4GOMD

Crystal structure of e. coli dna adenine methyltransferase in complex with aza-sam
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
243
Chain Sequence
b'KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
publication title Structural Basis of Selective N-6 adenine methyltransferase Inhibition by Transition State Mimic
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 81
structure length 243
sequence length 268
chains with identical sequence E, F
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4gomD02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gomD01
3B3JA 4FT4A 5ICEA 2V74B 3UJBA 1YF3A 5K0BA 3BGDA 2XVAA 2ZULA 3DMFA 3PT9A 1RI3A 4F86A 5JUWA 3FUXA 4WVLA 4HG2A 3HCFA 1XCJA 3RW9A 2UZ4A 2UYCA 2XYQA 3V97A 2VP3A 1TW3A 2P41A 3LL7A 5EOVA 2PX2A 5GP1A 2IDKA 3DH0A 4CTJA 2HV9A 4RTLA 3PVCA 4MQ4A 2ERCA 3NWBA 3HM2A 4PYNA 3DXZA 2UYHA 2BR3A 2PVCA 4PYKA 2OB1A 2V7EA 5EMKA 3RIEA 2ZIFA 2QY6A 4QDKA 3HTXA 4DCGA 1EJ6A 2IGTA 4NECA 4RSRA 4Z2YA 5CD1A 5T6BA 2YQZA 5KYGA 3BKXA 1EG2A 2PXCA 4PYLA 1QYRA 5P8WA 4RTKA 1DCTA 2AVNA 2WA2A 3NVMB 2ONZA 5EIWA 1QAMA 3E8SA 3OU7A 3Q7EA 5C1IA 3KR0A 1SUIA 3UJDA 2P35A 1JR4A 2HNKA 1AF7A 3KPJA 4C08A 1M0EA 2R3SA 2PLWA 2ORED 1R6AA 3ERCA 3GRUA 4GUAA 3FTCA 5HZMA 4HH4A 1KP9A 4RVDA 4AZVA 5KS2A 2VDVE 5M5BA 4GOLD 2ZZNA 2ZW9A 3UJ6A 4RTSA 2I7CA 4KIGA 3EGIA 3GRVA 5DRTA 1BKYA 2WA1A 4C06A 4GQBA 5EPEA 2FPOA 2G8NA 4MIKA 3FYCA 5DT2A 2ZSUA 2UYOA 1WZNA 3PLAE 3UFBA 3LKZA 3RODA 2PT9A 2F8LA 3MB5A 1NV9A 3MGGA 4RVFA 3BT7A 1ZG3A 2OO3A 1VIDA 3G5TA 4QQNA 2OBFA 5K0LA 2ZBPA 2ZTHA 4CKCA 5IKMA 4RTOA 3ID6C 2ZBQA 5KQSA 5CIYA 3LPMA 4LWOA 1BC5A 2GLUA 2G71A 5E1OA 5K03A 4FSXA 1KPHA 3MQ2A 4X41A 5JR3A 2AZTA 3M4XA 3S68A 3LECA 5DM0A 3TM4A 1ZGJA 5DRYA 3T7RA 3P9KA 2IIPA 4HTFB 1SVUA 2QRVB 4IKPA 3B89A 4KW7A 4QVGA 1OR8A 1P1BA 4M38A 3G8BA 5FWDA 3SR4A 4E2ZA 5BW4A 2B2CA 3QV2A 5DX8A 4CXMA 2PKWA 4PINA 1VP9A 2OY0A 3ANXA 3CBGA 2IP2A 3EVCA 4GEKA 3FUUA 5E9QA 3I5UA 4X1OA 4RVGA 4MHTA 1DUSA 2BR5A 4QDJA 4R8RA 4R6XA 3BWMA 2BH2A 4EQZA 3OZRA 4G56A 3ELWA 1ZQ9A 2AOWA 5K01A 4CTKA 1PRYA 2IPXA 1JQDA 2GAFA 1MJFA 4RYLA 3MTIA 1V39A 2EX4A 1B42A 3E05A 3F4KA 3FZGA 3KQYA 2I9KA 4YV0A 4DMGA 2XVMA 4PYOA 4Y30A 4WXHA 3SSNA 3R24A 5GINE 4DA4A 2NYUA 3DULA 5K0EA 5F2OA 3FRHA 4FSDA 1RI1A 3Q87B 1R00A 2EJUA 2N47A 2FK8A 5HOQA 1AV6A 3HVJA 3OFKA 3BWYA 2FHPA 3X0DA 3MAGA 1FJXA 3TLJA 2FK7A 3P2IA 3PFGA 1RI4A 3A26A 5BP7A 1Q0SA 1I1NA 3MERA 3MTEA 4R05A 2CMGA 2JHPA 1N7IA 3GIWA 3UZUA 4GOMD 4C07A 3GU3A 1BHJA 4PIMA 3B3GA 2WK1A 3GCZA 2Z6AA 3I53A 4OX9Y 4C04A 5BW5A 1NW8A 1JSZA 1NW7A 3MCZA 4M7RA 4R6WA 1G60A 3KU1A 3OU6A 1G38A 1QAOA 1SQFA 3NW9A 4Y2HA 5CVJA 4DZRA 3KR9A 5KQRA 3KKZA 4BY9E 1HNNA 1KIAA 2CKDA 1JG3A 5EEGA 3FTEA 5K0GA 4DQ0A 3LCUA 2YUIA 5LQNA 4LECA 2C7OA 2AOUA 3A4TA 2P1DA 1VP3A 3KHKA 1F38A 3E23A 3UJ9A 3GXOA 4LG1A 1N2XA 1YUBA 4XCXA 4ER0A 5DX1A 3SXJA 3R6TA 2ADMA 3KQTA 4E33A 4YMHA 3H2BA 5T64A 3OPNA 3NDIA 2GS9A 1NKVA 4C4AA 4YV1A 1Q0TA 3NTVA 1D2CA 1R18A 3P9NA 3FUVA 5FTWA 2P3OA 3M33A 1DL5A 4ER6A 3GNLA 3M6XA 3GDHA 3KQPA 3HP7A 3HVIA 2JH8A 3NVKI 1G6Q1 5IH3A 2EFJA 1R74A 3TPZA 2AVDA 3DLCA 5EMMA 2OPBA 2P7HA 1L9KA 3LBFA 3HNRA 5DTQA 5E1BA 10MHA 3EVDA 3JWHA 2AOVA 3LHDA 3FPEA 2FRXA 2G72A 2HMYB 2HWKA 4GC9A 5ICFA 5C0OE 3TR6A 4EKIA 3HVKA 3DMGA 3JWJA 1NW3A 2B25A 3FPFA 3EEYA 2O57A 3A7EA 3IHTA 3HA3A 2AS0A 4X63A 1L1EA 2O06A 3NDJA 3UJAA 1ZKDA 1Y8CA 1JTEA 2I6GA 2ZZKA 5E8RA 5HILA 2PT6A 3SSMA 5K09A 4YUZA 1SKMA 4OQEA 7MHTA 5FHQA 4GOOD 1NT2A 4PGGA 5F2NA 3LCVB 1AQIA 5EHIA 3AJDA 4FT2A 3VC1A 4HTFA 2QRVA 1KYWA 4PWYA 3T0IA 3THRA 4ZTBA 2CMHA 4ER7A 3ER9A 1XVAA 1NW5A 3EVGA 1RI5A 1NE2A 2ZBRA 3PX2A 1XJ5A 3NJRA 4KRGA 3SVZA 2Z6UA 3DR5A 2R6ZA 1X1AA 1XDZA 3OFJA 3EVZA 3BXOA 4PYMA 3P97A 4RTNA 5CUQA 1AQJA 3K6RA 1XDSA 2Y1XA 4P7JA 2KW5A 2E5WA 4MWZA 4YV2A 5EEHA 3G2OA 4OBWA 1L3CA 2IH4A 2YR0A 4GF5A 1YFLA 2PBFA 1I9GA 1X1BA 2OXTA 3C3YA 3C3PA 3B5IA 4HC4A 4HGZA 1PJZA 3HVHA 1WXXA 1WY7A 1NW6A 4GOND 1ORHA 3DTNA 3OCJA 3C6MA 5CVVA 4BP3A 5KVAA 5ICCA 4X61A 2ZVJA 2ZWVA 1G55A 3KPUA 3KQSA 3KPVA 2IBSA 2YTZA 4RTQA 4YMGA 5CCXA 4P58A 4YUVA 3KQVA 1L3BA 4OQDA 2PXXA 3B3FA 3V8VA 3JWGA 5MHTA 3EVBA 4QVKA 2PX4A 4H0NA 4EK9A 4KWCA 1WXWA 3CJTA 2IFTA 4P7FA 4RTJA 4UOEA 5FULA 4RTMA 4KIFA 3EGEA 3FPJA 2VS1A 3VYWA 1FP1D 3C6KA 3OZTA 2NP7A 2NXCA 4PYJA 3DMHA 2ONYA 1INLA 3O7WA 3CC8A 3M6UA 5DM1A 1FP2A 3HA7A 2IBTA 3ELDA 5DPMA 3BGVA 2AN3A 3SGLA 3K0BA 3KPYA 4FR0A 4OA5A 5EVJA 1JTFA 3HCDA 5EG5A 3TQSA 5EIFA 5LQJA 1X1CA 3PB3A 4FGZA 5FADA 2AN5A 2ESRA 3TFWA 5LQRA 3KQMA 1WG8A 2P8JA 4PCAA 3G7UA 4XUEA 2NP6A 4F85A 3P2KA 2HTEA 5BXYA 3EVFA 2PX8A 2QE6A 3A27A 2B78A 4IWNA 5E2BA 2PX5A 2AN4A 2ZZMA 2VZ9A 5DXAA 2PGXA 5LQUA 3LGAA 1JSXA 2OYRA 4POOA 4YUYA 3MCTA 5HFJA 2AOXA 3PFHA 2NXJA 3UJ7A 5HIMA 5K0FA 4RV9A 3IV6A 1EIZA 1TPYA 2OKCA 5G02A 1Z3CA 3TKYA 4QTTB 3M6VA 1P39A 4A6DA 4C03A 4E30A 4AUKA 1VL5A 4RTPA 3G5LA 4HSGA 3HCBA 1MHTA 2BR4A 4RWZA 2QM3A 5D1NA 1D2GA 2IDJA 2DULA 5FCDA 5B1SA 1L3IA 3IYLW 3LDUA 5FUBA 2O0LA 2YXDA 3ORHA 3A7DA 1VLMA 3FUWA 4HRAA 3CJQA 4E70A 1F3LA 2G70A 5T67A 3SSOA 2C7RA 5E9JA 3DLIA 4MTLA 1XTPA 3LX6A 5E8JA 1RJFA 3ELUA 1G8SA 3P71T 3DXXA 5DWQA 5EC8A 1I4WA 5E9WA 4QTUB 3T7TA 4GBED 2NXEA 5EZQA 3LSTA 5E2AA 1UWVA 1YZHA 3GRZA 4PGHA 1QZZA 4PCLA 3T7SA 3LDFA 3C0KA 3KR2A 4M36A 5U4XA 2YXEA 5DXJA 3KQQA 3QOWA 4V0RA 5FA5A 4PYIA 1JG1A 4LWPA 3WSTA 3EEOA 5EMJA 3PX3A 2Z6QA 1KYZA 3FPGA 3BWCA 3P8ZA 4E2WA 3E7PA 8MHTA 4CKEA 3EGVA 3LBYA 5K05A 2O07A 1X1DA 1EJ0A 4V0QA 2Y1WA 5K0CA 3R0QA 4JXJA 5DSTA 2ZCJA 5K8VA 3DOUA 3HA5A 2FCAA 3D2LA 2HR1A 3FTFA 3LDGA 1NV8A 2IH2A 1R8XA 3ELYA 3CGGA 2OZVA 1O9GA 2K4MA 4P7GA 4U7TB 3JWIA 5LQAA 1SUSA 1P1CA 3VC2A 3TM5A 5E1DA 1T43A 3NMUF 3CJRA 4RX1A 5GM2A 5FWAA 5C9ZA 1KPGA 4HGYA 5CVEA 2YX1A 3DUWA 2XBMA 4RTRA 2NXNA 3M70A 1WS6A 2YVLA 3TOSA 2GPYA 3U81A 5LQKA 3PS9A 2DPMA 4YUWA 1YFJA 2EG5A 3CKKA 4U7PB 2AOUB 2XYRA 3B7PA 3BZBA 2ZIEA 2AOTB 5DTMA 1HMYA 5EQJB 3FPHA 5ICGA 1VQ1A 4CKBA 3BUSA 5EKXA 4CWAA 3O31A 5E1MA 5DTRA 1EQAA 2I62A 1JG4A 2PWPA 5CM2Z 4AX8A 2ZFUA 5GIOE 5CCBA 1QANA 3CVOA 1SG9A 3UJ8A 3MHTA 3GWZA 3VSEA 3G2PA 1KHHA 2H11A 5DM4A 4AZWA 5FHRA 4KVZA 3UA3A 5LSAA 2UYQA 3THSA 1G8AA 2P40A 4BLWA 3KPWA 1XDUA 3DXYA 2PXAA 4XUDA 1KPIA 1M6YA 2H00A 5F2KA 4KDCA 2ZIGA 2ZLBA 2VDUE 2P3LA 1IXKA 3HCAA 3OZSA 3HCCA 5DM2A 4QPNA 3EPPA 5LQCA 1KXZA 4DF3A 3OE4A 2JHCA 3UA4A 4ER5A 1JQ3A 3FRIA 3EVEA 3FUTA 2H1RA 2BM9A 4K6MA 1RI2A 1EAMA 2CL5A 2Q41A 4PIPA 3LKDA 4DKJA 1XXLA 4FP9A 2FYTA 4AZTA 3A25A 1QAQA 1YB2A 4BLVA 1P91A 1U2ZA 4E2YA 2P3QA 4AZSA 4DM3A 1IM8A 1TW2A 3QOXA 4FZVA 4RVHA 2PWYA 5HIJA 2IH5A 5EGSA 5FA8A 3GRYA 3FYDA 5EMLA 2B3TA 1IY9A 5CVDA 4E2XA 3UBTA 1JG2A 4EKGA 4E32A 1ZGAA 2JJQA 3NWEA 5CVUA 1RJGA 4B17A 3DP7A 3EVAA 3SX0A 1ORIA 1H1DA 1VE3A 4R8SA 3BKWA 3I58A 1BOOA 3AXTA 4QPPA 1VBFA 5EHGA 5DX0A 3EMBA 4BP1A 4YUXA 2GA9A 3BGIA 4ATNA 3KQOA 2B9EA 4ER3A 4C05A 2GB4A 3GO4A 3M6WA 4L7VA 2BM8A 2OB2A 3LCCA 3GJYA 2PSSA 2VDWA 3GRRA 3P9CA 2YXLA 3BWBA 5FQNA 3PTAA 3OU2A 2C7PA 2G1PA 5FQOA 3TKAA 3G88A 5DLYA 4EVIA 2C7QA 5HIIA 2JG3A 1ZHFA 3SMQA 2QYOA 4O29A 4E31A 2AR0A 3I64A 4XUCA 4IV0A 3TMAA 5HEKA 1D2HA 2ZWAA 2EJTA 4GC5A 4M37A 5EZSA 4PNEA 1O9HA 3AY0A 4A6EA 3IEIA 4QQKA 3O4FA 3KR1A 4X60A 3REOA 2O05A 3UWPA 5GOZA 3UJCA 3ER8A 1FBNA 3AXSA 3OE5A 2XYVA 1JQEA 2PV0A 4OBXA 3TRKA 5K0JA 3KQWA 4EMSA 4IV8A 4P7KA 4BLUA 2GH1A 3R9XB 4PONA 4OA8A 2NNWB 2BZGA 5GIPE 2PY6A 3R3HA 5D1HA 3CCFA 1O54A 1XCLA 3HCEA 9MHTA 3G8AA 4ISCA 5HIKA 4DCMA 5K0NA 1N7JA 5H02A 2CWWA 2AOTA 3G2MA 1R8YA 2JHAA 3EMDA 2P7IA 2A14A 3I9FA 2LD4A 3ME5A 3AWIA 4PYQA 3P9IA 1SQGA 1YZ3A 5GM1A 1UIRA 1VPTA 1M6EX 2PJDA 3G89A 2JH9A 4KDRA 1UFKA 1RJEA 1NBIA 1X19A 5DSXA 5GWXA 4FS8A 5ERGB 1RJDA 3FTDA 3P2EA 5LR6A 3GGDA 5EKUA 4F84A 3HEMA 1FPQA 3SM3A 3G2QA 3L8DA 1NBHA 1KR5A
chains in the Genus database with same CATH superfamily
3B3JA 4IJUA 3ZH2A 2V74B 3DOIA 1VRVA 4PPFA 5KDOA 4V0NA 1A7KA 2RSLA 2OSBA 4GVXA 5KTYA 4GG1A 4B9EA 1Y3HA 2J0UB 3BOSA 3VPAA 5CH5A 2Y68A 3COVA 2IOYA 1ZOOA 4N9WA 2IDKA 4LHVA 3V5NA 1XQWA 4B7UA 2O20A 1U9YA 1USGA 5T4HA 4MQ4A 1OSNA 4GZMA 4Z7JA 1MIOB 4Z1MD 4EUHA 1ICIA 4GAEA 1UEJA 5BUQA 1VA4A 1FSFA 1GEGA 3AR6A 2VRNA 3PXAA 4P82A 2V5AA 3TGPA 1YOBA 2JGDB 3KSUA 1Q92A 2BHRA 2DPYA 2H8KA 1XHEA 3M4YA 5CD1A 4Z3OA 1H8EA 1RXCA 1ZUHA 5FUMA 1ZK3A 2WTBA 1Z83A 1XTVA 1NW4A 2IGBA 1NYLA 3BULA 3PGVA 5AFSA 4ZICA 3WLLA 2P91A 4Q7EA 1FSGA 3TQTA 2VUHB 2XCIA 3GRPA 2QRMA 5A9TA 1JR4A 3QA9A 1AF7A 1JAYA 1ML4A 4Q39A 2UZAA 3ACDA 4C08A 3DE2X 3K0CC 4XJXA 3HACA 4ESHA 3Q2OA 4OMUA 3N28A 3TB4A 4IMIB 1FDRA 3GEEA 2ZJ2A 2EIHA 4RTSA 4RMJA 4FW9A 4FYPA 4YRZA 2V5VA 1YJXA 4CEJA 2GILA 3C3WA 4KYIB 2Y1FA 5DRTA 3U3OA 2CFIA 2FPOA 4TTJA 5DT2A 1ZRSA 2ZSUA 3OEHD 4HDRB 1FEZA 2QX9A 4OAOA 4P84A 3AINA 1YRBA 3HKCB 2AQ8A 1NQ5A 1H1TA 1NKSA 5L6MB 2ZBQA 3BDIA 3QG1A 4L3OA 4XM2A 3C1TA 2JANA 1NTRA 2MR5A 4KDEA 3QVOA 4PSVA 3AEKA 4OP1A 4TV9F 1EGQA 4G1EB 5IBRA 1OGJA 1QCYA 2AI1A 2VA8A 3PTLA 4HDSA 4RZQA 1DBSA 1RWOA 1ONSA 1S2DA 5A05A 2FWRA 1A88A 3AHIA 2QRVB 3W3AH 3C8MA 3LUCA 4M38A 4ZODA 1CCWA 4BNFA 4EGJA 3QV2A 3MHPA 3S0JA 1ACJA 3QFCA 4PZEA 4YRKA 3OPXA 4MR8B 2IITA 2QZPA 2XADA 4H7IA 1I3KA 4GXQA 4NHOA 4Y9TA 5ENZA 3UATA 3PUZA 4KAJA 4WFIA 1BQ4A 1CIPA 3BSYA 3N39C 4RVGA 4BC1A 4MHTA 1OI3A 1BX0A 2EIXA 3M1YA 4UNNA 3SLGA 2IYUA 4BO2A 4EELA 4D92A 3ELWA 1LFDB 1SA0B 1M75A 4WN3A 4ZCLA 5JJIA 4DJDC 5I4KA 1BRTA 3W5BA 4RYLA 3P0RA 4E4TA 3T7JA 3KQYA 1QGAA 1U5CA 4ZDWA 2C95A 4FN5A 2H7YA 2IXDA 1SBYA 4NNPA 1KORA 4GM0A 3OBBA 1R7RA 1T2NA 1K27A 1ZW6A 4A15A 1R00A 2QSYA 1WB9A 3HVJA 2QTVB 5DF1A 1Y3AA 4XIIA 1VDMA 3ZKAA 2GMWA 3BWYA 3NHKA 3JSAA 4K6OA 4JUBA 4MRNA 4JODA 2QPAA 4JLJA 5MDHA 4V3BA 2Y1CA 4P34A 5DI9A 4EHIA 4R9NA 3IUEA 4CG2A 1RHMA 1V25A 1G3RA 2P77A 2CN1A 3H9BA 3BCSA 1O89A 3K5WA 3KSRA 1B0AA 5A7HA 5B30A 3LGXA 3K71B 2GPJA 5KNCH 1Y6JA 4PV7A 4QM7A 3NHMA 4ZDJA 4R1UA 4B43A 1NUQA 1QAOA 2Y0BA 1BGVA 1QH1A 1QGOA 5CVJA 2I4OA 4TKVA 3RIHA 3Q0TA 2R44A 2Q1UA 3WK9A 4PZPA 4XIGS 4MMZB 2HLHA 3L79A 3NRCA 2IYOA 3NWOA 4KWIA 1IBRA 4NBSA 3CXUA 3GVCA 3GXOA 4L6CA 4OB8A 5JZVA 1U7HA 2AJCA 2NTJA 1IB0A 1T9AA 2ODAA 2XIJA 1Z08A 3KQTA 4D9KA 4RKEA 3LWBA 1ZZGA 4E88A 1I36A 1GZUA 2NPOA 5C2JB 2DR3A 2G9UA 4OB6A 3X1ZA 2K2WA 1EK0A 2YHSA 4WIAA 4G26A 3A4YA 3E1KA 1FXSA 3EXHC 1QE0A 1KY2A 2OZPA 4RD1A 2YQ4A 3QKIA 1BXGA 2VJDA 2V96A 3I4LA 2HT1A 4IHJF 4JI0B 2FEXA 4RC9A 2BFDB 3R3VA 2NSJA 3R6DA 2FXIA 5FNVB 4GX0A 1WF6A 1Q57A 3FZEA 1L7OA 1GG5A 2AMJA 1D6SA 3VKWA 4BDSA 1DPGA 3WWYA 1X74A 1NI4A 1QRDA 2XQFA 3WY9A 10MHA 4EW2A 1J20A 1WXQA 5KTMA 1FMJA 2ODQA 5EHXA 4MTCA 1KE1A 5DCLA 4K8OA 3RUHA 1YTUA 4XM1A 4FOLA 4MJLA 2O8EB 1P44A 1YQEA 2AS0A 1PUJA 2V65A 4KVAA 1GPDG 2I4LA 1K98A 1E2LA 2Q3MA 1SKMA 2I7DA 3WOHA 3AESA 1R0KA 4FI3F 2P9GA 3PF8A 4HPJB 4Q7KA 5FFMA 1L4UA 1R4ZA 3KDPA 5F2NA 4JLBA 5B2EA 3CG0A 2RBGA 3V9PA 3HV2A 2OAEA 4B84A 1FDSA 3IIMA 3CZ5A 1EUZA 1CK4A 1CKEA 1NQUA 1NP7A 2ODBA 2VHQA 3H4VA 3INYA 3OJLA 4G4SO 4ER7A 2C96A 4JI7B 3G6WA 2OC9A 1Z0DA 3DYVA 1N8NA 5ITZA 3AB3A 4G5HA 4RANA 1TU0A 2V55B 4DXDA 4RDHA 2CDAA 2WKRA 3ENKA 3LRPA 4PZYA 3TNDA 3I6BA 4KP7A 1E1KA 2GCPA 2X9LA 3O92A 2GK4A 3ORYA 5D86A 3WWZA 2DCUA 2NZVG 1CERA 2ZJ3A 3PYLA 5YASA 4E5DA 4PG4A 1XDSA 4GYYA 3PKJA 1LNZA 1LCIA 5H4HA 4Q4AA 4EW6A 1VA5A 2B0CA 2O3RA 1TZBA 2I4RA 2QRUA 1SCDA 3H1GA 3P1JA 4QEDA 4XYBA 3ZWOA 2GVDC 4U5QA 4JWKA 5EWLB 3DTNA 4ZQHA 3VNQA 5FJJA 2JDIA 3ZHUA 4F93B 2JH3A 2C54A 3AI3A 5FWXA 1EXVA 2AJTA 4XD7D 5EHQA 2CJWB 5KNDA 1E96A 2OK8A 4RTQA 1M0WA 4YMGA 4YRPA 1GZ3A 4FIZA 2WYHA 3DHYA 1CQJA 4IDFA 3ZXSA 3E9QA 2OYSA 4OQDA 5AW1A 3SBEA 1DJPA 1N2OA 3KTAB 4MS4A 1RKUA 4PSCA 4TZTA 2YBEA 1UBFA 1MN6A 4ROSA 3D7RA 4F3TA 4NOJA 2DZDA 1KGDA 1D1SA 1ZMOA 3N6VA 1XAIA 4XPZA 3Q3CA 4GVPA 4PFSA 4LOHA 3OBIA 5JY6A 1SXJB 4PYJA 4RULA 5COAA 3K8OE 1INLA 1ZJJA 3WYBA 2OCPA 3M6UA 2ZDHA 3IKLA 4BVGA 4GX5A 4DMMA 1STOA 3O3NB 3PPXA 1GSHA 3HDVA 2VTKA 4QG3A 3T1OA 3SQXA 3PEVA 2A88A 2D5CA 4HNAB 3ILXA 1W5EA 4TMFA 1SKBA 3QVSA 2EP7A 2E6UX 5KSWB 3TFWA 4O4HB 1X7ZB 1WG8A 4FMCF 2P8JA 4XVCA 1W2WB 2WZCA 2GPBA 3WFIA 4EZIA 2NP6A 3R77A 2PR2A 3EVFA 2C07A 3VMMA 1MGOA 2MSWA 2H52A 1J06A 2VCYA 2QPLA 3ICOA 4ZV4A 4FMDF 3QPAA 2Y76A 3WGYA 4F12A 4RPJA 3WRYC 4J0FA 1GY8A 2GKGA 3RQIA 1AKTA 1GSAA 1VJRA 1P39A 4A6DA 4OOFA 4E30A 2BTQA 3IPRA 1AS2A 4AIIA 1NYQA 4KH1A 4DLYA 1KQ3A 1IN4A 4CFZA 1FDIA 5D1NA 1H3EA 1VHQA 3A8TA 4PC1A 3RAEC 1L3IA 4I5IA 3QHQA 4YO7A 5AKGA 3GHYA 3Q0EA 2ZSHA 3CH5A 4C6TA 1VLMA 1E9CA 4HK4A 1II8B 4N01A 4ROTA 5FDFA 3PNPA 4CQJA 2ERYA 5FWNA 1RJFA 3L7CA 4FVTA 4M7OA 4M9UA 4GXNA 1OI4A 3C24A 1EBBA 3T7TA 1E63A 1Y9JA 2HRBA 1X80B 2GRUA 4URZR 4Y9RA 3SLRA 4OFZA 5KJ1A 1U0LA 1QZZA 4EZEA 3QLVA 2FHSA 5CHYA 2H1SA 2J9ZB 4IG9A 4XD2A 1EWTA 2GAOA 4YP0A 3KLPX 1Q1QA 3AEXA 1AKYA 2Y6VA 1JG1A 3K7EA 3NM5A 4I66A 4WZAA 3PX3A 4NRDA 3FPGA 2A3NA 1R0CA 5JHGB 4E2WA 1IEWA 2JLXA 1XZCA 4EG7A 2GN1A 2QZ9A 4L8WB 3P2JA 4JB0A 3BGWA 3RRJA 4L4XA 2JEYA 2OAQ1 4G1VA 3W2HA 4DEVA 5K8VA 2C4UA 4DCUA 4UDNA 3RUIA 5KDDA 1R6TA 1PR1A 3VPGA 3OIVA 1MJGA 4LYHA 4LXIA 2V6GA 3WHLA 4D9FA 4G4SP 1C3EA 2Z1NA 1PWHA 3KIPA 4J7XA 3OZCA 2IV7A 2BELA 2NUPB 4HWSA 1N1EA 3TAUA 1F9AA 5F98A 4J2TA 1DJNA 1UQUA 3L4KA 1GCGA 1Y6QA 1W5BA 3DDUA 5REQB 1H6CA 2P6PA 1M74A 4ENUA 2YWFA 3GVHA 4OGKA 1Q22A 1ZOLA 1WDWB 1TM5E 1IJEA 2DPMA 2AUNA 2BGNA 2PUVA 3OOHA 4LS3A 3TQFA 3TYXA 2W2KB 5KWEA 2WJGA 3BBLA 2CD9A 2VDKB 3BZBA 5DULA 3SXUA 2H1VA 3EF1A 5AVUA 5EKXA 1D07A 2Y92A 4XI9A 1CIJA 3ILVA 4ERXA 1F1JA 3O31A 5E1MA 3E3LA 2O5CA 2IXTA 2L17A 2ZSAA 5BSRA 4D0NA 2O2DA 5CMLA 3WYAA 2VSFA 1RXEA 3GW8A 4QBTA 3WLEA 2O0KA 4MVJI 1ESMA 3LDAA 3PNYA 4Z6KA 4IZHA 3D3EA 4I1PA 3IAUA 2IHTA 2Q6KA 2EFCB 4HUQB 5ALYA 3KT3A 5IT9A 2B2NA 3E2IA 2LP4Y 4D4LA 1XO1A 2C2GA 4PCUA 3GI1A 4EYOA 3QU2A 1JLRA 3DMPA 5B3LA 1UM9B 4EJFA 1E2EA 4RXMA 3VR4D 3O9MA 1T8WA 1U0RA 2BKXA 2CXHA 4LY0A 4LY3A 3LUJA 4WLVA 5FUQA 1V16A 1XRLA 1T36B 1T5TA 3LWZA 4UMEA 5JZMA 3DWGA 2PGAA 2Q5HA 5DIFA 2XB2A 3ZDEA 1PZFA 1XMXA 1TIPA 3VOTA 5AUOB 2A9VA 1IXZA 5J2UA 1EM6A 1EAMA 2Q41A 4PIPA 1E1CA 1H94A 2FTKE 4UD6A 1J0XO 3RU2A 3ZGLA 1EUCA 1GTMA 1UH5A 3VAZA 2P2DA 2GEJA 2B8TA 2VZLA 4BGUA 2OT3B 3IQXA 1Z3IX 2ZIXA 3C6ZA 1OKKA 1B15A 6LDHA 1PNTA 3EXFB 1Q12A 5LC1A 1F17A 1U8UA 2XDYA 5CXXA 4NFSA 1EP1B 4IHKA 5AHRA 1JQLB 2SCUB 4L6AA 3DGEC 1U31A 3TCNA 4D9CA 1RRVA 3OMWA 3OCWA 4CCSA 4ND5A 4Z4QA 1U80A 2DBRA 3EVAA 1Z8HA 2Q4DA 5CIQA 4ZJPA 1Z9BA 3BKWA 3I58A 2F1IA 1VBFA 2EKQA 3BIXA 5CLQA 4N18A 2W2QA 3KQOA 2HLDA 4ER3A 5JS6A 3EC2A 3GO4A 3OA2A 1MAVA 2IT1A 1JBEA 4NCHA 4NU0A 3GRRA 3GVXA 3BCUA 1U8AA 3DTTA 2WZQA 3V7YA 5BV1A 2GOYA 3E70C 1UADA 4HYTA 2WSSD 4EQ6A 1ML3A 1QM5A 2GF0A 3ZWMA 3LQ2A 2E4ZA 3F78A 4JR0A 4WXPA 4O29A 4EF6A 2I6FA 1XROA 2MSCB 2V7QA 1VG8A 1DG9A 1FLDA 1PG2A 4HN2A 4X45A 5K0TA 3IERA 4CG3A 1AV7A 1UBLS 2EJTA 5HUQA 4PRZA 1V43A 5EZSA 4C4PA 2WJ6A 3MVEA 1CEYA 4MUGA 3H1TA 1E1NA 3MWEB 3O4FA 4DMRA 2FKAA 1IONA 1U2GA 2GX6A 3KXIA 5I48A 3PYXA 4Y0NA 1PT9A 4OBXA 1P4RA 2FFHA 3PI7A 1U9CA 1W35A 2UVPA 2IYXA 2ZYTX 3AGQA 2WR8A 3JVDA 1YZVA 2FOIA 3A4LA 1KNXA 2VVTA 1TNDA 4XOUA 4ZCMA 1Z63A 1RZRD 1JEQB 2IYLD 4UVEA 4JV5B 4FCCA 4FUQA 2OQRA 3LBHA 1Z2OX 4EYKA 2VAMA 1ISHA 1HFJA 4CQLB 2X13A 4C7OA 3IQEA 3SZ3A 4D9NA 2P9BA 4FNGA 3R4VA 3B60A 1SR8A 4HNRA 4MWGA 2JIBA 5HVNA 4GSLA 3BMNB 1L1FA 4YT2A 3GN1A 4R41A 1SPXA 2VUIB 2PJDA 1GPBA 1ODLA 3HI6A 3H1EA 2IBMA 3FOWA 4IQFA 3M1AA 1E2JA 2GWRA 3VXKA 2JIZD 1VJCA 3G2QA 4BNNA 4K46A 1D5WA 5B1EA 1T4BA 3HBAA 1TM2A 2IY7A 2ZULA 1YBHA 5ITVA 1V9CA 3I5AA 4EG1A 5TLSA 3G2KA 5AW3A 1V4BA 1OY1A 1SUEA 2W2VA 1C1DB 3SF8B 3BEOA 2I76A 4AXXA 3TXYA 1BS1A 2VXYA 4TWJA 4L4RA 3O82A 1WP9A 3CYFA 5CB8A 2Z5FA 4LYEA 4K81B 1Z36A 1MA0A 3BQ9A 3H87A 1DBWA 1R27A 1Z4QA 2WVHA 4R68A 2QIPA 2V7EA 3K09A 4BB6A 2BISA 9ATCA 1KVSA 1V3QE 2ID8A 4LZOA 2RIRA 2IDZA 3O91A 3QTTA 3HUDA 4OBBA 4KAFA 1OGIA 3AJAA 1A2KC 3DDZX 5FBZA 3N9IA 3ZIAA 1IWOA 3N8NA 4J1TA 4UNQA 4XYEA 4EA6A 3MINA 1MR3F 4M76B 2VZ0A 1RLIA 2Z9CA 1M7HA 4GPZA 1E1LA 5IC4A 3BK7A 1WL8A 1KP9A 2BCJQ 1DLJA 5E4FA 3HXOA 2EHDA 4IJMA 4CW7A 3UUWA 3EPJA 4JLDA 2C2OA 3DBHA 1N33B 3RS8A 1I24A 4QXRA 3EGIA 1I7PA 1MA3A 4QUJA 3HXMA 2IRWA 2QROA 4U6SA 4YJKA 1KO7A 4HSEA 1MEOA 3LKZA 2GESA 3FMIA 3LXRA 5I4BA 3CW9A 5KTSA 3IESA 4MHOA 1N5IA 1QV7A 4IVQA 4XJSA 4IXWA 3AU9A 4G81A 1V3TA 1UXIA 1F48A 3NCTA 4JQYA 4MNTA 3MT9A 3DZDA 5LZ9A 2B5VA 2QTLA 2Y27A 4RS3A 3SU8A 4NBVA 1ULZA 4I1RA 2G9QA 4RFVA 2R7MA 3O2SB 4W5QA 3ZBUA 4MS3B 2JZOA 4L57A 1GWNA 1NQVA 2RHMA 3K30A 1Z4IA 1IAVA 4IKPA 4OFXA 2Q7DA 1UKEA 4KU4A 1Y5MA 1IUPA 5BW4A 4K6KA 1EP3B 1GHTA 5DX8A 4F8JA 2OVBA 4KITB 1BW9A 1L7RA 3ENZA 3FR7A 1M34E 2OD2A 4KK3A 4WA8A 5AKIA 2FZWA 4BNJA 3L8FA 3E48A 4G24A 4JWTA 4XFDA 4C9BA 4CT0A 4MWSA 3SOPA 1PYGA 5LQMA 4FDTA 2G67A 4QDJA 2BR5A 2CNWD 3ZTTA 3AHEA 3QELA 3OP1A 4L73A 1NY5A 2Q29A 3HK2A 1YE8A 3QWHA 1XD9A 1QO0A 1Z2NX 1P2FA 1ZQ9A 2HB6A 4WQMA 1EKXA 3PICA 3RTBA 3UK1A 1KI7A 4MAAA 2F3QA 1OX5A 4EM6A 3DEAA 5CTAA 4EF5A 4P81A 3IRVA 2BC9A 3SSNA 4OYLA 3MEQA 4KYUA 1MAUA 1QYVA 3A6EA 3FRHA 4D79A 2OCGA 5ESWA 5GAJA 5IMBA 2DJIA 1BCRA 1C3OB 4Z4CA 4CBVA 1KEVA 3HY4A 3HSYA 2QG4A 2I8AA 3HZHA 4B3JA 2MMGA 1NUSA 2V9ZA 3BS4A 4GGOA 1PVOA 2WMYA 2R97A 2ORWA 3K5PA 1OI7A 4GRDA 1LBIA 4QATA 3TEMA 1Y1RA 1GADO 2DEUA 1ESDA 4FJ0A 3S55A 4BFLA 3LS2A 2I1QA 4G0ZA 5CIWA 1GXSA 1TT5B 3KKNA 1RAIA 1N2HA 2N9UA 3KTDA 5I9SA 2Z6AA 2OL4A 3I53A 2ZB3A 4HLUC 3K0AA 3PWZA 2EHJA 4YLEA 3EGDA 1JFFA 3E5MA 3OU6A 4FYYA 4F9GA 4N76A 3SJAA 3ZI4A 1F14A 4HNTA 4NYJQ 3KR9A 4PGMA 3L1UA 3LMKA 4CE6A 2G40A 2CKDA 4FZRA 3T34A 3A37A 4OU4A 2G6BA 3SP1A 4CF5A 1C2YA 2BDTA 2OGSA 4XJTA 5LZ4A 3U48A 1SBZA 3UJ9A 4LVUA 5ES4B 1Y3DE 3F8WA 4A2PA 2WW8A 3ZYZA 1B93A 4F11A 3ASZA 4IDBA 4E33A 3ZD6A 3B6EA 3OPNA 3PC3A 1YQXA 3HZRA 1RVDA 1CB7A 3O7MA 2IXGA 3QE2A 5DGCA 2JAWA 2OCAA 3NM4A 1G4HA 5AJVB 2F1OA 5EQDA 5JRJA 1ONOA 1PJLA 1ZCAA 5IWAB 3U44B 1M83A 5D5PA 2JCXA 4ZHQA 2EERA 3GDHA 1T0UA 1US8B 3A6FA 4BTVA 3TIFA 3TCKA 1BU5A 1ZNYA 3GAZA 2JJ1D 1R74A 1ORRA 2Q5OA 2KSQA 1JJIA 1LGYA 3HDTA 4U8GA 2J08A 3KUDA 1HLDA 4I1YA 4UBOA 2X40A 2Z04A 2BFEA 4J90A 4OP2A 5DTQA 5HDBB 1ETHA 4TLCA 2K5UA 5KHOC 3DVRX 4RZ3A 2AOVA 3FPEA 4F4UA 3DT9A 3KJHA 3WRXC 5BMVF 5JH7F 421PA 4HKTA 4PRKA 3H11B 2I7VA 1VHTA 1Q1GA 5BN3B 2W6JD 3OC6A 1YZTA 2O57A 4YRAA 4MUBA 1P7ZA 1G5IA 1T8RA 2NU6A 2C8JA 2X6QA 1Z25A 5EP4A 1OLXB 5AKZA 1GNQA 4KR2A 2Q3CA 5LP1A 2JFOA 4FI3C 1ND5A 3EZFA 2P2LA 4HWTA 2YFHA 1OTXA 1E3WB 1F0KA 5ALMA 3AEUB 3PV0A 3T35A 3FNEA 2QLMA 2M6LA 3DKKA 1A5BB 1CQPA 1N6KA 1USUA 2IHKA 2Z4RA 4HAIA 4PF1A 1MX5A 1ODJA 2J7PA 3KOUA 4J7CA 3P0IA 3USCS 4EDHA 3A9CA 2DSTA 7ABPA 3PFFA 1CZLA 2X14A 3A2LA 1CY8A 1EWRA 1X1SA 3W5VA 5JW6A 2O7VA 4AKIA 2ZBRA 4RDCA 2LCIA 3AM1A 1JU9A 4L75A 1UK7A 2LV8A 3JRWA 3FCUB 1P2UA 2VNHA 3OFJA 3ETJA 2YIJA 4KIJA 1M6NA 2H1HA 4OGFA 3C5HA 3K6RA 1Z45A 1SHTX 3OWOA 1PVVA 3X2FA 1SXQA 3LCRA 3HY3A 4YFYA 6REQB 3NEJA 1NJFA 1WTCA 4E2FA 4O2BA 3EB9A 3DBLA 5TF0A 1UAYA 5KSYA 4NATA 5EP3A 2Z8YA 1VL2A 1E7SA 5CP8A 3CF2A 1W581 2FSHA 3JD3A 2FPUA 3DGFC 4N48A 3LUHA 1UJNA 5CB4F 4P58A 1TD9A 3E84A 3WKEA 4TMXA 3R44A 1L4HA 4TZ6A 4NCAA 1CUCA 1JGTA 2PMKA 6GPBA 1N2SA 3PNMA 2G04A 4AUMA 1C30A 3DAOA 2ENWA 2XSZA 3A1WA 4RCZA 3T9CA 2VH2A 3V8RA 4RDXA 2WOOA 2VFAA 2V45A 3LO8A 4CUJA 1ZH0A 1F12A 1I2CA 2BP7A 4LGCA 1FRFS 1V9LA 2FN9A 3GFGA 3VR2A 5AVVA 1H6BA 2ECPA 1WOMA 4ZAZA 3MRVA 3ZVLA 3KZXA 5JVDA 3GP8A 1WUIS 3ELDA 3M82A 1JLSA 3LXUX 2A5DA 2VIIA 4LA4A 2K6GA 4TX1A 3TRDA 5JQGF 1W4RA 3FMOB 3IOMA 4FS3A 4FGZA 5JISA 2ESRA 3HLTA 2PUWA 4HOYA 3P0FA 4QBIA 1UPTA 4OJTA 3S7ZA 5BVHB 3ZJTA 3D0OA 3NBYC 3RBAA 5J5CA 2HTEA 1C29B 1U2EA 3V7NA 2QE6A 4E21A 4DQVA 1QC5B 4XQEA 3QKSA 3OZAA 1EGAA 1HBJA 2PUGA 3M81A 1RR6A 3AB8A 4YA6A 1W4ZA 2DLDA 1YHNA 2CXXA 2QHXA 2YRXA 3EQ9A 3GJ3A 1NMZA 4H16A 4IVNA 4QYMA 5TGDA 3T61A 5K0FA 2DHEA 3M6VA 5AVOA 1E3IA 1P73A 3JAWB 5JPIA 2XTJA 1Z37A 2Z98A 4CQMD 2GO7A 2QM3A 1RD4A 2E4XA 1NUUA 1K4MA 4AWXA 4EPWA 1VE6A 3WAJA 1LX6A 3ZBPA 2D74A 5IDWA 2NXWA 3UMJA 1FTSA 1IMOA 1NLUA 4G0XA 1Z62A 4N82A 3IVMA 4HRAA 2JLUA 4D43A 1IHPA 4D8TA 4OUDA 1XEXA 4J3FA 1G5TA 2OCKA 1XMQB 1E2FA 4AQYB 1S8OA 3EXIA 4BNVA 5LUBA 4UHFA 4FNOA 2YZMA 2P90A 3R5TA 5AKXA 1O5OA 1WDMA 3LSTA 1OV4A 2DG2A 4IEFB 1W30A 4CL0A 1R1DA 2P2GA 3ASVA 4AICA 4XSVA 1NOIA 1E3JA 4ASUD 1E8DA 3AW8A 1KVQA 1UXHA 5C8VA 1QE3A 4FSHA 4HXEB 4V0RA 3ZJ5A 2CDCA 3I0NA 2IPMA 4Y6PA 4GMFA 4CTMA 1DC4A 1KJZA 1NMSA 3C3MA 3P8ZA 4FOPA 2X8JA 2C2KA 5H16A 1PGQA 1U3FA 1ATIA 1ULBA 3B78A 3DV9A 4AY5A 4G86A 3BFKA 2FCAA 1E9DA 2QVBA 1PDVA 4Y7CA 4L2IA 4YDSA 5KQGA 1M0SA 3NO4A 4L3VA 4N0QA 3WBJA 1XYGA 1PR6A 2I65A 2OEPA 2WZBA 4RZ2A 5L51A 3ZVNA 3VHXA 3UMMA 1KTVA 2EYQA 2WU0A 4GHWA 5D85A 4GECA 1N5JA 4FUTA 5IAJA 4H18A 3TOVA 2YINC 3BE6A 4KVGA 5U1PA 3RRFA 1MT0A 1AQLA 3HBNA 2BEVB 3O21A 4OK5A 3TW4A 1O97C 4DW8A 1BXZA 1VM6A 1OH8A 3R41A 4Q18A 4CU5A 3U6BA 4UD2A 4ID3A 1M8GA 1TVKA 1WS6A 2X86A 3B1ZA 5JS1A 1E2KA 1PBTA 2XKAA 1R5NA 3M3PA 5DGDA 5B6IA 2VK8A 2VJNA 1M2VA 1E0DA 1E1RD 5BOVA 3G5AA 1OU0A 3QVMA 2AOUB 3JS5A 2R4QA 3QBJA 3WL4A 3JYHA 3K8QA 4P98A 5EQJB 2PL5A 4JJ8A 9LDBA 3O73A 2AB0A 1NONA 1T1GA 5D3MB 1V5FA 3G7SA 3KEGA 1E5TA 1NIPA 3ZK7A 1H66A 2BBTA 1YKFA 2NSYA 4NFYA 2RD2A 4LZLA 1ZWLA 1P0QA 4TRNA 2KBEA 3L01A 3WDMA 5JSQA 4XWTA 2LCQA 1RZVA 3DEKA 3GLUA 1TYZA 4DLPA 1GPKA 1AQ6A 3W34A 3SJCA 3EOAI 3EH1A 3IB3A 3OOEA 5FPSA 1KEKA 2DM6A 2XCQA 4HQFA 2P3LA 5E9AA 4ZVNA 3PCRB 3QVWA 5JATA 5H68A 3HCCA 1W36D 1B00A 1J00A 4QPNA 5ALUA 3WIEA 4KO2S 1UJMA 3Q5DA 3O8LA 2WAAA 4X95A 3S7TA 2QXYA 4DF3A 2GCEA 4QD3A 1QIMA 3A4NA 3UA4A 4B9AA 3HXQA 2XLCA 3QKRB 1N34B 1KI9A 1IATA 1TO2E 2E5FA 3EXEA 2Q50A 1WD5A 4I14A 3T5MA 3ZS9A 5I7EA 1CJMA 1QKJA 1YNOA 3CLSD 4QXPA 4ITRC 1GKKA 1I3MA 3GHHA 4AFNA 4GMDA 1CVIA 4G4JA 1G59A 1JKMA 3C97A 1IG3A 3P96A 4KWTA 5BRNA 3TDKA 4ARCA 1GQYA 1J99A 4YJFB 3PQ4A 2I34A 1NBMD 3U0VA 1PQPA 1V3UA 1B2RA 1P2VA 1NVEA 1PT7A 1QHEA 1UJBA 4QYIA 4LRUA 1F8YA 5F23A 2A1UB 4DR7B 1QH8A 2PA0A 1V5EA 2ZT7A 4DBLE 1O58A 4UEJA 4D02A 1P5HA 5JXHA 1DAMA 1GZHB 4JUIA 5M29A 2HRQA 5CDUA 1L5RA 5AK0A 5LXTF 3UMBA 3V4LA 3AK4A 1C9MA 1RMTA 4DNQA 5BWNA 4X24A 3WGZA 2RKWA 2YHUA 3NTUA 4LYGA 5AVQA 2GB4A 3C1UA 5E38A 2F62A 5JCXA 4LJ9A 1E98A 3P9CA 3S4YA 4YRBA 1G16A 3HXLA 4ZVTA 1WVMA 2FP3A 3BH0A 3OKPA 3AEKB 4UHHA 5DGHA 1LSOA 4C4YA 2A0XA 2ZYWX 4HDSB 2D2IA 1JHOA 1DAOA 1RFLA 4ZPXA 1U8YA 5L9AA 4JIMA 4L5CA 3A6DA 4MITA 4D0GA 1NGSA 2ROQA 4Y9UA 2NZ8A 3VR5D 5BOSA 2I03A 2WKPA 3C6XA 3F3YA 2ZWAA 1L4EA 3U1VA 5ELLA 3JYLA 5A3JA 4BVEA 2H9AA 4GE0A 3D4OA 3U13A 1CD5A 3TGWA 2B30A 1SBNE 4AIRA 4PE5B 1AXEA 2JLYA 3ACBA 1U28A 4CL8A 2QLTA 3S70A 3Q8MA 2YYSA 5M3BA 2D13A 3U80A 3DTVD 3JVIA 1TTPB 1UK6A 4DLUA 1ESNA 3ZCUA 1FQWA 1JDJA 2IK8A 3PVZA 3IV7A 1JA1A 2JGNA 4BKRA 4G5YA 4OHYA 1QYWA 3WHKA 5K0NA 3H16A 4B3IA 1MD9A 3VYVA 4TPKA 4TN5A 1QP4A 3ZDAA 1BROA 2IVFA 5MF6A 5FPKA 4YS6A 5FF9A 2A14A 2X5OA 1ZUNA 1JJVA 2GA8A 2QM8A 3HP4A 4O1IA 2JK0A 3HYNA 1BD4A 3COPA 3LYLA 4MLPA 5I7WA 1O6BA 3SIWA 4KUGA 3VX3A 4B1FA 5ALPA 1OLSA 4GI7A 2E2WA 1IE3A 4AMBA 2F67A 2JFYA 4PZ0A 3UJBA 1QIKA 2KS6A 1N9GA 2XVAA 3FJOA 4G36A 4PAMA 1EZ4A 4M1MA 3W2FA 4HGNA 3Q8LA 2HGZA 3HZOA 1UJ6A 1I5EA 2XYQA 2NU8A 1HTWA 2RGBA 5IKPA 1TW3A 4MP8A 4RA9A 3RYHA 2AD1A 1FNSA 1NPYA 3SFTA 3DDCA 3FNBA 2NNLD 2PZAA 2VDLB 1SU6A 1W2GA 1CJUC 3DOFA 3QVJA 2NTVA 5EMKA 3T99A 4ZI7F 3DWEX 5MFZA 2O3UA 1SG0A 3DP9A 2YMPA 3TOZA 2CYCA 3GA7A 3NZEA 3CVXA 4M1WA 4DLKA 5B37A 4DHWA 9LDTA 4BMPB 2D3TA 1CXZA 4NCXA 3QW4B 4HYQA 4D74A 1PZNA 2B94A 1OASA 5KREA 1ZMTA 2CY0A 1G5HA 1Q0ZA 4URWR 2XXAA 4KO8A 5FWYA 1H2FA 1OB2A 2GHRA 1SULA 3R7DA 2QR2A 5GPBA 2X0EA 1FYFA 4AZVA 2XMQA 3DE3X 4GOLD 1UZUA 3HADA 2APJA 3R3UA 2WT8A 1XJWA 1KEPA 1SBQA 3OE7D 3CX6A 4IMJB 4KYTA 1NI4B 3KKOA 4YBRA 1XCOA 3GEDA 2O3TA 3RASA 4ARSA 5HWSA 4WKCA 3ZWKA 3FGPA 3VISA 2WHRA 2F8LA 3BT7A 1E4YA 3J80A 4UZSA 3UC5A 1XMJA 2AJBA 1G18A 2Q6VA 3F7OA 3IDFA 3K9WA 3AIIA 3DVAA 1RQPA 3JQGA 4JJZA 5KQSA 3OX1A 1T5OA 3H2IA 1EDBA 3CUTA 4X92A 3AESB 2NZWA 3B7GA 1VJGA 4W4TA 3FFAA 3WMEA 3O4VA 1BWPA 5HZKA 4IJ5A 3THWA 1OV6A 4RSGA 5I4CA 5DIZA 3RROA 4JQSA 2H1LA 1KI4A 1QNLA 4KW7A 2WHQA 5C4IA 5IBPA 4XDYA 4Q9DA 4Z53A 2RAPA 3JQ9A 3CB4A 4EW1A 4YMVA 4CXMA 1H0KA 4PAWA 7MDHA 1P7CA 1SOAA 1LF5A 2EFEB 3BGSA 2OY0A 1IEVA 5EQFA 2DH6A 4CVNA 2LWIA 3O83A 3EXHB 1I0ZA 3KLMX 3L6BA 3E5NA 1FDOA 3IS3A 3V4RA 1SU8A 3WYDA 1TI7A 3LA8A 2IYSA 2V7WA 5AW4A 4KXQA 1OBFO 1Q2XA 1X8LA 4NDZA 4R8RA 2C2BA 4FGWA 4NBKA 3SYKA 2O0JA 2ZRAA 2B35A 5JD3A 2FDCA 2DTXA 2ECOA 2WMDA 2VHJA 3R2JA 4HZGA 1NIJA 2YUTA 3MTJA 2HA0A 1RHQA 4Q4AB 1SC9A 3SX2A 3FCEA 2BFCB 3ZWBA 3AL0C 2IYRA 2OUKA 1VXOA 5GZ1A 5D2CA 3WLRA 3ZE2B 4CEHB 2X0RA 3A2KA 1CLEA 2FDRA 1FP6A 3E4CA 1A1SA 4HEHA 2IOQA 3Q87B 2V54A 4REMA 5FWXB 1JHMA 3I28A 3OM8A 3TZQA 3S5UA 5TQVA 3T9BA 3Q7TA 4M54A 4F5DA 3QPDA 5K2MA 1CQJB 3X0DA 3C16C 4XWGA 4TWZA 4G84A 3PFGA 3PRHA 3GJ6A 1BHQ1 1CRWG 3AKZA 2C78A 4KFRA 4FDVA 4UUOA 3CRVA 4HL6A 1VIAA 5IJAA 4CN8A 4N12A 1BHJA 3B3GA 4P93A 3A4IA 4YONB 4EECA 1LI4A 3NV7A 1JPJA 2JBWA 3QOFA 3ZE9A 3EWSA 2IU4A 3RFFA 4AKEA 2MSLA 1II9A 4M1YA 4QARA 1GYQA 3SJUA 3U61B 1I6KA 5TQ2A 1GTRA 4QDUA 3D02A 3BTUA 1JG3A 2FI1A 5LZ5A 4JFRA 4LBVA 1PHPA 4KZKA 3TUIC 5K0GA 5EJ6A 3DXFA 1J6UA 1JPUA 2ZJOA 3NETA 3T9DA 2ETVA 2GBGA 1J9EA 4CYMA 1B23P 2L82A 4XCXA 2PWZA 4YRSA 3OQHA 3QY9A 5CA1F 4A0GA 1UKZA 2UVDA 4D0RA 1TC2A 1WEKA 4L5JA 1DS6A 5IK2A 2YZGA 1D2CA 2JF0A 1K2VN 1QIEA 1F8FA 3P9NA 1T2DA 2SICE 5FTWA 1XMIA 2BIFA 1Y7PA 1RKXA 4JGBA 1XMPA 3JZMA 4I08A 2D8AA 4AS1A 3CF6R 3EIWA 3G2NA 2I3ZA 3S2ZA 3ZHOA 2VL7A 1EUQA 5LU8A 4BB5A 3RC8A 2OLJA 2YOHA 2QR5A 2VZEA 1E1DA 1DTWA 1EVKA 1RXIA 3EDCA 1C7IA 3BFJA 3C6BA 2V6JA 3JZIA 4FX2A 5DCUA 5FOXA 5HFAA 1ZO8A 1QH9A 2B1JA 3IBCA 2ZRKA 3MTAA 1IN8A 5C53B 3INGA 2AFVA 4YFVA 4C6TB 2ZU6A 1LXCA 1YS9A 1ZUWA 4TSRA 1NW3A 3D3NA 4H60A 3DAPA 3F0TA 2B98A 4Q4DA 2C84A 4NBNA 2O06A 3BDVA 4H7DA 4PHGA 2QPOA 1CZRA 5K09A 4M0CA 2QTHA 5FR1A 2UKDA 5K6TA 4BO6A 1RP1A 3MAAC 4RORA 1LTHR 4ENQA 4ZI2A 2ECQA 5T8KC 3ICQB 1ZI9A 3I04A 1B74A 4F21A 3JARA 1M34A 2YZ7A 3UWOA 3I8SA 4WZAB 3MMSA 1UANA 1L7DA 1ZD9A 2GYVA 4ZREA 4M0LA 5K0SA 2BDEA 3A2NA 3CPJB 3PJGA 2WU3A 2Q0SA 1JWAB 1XRSB 2WF5A 4LE0A 4MUFA 4IS3A 3OZFA 2VRCA 3UGKA 1MG0A 1TOAA 3NAQA 4PYMA 2XXJA 1QG0A 2E37A 3D6HA 3NHPA 3OQVA 4MUNA 2DBVO 4ZCPA 4N8EA 4PX3A 1XRQA 3K94A 1I6MA 4I50A 1Q0QA 1W4BA 4XAQA 1ZM4A 3VU9A 4CF3A 4YYZA 5GJVC 4W5TA 2RGNC 3IPYA 3MGBA 3OZUA 3PIDA 1EINA 3OCJA 1BO6A 5TT0A 1EXWA 2A2ZA 2QMZA 3SQMA 3TSOA 4MV3A 1F20A 4NIMA 4P0QB 2RH8A 1V8BA 1NNUA 1PL0A 2NU9A 3IT0A 1CDDA 3AONB 3AY6A 3FSGA 4YUVA 2O7SA 1A3CA 1GT91 3PTZA 2W6PA 3ONWA 3S29A 3OJWA 4JLPA 4LTMA 1WXWA 4AY6A 3EFOA 3QUCA 4HNGA 3T7KA 4MDFA 4R8KA 1VB5A 3EEQA 3W8RA 1KZ9A 3V7FA 1U0OC 1ZK2A 4IIJF 3T94A 3D8NA 3RYTC 4ZOCA 4DNXA 2WTAA 2R00A 1D4AA 2D1YA 3VTFA 4UTRA 1M2WA 1I2ZA 3I72A 3CC8A 1WCYA 4C30A 2CF6A 3LIPA 5EJ8A 2ODEA 2A9QA 1V41E 2EJVA 1HSZA 1U2RA 5FBWB 2AN3A 1RRCA 4OA5A 3RTGA 5EG5A 1MFPA 4BO4A 3QP9A 1DEAA 1MHPA 2VWHA 3CVVA 3CRQA 3L8HA 1T4DA 3GFRA 3V33A 2P9FA 2R66A 1UUFA 4NDAA 1G291 5IJ9A 5M34A 5FPTA 1Y3CE 3W3AD 4DIDA 1C7QA 3GL9A 3HLKA 1I4OA 4ZMRA 1RQNA 1YKGA 3W90A 4QREA 4RDIA 4QHTA 2YZ2A 4LMRA 1EUCB 1I1HA 2CVZA 3PQCA 3UJ7A 2NO6A 4DLNA 3IRUA 1X6VA 4NCNA 1A4RA 1U3UA 4QXMA 3IDOA 3SN6A 4RM2A 4AS2A 2OKCA 2ZIXB 4BLOA 3P9RA 2IXEA 2VT2A 3DM5A 2ZU0C 4JJKA 4JP8A 2BE9A 4RZUA 1SWWA 4Z3KA 1FNCA 1UMCA 3HCBA 1J5XA 2FLKA 2D4HA 3V1NA 2QTCA 4LSZA 6ABPA 1CZKA 1E92A 1TRHA 2ZSBA 5DLPA 3IXMA 1N8SA 4OXXA 1XTTA 2V7VA 5KAMA 3FUWA 3FZYA 4R1OA 4FOOA 5D3QA 3D8UA 5D51S 2XR1A 4ND7A 4XWYA 3SSOA 3M5WA 5AESA 3FPCA 1U2QA 5CH3A 4ZOLB 2PJUA 4MGZR 3A1VA 1U3DA 3CKMA 3IQFA 1IXYA 1MOPA 1ECPA 1HZZC 3SKXA 1YA8A 2QTAA 3DBVO 4LTNA 4EQ6B 1NMYA 3QKUA 2WTEA 4HXYA 4N3CA 4WT7A 5DXJA 4EAAA 1M8JA 4JT8A 4J0KA 2RG7A 4ILKA 5CNMA 4Z1MA 1SHLA 2PPLA 4FFVA 3VTKA 3N2KA 5EJEA 4GOKA 2XECA 3BTVA 1NHGA 5IFKA 3AO0B 1YQDA 1FFWA 2VPXA 3MTBA 4H08A 5EJFA 5FUYA 1JSLA 1MNQA 4JXJA 4A92A 3LLCA 4BAGA 5KNCD 4RSMA 1OT3A 1T10A 2FSUA 3KCNA 4LDPA 2YN4A 4AW9A 2WVGA 2CT8A 3GZ4A 3ADCA 1H2ZA 4O2LA 4YMSA 2R7AA 3CZCA 3PGXA 2K4MA 2V4MA 4HY3A 5GGXA 5SV2A 4IIUA 1OCEA 1E8NA 2XQVA 3DKRA 3MAJA 3QBVA 2C3YA 4FEGA 5CNJA 1D2EA 3LHSA 3VC2A 4EY4A 1Y8RA 2Z2JA 5F21A 2BOVA 2VZ8A 3SKYA 2Z8ZA 4TXHA 4RX1A 3PQ3A 1PGPA 3ZGYA 2BKVA 1QRRA 1K5PA 2CHUA 2FFJA 2VDPB 3P0JA 1M1ZA 2C8LA 4OI4A 2Q5JA 4RQUA 5K3EA 2C5BA 2RGYA 4ETMA 2O1XA 3USES 4KPEC 4MLCA 4YCSA 2GEUA 3P9XA 4COOA 4D8VA 5BWBA 4BVKA 5KSZA 5LQKA 4C7OB 2NADA 3FYUC 3OEHA 2M6RA 2D1QA 3IEVA 1HO3A 2PMBA 3ZGZA 4CKBA 1M8PA 5HSGA 1T4CA 2LTAA 3WB9A 4NXMB 2F1RA 3MJSA 4QJBA 4QU8A 4BKQA 2WI8A 3MWJA 2V4UA 1CUFA 2J33A 2KPOA 4YMWA 3L7LA 1CNMA 5EXEA 3RREA 5FBQB 3WV4A 1SURA 1P6UA 2MYNA 3K1JA 3L5KA 4KLCA 3HE3A 1V4VA 1C0PA 3HFSA 4IBOA 5C3UA 2AFHE 4WZBB 4Z2AA 2PE5A 3FBGA 1A8UA 1UBRS 2P4EA 3E18A 1RYDA 5HTKA 3ZUGA 1AKWA 1XPJA 3KRTA 4EKDA 4UVGA 2XE6A 4IRXA 3MD9A 4A8TA 3IXLA 3BXEA 4OCZA 5DM2A 2HXYA 3VO8A 1KOFA 3LUKA 1PWYE 2R84A 2X4IA 5E95A 2COEA 4CF7A 4ENPA 1AKRA 2ZTMA 1NYRA 4MVJM 4HGQA 1ZMXA 2GRAA 3MNFA 1P3DA 2CFRA 3PQEA 2A9OA 4IW3B 4JQZA 3ENVA 4WKGA 1EP2B 1EB8A 4ALIA 5JCZA 4I4TA 4UOZA 1X7XA 2CL5A 3FKQA 5A71A 1PLLA 2H2GA 4B71A 3HYCA 4WV3A 1Q0PA 4HAUA 5KHAA 2YH2A 3R7SA 7ADHA 1N2EA 2W6QA 1GAJA 2ZJ7A 3R5SA 4QFMA 1QNFA 1Z34A 2NQTA 3MINB 1JMVA 2R7LA 3R5KA 1RLOA 3C15C 3W5UA 3WO1A 1GGFA 4LN1A 2JEZA 4YJGA 4AJPA 2IH5A 1X8JA 2WWWA 1P0PA 4R9UC 5G1NA 1Z7EA 5FEMA 1IK6A 1WV1A 4ESEA 4ARAA 5IDVA 1XZEA 2J3IA 2WQ7A 5LD2B 1IY9A 2ZRHA 3E58A 5CK5A 3DBHB 4AMZA 4M8LA 1EX9A 1L9XA 1NJGA 3OC0A 4FE4A 1T5BA 1S5PA 1U5AA 2HIMA 3DAGA 3H1BA 3LWDA 4ZAYA 1DEHA 5A9RA 1PSZA 4H4EA 2DWPA 3O84A 4MMYB 4UW9A 1AS3A 5DX0A 5EJMA 5DEOA 3V7UA 3LOUA 1LB1B 2F6RA 3NI2A 3KAKA 4HH0A 4ND6A 4C05A 2FXVA 1YL5A 1GPMA 1W2HA 1TPZA 1C7EA 1L5NA 3EGOA 4BZWA 3AF0A 1UBKS 4ZDIA 1GA4A 1JAZA 3IAFA 1ID1A 5TT1A 1J9ZA 5IAOA 3WIBA 5AJWA 3GF4A 3TFQA 1G7SA 2BGIA 4F5EA 3ESXA 4FGUA 5LP6A 4NK4A 4IEIA 3BCRA 2PLNA 2V8BA 3R3JA 4HRXA 2LDXA 2WD8A 3DCJA 2HK7A 4GC5A 4BP9A 2E3JA 2DOKA 3DW1X 4X0EA 3KLBA 1BW9B 5HKLA 3F1KA 3PNQA 3A4MA 1PR9A 5KYKA 1VE7A 3DBIA 3OAAD 4RK4A 4BX3A 5AVSA 1LVUA 1K4KA 2GARA 1Q1NA 2I3GA 5CLIA 3GFFA 3FLMA 4ALNA 3TBFA 5BSEA 2HZ7A 2WRZA 1XTBA 3DT6A 4W7HA 1AK2A 1V1MB 1CRLA 3ADDA 3QELB 4L85A 1X7GA 3OJXA 1Q83A 3QFRA 5F7JA 5L4LA 1SCKA 4WMLA 3ON5A 3RUFA 3LPLA 4MB0A 2DUMA 3F8TA 3LNTA 4M98A 2VTBA 3ZV3A 1B8VA 1XTSA 3DPIA 4GLOA 5FO0A 4NULA 1IVSA 2CWWA 3NTOA 4CIDA 3K32A 1J1UA 1HLGA 2BD0A 4IJKA 1RPAA 2GM3A 3QNWA 3CZAA 4OGWA 1O4VA 1OOEA 4PLWA 3B2EA 3QLUC 2YASA 5KKCA 3TI9A 2YJ5A 3OJFA 4WBNF 1Q5PA 3P2EA 1UAGA 3DAYA 2YICA 3L7OA 2IQIA 4JC5A 1NBHA 1IY1A 1WHTB 1XXHE 2Q5IA 4Y0VA 4Y6OA 2ONJA 4BCBA 4BX0A 5L7WA 1GXSB 4DA6A 4UQLA 5BR7A 1ZR4A 2XWJI 4G2TA 4YAGA 1XMOB 2FZCA 1XAHA 2UZ4A 3EGDB 1JFFB 3QLTA 3D0KA 4Z7QB 5B57C 3RT9A 4RY0A 3L7IA 4EB6A 2C7BA 1SQSA 4ZQIA 3ROXA 3ROEA 1A27A 4S24A 1U0NA 1T0BA 2WWHA 2WYWA 2ZT8A 4IICA 1AO3A 4LCJA 4CFSA 4NAUA 4KLAA 3DXZA 3FCXA 1TQ8A 1RBMA 4WK2B 3T5BA 2Z2ZA 1QU2A 3FGZA 1QOZA 4E5VA 2QY6A 3PPYA 1NRIA 4ZT7A 4P4NA 4DCGA 2VSQA 1ULHA 4F4HA 2PZJA 5A9SA 5ARCA 3FLEA 2RI6A 3HYSA 1QTNA 1NF9A 2OE2A 1E6UA 2HJRA 1E64A 1SHJA 1OXUA 1H2RS 3GGJA 2ONZA 1UOQA 2XMBA 1I94B 1PLKA 5F5XA 3ETEA 1O5IA 1G63A 2FF7A 2L2QA 2A92A 3K2IA 3O2QB 3VHRA 4ZHQB 1MTOA 1KDOA 2R2AA 2R3SA 2VOJA 2HD4A 3I0ZA 2A8YA 3H3FA 5KYWA 4XD7A 1CF9A 2E85A 4G5XA 3P2OA 2Z09A 5DWDA 2GTIA 1M8KA 1KMCA 4EKNB 1VCHA 2OMEA 3OICA 5F1YA 1DPFA 4K5QA 1T9BA 2A0UA 2HCBA 2UYOA 1WZNA 4IS2A 1IZ0A 3QA3E 3WWPA 1PR0A 4A16A 4Q21A 3E6AA 1H2BA 5CX4A 1CJSA 1XK7A 1HQCA 2C94A 3AWDA 2A9FA 5ERXA 2Q2VA 5BQOA 2XYPA 1J8FA 2JAQA 4TTTS 2Y71A 1K75A 3MQ2A 1NRWA 2PO5A 2XUAA 3MJVA 1GIAA 5KNLA 4UREA 1TZMA 3HY6A 2ZR0A 1K3FA 3EUWA 2RK4A 1KSGA 2CCJA 5HMMA 3K9LA 1LTKA 4ZHSA 3SR4A 1MABA 5FWDA 3GEIA 2QTWB 5E3HA 2OCYC 4L02A 2ERXA 4XW2A 5CX1A 1L5ZA 4DLVA 3ZQ6A 1UDRA 1FS6A 3L84A 3ORQA 5A3RA 3W4KA 3WIVA 3N2ZB 3FUUA 4NPCA 3SR3A 4YI3A 3N8IA 4I55F 4M1TA 1JXMA 3I2JA 3DUFB 4BHTA 3EY4A 4JYPA 2QT0A 2PS3A 5DCYA 1CB0A 1Y3BE 2Q3EA 3HV0A 2QUJA 3QOYA 2PT7A 3L43A 3FFTA 3UCFA 1Z88A 1CUIA 1U3TA 1J97A 1GRCA 1K8RA 1ZOIA 2PV7A 1Q95A 2X2FA 1C4KA 2EZ4A 3KJZA 2I9KA 3HI4A 1B42A 4GPBA 2A7XA 2L69A 4Q37A 4YV0A 2PGDA 1JHZA 2BSXA 3DBLB 4GSYA 4WXHA 3FVTA 2NYUA 5F2OA 3SQNA 2LCFA 4FQ5A 1X1RA 1AV6A 1A9QA 4J49A 1Y7TA 3IMFA 3NB0A 1NBME 3CLKA 4AULA 3P94A 2H06A 1C7FA 2CK3D 1ISFA 2EBFX 4X6UA 1BAPA 2Q6IA 1IBKB 3DQQA 1DAEA 1WPGA 2FY8A 2WWGA 4HVCA 3BL6A 3MTEA 1HTTA 3TNJA 4FLEA 4YTEA 3TLKA 1NLMA 4P4GA 4Q4HA 4QIHA 4S12A 3UZUA 2WD7A 1TUEA 3W5JA 4KQ6A 4LZZA 1YS6A 3QVKA 4FDLA 3SS9X 3TW8B 2BP7B 2ISSD 3KU1A 1XL0A 1R50A 1O3YA 3AHHA 3GRAA 5C4GB 1MLDA 5EQTA 3X2EA 3NKFA 1PFVA 2QTMA 1GR1A 1QO9A 1S1MA 2OFPA 2QX8A 1RU3A 1EX6A 5I45A 3DZCA 3N0TA 4HEQA 1MW8X 3L6DA 3X2SA 2L0XA 3KLOA 2ZB2A 5C52B 1MX9A 1FYWA 2Z43A 1YCDA 2C59A 4NCIA 2B9VA 1VI6A 1NKVA 4HAZA 4Y2JA 4DDUA 4FILA 5IYZF 3QKSB 4JC4A 3TL3A 4YRFA 2ZYGA 2IIBA 3Q98A 3UHPA 2V7GA 3EHEA 2QWXA 4LZAA 3AVVA 2CB9A 2PH3A 2X1HA 2FPKA 1DEKA 2BGRA 4WY8A 4TYYA 4F72A 3VSAA 2EQ5A 4IFEA 3QUSA 2FMXA 4WVFA 3TI7A 2PHZA 2DX7A 2VTVA 2W8BB 4GP7A 4KPGA 4RMHA 2G7ZA 4AVYA 4DYHA 5DW0A 3ESRA 4PSAA 4JVMA 4G5GA 2IYZA 1QYCA 1TEXA 2O48X 4NR0A 3TDNA 4UHJA 5MN6A 3GFQA 4WSOA 3IUNA 4ARVA 1QU3A 2B83A 5CG1A 2FRDA 1NT4A 1K7FB 1P2DA 1U65A 4RFLA 4OUDB 1NOKA 1HA3A 1XEXB 1J23A 1R0ZA 3A7EA 4MIOA 3VH4A 3EXIB 3NDJA 1U4OA 4PO3X 1SRRA 4DA0A 2JVKA 5KU1A 3HKBA 4QGHA 1DFGA 1L5QA 2DQZA 1XMVA 3RYCA 3WGTA 2ASEA 2DQ4A 5JYCA 2X42A 2PTHA 3LQKA 2F3UA 5EHIA 1W47A 1PFYA 3A9WA 3R7LA 4TMYA 4FFWA 3PE6A 2XUIA 3VR4A 4PVCA 4RLSA 4XX0A 4ZTBA 2UVQA 3K4HA 4RK0A 3TUZC 2D00A 3O74A 2C92A 2VHCA 3JQPA 1Z5WA 3P5SA 3VPBA 1NUAA 1XRNA 3HN6A 3J7AC 4GLJA 5CVCA 4BDTA 4DT1A 4K1XA 1ST2A 3DPSA 4L2IB 1EX7A 2PD4A 5DHSA 4A1FA 4H7JA 1N57A 2ZWMA 5ECWA 3X1XA 1IC6A 3VHXB 4G67A 1RBZA 3AYXB 1DRUA 3BM5A 3KP1A 4U02A 5CUQA 3UEOA 3W6ZA 3MGCA 2JNWA 3WDSA 4NOLA 3EPHA 1SNYA 1R0BA 1UXJA 1YOVA 1KQPA 4GF5A 3E9NA 2ZB7A 1FL9A 4FD3A 2YFKA 1YZYA 1NAHA 3G0GA 2WG1A 5E6SB 4DSUA 1TVKB 4TT8A 4GOND 1QGDA 3PQ8A 2CBZA 5BVGA 3D6MA 4PR0A 3NNDA 3ET4A 2EJWA 3ZQKA 1M2VB 3IQDB 3EIUA 4IQ8A 1G55A 4P4LA 3G85A 2V1XA 5AI4A 2ATIA 1L3BA 4BP8A 3E2PA 3T5CA 4ACBA 3D4IA 2C97A 3LPAA 3SQOA 4KWCA 4AJKA 2IFTA 2H5JA 2PH5A 1YR3A 2P6UA 4IQGA 4WE3A 4XEHA 5AI5A 1AKNA 1Y0BA 2YJ3A 4KE9A 4BBAA 4YAIA 5C1PA 4U4AA 4II7A 4ZI5A 4FNMA 1JQKA 2WSSA 4P3XA 4F9TA 4TRMA 3ZE1B 1YD7A 1YR9A 1S9HA 3T52A 2I67A 4AP5A 4D44A 4G09A 1E9VA 1L5VA 2XOXA 3QV1A 4GP6A 1K0UA 3O4GA 5JROA 5KQMA 4EUKA 4JBHA 1IH8A 2GZSA 2ZJ0A 3VZRA 3DDWA 1T24A 4BB9A 3MHTA 4M8IA 5ADVA 121PA 1AN0A 1KH2A 5JNSA 3R0JA 3QQPA 5HJEA 4JJ4A 1J8YF 1AGYA 5LQRA 4NCBA 1DMRA 1L7PA 1TJ3A 2GLXA 1KY4A 1ZZEA 2W2NA 3D4PA 3KTFA 5KPDA 1NW9B 5EIAA 3A6JA 4LXYA 1Z73A 5FPHA 1A7AA 4TYNA 2GEDA 4Q9HA 3ZCPA 4GM1A 5B6JA 1COZA 1E7WA 1EYZA 1TYEB 1XWFA 4Q3EA 1VL6A 5DXAA 3V48A 2CV0A 2F43B 2FW0A 3ETNA 4DCJA 4RZXA 4EITA 2HO4A 1CRQA 5IJ0A 3O8RA 4DRZA 4ND8A 4QRHA 2I2XB 2IZ0A 2HA4A 4DUGD 4KE7A 2Q9CA 1TPYA 1G8JA 3IJPA 1EE1A 1T3GA 2C5AA 2GM9A 3IIIA 3IUMA 3JATA 3D8BA 2P67A 3NPMA 3ZWPA 2R86A 4FCTA 3O8OA 4AKHA 1TKCA 3KT6A 3JPYA 5C46F 1XIVA 2DULA 5NULA 3K9GA 4LMBA 3CUVA 4QYIB 2XOEA 4FYVA 4DLSA 1QH8B 3AP1A 3HFJA 4G9EA 4JB8A 4LIPD 3WG9A 5A7FA 2Q21A 1DIBA 1GL6A 1P2SA 1T8YA 2I1VB 2JIZA 1P8AA 2XW6A 4NBUA 1OWPA 2C7RA 4QOGA 1X87A 5HE9A 4D7AA 4LXXA 4EPYA 3U5TA 1DWUA 1G8SA 5GJCA 3DXXA 1A7UA 1P1HA 3NAMA 1BNCA 1LRKA 3I3OA 4NSNA 1H05A 1X92A 1NWHA 4RSHA 1YZHA 1ZJZA 2HJ9A 4X00A 3LDFA 3WNBA 2PYIA 3FCCA 4XH9B 3I2IA 4ZA2A 4YRRA 4CFYA 1ZUD1 2AEFA 5L7YA 2VJBA 5BOSB 1KVUA 1D5CA 2AE1A 3E7PA 4Y2TA 4CKEA 5K05A 1AMNA 2YJNA 5I5GA 2VYVA 2B37A 3D4BA 4LC9A 5ABPA 5DSTA 1EA5A 1G98A 3NHYA 1N1MA 2QB5A 3H19A 2I6SA 3W9UA 1BXKA 1QVWA 5I6DA 4J1QA 3OIUA 2DT5A 3LVQE 4HX5A 4JX9A 1CJTC 1H22A 5JQWA 1MVLA 1P3JA 3MXOA 2H8GA 2HNAA 3W2EA 4EOGA 1G6OA 1Z13A 1Z7WA 2CLOB 2IP4A 3KOOA 3QI7A 4TV8B 5ALEA 5DT9A 1QH0A 5J4HA 1TXGA 3BN3A 3SSAA 2VXCA 2C2XA 4W9NC 3FNQA 4PY2A 3CLRD 3W1VA 2IHJA 4U39A 3FHLA 2X6RA 3A9RA 2PH1A 4IIDA 1WXHA 1RWNA 3CRMA 5B12A 1OYVA 1K6XA 2FSVA 2OCLA 3NJ8A 1BQ3A 1QFXA 3D5TA 4U2FA 2ZPUA 4XDGA 4EHAA 1GSIA 3DYIA 6Q21A 2J0QA 5DTMA 5F12A 3DYBA 1R0SA 4TUYF 2GVZC 1ZUNB 2WWVD 3RUAA 2G3YA 3VU8A 1DT3A 2F59A 2ZRBA 1WF3A 5BYJA 3QEBZ 2XNCA 1JG4A 3IIKA 2IXFA 2WUVA 1Z6TA 3T5TA 3W5DA 2RHOA 3BXXA 3DAFA 1OLSB 1RBQA 2PRZA 2W2OA 1VG1A 4OXKA 3W2IA 1YA6A 4YH1A 1ZD2P 2FZLA 3KWJA 4RZHA 5FHRA 3UA3A 2UYQA 4RHTA 1M0TA 4MDYA 1N9GB 2VPPA 3KPWA 3IOYA 2W37A 1JFLA 4TKUA 4A5SA 2GCOB 5L4SA 2DE0X 4KQKA 1OXMA 3EWNA 2NU8B 5JAOA 3RYHB 4RA9B 2QT1A 2XD4A 4RK6A 1F7VA 2NUBA 3HCAA 3OVMA 4GR9A 1KXZA 4PG6A 1DJQA 1I5OA 3PFIA 4AKGA 1YR1A 4DR2B 4FXPA 4DJEC 5I7VA 1DMSA 2BEJA 1ZW1A 1VKNA 1BWQA 1E6CA 1F0NA 2FPPB 2HSEA 2P4SA 2ZSFA 3G2JA 5BWCA 5AK4A 1W1WA 3N74A 4JOBA 1FRQA 2GVNA 2NU7B 2OC4A 3E1GA 4FP9A 4AQDA 1N2JA 5KMGB 1OAOA 3EZ6A 4RF3A 5KYUA 1UBHS 2C2ZA 2RMKA 3SHWA 4AJHA 1XZIA 5IC5A 1PLJA 1L4MA 1U2ZA 2GZHA 5FWYB 1L5HA 5B6PA 3EJWA 5CFMA 2XXAB 5DYWA 1PZGA 1TW2A 5AM1A 4TLLB 4WK4B 3T3DA 3I09A 4F9EA 2W42A 3ICEA 3JW8A 3LRXA 1BTOA 3BFXA 4E2XA 2FPGB 2NO9A 1WQ4A 2QN6A 2ZI9A 4JLUA 3F49S 3F47A 4WH0A 4YQFA 4FM9A 1SUWA 3DW3X 1QPGA 3N7TA 4M86A 5A5GA 2DPHA 3RSZA 1E3DA 4F7WA 4BYMA 4WD3A 4ATNA 5JS8A 1Y5IA 2QXUA 3FOAA 2V98A 4TV9A 3MWLA 4LX0A 1JXQA 2QJOA 2CFOA 3DVAB 3JQGB 3M6IA 3RFVA 4CV3A 1K7SN 3AEYA 3BMXA 5B55A 4KOAA 4FB4A 1IBSA 4CHGA 3I9JA 4RL4A 3NDRA 3QHAA 2G1PA 4INPA 2C7PA 1DRWA 1LFAA 1OFUX 2VF8A 5JNWA 3LE8A 3GBVA 4N54A 3Q3VA 1TUBB 3QX8A 3GLIA 1FMFA 1X1TA 1D2HA 4MP6A 1ZCBA 2HEGA 1SIWA 4KYVA 3B3AA 4S04A 1U7TA 2JPDA 1MJGM 1NN1A 4BMXA 3OY2A 3CX4A 2XUGA 3ETLA 3QXJA 1ZU5A 1VFPA 5E6RA 1YZFA 4C3ZA 3FZNA 1S3GA 2PQ2A 4TQGA 4Q3AA 3REOA 4EHJA 1ZVVA 3KYCA 2XYVA 2HT6A 3TRKA 4LXQA 3KQWA 4BLUA 3RJ9A 4QHSA 5KI6A 2FPSA 2JJ1A 2P6OA 5ESDA 2ILVA 4UM9D 1LDNA 1VOTA 4EUNA 2G7MC 3RRZA 5B58T 2VDQB 1FTNA 5BW6B 5D8DA 2R48A 5FPQA 1T6YA 3VU1A 3CLUC 5NLLA 1E0AA 2X23A 1ECJA 1GYPA 2UDPA 4DGQA 1XYYA 4E12A 5DFAA 1UINA 2FFRA 2EEPA 2LD4A 2W6JA 3AWIA 3CB2A 3D6UA 4Z9AA 4BQOA 5AM0A 1IVYA 3ZV5A 1QX4A 2QKYA 1PL8A 2ZYUX 4JS0A 2AFHA 1T9ZA 4Z0HO 4QDOA 2O0MA 4RQBA 4AN0A 5ITWA 5LR6A 4AF7A 4FHGA 3NFYA 4L4ZA 5ALTA 4HWGA 2IHVA 4UUNA 3UAXA 4MVCA 1GYRA 3BWEA 1OF1A 2RC6A 3MWYW 3QWBA 4TTRA 4V38A 4UMVA 3U56A 3WHPA 1L0BA 2WOJA 5JYDA 1SRQA 1VYHA 4EL5A 1KO8A 1UBMS 4BBJA 3L0BA 5TQ2B 2BKEA 3DH0A 3U3RA 1V71A 2EOAA 4C2UA 1YACA 2HV9A 4Y2YA 1P45A 2Q5LA 3DKIA 4KNWA 4OP3A 4KN8A 4S35A 1DIOB 5LFAA 2V7TA 3BD7A 3N2EA 4MAFA 4CN9A 2P2YA 5DEIA 3ZJUA 4C21A 3DOEA 3FTPA 4MW9A 4V3CA 4M1EA 4HFNA 4X8MA 4DMUB 2YQZA 3O47A 4KAXA 2MR6A 3D4NA 3PDUA 4RTKA 4Q3NA 3HJCA 1Q14A 2YJGA 3ICPA 4FBLA 3KR0A 1SUIA 2CLHB 2YV3A 3EAFA 4LF4B 2CSUA 3OO1A 5T3UA 1G2QA 2QX4A 4FKBA 4KIWA 3GLFE 3BXZA 4RVDA 4UTOA 2DJ5A 3K0FA 4ETWA 1YZKA 5KS2A 2XDAA 2I2AA 3C2QA 2ZRMA 1XRPA 2WYVA 3GIDA 3U62A 1DTWB 2VHUA 4QLBA 1WA5A 5FPYA 5EKDA 3KKLA 2V3CC 5ER9A 1AZWA 4RF4A 3UFBA 4ZJUA 3I23A 5F7OA 3PLAE 2FQXA 2ZI4A 1NV9A 3D8SA 4YACA 3I6MA 3PLRA 5DBEX 2BN4A 3GPIA 3T6KA 1W5SA 1OX4A 2ZBPA 1FU7A 3HNPA 1ISMA 2AF4C 4X6XA 4IGAA 3HFGA 5E7QA 2VF4X 3E3OA 4LWOA 3UGJA 2B8EA 1XT6A 2O2IA 1B6RA 4A0RA 4X65B 2NM0A 2WZDA 5HGXA 3ZE8A 3P20A 2AC2A 1U81A 2I1LA 4YAFA 4B6PA 4C89A 4WLEA 4PAOA 2PQMA 2V0NA 1OXXK 1M34B 3JARB 1DIRA 2ZS7A 2Q3HA 3FWHA 3R40A 1YR2A 4QVGA 2VN8A 4HR7A 4UXHA 2HPVA 2HDOA 3NX4A 1E2UA 4HN4B 3DS8A 4Y67A 5FNVF 2CKMA 1UR5A 1QTRA 3A10A 1TD1A 3SYLA 2VAWA 4P2BA 5GMOA 2Z5LA 3QF4A 3T5PA 1FLNA 5EAIA 4JLAA 3SVTA 2GEVA 1DUSA 1I0LA 3BRSA 3PKIA 3WLNA 5K7SA 2Z58A 1LBHA 4C4OA 1E9AA 1O08A 1JR3D 3NC0C 3OCUA 2JCVA 2RHRA 4LEIA 1CUJA 4EHDA 1SUAA 2F00A 4I50B 1JQDA 4XDHA 4CQMA 1PK8A 2IHNA 1JEJA 2EX4A 1CY2A 2Z8XA 2PEZA 4BRUA 1B1CA 2D1RA 1M1UA 2BI4A 3BTOA 3COZA 3TVYA 1UODA 5CURA 3R24A 1CEQA 3DULA 3M5DA 1ZJ5A 1XFDA 1XZPA 3OIDA 3P9YA 2HO5A 1D2AA 2XZPA 2YHBA 2FK8A 3FB4A 1ZBDA 3LT0A 4OUKX 2XKBA 1ZX1A 2CLDX 1JDZA 1XXHA 3DZFA 4TXLA 2NU9B 4G8BA 4UU0A 3SYMA 4GWKA 1E0JA 4EG3A 5FBVB 3QWIA 1W52X 3MWKA 1V0JA 1Z6YA 4LI0A 4MK4A 3N2LA 3EFOB 4CIAA 2HYIC 3CFYA 2MCFA 1P9OA 3K1AA 3RANA 4GOMD 3FSJX 3MCWA 1UL1X 1KIMA 2AH5A 3A6GA 3IXQA 4ASUA 1CDEA 1Z4KA 2HJWA 4WADA 5BW5A 5FBHA 4YQZA 4AAYA 3S28A 4MW5A 2JI9A 4QOFA 1SQFA 5JJ5A 2AZDA 1T4GA 3GLRA 3ND6A 4MRPA 2FAXA 3BD9A 4I2VA 2I66A 4LECA 2J1LA 5KQPA 3AZOA 2J9XB 2QLJA 1SUCA 3NTQA 4CMGA 2CYAA 1L7BA 2H5EA 1AS0A 2OHFA 3KOMA 4M6WB 2I99A 1I2DA 2D5BA 2D0IA 4L9AA 5JNUA 2ZG6A 4WN9A 3ZU2A 3HB0A 5IJ9B 2EARA 1K8QA 3H9JA 4TL8A 1FP4A 2IEGA 1W59A 2P3OA 4C2BA 2OBLA 5TB5A 3AQIA 3RVDA 4Q6WA 3LV8A 4JKIA 1ISJA 1G7CA 4K86A 4KMOA 3RUCA 2GDJA 3V6MA 1PQYA 4EFKA 1KK1A 4GPTA 3WLJA 1E1RA 1S2OA 3JU3A 4KUEA 1YR6A 4LHXA 5BR4A 1NXOA 2Z2IA 3OESA 2P7HA 3OWHA 5G0TA 1UMCB 3GPCA 4MV8A 4ZDKA 1TKBA 1YXMA 1V8FA 3I1FA 3C8ZA 3SPXA 3G9ZA 3RIMA 4DDKA 1Z5OA 1CY7A 4FQ8A 3SBXA 5JDIA 3CONA 4TTPA 3HVKA 4U1RA 3FCOA 1ZN7A 1DI0A 4V02A 3BMCA 2O1WA 2ZR7A 4O4HF 4IDNA 4OGGA 5ALVA 1BEZA 1BJTA 1YA4A 3AYZB 2EZTA 2IYTA 5KQLA 2RGCA 3A9VA 3L1JA 4U63A 4X64B 1RC8A 4LFAB 1PJBA 2P5UA 2XWBF 3O8BA 4JIGA 4OQEA 4BJHB 4GOOD 1HQKA 3ETDA 3H0EA 4I6EA 4LW8A 4PO1A 4PLPA 2W93A 4P4UA 2VT7A 5FRDA 5J9FA 1I4TD