4GOMD

Crystal structure of e. coli dna adenine methyltransferase in complex with aza-sam
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
243
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Selective N-6 adenine methyltransferase Inhibition by Transition State Mimic
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA adenine methylase
total genus 81
structure length 243
sequence length 268
chains with identical sequence E, F
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4gomD02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gomD01
2B3TA 3C0KA 4RTPA 2ZLBA 3TFWA 3TM4A 4CKEA 3MAGA 5ICCA 1RI1A 4R8SA 1JG2A 5CVVA 5GP1A 2GB4A 4C03A 4X60A 5EMMA 5EMLA 5C1IA 5EOVA 4V0RA 3OZRA 2P40A 4AZTA 2P3QA 2N47A 1EJ0A 1L9KA 4LWOA 5K0FA 3OFJA 5G02A 4YUXA 2FK7A 3MTEA 5DRTA 4EK9A 1XDUA 3VC1A 2H00A 3KPJA 1FBNA 5FCDA 3CKKA 5E2BA 3T7TA 4YUWA 3MQ2A 4GOLD 3HCAA 5EC8A 1NW5A 2EG5A 2PXCA 5K05A 2AVDA 5CVJA 2BH2A 3PX2A 3FTDA 4CWAA 3UJ9A 3G2MA 2AOUA 3LDFA 4M36A 3IYLW 2WA2A 1O9HA 3UZUA 3A25A 1G6Q1 3DUWA 3E05A 2E5WA 4IV8A 3BWCA 1QAMA 4ER7A 2HTEA 3Q7EA 4MQ4A 5EZQA 4FSDA 1U2ZA 1SUIA 3R0QA 4YUZA 2ZWVA 3C3YA 1KR5A 1L3BA 1M6YA 4X41A 5T6BA 1NV9A 2ZWAA 3NTVA 4BP3A 2ZIEA 1NW8A 3BWYA 3KQQA 3P9NA 4G56A 4OBWA 2O07A 3B7PA 4GC9A 4O29A 2GLUA 3TQSA 3KPYA 1O9GA 3MERA 3DXYA 2FHPA 3GDHA 1FP1D 4C4AA 3HVKA 5CCBA 1XJ5A 2IP2A 2HR1A 4PGGA 5LQJA 3FZGA 3P2KA 4FSXA 4KIFA 2BR5A 4KRGA 4E33A 3EVGA 3PVCA 4QVKA 1SQGA 3A7EA 3E7PA 5P8WA 1KIAA 2AS0A 4V0QA 2VDUE 5LQNA 2QRVA 3SSNA 1G55A 1Y8CA 3OE4A 3CC8A 3DLCA 4FT4A 4RTKA 4PWYA 1WZNA 2PX4A 1Q0SA 4CTKA 1QANA 1EG2A 3GO4A 3HCFA 3FTEA 4PYOA 4XUEA 4E2YA 1JG4A 1PJZA 3M6XA 2YR0A 2ZVJA 4M37A 3V97A 5DXAA 1JSZA 1YF3A 3HVHA 3NDIA 4M38A 1L3CA 5K8VA 2ZZMA 1MJFA 3DLIA 5MHTA 2FRXA 1HMYA 2HWKA 2ZTHA 3FUXA 3FUTA 3JWGA 5CD1A 2VDVE 1R18A 5HFJA 5CCXA 4IWNA 3KQOA 4GQBA 4R05A 2IDKA 4B17A 2PX8A 2I9KA 2ERCA 3C6KA 3GRVA 4CXMA 4FS8A 3FTFA 3EVEA 1F38A 3SM3A 4PYIA 1N2XA 2GPYA 3PT9A 4WVLA 3KR2A 1WS6A 4RTMA 1R8XA 4DQ0A 1BKYA 3K6RA 4RTOA 3UWPA 4DA4A 2C7PA 2Z6UA 3THRA 5K0NA 2AOWA 3LDUA 1AF7A 2VZ9A 3T7RA 4K6MA 5IKMA 1YB2A 2ZIFA 3KQSA 4EVIA 4RTQA 1KP9A 1UFKA 3PB3A 1P1CA 3EVCA 1VL5A 3DMFA 5DTMA 2EJTA 3LPMA 5H02A 5B1SA 3FPGA 3E23A 3WSTA 3O7WA 3FPFA 1IM8A 2CMHA 1YFLA 2BR4A 3EGIA 3I64A 4ISCA 2PJDA 3I58A 3KHKA 4MTLA 3UJDA 2IGTA 2AN5A 5LSAA 4ER5A 2B9EA 4Y30A 1N7IA 4CKCA 3HTXA 2JHPA 5K0JA 1SUSA 5K01A 1JG3A 3NVMB 1WG8A 3FRIA 5GIPE 3MCZA 1JG1A 2UYOA 1INLA 3FPJA 4QQNA 2QM3A 3KKZA 5EVJA 5KVAA 1DCTA 1X1CA 3T0IA 2AOTA 3G88A 4QPPA 4ER6A 3UJ8A 1XVAA 1IY9A 1P39A 3LKDA 1NKVA 3OU7A 4P7GA 2CL5A 3I9FA 2NXCA 4RVDA 5C9ZA 3K0BA 2IBTA 2QY6A 5F2NA 3HM2A 3MB5A 1RI3A 4PNEA 2YQZA 3P71T 4RV9A 3UJBA 10MHA 5EPEA 3GNLA 3BXOA 4GOND 3BKXA 4Z2YA 3P8ZA 1JQDA 2BM8A 1NBHA 1NBIA 4AUKA 1NE2A 1FJXA 3ELUA 3BGVA 5BW4A 4YMGA 4PYKA 5K0CA 4E30A 1B42A 2H1RA 2CMGA 2YXDA 3KQVA 2IBSA 1KPGA 2JH9A 4LG1A 4YUYA 3GRRA 5CM2Z 2PWYA 5FA5A 1RI4A 3EGEA 3P9KA 2JHCA 3OZTA 4GF5A 5EIFA 4BP1A 4BY9E 3DULA 3IV6A 3G89A 1XDSA 2H11A 3Q87B 4RVHA 5ICGA 3DXXA 5DM0A 4OBXA 2XVAA 5D1HA 2G71A 2C7OA 3KPVA 5FQOA 1XDZA 3SMQA 3CGGA 3FTCA 3LCVB 3BT7A 5DM4A 4A6DA 2UYHA 4F86A 1BC5A 3NDJA 5FHQA 3DR5A 3TMAA 2ZCJA 2AR0A 4DKJA 3OCJA 1D2GA 3OFKA 1NT2A 3HCDA 1IXKA 4PINA 4RTLA 3MCTA 4OA5A 5FQNA 3KPWA 4IKPA 1WXWA 3QOXA 2PY6A 3B89A 3LBFA 5E9QA 5FTWA 2O06A 5EHGA 3EMBA 4KIGA 3PX3A 4U7TB 1WXXA 5E8RA 2NXEA 2O05A 2WA1A 4PYLA 4QDKA 1RJEA 1XXLA 4QTUB 5FWDA 3THSA 4AX8A 2ZIGA 3AXSA 1VBFA 4QQKA 3TR6A 1SVUA 2R3SA 4R6WA 2OBFA 3SSOA 1R6AA 5EEGA 4AZVA 1RI5A 5DSTA 4XUDA 5BW5A 2ZFUA 4HTFB 3C3PA 4PYQA 1UWVA 5F2OA 1D2HA 1PRYA 2PX5A 3GXOA 4KW7A 3NVKI 1FPQA 2G70A 1ZKDA 2Y1WA 2FYTA 4RX1A 2JH8A 3TOSA 5E9JA 3HCEA 4RYLA 1G60A 3M4XA 4PONA 3SR4A 2PKWA 5C0OE 2AZTA 1AV6A 5FA8A 3TPZA 4E2XA 4PGHA 2PSSA 3EGVA 4PIPA 2F8LA 2PWPA 5LQKA 2Z6QA 1R74A 5K09A 4A6EA 1KHHA 4R8RA 1O54A 2VP3A 4F85A 4DF3A 3DOUA 1HNNA 3SSMA 3M6WA 3LGAA 3E8SA 3DTNA 3TLJA 3C6MA 5CUQA 3VYWA 4GBED 3LHDA 4C05A 3AY0A 1JQ3A 2YUIA 5U4XA 3G2OA 3FUVA 2HMYB 1BHJA 4FP9A 2IDJA 3A27A 3ERCA 1ZGAA 2A14A 3EVBA 1G38A 1AQIA 3ANXA 4IV0A 5K0EA 3U81A 3UA4A 1VPTA 5HIJA 4C08A 3FUUA 1I4WA 1RJDA 5GM1A 1VIDA 2YXLA 5FHRA 4DCGA 3P9CA 1L1EA 4XCXA 2OY0A 4DM3A 4OQEA 3TKYA 3P9IA 1VP3A 4YV2A 3KR1A 2XBMA 3DMGA 3HA3A 2ZZNA 5IH3A 4HGZA 2OPBA 9MHTA 1X19A 1DUSA 2LD4A 3GGDA 3BUSA 2AVNA 3KR9A 5LQAA 3KQYA 3B3GA 1YFJA 2FPOA 4C04A 4UOEA 3PLAE 2ESRA 5CVDA 5LQRA 3BKWA 3BGIA 5K0GA 4DCMA 1QYRA 2XYQA 3GWZA 3VC2A 2Z6AA 5EIWA 5CVUA 3A4TA 2OZVA 4RTRA 2G8NA 2PX2A 2QE6A 4KDRA 5F2KA 2ZZKA 3NMUF 1VE3A 5GINE 5EGSA 2IH4A 2NP6A 2Y1XA 5T64A 2IFTA 5CVEA 3CBGA 5HIMA 1G8AA 2B2CA 3R6TA 1YUBA 2ZBQA 4BLWA 3ORHA 4E32A 3AJDA 5E1OA 4RTSA 3ER9A 2HNKA 1JTEA 2PV0A 3FUWA 3HVIA 3PFHA 4DZRA 2G72A 2OO3A 2P41A 3G8AA 4PIMA 2NNWB 4QTTB 5E1DA 3BWBA 3GU3A 1ORIA 4OA8A 5E2AA 5EHIA 3PTAA 5BXYA 3X0DA 3LX6A 3DP7A 3M70A 2FCAA 5DT2A 3SX0A 4CTJA 5E1BA 4HGYA 3UFBA 1X1BA 3OU6A 2I62A 1RJFA 1VP9A 4QVGA 3BWMA 4ZTBA 1NW3A 5DTQA 4EQZA 3V8VA 2PGXA 2EFJA 2NP7A 2ADMA 2Q41A 2GS9A 3REOA 3GRUA 3KQWA 4DMGA 5LR6A 1TW2A 2R6ZA 3LL7A 4HSGA 2CKDA 5DPMA 4ATNA 1V39A 2C7RA 2UYQA 4AZWA 5KS2A 2P3LA 4P7FA 2OYRA 3UJCA 1MHTA 3NWEA 4HTFA 1L3IA 3CJRA 1QAQA 2FK8A 2HV9A 3LECA 4KDCA 4QPNA 5HEKA 2V7EA 4X61A 2IPXA 4XUCA 4P58A 5EZSA 4HH4A 3P2IA 3GCZA 2P3OA 3FPHA 5DTRA 2I6GA 4P7KA 2QYOA 3M6UA 1I9GA 5GWXA 3IHTA 3BGDA 4WXHA 1Z3CA 1ZGJA 4BLUA 3RW9A 2JHAA 3EEOA 1QAOA 5KQRA 4H0NA 3O4FA 1XCJA 3KQMA 2BZGA 5KYGA 3RODA 3UJ7A 4MWZA 1M6EX 4POOA 3JWJA 3CJQA 3LKZA 3MHTA 3DMHA 5E1MA 3HCCA 3I53A 2NYUA 3ELDA 1JQEA 3R3HA 4OQDA 3T7SA 1DL5A 1QZZA 1F3LA 5E8JA 5EMJA 5K0LA 1XCLA 4E2ZA 3UJ6A 7MHTA 3EPPA 4L7VA 5DX8A 5EQJB 3HA7A 3TKAA 4PCAA 2EJUA 3DXZA 1YZ3A 3G8BA 4FZVA 3B5IA 3TRKA 4C06A 2V74B 1N7JA 4LECA 2ONZA 5CIYA 4E31A 3IEIA 1FP2A 2EX4A 5GOZA 1SKMA 2B25A 3QV2A 5HZMA 4X63A 1P91A 3EVDA 2XVMA 3ELWA 3TM5A 2BR3A 2YX1A 2PXAA 2DULA 3G2PA 5DX1A 3R9XB 3CVOA 4HG2A 2PT6A 3GJYA 2WK1A 2PXXA 1H1DA 5EKUA 5KQSA 4RSRA 3ID6C 2GAFA 2P7IA 3CCFA 4KVZA 3UBTA 3S68A 2B78A 2XYVA 3EMDA 2ZULA 3EVZA 3KU1A 3OU2A 2JJQA 3JWIA 5JUWA 5DWQA 1KYWA 4YUVA 5GIOE 2ZBPA 5FUBA 4YMHA 5DSXA 4CKBA 4EKGA 4JXJA 2PT9A 3AWIA 1OR8A 1T43A 2QRVB 1XTPA 2ZW9A 3D2LA 2AOTB 3OZSA 3UJAA 5FWAA 5ICEA 1JR4A 5EMKA 3O31A 3GIWA 5DM2A 1KPIA 3OPNA 4AZSA 3SGLA 3HNRA 2PBFA 3LBYA 5DM1A 5M5BA 3HA5A 2DPMA 3LSTA 1SG9A 4HRAA 3SVZA 3EVFA 1EJ6A 4NECA 1EQAA 5LQCA 1SQFA 1ZQ9A 2CWWA 2YVLA 3M33A 3P2EA 4PYNA 4C07A 1VLMA 3KPUA 2OXTA 3NJRA 1ZHFA 2GA9A 2NXNA 5EKXA 3SXJA 2AOVA 5HIIA 1ZG3A 2IH5A 2OB2A 5EG5A 2JG3A 2AOXA 2UZ4A 3MTIA 3LCCA 2XYRA 8MHTA 4HC4A 1KYZA 3G5TA 4RVFA 3R24A 4LWPA 3JWHA 1YZHA 4QDJA 1EIZA 4GC5A 1Q0TA 2BM9A 1X1DA 5DX0A 4E70A 3EVAA 1R00A 1UIRA 1VQ1A 2AOUB 4FR0A 1R8YA 4R6XA 4MHTA 4GOOD 2ZSUA 1ORHA 3P97A 5E9WA 4PYJA 2UYCA 3KQTA 2YXEA 4OX9Y 2O57A 3H2BA 3LCUA 3LDGA 1RI2A 1KXZA 3PS9A 5K03A 1X1AA 4E2WA 3KQPA 1TPYA 2K4MA 2P1DA 3VSEA 2PVCA 3OE5A 5DLYA 2AN3A 3QOWA 1AQJA 2OKCA 1KPHA 1P1BA 1I1NA 1NV8A 5FULA 4FGZA 5GM2A 3MGGA 3B3JA 2C7QA 2ZBRA 4PYMA 2PLWA 4KWCA 2IH2A 2VS1A 3A26A 4YV1A 3I5UA 4RWZA 3G5LA 4ER0A 5DXJA 5K0BA 4BLVA 4Y2HA 4EMSA 4YV0A 5ICFA 4FT2A 2IIPA 3PFGA 2AN4A 3KR0A 5T67A 5HOQA 2G1PA 2P35A 3M6VA 3NWBA 3FYCA 3ME5A 2P8JA 3F4KA 3ELYA 3HEMA 3BZBA 4ER3A 5JR3A 4RTNA 1RJGA 4GEKA 2ORED 2VDWA 3DH0A 4U7PB 3GRYA 3GRZA 1JSXA 3G2QA 1NW6A 3FRHA 3ER8A 4RTJA 1WY7A 2NXJA 2ONYA 4F84A 2P7HA 3B3FA 5ERGB 3HVJA 5D1NA 3EEYA 1TW3A 3NW9A 4GUAA 3HCBA 5EEHA 3UA3A 4GOMD 4P7JA 5HIKA 3CJTA 3FPEA 1D2CA 1EAMA 2KW5A 3AXTA 4MIKA 3G7UA 1JTFA 5DRYA 3HP7A 5HILA 3FYDA 3A7DA 5FADA 4EKIA 4PCLA 2GH1A 5LQUA 1NW7A 5BP7A 2I7CA 1M0EA 2YTZA 3RIEA 4RVGA 4M7RA 1G8SA 1BOOA 3L8DA 2OB1A 2O0LA 4X1OA
chains in the Genus database with same CATH superfamily
1RABA 1NVXQ 1LC3A 4Q9JA 2E48A 1XZIA 2RKOA 3IPXA 3HV0A 3RS8A 2YY5A 4FEGA 3HU3A 1R5NA 4O4LA 2SKEA 3ZE2B 1L9KA 3A0UA 2QG9A 2XUFA 1ULZA 1CR2A 2IU6A 3KOZA 3L2OB 4TRRA 1A5SB 4Z0NA 2RHHA 3AHHA 4I9GA 4CCWA 1JA1A 1C3VA 2D2XA 4K5QA 1Z0AA 2AA3A 4OXQA 4D74A 4PTZA 4ZREA 3EXFB 2G9UA 3B1ZA 4RK1A 1RP7A 3KPJA 4AMUA 1YJCA 3EXFA 1EP1B 5KCMA 2J3EA 1MH9A 4DR3B 3PQ3A 3KETA 1UAYA 3HB5X 4CM1A 2AXPA 4MO2A 1URPA 3QE9Y 3W05A 4EZBA 4ZT3A 1U2GA 3ZXIA 2QAIA 3AHDA 3G9TA 4F6LA 2WA2A 1TIPA 2WEKA 4G0OA 4UPVA 4OHVA 4NV1A 3AR6A 3ZBTA 2YY7A 1FU4A 1J5PA 2D62A 1BKSB 1BDHA 2GUGA 1Z38A 1P3DA 4ZAZA 3RU9A 3CY6A 3WI7A 4BEBA 3IBCA 3F6PA 3SDSA 1DLJA 3RYIA 1JIIA 3EZYA 4TN5A 4X1KA 1W5SA 2EEPA 3AFMA 3EWNA 1TJ3A 4D8XA 2QUZA 4HMQA 4ENSA 3FIUA 3DXYA 3O3OB 1GEGA 5F2EA 5TLSA 2VPQA 4CKWB 4BJ1A 1G3UA 2GN1A 3AX6A 4M9QA 1P7ZA 2CXTA 4QQ8A 5EP1A 3RS9A 3EIQA 3TLGA 1FMTA 2NU8A 3CLTD 3U4CA 2ST1A 1J0AA 1VYTA 4KIFA 2W2PA 4R1NA 1U3DA 3A7EA 1GZ4A 3PQ8A 1KO4A 4ZQHA 5EJFA 2B92A 2R5WA 4B6SA 4D9NA 5GADl 3ZYCA 1WPXA 3NAQA 1A76A 1DBRA 4G4SO 1I7PA 4NARA 4RPIA 4DLVA 3FNFA 3DDZX 3PTLA 3QMWA 3PE3A 2QRZA 4UU8A 1M0WA 4YP0A 5F35A 2NZWA 4G09A 1NBME 2VWQA 1K6XA 2BEUA 2H2FA 2IP4A 3L8CA 2XLBA 4R1OA 4DA8A 2GCIA 3HCFA 1WMDA 3WK6A 1H93A 3O8BA 1A8IA 4YN3A 1AKUA 4HWTA 4Z7NB 5C37A 1RYNA 5I9LA 3Q1KA 5LBUA 3ZKAA 2YNMC 4DDKA 1UAGA 1VXRA 4IL5A 3KTAB 1FW6A 2WZBA 3U7EB 2C9OA 4D3SA 5JASA 4UMDA 1R18A 3WNCA 4ES6A 2GZHA 4M1KA 1WBJB 1BDIA 1S4QA 3LPDA 2V6FA 2VFAA 2ZI7A 1N4AA 1EUDA 1NP7A 4DMLA 2QB5A 1JJVA 1I2BA 1SHUX 1BGXT 2G1AA 3EVEA 4KP7A 4L02A 1NF8A 3I39X 1VDMA 1CC1S 1FTSA 1Z39A 3TNFA 2AFVA 3BMXA 4KAAA 3I42A 1Y9EA 3VUEA 4RTQA 3LUPA 4I1YA 1ECGA 5MFPA 3H1AA 2EJTA 1K2WA 1Z7BA 2NUTB 3IQWA 3LPMA 1EBFA 4K86A 4HX9A 3GBSA 2ZYHA 4LHXA 4TWBA 1EXWA 1PR2A 1Q7RA 3HB0A 1A7JA 2Y9PB 1ECBA 1NF2A 4ISCA 4PQYA 5B36A 3I58A 3VGPA 3QWBA 4U63A 1KJWA 1Z5GA 2EZ8A 3OO1A 1RW4A 4Y30A 4B40A 3JRNA 5EINA 1SULA 1HE4A 1TGYA 3PFBA 2BFFA 4BMVA 1MP0A 2DB3A 1XRPA 2MYTA 2JHPA 2Q1SA 1D6SA 3MNFA 3FLMA 3BH7A 4RPKA 5K0JA 5FWYB 3NIFB 3TYXA 1BXRA 4H2DA 1I51A 4CE6A 3TEJA 2WT9A 1R4ZA 4RIHA 1JG1A 1I30A 2UYOA 1H2YA 5FLXA 4KHZA 4D5GA 5AOAA 2IODA 5EVJA 1O03A 1Y89A 4C29A 2GCOB 5IH7A 3D54D 3KBOA 2QMYA 4RIEA 3Q8WA 4RH3A 3C6BA 3PNOA 4XTRA 2C2ZA 4YLGA 2JAQA 3K0BA 3MOGA 5FPTA 4Z49A 5K6TA 4ZOLA 1X7XB 3MILA 1MX3A 2UVPA 4LYGA 4PNEA 2ZRQA 2WU8A 1FYVA 1Z4JA 4UZFA 4JQSA 3UV7A 4A5OA 3BXOA 1W5BA 3TMKA 4YRLA 4BFSA 1J9GA 1JQDA 3MS7A 4FNOA 2Z30A 4COOA 4C7JA 3U09A 1CUZA 3C5VA 3OHPA 4PAQA 2VSXA 3M4JA 1QTNA 3CINA 3EPRA 2W2LA 2QRNA 1RJWA 3EGXA 1VHLA 4IWYA 4O2AA 5AJTA 4MCIA 5DHFA 4HYEA 4PX3A 2GXQA 1SBYA 4YIHA 2H4HA 3TNYA 4C0WA 1RYHA 1KA9H 1KK0A 4M1WA 5DNEA 4DN6A 5J47A 3A6KA 3FAKA 3OZAA 3W2FA 4AECA 2P6OA 4P4GA 4QODA 4DCSA 1Q0LA 3MS2A 2IQ5A 4G2TA 4BY9E 3H9QA 1T25A 3MUEA 3QK7A 2BI4A 4I3GA 5JFOA 3I2KA 2J9GA 4IS2A 4D9EA 1W5EA 5LJLA 1Q92A 4R8KA 4UHFA 2NTVA 4JYZA 4HDKB 1ETHA 1XA4A 4WLUA 2ZJ2A 2R6GA 5ALKA 1HRKA 2YVAA 4BN5A 2NMVA 1E92A 2JLQA 2QHXA 1XEAA 4DIFA 3O7MA 1XI2A 3HJHA 4XM0A 2YBDA 3VU8A 4G67A 1I2MA 1U1EA 1EDZA 2I3AA 4OA5A 2EKBA 4LE0A 1F8XA 2OSVA 3N7TA 4E5KA 2FEPA 3GROA 1Z0UA 4HX2A 4D4IA 4ZKEA 2HIGA 4ZXFA 1TM1E 1DAKA 4HMOA 5BWOA 1CJSA 1W94A 1ZP6A 2VUSA 1G7CA 3DFFA 3PWSA 4R84A 2FUKA 4DLPA 3AXSA 1OFVA 1DQNA 2V7BA 2QTGA 4OGWA 4DLXA 4ZHQF 1L4GA 1MOQA 1YRWA 2ATVA 1P6QA 1RI5A 3AF5A 1ZK2A 2QORA 1I2ZA 3CNHA 5D2CA 2O8FB 1SD1A 4CF7A 1WE2A 4E7PA 4ENPA 1NTOA 3P9QA 2GN4A 1OI2A 4RK4A 3NV9A 4GMGA 3TXXA 2X3FA 2PS3A 3PFFA 3OBIA 5A04A 4GXQA 3SR0A 5C0OE 1Z33A 4K6CA 1IK4A 3TPZA 1FNCA 4PGHA 4G0WA 4GBGA 1X1SA 3EA0A 3O8LA 5KNCH 1O87A 4PC7A 2FR1A 1IZZA 2J5QA 1JS1X 1GQSA 1RM0A 1CK4A 2BN4A 2ZI4A 3DKPA 3NI2A 5CK5A 5D86A 3ROKA 3TQHA 3KZVA 5B12A 3E8SA 1QH9A 5B3JC 1O94D 3DTNA 4MQMA 3RLIA 4YI3A 4RIFA 3L8MA 2ASEA 1HR0B 1Z9BA 3RUAA 3PNYA 1FVOA 5JTTA 3LI2A 3KWJA 3WQRA 2RAPA 1M83A 4JDUA 4IINA 1XD2B 2EBWA 5HFAA 1P72A 2P5SA 3X1WA 4IV0A 3ZI4A 3X1DA 1JG6A 3NWJA 3PD1A 2LP4Y 3O8OA 1W0CA 4YQYA 5B7GA 3EUAA 3NT4A 3PUIA 3T7AA 1XEFA 4OQEA 3ZZMA 4CF3A 4DWJA 4F6CA 5HKOA 3DFMA 4EKNB 3E9DA 3AHFA 1M2OA 1EXNA 2GEBA 4LDAA 4AL4A 2LD4A 1H3NA 1M8FA 1ZRMA 1OF1A 1P2DA 2AVNA 2H0AA 3NBZC 4OBBA 5DLDA 2FPKA 1XRRA 4XM2A 1A2QA 5JS2A 3FCAA 3DDSA 5I5EA 1QIMA 2PSHA 4L73A 1QYRA 1ZNYA 4J2TA 4OREX 1KEWA 2VAWA 3EAQA 1AC5A 1XCOA 3PHBE 1NR7A 4KQ1A 4LF7B 1JYSA 4YC7A 2YHSA 1QWOA 2AH5A 2Y1XA 4HL6A 1GCUA 1FNNA 1W4LA 2ZETA 1YUBA 2D0OB 4WBXC 3ZVNA 2ZYWX 1SVLA 5DH9A 4OI1A 4BO3A 4D8WA 3WAGA 1MC5A 3A36A 4H7EA 1GZVA 3VO1A 1H0RA 1TX4B 3N5KA 4CF4A 3S5UA 2P41A 5J40A 1NN0A 3EXG2 4QTTB 3ZCTA 1L7RA 3S0JA 1GPDG 4BB6A 1U4NA 4HYTA 1D2NA 4WXMA 4EG7A 3RPEA 2FZKA 1Q83A 3SX0A 5E1BA 2RAUA 4HD8A 4HUQB 2HPVA 3GPCA 3E18A 4HLNA 3SS9X 3U48A 3FI9A 2WLSA 3TE6A 4TXLA 2CNDA 2QSJA 3KUUA 3OMXA 1R6UA 1UKBA 3N7AA 2QS9A 3BMCB 3RUDA 3NDPA 3TTTA 5LR6A 1QGED 1U0HC 4IIJF 2VQDA 3H0EA 4E5UA 3E0QA 1W75A 2FKAA 1P2SA 2PNFA 3MAAC 2YWRA 1XXHA 1KZYC 4E1BA 1NDQA 1W7AA 4FHGA 1EKXA 3F3MA 1U7HA 2EWMA 5CH5A 2Q3LA 1L9XA 3UTCA 4AZ0A 2OGTA 4B3FX 4RL6A 1X7DA 4BPBA 5A4MS 2AHOA 2I6GA 1H8HD 4U7GA 3FNEA 3ZLUA 4YPVA 3BM5A 1FZTA 1YO6A 4RA6B 1ML3A 3BMNA 1RHJA 2IGBA 3NC0C 4DSNA 5HUHA 4WA8A 5ICSA 3FLAA 3IC5A 1HQDA 4GWLA 4TL7A 5JMOA 4D3YA 2OCGA 5FRDA 3R8CA 1XCJA 4QRHA 3RGWS 1DARA 1TU4A 5HE8A 2Q2QA 3KYCB 2I1WA 3NBXX 4LDPA 2VQFB 2QSYA 2C96A 3QTLA 3SEAA 3V8QA 3MVEA 4DNFA 3HCCA 4YJHB 5G1PA 2YV1A 4R81A 4EGSA 1A9ZA 2OWDA 3TDMA 4Z9YA 2PZFA 4NS4A 5LDHA 3N6XA 5LOVA 4AMBA 1PVVA 4JOCA 3WWOA 1MZVA 3RYFB 1EGAA 3HJFA 4JLAA 1U2PA 1YQDA 1JKIA 2A94A 5JPIA 3PYXA 5HUJA 1B00A 2GN6A 3CX7A 1P9RA 3IEIA 3WO0A 3D6AA 1UANA 2IU4A 2D5LA 4YY3B 4X94A 5EUQB 1IH8A 3TDNA 3EZFA 3SZUA 2IYAA 2QTVA 3GUCA 4KL8S 1V9CA 5AM4A 3A1FA 4OQPA 3D6NB 4X7BA 3RFTA 4EZIA 3ZCVA 3HXMA 2O7RA 3G6KA 2QBYA 3QELB 5LWQA 2WK1A 2IC5A 2VO1A 2ZRJA 3A1WA 4FMDF 4ILEA 4KZKA 5FB3A 5HS6A 4ARZA 3N1UA 4MXDA 5CDUA 3CCFA 2WABA 1E69A 4H7KA 4XSGA 3OU2A 1EVYA 1FP4B 1GKYA 3LHFA 5DBFA 3WDMA 4QAJA 4Q3OA 1IBLB 2XNSA 3MF4A 4Q4JB 4UPDA 5IT5A 5DSXA 3LIIA 3NETA 1Z4LA 3PXXA 3VOBA 4ZFNA 4H4CA 2G63A 1Z4MA 2R8EA 1HY3A 3L3BA 3PEEA 5DNDA 1W36D 2HLPA 4O4JA 5HKLA 1KAHA 5BOSA 3OZSA 4MV6A 3VNSA 1NWHA 3JR3A 1JBQA 1FFDA 3TLAA 4C4SA 2C2KA 1ZIXA 1W52X 1RYZA 7ADHA 2JI4A 2YMPA 4FWTA 1ADBA 1ORVA 1Q44A 2HA3A 2X6TA 3HHEA 1YIOA 4M86A 1GNQA 1YRYE 1UJCA 3FCUB 2W2KA 3GI1A 3H97A 4FKBA 4IDGA 4BNZA 1FMJA 3CPSA 3LSTA 4YAWA 1EJ6A 1M2GA 3FAZA 1TTTA 2KX7A 2QAGA 3I01A 4UE3S 5BSWA 1KBQA 4PBTA 2ZS9A 3RABA 2YZGA 4Z3DA 1ZRHA 3GJ5A 2JG3A 3DC2A 5CM8B 1XAJA 4XFDA 4PLHA 2MOKA 3NFRA 3SFVA 4FE3A 3U4HA 4D0GA 4RPCA 3DE5X 4G8BA 2OECA 2NU6B 3TPFA 3GNSA 4W1QA 1IMOA 3OP4A 1G4UR 2PUVA 3H8JA 5KOHB 3NAMA 1MVLA 5ECYA 3DL2A 3OPYB 1OKKD 3H5IA 3QWFA 4O4HB 2NNLD 2RCYA 5I45A 2PBRA 2C0CA 2ZAOA 3TBHA 4JX8A 1RADA 2HF8A 3QFSA 3R8FA 2ZWMA 3G2JA 1DG3A 2OKCA 4TRJA 4F2GA 1I1NA 4BEWA 4F12A 3IQEA 3OZXA 4Z3KA 5KQPA 4P3XA 5GM2A 5IYZA 1FJHA 4B4DA 1VMDA 1H2RS 3VYSB 2UVPB 2H65A 2ONCA 5DXJA 4IMJB 2XIQA 1LF0A 1CNFA 1IN6A 2WM2A 1IIRA 4RZIA 1EQUA 1QCDA 3FOAA 3ONNA 3E2MA 1XR3A 1AN9A 2PZEA 3PNPA 3ZWQA 5EZYA 1S3SA 4BIMA 4NBRA 5AW4A 5IZCC 3LP5A 1W0JD 4A6PA 2FNAA 1J2YA 1R2QA 4MUYA 2R8XA 2FH5B 3DVAB 3IDFA 4XM1A 1PK7A 1RYMA 3M1YA 3S1AA 1PR9A 2AE2A 4GOKA 4BVHA 4ZCTA 1G5TA 1R88A 2V4UA 3H5TA 2WD8A 4UAVA 1BX0A 1U94A 3IO5A 2AQHA 3NKFA 4FPXA 1U3GA 2C98A 1HV8A 1W35A 5E6RB 1SXIA 1J1ZA 1P3JA 1USGA 1JWBB 1U8TA 1Y6JA 4OGGA 4P7JA 2QTTA 4NENA 1KDVA 4BP8A 1KARA 2QMUA 3ZHXA 3SHFA 4XA8A 1OZFA 1MDFA 5LZ2A 2IOHA 1C0IA 4WXRA 4NCHA 2I7CA 1LNQA 3DBOB 4J0IA 3C7KA 1F0KA 1O97D 2BI8A 1VTKA 1ESDA 3IX7A 3ZNQA 1NQOA 3K8YA 1FUYB 2MR6A 5BQOA 3JVVA 4CKEA 3K6JA 4LXTA 2XB8A 4KFSA 2VJNA 1Y8RA 4UM9B 1CYEA 2YHUA 4NEGA 3ZU2A 2FZ5A 4BLTA 2GAAA 5EJ9A 3I73A 4Y8VA 2CXPA 1PEDA 2XYPA 3FHTA 2LGJA 3FN4A 4CM4A 1IY1A 1UC9A 1P17A 1K5HA 1O6GA 4MZXA 5BSTA 2O2GA 3LXUX 2Y3IA 3LY9A 4PXSA 4G24A 4QO7A 3RWBA 4OHZA 2ZDHA 4Y6GB 3DTTA 1RXVA 1TK9A 3CKKA 2QK4A 4QICA 2NT3A 1R12A 1FE8A 1W19A 3MQ2A 5LP6A 5DHAA 4PGAA 1I01A 3JAWA 4C4OA 3G9UA 4PPNA 2CXNA 2AK2A 4DC9A 1L5HB 2CVQA 3OX3A 2Q5FA 3UJ9A 4LE1A 3JYOA 2I7DA 1UDWA 1W88B 4RGQA 1AUOA 5D00A 3CB2A 1JLLB 3A25A 3ESAA 3ISJA 3CX6A 4ID9A 1KF0A 2CMFA 4CR7A 1SVKA 3NHBA 4NNJA 3ZHUA 1WPRA 3JS5A 4RS3A 4OBEA 3QEAZ 4BNIA 2ZWVA 2VKTA 1NXPA 4BP3A 4MGEA 2JI9A 1K5DA 2WFAA 2P9HA 5MFZA 3GRCA 4PZAA 4JENA 2R6JA 2C5GA 1B76A 1G0NA 2L42A 5B3LA 3HJUA 3UJHA 1JJBA 3CPHA 4Q4DA 2C9MA 4N7RA 3W90A 1BWSA 2E0IA 1JIXA 1L7AA 3CZCA 3PEUA 4RENA 2GEUA 2Q1YA 3CNBA 4IEFB 2PJZA 3OE1A 3WLLA 5LQJA 2Z5FA 4YRFA 2C4NA 1BJRE 3K0CC 4U9HS 1T5BA 3EVGA 4QVKA 4KNWA 3E7PA 2NU9A 5AM1A 3TOVA 2FW9A 3NBAA 4KZPA 1QZ3A 3I5MA 2HGZA 4HYYA 1LBSA 3DLCA 1TEVA 1WHTB 4B6GA 1PNRA 2AZ4A 4EPWA 1SBIA 4NCKA 3UT6A 4CIDA 4OHOA 3FTQA 1DQSA 1EG2A 3JWEA 2WF9A 4NULA 2QD1A 3V8PA 2YRXA 3KSUA 1N75A 4DC0A 3QVMA 2OD9A 3RBXA 2HMAA 2E37A 1RWNA 3RTDA 4TQUS 4FU0A 4NAVA 2R62A 3LYHA 1K6EA 2Z83A 3E48A 5L45A 3EWSA 1FRNA 1Z6ZA 3F6CA 5J63A 1JEDA 1C9EA 4ABTA 4EW2A 2MSNA 1RWBA 1XAGA 2EDAA 1F5SA 3FWHA 3ZV7A 4AY3A 4F56A 1X7ZA 4TV9F 4B34A 3NTOA 3R3WA 2YJZA 4LS3A 4RJIA 4IIVA 4UZEA 1JLRA 4X85A 2OMEA 2X9NA 3P4UA 2DBRA 4IPTA 1DOAA 1TO2E 2P5UA 4MS1A 4G1UC 4WVLA 4DLAA 3IP1A 3RDPA 4DSOA 1WS6A 4UAGA 4DQ0A 2PRIA 1L4UA 3MZ0A 4Q9LA 3VJMA 4GECA 1COWA 3KYDB 5H9WA 4AZ3B 1P74A 3ODPA 1P0PA 1OZHA 3HO8A 3PV0A 3QWIA 4YCCA 2VAXA 4BXOB 4GZLA 3AM1A 3LBHA 5BV0A 2GM9A 4DJAA 1RHMA 3ACBA 3B9BA 3H17A 3R77A 4IJ6A 4M6WA 1P1CA 1FVFA 1Q0ZA 4NDNE 2HA0A 3NEAA 4MWOA 5TJ9A 1V6SA 3UV6A 2ACVA 4KK4A 2QRLA 3WNQA 4KQJA 1IHYA 2BJHA 5JSQA 2QQGA 3UJDA 3HV2A 2WFLB 2AN5A 2JIMA 3MYYA 1BG6A 3CONA 3M5WA 4M7OA 4I4TB 4MR8B 5JDIC 1XP5A 3G0DA 3D5TA 3NBQA 2KYRA 3AR3A 1XKXA 1E2KA 1DJPA 2ODNA 3KSDO 5D5QA 3RV4A 5DEOA 2XZLA 621PA 4DBVO 3AR8A 4AF8A 5JQGA 3NVMB 2JLBA 1B7GO 4XQCA 1K7CA 2R00A 3EIHA 3EXIA 2RFLA 4L9SA 4N18A 3AERB 2Z09A 4H4DA 5L3QB 1NY5A 5CPBA 5FAKA 3UHFA 3F5SA 1CEEA 2ILVA 3LKDA 4C0QC 2PMDA 4MP8A 3RS4A 3ZDYB 1RS0A 1CYDA 1T26A 2VDJA 3JPWA 3QE2A 4R5HA 1B23P 4FD2A 2IHZA 4IQ0A 4RXUA 2GVNA 3AEKA 3R41A 3RR2A 1SNYA 1ZI9A 1G8YA 4HAYA 3H9CA 3HYSA 4HWOA 1G1AA 1M75A 3MTJA 4KQFA 3H65A 3DF7A 4WJKB 2X13A 3B13B 4RVOA 4V0NA 4BBJA 4NX2A 2VP2A 1G9XA 1Q2XA 1E98A 2QZ9A 2TMDA 3OUUA 4GVLA 3ZHOA 5JH7F 4DUZB 2XKBA 3HFSA 2P0YA 2HLDD 1SIWA 1GQYA 2PUFA 1AD2A 2KQUA 3D5QA 2BLNA 4H15A 3JQGB 5DNVA 3DULA 4GLBA 3B48A 3PUKA 3Q87B 3QKUA 4Q9KA 1S2IA 4Y2GA 5H83A 4F1JA 2WB4A 4RFLA 5AQEA 4UNRA 4CIBA 5HRUA 3OJCA 2PAAA 2ZJFA 2C7OA 2OO7A 1XDZA 1QBKC 5FQOA 2ZREA 2WTNA 3L0SA 3CYFA 1KOJA 3FFWA 3MWEA 3NDJA 3F96A 4RU1A 3AESB 1FU8A 5HCIA 1TZCA 5CAEB 5FT9A 1QU2A 1MRNA 2ZSHA 4BNUA 4PINA 5KTTA 4JU8A 3PXEA 4JNCA 1Z13A 4KQMA 1VKZA 2BKXA 2FE4A 4QT4A 2JIZA 1W93A 3O1HB 4Q7JB 1KEEA 4AU1A 3PX3A 1DC6A 2NXEA 4TL8A 4EHFA 4TKVB 1XXLA 3Q85A 5CA1A 2C59A 1A9YA 3EDYA 5A4IS 2G5GX 4KAFA 3GP8A 3MMXA 4KR6A 3OT5A 2GZRA 1KZGB 1R6AA 3E4DA 3I61A 2X0FA 4X54A 5D85A 2H0RA 2YXBA 5L4SA 3IAXA 3IDZA 6GPBA 4U7JA 3C3PA 1Q1BA 4W6QA 5LKAA 3ET5A 1DE0A 1FPQA 1DQYA 2OCXA 3AJ8A 1EWKA 3P0HA 1I7DA 1QQBA 1EP2B 2VDNB 4GXRA 1O77A 1XZBA 3QLUA 4KI7A 1C3EA 4TLEA 1FXUA 4M3NA 1PJ8A 2PH7A 2PSSA 5I9MA 4QOEA 3AM5A 4RQUA 2DBYA 3ST7A 5LZ5A 1LK0A 2VTKA 4RSMA 2D4AA 2ZBGA 1C8KA 2BBSA 2D7JA 2M1ZA 1XELA 1YTUA 1U1GA 2XUQA 3IE2A 2Q5QA 3EGCA 1SC9A 1TIBA 3C6MA 4CZ2A 2R97A 5LBIA 2P9BA 2EWWA 2ZOSA 4WZBE 2AFRA 1WULS 2YUIA 1N5MA 1ONSA 4HNHA 2PDAA 1E0AA 5KYWA 4MWGA 1B41A 1J56A 1BHJA 1G2PA 1S8NA 2IW1A 2YV2A 3MCAA 4XX1A 1NSYA 4X6UA 3SZGA 4F8YA 3WFIA 1G38A 1AQIA 1U8CB 2G36A 1X74A 1Z34A 4G41A 4EJMA 2G17A 3T7DA 3RYHA 1DKUA 1W2HA 2ILTA 3CF2A 5TEVA 2GZ2A 3HXPA 3F6YA 4O8ZA 5IU6A 3QI2A 2DH5A 4H9GA 1Y1QA 3NUZA 4N54A 5ES4B 1MB4A 2HW8A 3UAVA 2QVLA 4OV6B 4JJAA 2POQX 4GQAA 2V6JA 3D7MA 5LXTF 3J81k 1SHKA 1RYFA 1Z0KA 1QRTA 3ZV3A 2WFMA 2YUTA 1LRJA 3VPSA 2Z6AA 5CVUA 1FRFS 4Z54A 2Y76A 4P31A 3CR3C 4MIEA 4N5NA 3RYHB 2HEGA 3ZS9A 2VNHA 5FD8A 1K86A 4JP2A 4GZ6A 4GBMA 5T64A 2RG1A 3CBGA 3QX9A 4HLUC 4NEHB 2YNMA 3KQUA 3IR6A 1NBMD 4KXMA 1QRUA 3FYTA 1ISPA 1PS9A 2Q7XA 3KK0A 3PFHA 1ZBQA 1VBMA 5D87A 2VP4A 2Q45A 1G19A 1XHLA 2XXJA 1XJQA 3PYLA 2WF7A 3B8HA 5DHSA 3A1NA 1DC8A 4Q7KA 3C45A 1EM6A 4GNRA 1X1BA 2VNAA 1P3Y1 1ID1A 3B5EA 3KL2A 1T10A 5C1DA 4MK4A 5A6SB 1PQ4A 2CLLB 4FQ5A 4AK9A 4GX1A 3KJFA 1CF4A 3M82A 2VP9A 4YDSA 5T8KC 5BW6B 3TIGA 1WOYA 2FFHA 1TA0A 4NDZA 3REOA 2I7XA 3BTSA 3UB3A 1J20A 1TDJA 3E5RA 2BZSA 5CJJA 3Q6MA 1YS6A 4BMNA 2PRSA 1SCNE 1CUAA 1XU7A 2BFAA 3K3PA 3NWEA 3RSGA 1EUCB 2ZRAA 3A05A 3LM8A 4JFRA 4NR0A 1DUIA 4QPNA 1D0SA 4TZKA 4QXMA 3NWOA 4YP6A 1GO2A 1F17A 1IJKA 2I4RA 3E5NA 3ES9A 2HZBA 3GCZA 4Q9HA 1JEJA 2XF2A 1L7QA 2XMSA 4WI1A 4TXMA 2JCGA 4TSKA 2M6KA 3IQXA 5GWXA 3IHTA 2FU5C 1DXOA 3H5VA 5JNSA 1TT5A 3CRZA 2IU3A 1XB2A 2BUCA 2G80A 1HK7A 2JFHA 4KOAA 1CNMA 1ZH8A 3JD0A 3IODA 4O02B 5CTAA 2ZUWA 1F7UA 4MP6A 2YH2A 2DG2A 3LKZA 1VLLA 4GO1A 4OLHA 1LW6E 4J16A 3AFOA 2CK3A 1KC3A 3OF5A 3GARA 4TTAA 1NDHA 1E6UA 5FBRB 1I4LD 1QZZA 1B43A 3LLCA 3X1MA 5BXQC 5FNVF 5EMJA 2I6FA 5K0LA 2FWNA 4YRSA 2CXHA 2VYNA 3ILYA 5IAJA 3E9MA 2FRDC 3SNHA 4BNFA 3DZHA 4AKTA 1EVIA 5BSFA 1E2DA 1QZUA 4QHTA 1UZMA 1YQTA 4LBWA 1AMUA 3N2KB 1OAOA 3DTVA 4TTJA 5CDTA 3DR3A 1J39A 1UQTA 5E3JA 1A8QA 5E6UA 1XZJA 5TVKA 1TTHA 3ZQKA 5CA1F 3QUCA 4IQ4A 4ZCPA 3C5HA 3V32A 2VF8A 3F8SA 4BE4A 3DZKA 3BE4A 5K7SA 4TWIA 2BGNA 1ISRA 5KI6A 1PDWA 5U4QA 2C54A 3VR3D 5IDYA 1V7CA 4RIGA 1LK7A 1YAHA 3AZPA 3VQTA 2XJ9A 4QGSA 4BV9A 3PUJA 1GGVA 3BCHA 1C14A 3OAAD 4URZR 1JDPA 2G1JA 4KVZA 1VRVA 1YKSA 1NMQA 2P9ZA 1GV0A 3NU1A 3KCQA 1U6JA 5DU2A 1YS4A 4ZEWA 4KWEA 4IRMA 2CHGA 4V3CA 2LXNA 3VMFA 2ORYA 2QRPA 2VCYA 5CXSA 4E11A 5JAIA 3TRIA 3VPHA 4CQMD 1HDXA 2A5LA 1OR8A 2QRVB 3UT5A 4NMXB 2D4HA 2Y0CA 3HBNA 5BQPA 1XTUA 3BCUA 3A6GA 4ZDIA 1VL2A 3FOCA 2HDWA 3O31A 3URKA 2HMSA 1UPFA 1Y81A 3WY9A 4BS9A 2AC2A 1KPIA 2V9ZA 3NBKA 4UBNA 2WMYA 5JECA 2BM1A 1K7EB 3ESXA 1Z4NA 1OW3B 3BMQB 1U2SA 1N6HA 1SC4A 3PQ4A 4RHYA 3USZA 2VK8A 3UAXA 1ZQ9A 5ENZA 1VC2A 1M0SA 3IVMA 2CEAA 4D4KA 1CXZA 1WBDA 1U31A 2R4QA 1E2PA 1ZL0A 1BYUA 1G7TA 1IBSA 1SEPA 4NZYA 4POAA 4CI9A 4ZVLA 1QP0A 1E79D 4L4SA 1X14A 2HFKA 2HFJA 3ETEA 2XYRA 3M8KA 2EQAA 4DV4B 1E1MA 1JR2A 3PPIA 1KYZA 4JP1A 4Q7MB 2FB9A 4O33A 1PFKA 2VJMA 3GLQA 5IXJA 3SIPA 1XK7A 2CDAA 3JWHA 4HY3A 3LUBA 1Q0TA 3GVHA 2CLCX 5AXAA 3PZBA 3T4XA 1LS1A 5I4IA 2QP4A 1AS3A 2X6RA 3A37A 5DEIA 3UHOA 4NH0A 4LTMA 421PA 3H04A 3LK6A 4GPTA 1E4OA 1HQYE 1ZFNA 1JKFA 1OC4A 1X9HA 2FPGA 3LE8A 4NK5A 4EENA 3KQPA 4QBHA 3E5MA 2HU2A 1E6CA 1P2FA 3OCXA 3STWA 1PL6A 2MYUA 1SR8A 2CL0X 2FCRA 5JQWA 4BNDB 2IEIA 2O48X 5J4HA 4FLFA 4J0JA 4K9QA 3WOVA 4AM8A 2F55A 3DTYA 3ABZA 4O4LF 2Z6VA 3D31A 3NONA 3C97A 2ZBRA 1Y8RB 1YKFA 2GOYA 2PAFA 5E6RA 5GJVC 3CNEA 1W8IA 3CEHA 3RU7A 2WWRA 4ER0A 5KB3A 5KWJA 3TBFA 2F1RA 3IP9A 4YAUA 3JXEA 2VF7A 3R5KA 4GPEA 3KLBA 2FFBA 3KO8A 4O2AF 2RIPA 5KNCA 5I3ZA 1FUKA 1I7QB 3M6VA 2D0DA 1KJ8A 1IPHA 1XF1A 1U3TA 2BMDA 2ORIA 2REOA 3DT8A 1BQ3A 3ME5A 2HNBA 3X44A 3C3JA 3EDMA 3FCCA 5I7VA 3H6HA 5JAMA 2QN7A 3N8KA 1NW6A 3AJEA 5FTNA 1IRXA 4BFVA 1ZGHA 1QWSA 2ZU0C 3JZMA 3PQEA 4AKIA 1G8FA 2PMFA 1PJ4A 4JYPA 1EK0A 1FSGA 1MV8A 3NHPA 4QE3A 4RHUA 5ERGB 1O5IA 1D4FA 3HCBA 3MUNA 2OBNA 4FHFA 1AXRA 1DAIA 2Q99A 3G7UA 3BHIA 1ZOIA 2FJ0A 4ZMRA 2QJFA 3R9IA 4IOLA 2QT9A 2V58A 4F38A 1ECPA 1V9SA 2YTZA 3B1YA 4Q4AB 4M7RA 1KFBB 1P7YA 1KDRA 4PHGA 3TVTA 3TXAA 4MIOA 3K6KA 4XX0B 1YE8A 1I1OA 4H27A 1JKJB 2X7XA 3KSAC 4E88A 2UZAA 3Q0IA 1HSZA 4ZAGA 2ZJAA 3GEDA 4BNHA 2B83A 3OZFA 1PJ3A 4HPWA 3MTEA 4WVFA 1M6NA 1F0PA 3DKVA 3HJNA 3K71B 4FS3A 4GP9A 3CA8A 1XKLA 1Z62A 2JL1A 1VGQA 4AXXA 4UM8B 1FBNA 2PEYA 2WRZA 3LHKA 2VZ0A 3CW9A 3F3SA 1EEHA 1ZJZA 1MTOA 3JQBC 4R1TA 3RUPA 1FMCA 2IX3A 3Q7SA 3SYMA 2Q6VA 4E51A 1JDBC 1W96A 1WO8A 3ESBA 4CMBA 2B30A 3QVGA 4L51A 1A8PA 4N01A 4NBLA 1KEVA 1DAHA 5A06A 2CV0A 1U8XX 2B0JA 1LQTA 2OQ2A 2FN9A 1Y7HA 1RQPA 2RBKA 2B5WA 3CQ9A 1C3OA 3L40A 4NHOA 1KI2A 5K3OA 3Q7EA 1KKUA 3PYMA 4DR5B 3R0QA 2J59A 3VVMA 4REQA 4B87A 1M6YA 1FMFA 1NZJA 1UXIA 3DLAA 2PSJA 5ERXA 3D7LA 4S24A 2HM7A 3OJOA 4WERA 4BECA 3QLJA 2FZCA 1CZLA 1KI7A 3MS4A 4ZQEA 1RAHA 4G4JA 4HNSA 1U28C 2P11A 1GGMA 5DHTA 5I9SA 1SCJA 1GGHA 1QFYA 3O0DA 5TSDA 1FCJA 3ZK9A 4G4GA 1NJFA 3KPYA 3TQCA 4F6RB 1OIVA 2ZGVA 3IVXA 4EJSB 5JJKA 4QNRA 4UHJA 4V24A 3SEQA 3ZY4A 3RG2A 5KWEA 2J85A 1Z2PX 1TGVA 4A0HA 3WC4A 1FJGB 2YWFA 3TMYA 4EG1A 2HI0A 3TD9A 1Q3HA 3H3JA 1P5ZB 1RWKA 4J0EA 5B7PA 1ULHA 1VPLA 5P8WA 4E33A 3GLUA 1SQGA 1UBRS 3FSEA 4WCDA 2WYUA 1YB7A 4XB6B 3RVOA 3SF0A 2XTMA 4GAEA 2OLKA 4IW3B 1E89A 1M74A 3FMFA 5LQDA 3OESA 1CQWA 4PE5B 4U2GA 2D5AA 1TTQB 1PGPA 4PYOA 1AM4D 1GGJA 3LYLA 2RSLA 4GYJA 2NTJA 3R9KA 4ZCIA 4H6XA 1PDVA 3D4OA 3E7WA 3I12A 3MSXA 3Q7IA 1FVHA 5HS4A 1EFLA 1VLJA 1BQEA 4KH0A 2PX0A 1N5RA 1RRMA 3CWZA 1GUYA 3FH0A 4HQ0A 3TJRA 3UW3A 5AW8A 4QXRA 1Z7YA 3AT1A 5MHTA 9LDTA 4KI0A 2ZTHA 2HK8A 1U28A 1EZ4A 3JWGA 3K0FA 2IQIA 1I2AA 2W0MA 3H5NA 1WDLA 3Q6IA 5EJ6A 5IN4A 3QWAA 4YRRA 1D9XA 2ZTSA 4FYPA 1F1JA 3UK1A 3ASUA 4EPXA 5JEEA 1VCOA 3AUTA 2OFWA 5BN5B 5CDHA 1F8FA 2BFEB 3KOXA 5HNKA 1QRSA 5M2QA 1P5FA 3UOGA 1XLTA 1GRQA 2C7PA 5AJWA 3THRA 5K0NA 1SIOA 1KL7A 1T91A 4YQZA 1YBFA 4UZSA 1I80A 1XHEA 2CVPA 1QJCA 3FF1A 3PGA1 3WMRA 2A9QA 4XPIB 2FX2A 4ZVUA 4W5QA 4GVPA 2VP6A 2KBFA 1UEJA 3MJEA 3KYCA 2X1VA 4I9HA 2GILA 3HRKA 4DVJA 4F5YA 2AN1A 2WTBA 4EPTA 4JVOA 2HDNB 3A14A 2P1ZA 1TFUA 3V00A 1Y6RA 2R2AA 3NNNA 4A82A 1VZ3A 2YV4A 5K3BA 4OMFG 3U0BA 5IHXA 1GR0A 1CY8A 5BOVA 1EGHA 1ACJA 3E6AA 4RUKA 5KQLA 2VHQA 3R3SA 5ER6A 1OXKB 3L02A 1SVNA 2CKMA 5AVRA 1D7OA 2SKCA 1AZWA 3KWMA 5HDQA 1P1FA 3UMRA 3OH8A 3P2OA 1E6EA 3R8XA 1P5JA 5A5VA 2D74A 4TYWA 2MSLA 3EAFA 1OZAA 1CR1A 1GADO 4G36A 4WIAA 2K7FA 4DR7B 4S1PA 4YJ2F 1LVUA 3S1LA 5KSWB 2VAVA 1KSJA 1TVKB 1TJPB 4KAXA 4WRRA 5I01A 1BH2A 4Y7CA 3STHA 3ZOKA 2I3BA 1N8TA 2AUNA 2Y92A 3D5EA 3H5LA 4TTQA 5ALJA 1KDTA 4Z2YA 1WZCA 3U3MA 4HEA1 4UHKA 4EECA 4ZCMA 1KAEA 1QM5A 3OJ0A 3SXPA 1B1AA 5CX1A 4AWAA 1CEYA 2P6UA 3SSAA 3FSGA 2FMIA 5K0CA 4X62B 1B42A 1TMYA 2H1RA 4N8EA 4R8VA 4UUNA 4CG3A 2QT1A 5CM2Z 2AFHE 2VUIB 2FW1A 4JLPA 3BFKA 5E7QA 5H0IA 3WA7A 3RHTA 1UADA 2P4SA 3C7CB 1OE0A 2GPBA 3ECAA 2X7HA 4GF5A 2JKZA 3IV6A 4EFKA 3ZUPA 4M54A 3AUYA 4RVHA 2H5JA 1C9JA 5JXJA 3KXIA 1NNLA 3QFRA 4G65A 2WWYA 2PKCA 3KPVA 1EK6A 1HH4A 1BH6A 2J31A 3ZOZA 3FTCA 2G06A 3GJZA 3EFOB 4PLYA 4A6DA 4HXGA 3M5DA 4YCJA 5EJMA 5BQXA 3VR0A 1UBSB 2Q46A 2ZCJA 4PQRA 3UPTA 2AEEA 2JI8A 4CMEA 2QU8A 4EI2A 3EZNA 4GWGA 1XU9A 1NT2A 1PGOA 4XRGA 1RXWA 2VHWA 1QZXA 4TUYA 2AW3A 3FMVA 1DDGA 3DNPA 3KPWA 3OPXA 5FQNA 1EUCA 4ZDJA 3AGQA 1RXEA 2NQTA 1UUFA 1FFGA 3PSHA 1VG8A 4NPCA 1RKUA 4QDKA 4JOBA 4DJDC 1VSUA 4B6EA 1Y7PA 3L05A 4NYMR 2E87A 3LNCA 2VTDA 3TR6A 2NO5A 3IAFA 4QQKA 4B6OA 2XNJA 4LZOA 1VIVA 4MPPA 1YZGA 3GELA 2EU8A 5FR1A 1QORA 1PJSA 3GG2A 2WHQA 2O3JA 2B1RA 5AI0A 3ZWVA 2OZLB 3CWQA 1ZN2A 3DMRA 3TUZC 3V34A 1TM4E 4AJEA 1NR1A 4QT0A 2GWHA 2QQ0A 1CY4A 3K1JA 3WMXA 1CRZA 2FPUA 5A1JA 2X9QA 3W77A 2IYOA 3JQBA 4HAWA 4ZCSA 4X7PA 1SIUA 2HQ1A 1NJ6A 1ORDA 4G0PA 1TFRA 2C7GA 3GNQA 2RH5A 4HP8A 1L4FA 1P4HA 2CN1A 3O94A 5LIRA 2RONA 4A2QA 2ID7A 2HJHA 2C42A 4R68A 2W2OA 4CLOB 3WB1A 3OUZA 1Y37A 4C05A 4R1PA 2GBFA 4UEJA 5KVQA 2X42A 3PC4A 5E4FA 3RBZA 1XN4A 5DZSA 2PUBA 3HB9A 2ICAA 4TQ9A 1W0JA 4IJUA 3IIIA 5IANA 3SF8A 3ZE8A 2WM3A 1RWWA 3OA0A 2QM0A 5IDXA 5K0EA 3BDAA 3KT6A 3WBBA 1F9AA 3H3XA 3SICE 4BIIA 2O7VA 5B3KA 5KYWB 3A6JA 3IVAA 1ICEA 1ODSA 5AIBA 3H9JA 3BIXA 1PWYE 4XDZA 1SO8A 2AIRA 3BD6A 1ZCJA 2A9FA 3F7MA 1HF3A 3LX8A 3RKUA 2R4TA 1XROA 4FYVA 1EAYA 1DUSA 1OX4A 3DW3X 3G0OA 4HAXA 1SD5A 2FR8A 2XVXA 1Z2NX 5JAQA 2FPOA 3EXEB 3WGYA 4JODA 5C8YB 4JLJA 1X8LA 2D1YA 3GA0A 3QX3A 5DDIP 4YRGA 1FUIA 3P2YA 1MRSA 3R3YA 1NKTA 4WXPA 4XIYA 1Y1RA 4F45A 1F51E 2ZZKA 1E18A 2QSZA 2BMVA 2V97A 3GVPA 4UDOA 4XVQA 5CCDA 1M2HA 1RPTA 1BHQ1 1JHYA 2B2CA 2XUZA 5AOCA 3ZWYA 2A58A 1DO0A 4F9TA 2GM4A 4MVJD 3AF3A 4ENUA 2VPXA 1GU1A 3CMMA 4N7BA 2CFIA 3H18A 3Q3EA 3I01M 1CUSA 3TOCA 3UYKA 3TAXA 4DDUA 1XTIA 3ED1A 1YDMA 2EEZA 2L69A 5CB8A 5G53C 3PI7A 1T4GA 3TZCA 2JBAB 2IV7A 4TVKA 4P2GA 5H8WA 4QVIA 1TT5B 2FSFA 2H2IA 3AKCA 3PWZA 1VP9A 5ILGA 1O96B 1GU7A 3H5RA 4YCLA 4MYUA 4AY4A 3ESCA 3FBGA 2P2CA 4EQZA 2QJTA 3IOBA 2NUBA 1Z75A 4OK6A 1R9JA 4Q00A 3SLRA 4F3KA 3O21A 4RF5A 4K9DA 1JH9A 1SG6A 3LL7A 3ZXUB 1OREA 3PHJA 2RGNA 5L4LA 3WYFA 2C7RA 4ZZ2A 1SH7A 2VAPA 1RJ9A 2WHEA 4ZOBA 1XALA 3QUSA 1EFPB 4KX5A 3SC3A 2FK8A 1VMKA 1ZKMA 1TF7A 2OCBA 2PYDA 3V4OA 4YRBA 1PFQA 2FP3A 1Q1EA 1ZISA 3FSRA 4MYSA 1W30A 2ZT5A 3W79A 3HNPA 4JGGA 3WIEA 4HEJA 4RJLA 2GJ8A 3V4FA 3K92A 5TXGA 4P7KA 4AVYA 3TX2A 4BAZA 1R6VA 2BJWA 2QMQA 2OAGA 5KIAA 2GZDA 3VJKA 5LL6P 1MZPA 2Q7DA 1XRSB 1ZCBA 3LCMA 1SKBA 3BERA 4DT1B 5AJYA 2WU1A 2DUUA 4HFNA 3ZGXA 3KOMA 4EDHA 2X0KA 5H68A 4A2PA 4P38A 1WMFA 1AH2A 1VJ5A 3EZ7A 2IXBA 3DAYA 4MCAA 5FOVA 1EUDB 1B8VA 4M2LA 4RABA 3MHTA 2GXSA 4XGKA 2DKFA 1P9WA 4WFKA 5FFFA 3ELDA 4DSTA 3BXEA 4LQ4A 3DWFA 1CUFA 3VPGA 1NUTA 2N46A 1XCLA 2F4VB 1K3TA 5AT1A 4QG7A 1N9GA 1SBNE 3D7RA 3EPPA 5JNUA 2G4CA 3KQNA 1Z2EA 2VDKB 2ZRHA 1HEYA 1BX1A 2C7VA 2LVBA 2G4VA 5DYIA 4OFBA 2WKWA 3B6IA 2V74B 1Q7CA 4C3VA 1UBUS 3UMBA 2H5EA 2DHQA 6LDHA 5BWLA 1JEAA 2PS1A 1XC7A 4LGCA 3KQKA 2BR3A 1NSFA 1AQ6A 2HSZA 4MWCA 5CHYA 1OWLA 3OMWA 3R76A 3NHAA 5T4BA 5CBPA 4WNIA 1GDTA 2JFPA 1TQ8A 1EDBA 1Q3KA 1QF7A 1AQUA 2IYWA 3MINA 4BMCA 4C1NA 5KDOA 4MAFA 3UBTA 4LA4A 2ZAYA 3TL3A 1X7XA 3COYA 2WG1A 2O0JA 2Z1MA 3QVWA 4REMA 2N9UA 4KXQA 4ZHQB 3K72B 4BB5A 2Q3FA 3VDNB 2QE7A 3BSFA 4NFHA 3IA2A 4UC0A 3IJRA 4L08A 1Z0IA 3B1FA 3U40A 2PBZA 3ZHZA 1LU9A 2FV8A 2XWBF 1X9IA 2AFIB 1H23A 2C2WA 2YDXA 4DMCA 3LOQA 4EM6A 1N8NA 4B2IA 1XKQA 3G3EA 4GX5A 1Z88A 2ZKLA 3U7HB 2VDMB 1W0KA 1DFIA 3AVWA 1KERA 1JHOA 2O2HA 3OFVA 1KVTA 5EKSA 3PA6A 4UXHA 4E6EA 3PD7A 4OQYA 3H75A 2DBZA 2YWGA 3I72A 3TTSA 3VVCA 3L8HA 1Q50A 1WF6A 4N8DA 1JLSA 5JTUA 2YVLA 3GCWA 4TVOA 1A1VA 3RF6A 1T3HA 3H99A 4GR4A 3I1JA 3M6MD 4D9IA 4F4HA 4CDGA 3L6UA 1M1YA 2E4UA 2X5OA 5COQA 3EOZA 3FDFA 3VOTA 1ZJWA 2IH5A 4NCNA 2WHPB 2OB2A 4FOOA 1H2BA 1ISJA 1E1YA 2VT7A 4RHTA 2O54A 2VN8A 1QX4A 2O1EA 3BXXA 4CU2A 4LRUA 1IQUA 1UXHA 4QRDA 3V8NA 1GUBA 2BFFB 2AFIE 4XUGB 5E3IA 1P9LA 2ZSIA 3M83A 2BM0A 4KQ2A 2JAXA 1US8B 3JQ9C 3STYA 5IABA 1IN4A 2H3EA 4HAVA 1CUBA 2C8VA 4OL9A 1S89A 1UIRA 1G5HA 4RMGA 1ORHA 5JSYA 7YASA 2NU7A 4ABYA 1OBHA 4XCVA 1WL8A 1KXZA 1T15A 3MWEB 4PGMA 4X20A 1TPZA 4ZAVA 1QG2A 2CNKA 2HIAA 3KUDA 3U6KA 3GRKA 4UFNA 3QOWA 4EA6A 1R15A 4OU5A 3KT0A 4R41A 4KTVE 4MLZA 2D2VA 3U3KA 5A03A 5BQ3A 1JB9A 5CYGA 2AQ8A 3V80A 2OHHA 3HDVA 2W8BA 4L2IA 3H7IA 4B71A 2C7QA 2NO6A 3TZKA 5KTNA 4HR7A 1DP4A 4CQNA 4WKGA 1FDRA 4NE2A 4W5HA 1IUPA 2Y93A 2GVZC 1YOBA 1RBMA 2CZCA 3ONEA 4MKIA 4MYDA 5G40A 5ICFA 2HX1A 1X1EA 2E4YA 4KXXA 1WBBA 3PCRB 4HFJA 2I6UA 1O0CA 1XZAA 1JHQA 2Y2UA 3BFVA 3E7FA 3VZPA 5JCOC 2BFWA 4TLBA 3P45A 2IKQA 5TF0A 4ZMSA 3BZBA 1R50A 4GEKA 1E4EB 4L75A 5HM8A 3GRYA 1PD1A 1DXQA 3K0AA 4OHXA 5KKAA 1JMVA 5DM60 4RTJA 1CUVA 1JIJA 3O4GA 5AJVB 4L78A 5JQGB 1VE1A 4XXHA 4ZOAA 3UA3A 5KOJA 1L5MA 3K0AB 3G0CA 5ARCA 3FPEA 2IEAA 4MIKA 2KW5A 2X8LA 4JGBA 1PQPA 3GLGB 2WFLA 5L3QA 4IHJF 3PJEA 1UM9B 3DVSX 4Q3EA 5I4KA 4WESB 5A5FA 1BQ4A 1FTQA 2HXGA 3C7DB 3HFRA 1Y3BE 2O0LA 3GV0A 5AI9A 5JAZA 1T0HB 4WLEA 1T5OA 4ZGWA 3W9YA 1LSSA 1NQXA 4OY3A 2I55A 4R8SA 5CXXA 2WWVD 1Z2OX 1DBVO 1JQAA 1PF7E 2I4IA 2IPAB 5GGYA 4LRXA 2ZITA 1S9HA 1PI3A 1UBJS 3PIIA 4YUXA 4HOYA 1ENOA 3QW2A 2PGNA 4HLDA 1AKEA 4I4LA 4RK5A 4WCFA 3LKBA 1PCXA 4DA6A 1D1QA 2O8BA 3HBJA 5BYBA 1JSLA 4GOLD 5KYNA 3NPMA 2EZ4A 4ETIA 3ABRB 1R0KA 3WQHA 1Z8DA 3ADKA 3LVBA 4BBPA 4CWAA 4DM4A 4D25A 3GMTA 4J0FA 2WSIA 4N3BA 4M36A 4PV7A 2VCHA 1Q0HA 2VTEA 3O82A 4ZJPA 1NURA 2Q0QA 4UAUA 1M9NA 3PD0A 1ADGA 3BWCA 1QC5B 4TMYA 3TLYA 5EZQA 4FSDA 1XZFA 3CUYA 2H4FA 4GPIB 5JAOA 3IP8A 4DAOA 4OLBA 3NRJA 2FN7A 1HXHA 1RT9A 3K1ZA 1N2CB 2X0JA 3QVKA 4JJZA 4BZZA 4HUQA 1Q1NA 2O07A 3ITEA 5CW2A 4ENRA 1XGKA 5C7LO 1L7VC 4QQFA 5EPOA 3U9TA 1U80A 5A3VA 3GDHA 1E5VA 1Z7EA 3MJSA 4DANA 1SCQA 1RIFA 4A0QA 5I4BA 2G04A 4IYJA 2VRWA 4GVXA 4RJJA 3UO8B 5EXEA 2WJ4A 3DXFA 1QOZA 1UM9A 4DV2B 3MJRA 1DMSA 1XIVA 1TXGA 1C7JA 4V0QA 4LF4B 1Q15A 4IV5A 2YFYA 4QIHA 4H77A 5M04A 5EE5B 1W36C 4B4KA 4M9SA 5M7EA 5CLGA 3QXCA 3X1KA 4DXHA 1OPXA 2BCJQ 4O6VA 3PQDA 5M3BA 4CTKA 3R7AA 1FTGA 4G8CA 4ZVSA 3LNTA 3GJRA 5IUJC 5IK2D 3Q3CA 2CUZA 1TUEA 5KREA 3V48A 4B3TB 3R0XA 4X0EA 4E46A 2OHXA 4MQLA 3V33A 3PRHA 4YS6A 2LUOA 3IEXA 2QBYB 2LDBA 4H7HA 4LJ9A 2QY9A 3LOUA 4MQFA 2MSEB 4LRTB 1K92A 4LZPA 2VR1A 4LJ5A 3HXLA 5BSMA 2WKSA 3PA8A 5AUNB 1O5OA 1FLDA 4XWOA 4DCPA 3FDZA 4DDWA 4PYIA 2FQ1A 3RM3A 3KR2A 3U7IA 2RJOA 3LP8A 3KKQA 1A77A 4JC4A 2AJLI 4M0UA 4RA9B 4RNDB 4WA7A 5BRNA 4GWKA 4GZMA 2PLAA 1CETA 4LZNA 3A28A 1L5HA 2GT1A 1S01A 5ICMA 1KMCA 2YW9A 4EYSA 4O8CA 5K2OA 4MB6A 4Z9FA 1LPSA 5DTMA 1WABA 3SZOA 3OCVA 4MV5A 4TXJA 1UOQA 1QO0D 3DO8A 1O5TA 1J8YF 3CF4G 1I6LA 4EQ6B 4MCHA 4CLHA 4BDTA 3KHKA 2P77A 4C87A 1OFUX 1QNLA 4ER5A 3C74A 1LBTA 1G66A 2VSQA 3JALA 3S2IA 5BNFA 2BRUA 4M9CA 5BVHA 1IUKA 1KBZA 4Q4JA 4RGYA 5KAPA 2CXXA 3RRMA 3HCNA 4ESHA 1JFRA 3HZOA 5F7JA 1DBWA 1VFNA 4YAEA 2IEYA 3FRIA 4PLFA 3EA5A 1KQGA 1WD7A 2WLTA 2V7UA 4RDCA 2C95A 1CJBA 2ZRGA 3RKSA 2P78A 2HBYA 1BVYF 1M7BA 2C4WA 2QN8A 4A1FA 4ERXA 2PRZA 3HADA 2VDLB 1GVHA 4Y2VA 2VPTA 1G6HA 5AP9A 1M7HA 2AT1A 3IE0A 3HMKA 1VKRA 3KE9A 3PPXA 2PE5A 1XE3A 3VHXB 4C4RA 3A6PC 1N77A 1F0NA 2ZUEA 1MB2A 1O94C 2YQZA 3A10A 4Y3UA 3UB2A 5JFGA 1ODFA 2Q5JA 4IDEA 2G9NA 4UTPA 5JCZA 1U5AA 2XVYA 4RCZA 1XLUA 4F11A 3IUJA 4ZIRA 1CQJA 1V8DA 3ICVA 2FF5A 2XSZD 3GQBA 1KAMA 4LE2A 3U44A 1U8FO 4D3ZA 4DLLA 3M5CA 2AHRA 3R7SA 2WKPA 3UEOA 7ABPA 1GFSA 1L0BA 2F4NA 1Q7TA 1K63A 2JGFA 1I0IA 4MGHA 5EWLA 1IXYA 4I0WB 4I4IA 4QU9A 1E9EA 3I6ZA 3NH6A 3RVKA 5JT1A 1J49A 3CGWA 2PGIA 4HNQA 3BD7A 5FA5A 4ZTZB 3ZE9A 5IUKC 2XAAA 1ZM3A 1FFHA 1IXRC 2HA5A 3VKWA 1LPOA 1A27A 4JU9A 4XYEA 4US0R 5HF8A 4FCCA 2ZAMA 3RSQA 1PYGA 3U17A 4F7WA 1C30A 4PN3A 4WK0B 1E4VA 1RLIA 3A9RA 2X2OA 3CGGA 4H3SA 4KXVA 1BC5A 1EK5A 1E0JA 2Y8EA 3FXAA 3TFQA 1IYZA 1GZ7A 2JFQA 4S0ZA 3WLFA 3HGTA 4JBNA 2ZRFA 5A02A 3DMPA 1IXKA 2WUDA 1HYGA 3Q3IA 3FJ1A 3AUUA 1Y4DE 2EAUA 3W34A 2HSDA 3RBVA 1UMBB 1GNSA 1WXWA 5EIBD 2A8YA 5T7BA 1FFWA 2HTFA 3D3WA 3K9WA 1DIOB 3AINA 3NC4A 3P9ZA 5EHGA 4DZTA 2ZPAA 3AMVA 3R75A 3ETHA 3HRHA 1ZVMA 1U3UA 1R0YA 3I6BA 3OTQA 2G3YA 4QXOA 1FQOA 5SZKB 2GESA 4GPAA 3ZIAD 4UBOA 3TNLA 4W7IA 1M1YB 4AS2A 3OO0A 2X3UA 3AGPA 4ZQBA 5DSTA 1RQ2A 2IUEA 3EVNA 2ZFUA 5ENDA 4BU0A 4MKZA 2X0IA 3DOHA 1UWVA 4GR5A 4L6CA 4KQKA 5AK5A 1LLUA 3RIGA 3ZDCA 1RR6A 2H1HA 3COVA 1NE7A 2IHBA 2R4UA 4FSHA 3OM9A 3OWXA 4DM7A 1IOLA 1NLUA 1AV6A 3PBKA 2H48A 4NFSA 4MWTA 1E0KA 1IQRA 1Q1ZA 4HDSB 2IYVA 3CNQS 5J5VA 5IJ9A 1ULTA 1XNRB 4DF3A 4IEIA 1NJ2A 2E9SA 5FDFA 1LPMA 2BZ1A 2IS6A 1M5RA 5DYYA 4Q3BA 4Z0HO 4LYJA 1A9OA 4XTCS 4UEQA 4AO8A 1PDOA 1LS6A 1KRWA 4WGFA 2HMYB 3A32A 1YDWA 1FDOA 2J6BA 5B37A 2QN1A 4UBIA 2IDJA 2H08A 1U7PA 1O96A 1K5GA 1XMXA 2HV8A 3ZHYA 3AHCA 3K6SA 4J0GA 4X1YB 5GM1A 4A26A 2WAMA 3LQYA 1DQPA 2QVGA 5CT8A 3O8RA 1ZBDA 3QLTA 3A9TA 3TKYA 4K1XA 1NWCA 3FM9A 4ENQA 5J23A 2FSUA 3WS7A 4NV0A 4B76A 5JANA 1IL0A 1ETUA 4HWKA 4MUFA 1JFFA 3GC6A 4G07A 2O2SA 5LXTA 4XDYA 3D0OA 1J0CA 4RESA 4ARVA 3GN2A 4XYMA 4B2LA 2NZVG 2YQ4A 1SIBE 1RTTA 4FLMA 4J7XA 1VDZA 2C5EA 2HUNA 2QF7A 3BJZA 1GKKA 1MQAA 2CNWA 1NSTA 1CLUA 1M2KA 3ZE6A 2JD2A 4HJRA 5F2KA 4DV0B 3VSCA 3VKHA 2ZRLA 1CZKA 1U9ZA 1ZMRA 3DVQX 2ZPTX 3OJWA 2BF7A 3LC2O 4HDCA 2AWOA 3T3EA 3THWB 2VHJA 1A8SA 3EXIB 4NYJR 3ER9A 2PV0A 2QVYX 4M0FA 5J3JA 4K9RA 2W4IA 1BOFA 2E49A 3LY8A 3MGAA 2GK3A 3ZVKA 3EB9A 1M34A 1AE1A 1AKRA 2J5BA 1KBOA 2YHAA 4TSRA 3IDAA 2G9RA 5LWHA 4JI7B 5K4GA 2V7PA 1SN7A 3RC7A 1KJZA 1SCIA 1U8ZA 3OPYI 3BWMA 1K68A 1NJGA 1O3YA 1WU8A 2NG1A 5CVCA 3OEHA 4CIAA 2V7VA 3QKIA 5I5GA 2UU9B 1KVUA 2J6IA 4W5NA 2WWTA 1SU6A 3NV7A 2G40A 5K4AA 5KJ6A 2VP0A 4HSGA 3BF7A 1XLVA 3TO5A 1E2UA 5DV9A 1VJRA 3HDQA 1WLSA 1Y8QA 1A9RA 2P3LA 3MTAA 5JWRA 3GZNA 1OLUA 4BNJA 3L7JA 2P2ZA 2GAOA 2QRGA 3BTVA 2CNOA 1DX9A 1ARZA 2HWUA 1OXUA 4ZVKA 3DLHA 4ZP1A 1BXGB 1Z4OA 3IEUA 2UUAB 3FJYA 3ISVA 1KJ9A 4MKRA 2M98A 4IBOA 4H4EA 5IWAB 5IBPA 1UC5B 1JR3A 1OSNA 1GG9A 6YASA 1DXYA 2NIPA 5FL7D 1Z4PX 4B1FA 4IIJA 3O4FA 3M6LA 3UWSA 5FWXA 4N65A 4CR8A 5F64A 2KE5A 5DGDA 5CFRA 4RPGA 3WQQA 4ND2A 1YASA 3TS1A 2JGJA 1KDYA 5JH7B 1VOTA 1G1MA 5HWSA 3TZLA 3RS3A 5JVDF 1E2BA 1QQTA 1E4EA 4DJTA 1CTQA 2NYUA 4B74A 3W8RA 2B99A 3GFQA 5J4KA 1F60A 1DX4A 1ANKA 1GTG1 1TCVA 1ZNWA 1DBIA 1L7PA 1DJNA 1WCXA 3DL4A 4BWGA 3ZY2A 4CUZA 4BQFA 4CTNA 4UTOA 3QLEA 2EJUA 1CUWA 3MC1A 3VMMA 2E89A 3HEBA 5JH7A 2H16A 4E31A 4ESVA 4BJ5A 2PZ8A 1BJTA 1LPBB 1V6CA 1VCIA 3BQMB 2XVMA 3ELWA 1C2YA 4UMVA 4N76A 5GTDA 2OAQ1 2BBOA 3CN9A 2RBEA 3DZ8A 4TWJA 3HB1A 2M6SA 4MLCA 1WHSA 1CY0A 3G9QA 3LVFO 1U81A 1NDUA 2JLSA 1OOEA 1UOPA 2VJAA 3W3AA 4GSYA 2H92A 3IEMA 1N34B 1X7WA 1R4NB 4U3JA 1U2EA 2HEIA 4DVGA 3GLIA 2O5CA 1CJMA 1II0A 2C3OA 1NUUA 2PGLA 2C2XA 3NCTA 4QYTA 4S2EA 5FPSA 5IJAA 4EX6A 4JLDA 2CUTA 4EY8A 3H2HA 1OLUB 3IURA 2AG8A 3GCXA 1Y8QB 2FLWA 1MQ9A 3A9VA 4JVLA 2W6JA 1KYTA 2HCJB 3AWIA 1T43A 3C8UA 1H2EA 1PFGA 1J1IA 2C78A 4DA7A 4UTVA 4UHBA 3E7XA 4Z8XA 5HJ7A 4AZSA 1GRCA 4BUZA 3TXYA 3EAGA 2VQSA 2PGJA 2O2CA 1IY8A 3IKMB 3OZWA 5TS3A 4TLMB 2ONJA 2BL4A 2GN0A 1SGWA 4NECA 1NBAA 2G8LA 2GEDA 3KDSE 1A95A 1QIIA 4RF2A 1A96A 4QFDA 4OHPA 1Z4KA 3KPUA 1J23A 1JUDA 1N2IA 2NU7B 2SKDA 5D5PA 4B5LA 4DG9A 4B2PA 2D8AA 4D1YA 4PRZA 1O95D 3IDQA 1UMKA 1PZEA 1ZG3A 3ADPA 4Q4HB 1VIAA 4CCSA 1XVVA 3G9XA 1K4MA 1OV4A 2ZB8A 4JUCA 4LHVA 3VR3A 4UVEA 1HEIA 2MSDB 4YRDA 4BCCA 5JS6A 8MHTA 3COSA 5IT9A 3BE5A 3I1YA 1LJUA 5FUQA 1QHHA 1UM8A 3ANNA 3D4NA 1Z5UA 1GAJA 2QL6A 3HL0A 3N59A 4PC3A 2LIVA 3A3OA 5G0WA 1X8JA 3OEEA 1L5GB 1WXIA 2XE4A 3C1AA 4LJ6A 1GAEO 2NPOA 4KYTA 4OUDB 1R4MB 4LNUB 1IRIA 4QDZA 3KXDA 2GEFA 1V16A 4MI1A 1MUUA 4QTXA 1DI0A 3ZCRA 3TZEA 4BO0A 1SHZA 4XPIA 2IS4A 2CXRA 3DHVA 1DAEA 3W5CA 1PJTA 1L6IA 4G5XA 1N7GA 5DLYA 4MQEB 5F7XA 2D6FA 2DQYA 2WIKA 3A9WA 1OT5A 1IUOA 1P33A 2CL6X 2GAJA 5LLDA 2ZIZA 1AQJA 5BWCA 3G7SA 3U7QB 4H59A 2R6FA 4I36A 4PYMA 3FMIA 4KO1S 3C24A 5H3HA 3HJTA 2FWAA 3G5LA 4ZALA 1T1SA 5TC4A 1VJTA 1WZUA 4CKWA 2DRIA 1ZR2A 1EGVB 2IIPA 1QGOA 3BQ9A 1V3VA 2MYNA 4BFXA 2R6R1 3HUFA 2G1PA 1PNQA 2C00A 3D8RA 3NHJA 3NWBA 1LGYA 1JVSA 1IZ0A 1G8KA 2XEXA 2DFTA 4X1KB 4Z4HA 4Q01A 3U7QA 4CKXA 4TMXA 3DH0A 4QUHA 1EHIA 1JSXA 1XVIA 1I1QB 1A7AA 4EDFA 2BFNA 5H3CA 1MJHA 1KH3A 4UCFA 1GGFA 1EIWA 2XUIA 5EEHA 3YASA 2I3GA 4YREA 2X8AA 1D2CA 2E4XA 3AXTA 3TQRA 1TA9A 2J67A 2A78A 3X2EA 1TKCA 1CDDA 1RP1A 1VLVA 1VI5A 2PKRA 3FYHA 4PXYA 2A1TS 1N2CA 3L1UA 1GG5A 3BULA 4ND1A 4GM4A 4C5CA 1P2VA 1KMMA 1CE8A 1NW7A 2HDHA 2PO5A 3HLTA 5BP7A 4GIBA 4FR2A 3DP9A 1TAQA 4IP0A 4RJKA 4DPKA 4EF4A 4TX1A 2YCLA 3CIFA 3MTDA 3ZGOA 3BICA 1Z15A 2B3TA 5AHXA 3WHIA 5BVHB 5AD1A 1N6KA 1QCYA 1HDEA 5LA6F 5FL3A 3GEMA 5C5IA 1TQ4A 3ORQA 3HJBA 2AD5A 1PFUA 1ZQ1A 4X92A 1XA3A 1B0PA 1H2WA 1R0SA 1U7WA 3DBVO 2O8CB 1W1UA 3L7CA 1YC2A 4EQ6A 2GRUA 2O0KA 3AW9A 2IXFA 2VRBA 3QVUA 2PZAA 5TQVA 4XWWA 2OHJA 2EFGA 2V45A 5FCDA 3ZDFA 5HZKA 1V48A 4ROTA 2OK7A 2QUJA 3ZV5A 4BLQA 1QHFA 2ZB4A 3VH3A 1UBOS 1NW5A 1TTPB 5HA5A 4LC0A 3ZBQA 2XIJA 2HY7A 4PVDA 3ETCA 4OIFA 2PLNA 3BD9A 4IUCS 2NO0A 2HWWA 5B1HA 1V3UA 2HQBA 3GLTA 5KWIA 4EYEA 5HCUA 3LQ4A 1KYIA 1P62B 4WUTA 3Q6NA 1YDGA 4FM9A 3BWXA 1SUIA 1CJCA 1K7YA 1SB8A 3KALA 4RY0A 1L3BA 3AWDA 1RZUA 4EFNA 3VDMA 1C1YA 1Q1QA 2SCUA 2ZYTX 4PTLA 3BRSA 2Q8PA 3U44B 4Z0PA 4QA9A 2AN9A 4WSOA 3CRMA 1NG1A 3QBTA 4CMIB 1UINA 1HFJA 4NZ9A 3N2GB 4MX8A 1B15A 4GI7A 1XDBA 4LXGA 1DWPA 3OIGA 3CVUA 4C4AA 4OB7A 5EI5A 1A2KC 4F3YA 1BGVA 5EWJB 5DN6A 5K0ZA 4PGGA 1WDKA 2HR1A 3GXBA 2IVZA 3BQNB 2FN8A 1XEWY 1KY3A 2ZUUA 3KKPA 3A6HA 5CDSA 4AJIA 2Y0DA 4D98A 3EH1A 3ENKA 3V1MA 1Z5NA 2V0NA 1EFCA 1GPAA 5FLKA 2GXUA 2QRVA 3KKMA 3RYIB 2Z98A 1GXSB 4WOBA 4ZCQA 2W6OA 3SSNA 4F71A 4Q3AA 4FOTA 4PWYA 3PXGA 3KEGA 1BGWA 1CFJA 2ECQA 2WZDA 3NO4A 2JK1A 2VDRB 1TLTA 4ZTUB 5HBRA 3SI7A 4NCAA 3C98A 1OFGA 5BSVA 3Q8MA 4FKMA 3Q3JB 3Q5DA 2NTEA 4G1VA 4R0NA 4IWXA 4M37A 4UBMA 3AOEA 2XR1A 3PJRA 1OUMA 1N3YA 2OP0A 2GF2A 3OZEA 2HADA 3MPOA 3R0ZA 4TMFA 1NZDA 4TSFD 5BO5A 4Y6LA 4NU8X 3U62A 3VOSA 2WSLA 3OZCA 5K8VA 2L17A 4KLNA 1HMYA 1DRKA 2IWRA 5I7UA 4Y9UA 5GOTA 2VYFA 1ZHOA 3BORA 4HGQA 1EZZA 4Z3OA 5H81A 4X3PA 3T5CA 1KQPA 2OVFA 4B17A 1PV4A 2FPGB 1RWMA 4YCNA 1XTZA 1L8XA 4CXMA 3FTFA 2B4KA 4BMYA 3GP3A 5B2FA 3P20A 1BCSA 3DTVB 4IX9A 2DFDA 1SC3A 1U7ZA 2Z2XA 3JU3A 4G3XA 4Q02A 3PC6A 4UNIA 4BNDA 2NZYA 1IBCA 3OEED 4PZZA 1P1IA 2RGDA 2XSZA 4X6XA 5D5HA 2Y0PA 3PB3A 5C8VA 5J43A 5KQMA 3FYUA 3AUXA 3OZUA 3LXXA 3MRTA 5AR1A 4AI6A 4LHZA 5ITZB 1XZHA 1K98A 4M87A 3UG7A 2AV6A 3GUUA 4YBRA 5D3MA 2CMHA 2DHDA 1JMKC 2I80A 1AZTA 3UICA 3VH2A 2IGTA 4A91A 1W76A 1B0UA 4M8NE 2B9EA 4J7AA 1E1RD 4IIYA 4N6GA 3AUSA 1FFCA 3QP9A 4HH0A 2WD7B 4OXYA 3INTA 4CKCA 3C87A 1P8JA 3ZWAA 3G59A 2VHVA 3NEPX 4WE3A 1MX5A 1GQRA 5DNAA 2PR2A 4BLPA 4ZJYA 4MW5A 2QQEA 4JITA 4RWEA 3OT4A 2G1UA 2HPAA 2Q3JA 1E1NA 5AKHA 2XRYA 4DRXB 2POCA 2E7ZA 2GA8A 4YCMA 3FNGA 1AKVA 4O1IA 4Z9XA 3UT5B 5A6VA 4Y67A 2BCEA 3UJ8A 4BUJA 3BN3A 3N86A 3Q12A 3ZC3A 1R1DA 4I8DA 1NN3A 3WLSA 3PT5A 3ITNA 3M2PA 1EM8B 1E2EA 2V8OA 1OH8A 4B3DA 4GDFA 2QY6A 4RV5A 1A9TA 1BS1A 2Q2WA 3IIJA 4ZV4A 5JXWA 4PQGA 3AK4A 4Q1FA 1IPEA 1GLNA 4ASUD 1TM2A 3HSKA 3K1TA 4MEJA 2Y27A 2BM8A 4WADA 1E