8C 2AFHE 1FDIA 1LI5A 4UJ5A 1S02A 1IY8A 1G6HA 1HMYA 4JDUA 4EHBA 4R9UC 4PG7A 2VZ8A 3IPYA 3KOUA 3DWEX 2QSJA 3F6RA 3DPSA 4JLNA 1GG5A 2YWHA 2NPOA 2OEPA 3GCDA 1AM4D 1TO6A 3V46A 4BKUA 3KQHA 3JYQA 3UC5A 3L8MA 1NVWQ 1IAQA 3FUCA 3RFFA 2IXTA 4OU5A 3ASUA 1ESEA 4FOOA 5FLYA 3QNMA 4HQ6A 4MVJH 2PR2A 1NBEA 4ODIA 3CZ9A 1Y1PA 5JWOA 1CS0B 2IOFK 4TUYF 5IDWA 1QP4A 5FL7D 2D0IA 5JC8A 4JYAB 4IDDA 3RKRA 4CL3A 2W11A 5JZMA 3DR5A 1E2GA 2DE0X 4WFKA 1IVSA 1X7WA 4B2LA 1ABBA 2BGTA 4DCNA 5K6AC 4WCFA 4JR0A 4KE6A 4BFUA 5T6MA 1B8OA 3A25A 1IK6A 1AZWA 1QAOA 1PQYA 1SBZA 1G7RA 2D5BA 1JE1A 3CZ4A 5ALTA 5KTNA 5CNMA 3L6DA 1PDWA 3SQLA 2CMKA 1JHRA 4GXTA 5TVGA 1RXIA 4FNMA 2CNWA 1F12A 1NONA 3KL2A 4UTXA 3D2LA 4RVUA 2WJYA 1R1DA 1XDSA 2FFRA 1GGMA 4G5GA 4O59O 4JL8A 4OQZA 3HB4X 2WUFA 4LJLA 1YS2X 2VWHA 1W73A 13PKA 5FRDA 2CHGA 2UXDB 1MEOA 3I28A 3UT0A 3BFKA 2IUFA 3VR5H 4FI3C 3WFJA 4RFSB 5G4LA 1DEAA 3B60A 2Z04A 5CR9A 5I4KA 1DC7A 4GI7A 4IY1A 3I6BA 2EFYA 3BUSA 3TL6A 3NAGA 1E6KA 1OTXA 2AYZA 3BMNA 1CJUC 1DAPA 1HWYA 2PZAA 5A3RA 3GBSA 2VWPA 1BU5A 1OVMA 1JZQA 3R5KA 2XCRB 3E7WA 5IFKA 3DL0A 4ENQA 4QOHA 1F6BA 2H6EA 3CNQS 1LDEA 1E6MA 3BH6A 3IAS1 1RHJA 1UM9A 3BBPA 4L5BA 3TRHA 2ZSDA 3NHKA 4ENPA 1OAAA 4F7DA 3QUAA 4RM2A 5JHHB 2X8JA 3BB4A 1OIWA 1T4CA 1KSJA 3D5QA 3ZK8A 2NN3C 1LV8A 4I5DA 3N5KA 2M1XA 1KEKA 3RVMA 5IZCC 4IGFA 5HKKA 2QNBA 4NONA 1S01A 1ZD5A 1B8UA 1OZFA 2YXEA 4QO7A 5CXXA 1A71A 1EP9A 4DWOA 4F96A 3CZPA 1EA5A 3HFJA 1VJCA 1FDRA 1UBJS 1RXWA 2D2IA 4ARAA 2AWOA 1JV2B 2GZRA 4FYXA 4RQAA 5DSTA 3IEUA 4BZWA 5KSWB 1WHTB 2WMDA 3SKVA 5EXXA 2VQSA 2EF0A 4H3HB 4MV3A 1SVOA 3PNLA 3UT5A 3DZKA 3HP1A 1U9YA 4QSMA 2HTFA 1WMAA 3D8NA 3GXOA 4KX5A 1L4HA 3EEBA 1B1CA 4HMOA 3DOIA 1M2VA 3MJEA 1AOXA 1UDWA 3Q15C 5D3MB 4E09A 1XNQB 1BVUA 3EAQA 4BQFA 5IUNC 4L16A 5F9MA 3EA5A 2GKGA 3ETNA 3UHFA 2QRNA 4FEEA 4AMZA 1FFYA 2DT8A 3DXZA 5BSKA 5IH7A 1KPGA 1KQPA 5GJWC 4CIAA 3OPQA 1XRJA 3C3EA 2QMOA 4JROA 3OEED 3AR2A 3IQEA 1LX6A 1XZHA 4R8KA 1HT0A 2JK0A 3CYFA 5B36A 3OEEA 1VKZA 4Q12A 4QUJA 3TK1A 1NQWA 2G83A 4XARA 1E3EA 4C2BA 1Z22A 4J1NA 3RRMA 3C4VA 1RHQA 5EJMA 1GUBA 1E5XA 1RXEA 2M2IA 2J4FA 1JAXA 4LY3A 1DCTA 3LD9A 4P84A 3SXJA 1A5AB 4LJSA 1GHTA 4JLBA 4DS3A 3TLKA 1EE1A 4ONEA 2G8NA 2UZ3A 2CLFB 3VR4D 3MLBA 3E5NA 3DAGA 2OECA 3LUBA 4OB7A 2BMWA 4KIJA 5ITSA 3AGPA 3IDZA 2FPIB 4QRDA 1WETA 1N0HA 4DR5B 1O3YA 5G0UA 5M04A 2OBYA 4REQA 2G7ZA 5KHLB 2W2OA 2PE5A 1UK6A 5EZ6B 1A4XA 2GARA 2GBPA 1E1MA 1N6OA 4UM7A 4OBXA 2R751 4DLAA 2Z4TA 4H6XA 4LZJA 4BAUA 2F9LA 1WVGA 1YRLA 1NR5A 1U7UA 2DQKA 3BIJA 3FXAA 4XWTA 3SK0A 4DJTA 5BW4A 5C32A 2XQVA 3VR4H 4UU8A 4TYNA 3KUKA 2OE2A 4IMJB 1TM1E 1HLFA 1B0UA 1K9SA 1KH1A 3BSWA 4JASB 4LXIA 2UVPB 2XVXA 3OZSA 5KUTA 3O4IA 3VYTB 2RDMA 2ANCA 3M2TA 2H7CA 4PSDA 2FWAA 2IXGA 3GMTA 3I39X 1PJRA 5K0FA 3P0IA 2GZ2A 3PNKA 5E6UA 1N2SA 4YONB 1Z62A 1OFHA 2HPZA 4N7BA 3EGXA 1H66A 5IBCA 4JI6B 4AJLA 1Z17A 3DE1X 2ZT5A 5JDIC 1SXQA 4JITA 5H7XA 4Q1AA 1U02A 1FQJA 1YB5A 3FZNA 4LY0A 3OPYA 2LKDA 2XITA 4YPFA 4AUNA 2WFAA 3KQVA 3G1WA 3UQYS 5DGCA 3EZXA 3OFNA 5LCXA 3L18A 3AVQA 2HIAA 3ICPA 1UBHS 1SQ5A 1VPVA 4E30A 3EASA 1Z25A 3QFSA 5AM0A 3BXFA 1T8RA 4B0PA 4CLHA 5CEEA 1KBQA 2JCGA 4N3CA 4O8ZA 1G3MA 3I0NA 3U4GA 1I33A 3QKUA 4D9EA 4YRFA 1M6YA 2XNJA 2JA2A 5FPKA 4F3CA 4MIOA 1ESDA 5JS8A 2RBKA 4UAUA 2OCIA 3MJTA 5EPEA 2D1RA 4KAFA 4GPEA 5EL0A 4DLXA 5C18A 1NV9A 2CLKB 4QTTB 2FQXA 3KJGA 3QMVA 1RAFA 1B73A 4OB6A 4L78A 4D8VA 3P9CA 5B4UA 1C3XA 4COOA 4LF7B 4RIEA 1E2LA 4MVCA 1PP4A 2G70A 5HIKA 1YR1A 1EXWA 2EIXA 2NXEA 2CNBA 2QX4A 2AQKA 2YWBA 3LIIA 4R1QA 2X1MA 3UKOA 3WLHA 1FFBA 1NF3A 3BGWA 3ZWVA 1ULAA 5FKJA 4RTLA 4C6TA 2Q4DA 1E2BA 2VZLA 1OA1A 3UT6A 2VJCA 3BWDD 4Z3KA 2J4DA 1RP7A 3RSGA 3SI7A 4MPDA 4G97A 3AHDA 3HRIA 3GMSA 4CCSA 3Q3GE 1YCFA 3CPHA 3SJUA 4A03A 4IRUB 5MN6A 3JCZA 5KWVA 3OT1A 4TT8A 4ME6A 1W7AA 2HRBA 1XD2A 5AOAA 1XTZA 1WSWA 3CGWA 1P1RA 3KKEA 4CV2A 4YJ2B 3EGIA 3SXPA 3ZE0B 4CKCA 4WNIA 5FO1A 2C4HA 5B7QA 1SB8A 2CDAA 1QG6A 4LFAB 1FNMA 5I7VA 4Y6GB 4B43A 1Y4DE 4U0KA 4DYVA 4KLZA 4Y3UA 3IP8A 1ISHA 3UJNA 1T4DA 2NACA 4NAHA 2ADFA 4M1QA 4BV8A 2FZ4A 2O1SA 1J7JA 3J80A 3HKBB 1ABEA 3CR8A 5LOVB 1MAUA 4LQDA 5SYNA 1UOPA 3JQFC 4MGKR 1MB9A 2RHMA 3P26A 4ZREA 1OMOA 2X3YA 1K0FA 1HR0B 4I5EA 3OWXA 5LD2B 2YJ6A 4N3GA 1NRJB 5D6OA 4UVGA 1EHCA 2WSLA 4ZV7A 3DKVA 3PZBA 3PC8A 3QXXA 4B44A 3HQ4O 4UXIA 2WFMA 3M49A 5DGIA 3VX4A 4BYMA 2D7DA 3LJKA 3HGTA 2O19A 1PUIA 2N1MA 1ZRNA 3SAJA 1F7UA 3B6EA 1T6XA 2BJVA 2UUPA 1J33A 2LRHA 5CJPA 1FFXB 4Q1DA 3WA7A 5IULC 4A2WA 5ISMA 1UOOA 3GQBA 4GLBA 4A5OA 4RDCA 3RH0A 4LI0A 3VDQA 1EFVB 5KNDH 2F1IA 5AD1A 3MRXA 5KTOA 4AK9A 1T6ZA 4R0MA 3I23A 2WFZA 3H86A 1ECLA 1N4DA 3NBQA 4KMSA 4WZBE 2QN2A 1R74A 3ZDAA 4NEGA 4A73A 3MRVA 4AIIA 3E82A 4CTNA 2Q8NA 4EHNA 4X00A 5FPQA 4B4OA 5I9IA 1QPZA 1V96A 4LGVA 4RH0A 5BMVB 2DG2A 4NZNA 3WLOA 4JP8A 4GP9A 1UKEA 3CCBA 1HBJA 1I7LA 1Z5UA 3B1YA 1Q0ZA 3GRAA 1VDMA 3EIHA 4HYTA 4ZOLF 2CXUA 3KEMA 4WAUA 2OPHA 2VYFA 4KIFA 4DDTA 4CMEA 3TECE 5AIBA 1RYYA 3HCPA 4AWXA 5TGDA 1FPMA 1WHSB 3QOXA 5LZ4A 1G9XA 1XZDA 3EHDA 5EUMA 3UANA 2XOXA 5KYGA 4G0PA 4EF6A 5A1JA 4I1OA 1AZTA 4JUAA 3UH0A 4RPJA 4JT9A 1O57A 2JGDA 3G82C 1NNI1 1TJ3A 2GJSA 2ZYGA 1NKVA 3EWAA 1ZM2A 1OAOC 5AJXA 3D8UA 4MR8A 4E5SA 5DI9A 5THQA 4U5QA 1L8LA 3ONFA 3SZRA 4AP5A 1VCNA 3TIGA 4X1YA 2B37A 1XEFA 4QX6A 4WKCA 3WMXA 5GTDA 1FUUA 4AZ3B 4PLFA 4KPYA 2Y1EA 1JU4A 4NOJA 4QG7A 1T0IA 3IHTA 1N6RA 1Y98A 2AD5A 1E4EA 1BWRA 1QANA 3FTFA 5PNTA 2WM9B 3RVOA 2OVBA 4ENVA 2UXBB 4PYIA 2WW8A 2NPFA 1VJ0A 1WNFA 4Y2HA 3OSUA 1N5MA 4V0LA 3TD6A 2W2PA 1P0CA 3F67A 5DNYB 1UJ5A 3FSJX 4FOSA 2L17A 1KOJA 4O0MA 4CHTA 4PSCA 1MJHA 1UC8A 1XI2A 1UADA 3I9MA 2GHQA 3WYNA 4DARA 4R41A 5KNBA 5FQNA 1TJ4A 1YVDA 2EVWX 3CXUA 4TL7A 1BH6A 5AKHA 1ANKA 1OBFO 1A69A 3H1FA 3ZHOA 3JZFA 3X1YA 1W581 3AM4A 4OO3A 1PZNA 4EMUA 1E9FA 4P1ZA 5C7IO 1Z5NA 3LG2A 3KWJA 3PXAA 4OHMA 3IVXA 4Y6RA 2AN9A 5DH9A 3RT1A 2VEDA 3QUCA 2HO4A 5DXFA 6CHYA 5E9QA 3ZY5A 1E89A 2VSYA 5DNVA 2FMXA 3TLCA 4MO2A 3GEPA 2WA2A 4AF6A 5C5CA 4RJLA 1K7XB 4EHFA 4R5MA 4QQKA 4Q7KA 1GD1O 2QMZA 2X19A 2FPRA 1R3DA 1QRSA 1K3FA 2PDAA 2G06A 1HI9A 3B12A 3R2JA 3CE9A 1V37A 3E1GA 4G86A 3PJGA 4Q1CA 3BEDA 4L8WB 3KNZA 4K0RA 4NYIQ 1QYVA 4MXDA 2R96A 2LPMA 2VH2A 2FW7A 4US0R 5TSDA 4DA8A 1NM5C 1UMDB 4H6VA 4D57A 4YAJA 4G9BA 2WT8A 4UEWA 4BQEA 2QG4A 3EXHA 1GIAA 2HBZA 3T8YA 5J23A 4BO2A 1T0UA 1PW7A 1SVWA 2B1RA 4AU1A 3IP1A 4LSZA 2CHVA 4FLMA 4FMCF 4YJ3B 2Y4NA 1CDZA 4K9LA 3G8BA 3Q0EA 1MABB 1U0TA 3BQ9A 1RIFA 5FLXA 3U3KA 2H1RA 3LT2A 4B74A 1TCUA 4EVQA 5K7SA 3KYCA 3DMRA 3SEAA 2PKRA 2F8MA 3MJRA 4DDWA 1EX6A 2WU0A 4O4HB 4MYHA 4XLLA 5HMLA 4FGZA 1P7ZA 3Q10A 4F5EA 1J42A 5C81A 4E5NA 1FL9A 1WB5A 2JIZA 3SE0A 2V7QA 5ILOA 3F73A 2HY7A 1A8SA 3GPCA 4X9XA 3U5TA 4FEYA 5FFNA 1GILA 3R9XB 2ZI6A 3L49A 3IXLA 2O7NA 2OG2A 4ID9A 4HFMA 1XTQA 2ODWA 5LQJA 3VJKA 1IQ0A 2JKYA 1Y7LA 4H0CA 3EPKA 3LZCA 1SEPA 3MAAC 1Y8QA 3EDMA 3QY9A 3ORQA 5CYPA 3IT0A 5FBQB 2G71A 5DN6A 1OJLA 5IHPA 2OO7A 2F3UA 3TB6A 3HM2A 3WGNA 3RROA 2PCLA 3GMDA 3SNKA 3KQUA 2X9LA 1GR1A 2VS1A 1XMPA 3HDJA 3FFTA 2GHIA 3BBLA 5TIIA 1X1RA 3MTJA 3KX2A 1NOIA 3GA7A 4E32A 2ZI4A 2CT8A 1CF4A 5C4MA 1N8KA 1UBFA 1ZH4A 2NZVG 1GPDG 4IWNA 4QRHA 1CY0A 4DQUA 4ZYTA 2UU9B 2CFIA 1P9RA 5GINE 3KTAA 1ZD8A 3R9KA 3GELA 3ANLA 3IPRA 1W30A 2GYVA 2IRWA 3IBYA 3N2NA 4NOMA 3GJ7A 4W8OA 2QD3A 1U1GA 4J7CA 3T5MA 4ZT3A 4AO8A 3KKKA 3M9WA 3PEFA 4LI3X 4DA9A 5KQRA 1MHTA 4BE7B 4R7ZA 1IK4A 1Z74A 3TTUA 1AQ6A 5ILGA 4M8SA 5KNCH 4DOMA 4TX1A 1P29A 3REFA 3K4HA 1QS0B 2RK6A 3I0MA 4GOKA 3LT5A 3DVRX 1IBRA 4YDHB 4YBRA 2JW5A 1FOEB 3GLKA 2J9FA 4MQBA 3CM0A 3RW9A 4XH9B 3HVRA 4JHXA 1DQZA 4NG4A 2G36A 1KNQA 5JFTA 1U0LA 2PA3A 4GUAA 4LZAA 3R44A 3FJ1A 1C2TA 3PPIA 4JP1A 4WASA 3KO8A 2NW6A 3WYCA 5J4YA 3ZWKA 1YAJA 2I6GA 2DUMA 1JILA 4HYYA 4X20A 1P60A 4I1IA 3ROTA 1QRDA 1T6YA 4A82A 4HUTA 1SD5A 5LOVA 1K06A 4IHJA 1NQTA 2A0FA 5D6NA 3DLHA 4N6GA 4FXPA 4BUJA 3PLNA 2RGAA 1F14A 1W4CA 5CH8A 4GVPA 5CH3A 1RLMA 3KTFA 3CVOA 4HQKA 1E32A 2XDYA 1T4MA 3T35A 1TE2A 2RB4A 4LC9A 3ZDDA 1QR6A 3GRKA 4DIDA 5EHGA 1Z45A 3R1IA 4PX9A 5FHQA 1ZW1A 1SGWA 4ZRDA 1QM5A 3ZE6A 4J03A 3OOWA 1JDVA 1UJNA 1E3SA 2C5SA 2N42A 3E22B 3FNEA 2JGJA 2HZ7A 3LUJA 4KUEA 1L5KA 1T91A 3MAJA 5EJGA 3U31A 4G4IA 2Q7XA 4MA4A 1U0OC 4PS0A 4TV9A 3WZMA 3F6BX 4QBIA 4AJ9A 4EJFA 3DTVB 3AXSA 4BEJA 5CT9A 4E7PA 3NT4A 2Z1MA 3EXHC 4MRPA 2ZT8A 5CX4A 1PFUA 4TTTS 1SK8A 1Y4AE 2Q3MA 4GZMA 4NDZA 1AUOA 5EHZA 1ZY2A 4M9QA 3NOOA 2GCNA 2DKOA 3ETGA 1QRTA 3AVXA 1YKGA 3DT6A 4BFYA 3MELA 2BFFA 5JCJA 1WPRA 4AFNA 2XOKA 4Z86A 4LWZA 2KW5A 1GPLA 2YINC 4PO8A 5CK4A 1QMPA 1YJ8A 3A3YA 3ESZA 3IB3A 4JLDA 3N76A 4E88A 1YZGA 4M1YA 4IPTA 3OP1A 1Y0BA 4H9GA 2J67A 5JECA 1EDBA 3PFHA 2UXCB 1ODSA 4DTIA 1HOXA 3KZXA 2XMZA 1U5AA 3EQ9A 3IQFA 1MAVA 2PTHA 1UWLA 2WU3A 2ZYHA 3PX3A 4W5TA 1DC3A 2JLXA 4A0FA 1BX1A 2EZUA 2IUTA 3U5ZB 2JHFA 2GF0A 3GG9A 1DUIA 3WTBA 2HCJB 4EAAA 2XDQB 1R9GA 1HE3A 1OV6A 1QU2A 3N75A 3FG9A 5ARDA 1DO2A 2YXLA 4XIYA 4O2BA 2BGGA 1NU8A 4PM4A 5JBNA 4NTZA 4KRXA 3SQXA 3AJAA 3M6FA 3V2UA 3S2SA 4ZU1X 5MDHA 3B5JA 1EVYA 3L7BA 2Y1GA 3A2LA 1GUZA 4U7PB 3PLAE 2Q3JA 2MSWA 3KUCA 4IFIA 3FB4A 5E38A 8ADHA 2J0VA 4DDKA 5LB4A 2XF2A 3ZG6A 3Q9NA 3VOSA 5IUJC 1CX9B 2WF9A 3PJFA 3T9DA 1UBCA 1N8TA 3KOOA 3MRTA 4JA0A 1F0NA 4RMHA 2X9GA 3RU2A 4RSHA 2K2WA 3IALA 1Y6GA 1P0QA 3WXMA 2OP1A 1F5SA 1T3LA 2P9FA 4TS3A 3BMQA 3IIEA 4QQ8A 4GMKA 4BMZA 4RA6B 2DETA 1YB1A 3AJRA 4CM1A 2PL5A 1G6OA 2BP7A 2I2DA 1U0JA 1VIVA 3BHJA 3HB1A 4OXYA 4UDNA 3UNXA 2BYTA 3L0BA 3HZZA 3VI3B 3V33A