4GOND

Crystal structure of e. coli dna adenine methyltransferase in complex with indole aza-sam
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
268
structure length
243
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Selective N-6 adenine methyltransferase Inhibition by Transition State Mimic
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA adenine methylase
total genus 82
structure length 243
sequence length 268
chains with identical sequence E, F
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4gonD02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4gonD01
2UYQA 4L7VA 1XDUA 2F8LA 4HGYA 1IM8A 4MTLA 1FBNA 5E2BA 2AVNA 2NXNA 3M6UA 3MCZA 4C07A 4PYJA 4RTKA 2QRVA 3EPPA 3KR2A 3O31A 4RTLA 4Z2YA 3ME5A 2PWPA 1G60A 2B3TA 2WK1A 3VSEA 3LCVB 2VDUE 3GGDA 2Z6QA 2O06A 2AZTA 3A25A 5EIWA 2EFJA 5DTRA 2VZ9A 3LL7A 2IH5A 3BXOA 1VE3A 4RX1A 2OYRA 1P1CA 1ZGAA 1N2XA 3OU7A 4YMGA 1Q0SA 3B89A 1JG2A 4HSGA 1RJGA 5FADA 4A6EA 2ORED 2VDVE 4FSDA 5FQOA 2B78A 5E8RA 1KHHA 4BP3A 1I4WA 3ID6C 5EC8A 2C7QA 3EEYA 1WXXA 1YZHA 2XYRA 1BHJA 4P58A 3B7PA 4RTRA 3CC8A 4X61A 5CVVA 2PY6A 2XYQA 1M6YA 3PS9A 4AZVA 3BUSA 5KQSA 3AXTA 1IY9A 3UBTA 4RYLA 3H2BA 1AV6A 1G38A 3UJ6A 3KPVA 3SM3A 4GOLD 3ER8A 5F2OA 3JWHA 5DXAA 2QY6A 3R3HA 4KDRA 4BLUA 3O4FA 5D1NA 4MHTA 4HG2A 3SGLA 2ONZA 3DULA 1KXZA 1XDZA 2BR4A 5E2AA 2P7IA 5BW5A 3IHTA 3DOUA 5HIJA 3LDUA 1XCJA 2N47A 1JQEA 4BLVA 2OKCA 3HA7A 1L3CA 3Q87B 3CCFA 4V0RA 3SX0A 3V97A 2BH2A 4AZWA 4M38A 2H00A 3LHDA 2NP6A 3G2OA 5FHRA 5DM4A 3I5UA 3G2QA 4MWZA 2JHAA 4X63A 5FULA 2Y1XA 1Y8CA 4F86A 3MQ2A 3HCAA 5ERGB 3PB3A 4PYNA 3EGEA 5EGSA 2AOUB 2PXXA 2P1DA 2AOUA 3HCBA 3V8VA 3CJTA 4C04A 3R6TA 1L1EA 3FTFA 1X19A 5DTMA 2PXCA 3E23A 4YUZA 4X1OA 3NWEA 5HIMA 5U4XA 2BM9A 2P3OA 3IEIA 2Z6AA 4PGHA 4FT4A 4QVGA 5E9QA 2YTZA 3LBYA 3NDJA 2G1PA 4R8SA 3DUWA 1NW7A 1ZKDA 2IDJA 3NDIA 4OBWA 4GOMD 4ER7A 1EJ0A 4FS8A 5H02A 4E32A 3BKXA 5LQKA 4F84A 2UYCA 4OA8A 5KVAA 4DCMA 3FUXA 2OPBA 2IBTA 5GWXA 1ZHFA 3TRKA 3KR1A 2AN3A 4KRGA 2GS9A 1M6EX 4E2YA 3MTIA 5CM2Z 2FK7A 3D2LA 5GM1A 2ONYA 4ER5A 3HVJA 1SUSA 1P39A 4QPPA 4YV0A 3I58A 5K0GA 5FTWA 4LECA 3I64A 3THRA 2PX2A 2XVMA 1NV9A 1KPHA 2BM8A 5FQNA 2Q41A 4V0QA 3OZSA 1L9KA 2AN5A 3THSA 3KPJA 3C6MA 5CVUA 1RJDA 4FR0A 4PYMA 3EGIA 2GPYA 3P2EA 3GIWA 2CL5A 5DX8A 3ANXA 1WXWA 1BOOA 1VQ1A 1QYRA 2PWYA 2HTEA 2ZBQA 3KR0A 4PONA 5FA5A 5IH3A 4XUDA 2HR1A 4GEKA 1NKVA 3MTEA 2AOVA 5HIKA 1ORIA 4WXHA 3GRYA 3GRZA 1ZG3A 3S68A 4PYIA 2ZBRA 3KPYA 2GA9A 5HOQA 3B3GA 2ZZKA 5DSTA 3GRUA 3M6VA 4HGZA 2JH9A 5E9JA 1NT2A 1ORHA 3GCZA 1SUIA 2AOTA 2ZLBA 3GNLA 4IWNA 5E1MA 2AVDA 2BR3A 3TOSA 2UZ4A 4BY9E 1X1AA 1MJFA 1D2CA 3KQYA 3RW9A 2BR5A 10MHA 1FJXA 3G7UA 3AXSA 2P35A 3BWBA 3MHTA 5ICFA 5BP7A 5HFJA 1G8SA 1KYZA 2O0LA 2V74B 1QAMA 5JUWA 3SSMA 5KQRA 3G8BA 4FP9A 1I9GA 3KQTA 3BWMA 4Y30A 5DM2A 4A6DA 2JHCA 4PINA 4FSXA 5K0NA 2NXCA 2NNWB 2WA1A 4YUVA 2IP2A 3A7EA 1RJEA 4OX9Y 5DM0A 4H0NA 2AOXA 1XCLA 2P40A 1MHTA 1AF7A 3BGVA 3NJRA 2NP7A 3I53A 3BWCA 3M6XA 4QTUB 4X60A 5T6BA 3GJYA 5EPEA 3T0IA 4C03A 2C7PA 5EMMA 1JG4A 4PIMA 4C4AA 2IGTA 5JR3A 3FUTA 3OCJA 3TMAA 4BP1A 5GINE 1BC5A 1SQFA 2HMYB 3F4KA 1EG2A 3HCFA 3IYLW 3LCUA 4KW7A 4PYOA 4R6XA 3JWIA 5HILA 3VYWA 2I62A 3PT9A 5K0FA 3G5LA 2ZZMA 3P71T 3M6WA 2EJUA 1YFJA 1IXKA 5CCXA 4CTKA 4YUYA 3T7RA 5P8WA 2XBMA 4B17A 3HVIA 2DULA 4ATNA 4E31A 4KDCA 3LPMA 2IBSA 2ESRA 1B42A 3X0DA 2HV9A 2Z6UA 1EQAA 1EJ6A 4HRAA 9MHTA 3KQWA 2ZWVA 4PYKA 2B9EA 1EIZA 2YXDA 3FPHA 3MAGA 3R0QA 1AQJA 3FUUA 2FYTA 4GOOD 3HCDA 1VBFA 2PV0A 3MERA 3DMFA 3NW9A 5G02A 1RJFA 4KIFA 3UFBA 3UJDA 5DRTA 1WG8A 1P1BA 3HM2A 5DRYA 1XDSA 3UA3A 5LQUA 3OU6A 3OZRA 2VP3A 2PKWA 3OU2A 3TM4A 3OFKA 4RTJA 3M70A 2PGXA 5C0OE 3BWYA 4ISCA 2QE6A 5B1SA 3ELWA 3EVZA 3NWBA 1P91A 3FZGA 4PWYA 3SSNA 3FPGA 3KKZA 4EKIA 3HVHA 2PX4A 3LBFA 4RSRA 7MHTA 2I9KA 1QAOA 3NVMB 1O9HA 1FPQA 2GLUA 2AOWA 5DX0A 4E2WA 3DMGA 3UJBA 2Y1WA 4CTJA 5GIPE 5K01A 3KQVA 2EX4A 4QQNA 3KQOA 2IH4A 3ELDA 3TFWA 5HEKA 1R8YA 1YUBA 2ADMA 4AZTA 3G8AA 2G71A 5FWDA 2ZIFA 3FUWA 5DWQA 5EEGA 5FWAA 5K05A 4OBXA 3C6KA 5E1BA 1G8AA 3R9XB 1AQIA 1N7JA 4ER3A 1L3IA 3EVFA 1QAQA 3CJRA 3FPFA 2FRXA 1T43A 2IDKA 2ZIEA 4UOEA 4CKCA 1O54A 5CCBA 2CMHA 1NBIA 1QZZA 4R6WA 2K4MA 3DP7A 3HA5A 2IIPA 2R6ZA 2R3SA 3CGGA 4HTFA 1XTPA 3AY0A 2CKDA 1KPGA 3E7PA 3EMDA 4O29A 3PVCA 4EKGA 4PGGA 3PFGA 3QV2A 2CMGA 1VIDA 3SMQA 3EVCA 3KR9A 4AUKA 4EMSA 1DL5A 1OR8A 3B3FA 5DSXA 4M36A 4GC5A 1YFLA 2YXLA 2PXAA 5LQRA 3DLCA 4MIKA 3BGIA 3DXXA 4E33A 1VPTA 5K0CA 3KQMA 1JG1A 2XYVA 3NTVA 4XCXA 2GB4A 3VC1A 3ELYA 3KU1A 5DTQA 5EEHA 1PRYA 1R00A 3UA4A 4YV2A 2ZVJA 2IH2A 1F38A 5E9WA 1ZGJA 5CD1A 4PCAA 3G2PA 4E30A 5CIYA 1X1CA 5M5BA 3LCCA 2I6GA 1O9GA 2EJTA 4HTFB 2YUIA 3VC2A 2ZULA 3UJCA 3IV6A 1X1DA 1ZQ9A 3DLIA 3P9IA 3RIEA 2AOTB 3NMUF 5K0EA 4ER6A 2PT6A 4MQ4A 2YQZA 3EMBA 4XUEA 2JHPA 1JSXA 2O05A 2PSSA 4IV8A 5BW4A 3KPWA 1R8XA 3G89A 3MCTA 4RTSA 3DR5A 1F3LA 4GOND 2O07A 5EIFA 2YVLA 4M37A 3TKYA 3UJ9A 2GAFA 3M33A 4OA5A 5EMJA 4E2XA 3LSTA 1NW6A 2XVAA 2YR0A 2AN4A 5EMLA 4P7FA 4ER0A 4R05A 1XXLA 4OQEA 2OXTA 3GRVA 3TLJA 5CVEA 5HZMA 2FCAA 1Q0TA 2NYUA 2CWWA 2P7HA 3FTCA 1KR5A 3SR4A 1NBHA 1RI5A 3A26A 3LDFA 5CVJA 3T7TA 3C3YA 1YF3A 5EVJA 1UFKA 3AJDA 3UJAA 4OQDA 3FPEA 1WS6A 5EMKA 3TPZA 5EOVA 3ERCA 3A7DA 4P7JA 2ZZNA 3BGDA 5ICEA 5ICGA 4U7TB 3FRHA 5K0BA 5DT2A 5K09A 3EGVA 3GWZA 4GQBA 2G72A 2GH1A 2ZWAA 4JXJA 5DPMA 2A14A 2IPXA 2E5WA 3SVZA 2VS1A 4RVHA 4ZTBA 3T7SA 4F85A 4RVGA 2H11A 4AX8A 2FHPA 4GF5A 3C0KA 4CKEA 3DXYA 2I7CA 2YX1A 3EVEA 3G88A 3HCEA 3MGGA 5F2KA 3REOA 5C1IA 4C06A 5E1OA 3U81A 5E1DA 2PJDA 1YZ3A 1M0EA 2PLWA 4CXMA 2P8JA 2QYOA 1QANA 1H1DA 3B3JA 2PX5A 4KVZA 5KS2A 3B5IA 4DKJA 2YXEA 1JTEA 2NXEA 3O7WA 4E70A 3KHKA 1UIRA 3BZBA 3MB5A 3P97A 3FRIA 3OE4A 5IKMA 4DZRA 1N7IA 1JG3A 3HEMA 3LDGA 3P8ZA 5CVDA 3TQSA 3PTAA 2ZTHA 2PX8A 3CVOA 3DMHA 4QDJA 4BLWA 3ER9A 3P2KA 5DLYA 3FUVA 1JQDA 2PT9A 2FK8A 3GXOA 4RTMA 4U7PB 3P9KA 2AR0A 1DUSA 3EVAA 2QM3A 1R74A 1X1BA 3LGAA 2B2CA 2C7OA 1VP3A 3KQQA 1R18A 3GRRA 4IKPA 4QVKA 5EG5A 2ZBPA 5T67A 5EHIA 3DXZA 1FP1D 3PX2A 3G2MA 2EG5A 4DA4A 3P9CA 2ZCJA 2UYOA 3EVBA 3FYCA 3G5TA 3LECA 8MHTA 3OE5A 2HNKA 1RI1A 1G6Q1 1PJZA 2G70A 4K6MA 3NVKI 3KQPA 3UJ8A 2O57A 3EEOA 5LQJA 2ZSUA 3LX6A 1Z3CA 3GO4A 2P41A 3LKZA 1HMYA 2JH8A 3EVGA 1VL5A 3OPNA 5EQJB 1JTFA 5DXJA 2OB1A 1RI2A 1XJ5A 4R8RA 5K0JA 5LQAA 4PCLA 3DH0A 3PLAE 1SKMA 4GBED 3M4XA 5GOZA 5FCDA 1U2ZA 3HNRA 3HTXA 1RI3A 3P2IA 3CJQA 1EAMA 5BXYA 2G8NA 4M7RA 3E05A 5CUQA 4RTNA 3K6RA 2HWKA 2VDWA 3A27A 3L8DA 1KYWA 2ZFUA 4P7KA 2NXJA 3OZTA 1NW3A 4YV1A 1WZNA 3WSTA 2OB2A 3SXJA 1SQGA 2PVCA 1JR4A 2KW5A 4P7GA 4CWAA 3FYDA 4RWZA 2P3LA 5EZSA 1KP9A 4C08A 1VLMA 5FHQA 3E8SA 3HA3A 4CKBA 3TM5A 3TR6A 5EZQA 4RTOA 1JQ3A 4C05A 4PNEA 5C9ZA 1VP9A 4YUXA 2DPMA 1YB2A 2BZGA 3HP7A 3OFJA 3TKAA 1TW2A 1NW8A 1RI4A 4QPNA 4POOA 5K8VA 2OZVA 4PYLA 1R6AA 3Q7EA 3HVKA 4G56A 3PX3A 4RV9A 4E2ZA 3ELUA 4YUWA 2V7EA 5FA8A 2P3QA 4QQKA 4X41A 3I9FA 5ICCA 5MHTA 4NECA 4LWOA 2UYHA 3EVDA 2B25A 1XVAA 2JJQA 2WA2A 3LKDA 4LG1A 4LWPA 4XUCA 4FGZA 3P9NA 2ZW9A 2OBFA 3UJ7A 1NV8A 2H1RA 2JG3A 1KIAA 2OO3A 5K0LA 3SSOA 1TW3A 3ORHA 3DTNA 1WY7A 3RODA 5T64A 4QTTB 5LR6A 5LQCA 4FZVA 3FTEA 1NE2A 5EKXA 4QDKA 5EKUA 2FPOA 1SG9A 2QRVB 3AWIA 3FTDA 3QOXA 4IV0A 5K03A 5GIOE 1FP2A 1G55A 3C3PA 4AZSA 3R24A 2OY0A 3GDHA 5HIIA 2PBFA 4KIGA 3CKKA 5FUBA 4WVLA 1SVUA 1BKYA 4FT2A 5EHGA 5E8JA 5D1HA 3BKWA 3A4TA 3JWJA 4KWCA 4RVFA 4Y2HA 4DMGA 2LD4A 5F2NA 1DCTA 4PIPA 3K0BA 4RTPA 3KQSA 4EK9A 1V39A 2AS0A 1D2GA 1HNNA 1INLA 1JSZA 3QOWA 3UWPA 1TPYA 3KPUA 5DM1A 3FPJA 2ZIGA 4DQ0A 4PYQA 2IFTA 4GUAA 5GM2A 2C7RA 1I1NA 1D2HA 4EVIA 4RTQA 5LQNA 5LSAA 4DM3A 3CBGA 4DCGA 3UZUA 1L3BA 2ERCA 3HCCA 4HH4A 1KPIA 3JWGA 5GP1A 5KYGA 5DX1A 4GC9A 3BT7A 1UWVA 1NW5A 3GU3A 4DF3A 4RVDA 4YMHA 4HC4A 3PFHA 4EQZA
chains in the Genus database with same CATH superfamily
1T5TA 1XDUA 1N7HA 2P5YA 3HUDA 4HGYA 4LVOA 2G0NA 4NYJR 2RHDA 4TL7A 2IZ7A 4ZYUA 3I2FA 3QEOA 1ONNA 1KEWA 1EUQA 2A5GA 4XM0A 2NU8B 3SIWA 4J91A 2I1QA 3GT0A 1EZ1A 1XTIA 2O06A 2OHJA 3HMKA 3OMXA 2XUOA 4KN9S 3MB8A 1B93A 5FPYA 1A72A 2PS0A 3MJFA 1BA2A 3ZG6A 2DTDA 3Q6MA 4RX1A 1C7JA 4CIWA 4KITB 3GHHA 2FQQA 3O4HA 1BKSB 1KRXA 5BWNA 1LBSA 1J21A 2AE1A 5JOQA 1JQBA 4UE2A 1QG0A 2B8EA 3COVA 1BXGA 2F2TA 4GI3A 5AK6A 1CQJA 3ZWVA 4ILKA 1KHHA 3QLEA 1J2RA 3ID6C 4M9SA 1X0VA 1EHCA 1OI2A 1DARA 1ZR2A 1ZOPA 3PRHA 4IIGA 4M1ZA 1NN1A 2FXVA 3T12A 4BVGA 5EHZA 4KMMA 3EFEA 4HBZA 4IINA 3CUVA 1ZMTA 5KQSA 1PU2A 2FEOA 3O6VA 2M6LA 4WVFA 1THGA 3WB1A 7GPBA 2JAQA 1G38A 2DBQA 1L8LA 4MVJE 4DR6B 5EUCA 4AN4A 3RVRA 3IKVA 4G1UC 3VKFA 4E4TA 2HPZA 4LXHA 1ZVQA 2OCYC 2QT1A 2RARA 4KDRA 4XA8A 3BCSA 3ZVNA 4MKFA 2HJHA 1KSFX 2XMZA 2VK4A 2GKGA 1CQPA 4RIEA 4QNRA 3OQMA 1J09A 2C2GA 1Z7YA 2W2KA 2WI8A 2ZCVA 3G8DA 5DEIA 5F7OA 4R1PA 3GNSA 4FYKA 4U02A 3CH6A 4BEWA 1WBDA 1AKNA 1DOZA 1Z6ZA 2WG1A 2PS3A 3D2CA 1L4UA 1QPBA 2SKDA 1L4LA 1A5TA 3G5MA 1JA0A 4HFRA 3V97A 2XRFA 3SHOA 3I45A 1JR3A 3MUNA 2ZWMA 4WKCA 3SOZA 1S3SA 3AR8A 4H27A 3ZCPA 4IZ6A 4ALMA 5CFOA 4URWR 3CH5A 1M1YB 2J09A 4LXTA 3V8PA 3T5GA 2JHAA 4OHXA 2CMFA 5FULA 3ZQ6A 1O6CA 4QOFA 1E8MA 4BNYA 4C4OA 1NU8A 4CQLB 1L5HA 4UM7A 1E2FA 4GR4A 7MHTA 4I50A 1CF9A 2NO9A 1WD5A 2YY6A 3OZAA 1N6LA 2EQBA 3S5UA 5BWOA 3RVKA 5FBRB 3IVMA 3VVMA 2R6AA 2F64A 1FSSA 4M55A 4TL6A 1GEGA 4B9AA 4OXKA 3B38A 3HA2A 5DOZA 2Z6AA 4JMPA 1HT2E 1ZK1A 2MOKA 1ZL2A 3K0AB 4KPEC 2HMTA 2QDKA 3PC3A 5H3HA 4R8SA 3ZHCA 2QVYX 1ZKDA 1VCHA 2GYWA 2P8SA 3NDIA 5ALFA 2DFVA 5JMWA 2CLIB 3N76A 4E32A 4UCQA 2HSGA 3A6DA 2ZBGA 3BKXA 1BE1A 3OIYA 2Z5VA 1MOQA 1FSZA 4BEVA 4NCXA 1CY0A 3K8YA 4U5XA 5F2EA 5JI2E 2O8FB 3LF2A 1KH2A 4UZEA 3V4LA 1YKFA 3CUYA 3V2IA 4B4UA 2BC9A 1R6VA 2GS9A 3QUSA 4JT9A 2J32A 3S0JA 2CLSA 1L9XA 1VHLA 3T61A 4RQTA 3EC1A 4JKOA 1OYWA 2IRWA 3ER6A 1U90A 2Q41A 4TRJA 4IWXA 5HCIA 4EHHA 2FEXA 2VA8A 4QBGB 2W6IA 1ZITA 1K7YA 5HKAA 2VH1A 1ZM3A 2P2NA 3BXGA 1ZONA 3NHMA 1QCYA 3HM9A 3I9V6 1O94C 4ZYYA 5TE9A 4FFSA 3IMFA 2WSSA 1YDGA 1XKLA 1W30A 4UBOA 1UP6A 2Q2WA 2XRMA 3JVVA 4U0JA 5I3ZA 4TZ6A 2ZBRA 4UFOA 1ORRA 4HWOA 3ET4A 3F8SA 4C7OB 1DHTA 2VXCA 3M6VA 3OJCA 4Z4HA 4RPKA 2ZJ8A 3GCZA 4MS3A 2WG0A 4NAHA 2ZLBA 4IHQA 3C8UA 1RIIA 1U9YA 1Z0FA 4KAAA 5FBZA 4LJRA 3GLVA 2OD2A 2KBEA 2YMQA 4ESVA 1B3BA 3TLEA 1YHYA 4Q18A 2JLZA 1L4YA 1EFRA 2JLSA 3D7LA 3PPIA 5TPWA 4D99A 2VZ8A 3QVTA 3ZLBA 1G20B 3F1KA 2H1HA 4HS4A 2ZRLA 3R7SA 2E4VA 2JHCA 4KPUB 3NGMA 4ZAVA 3ZV3A 4CL2A 2PKCA 3O8NA 1F0NA 4H17A 4TWBA 4TPKA 4CM9A 3OJWA 5G1NA 2H5IA 1ISMA 2J5QA 1IN4A 3HPRA 1D8AA 4TZTA 1XCPA 2R11A 2ZATA 4MVXA 1U0GA 4BFXA 1LV8A 5TDHA 1OTXA 3SR3A 1BFKA 3O3CA 3D0KA 2ODQA 3TSOA 1T0IA 1XEXA 5HTKA 2CFOA 3KYDB 3PQ6A 5ARBA 5KKCA 2P9ZA 4BO8A 1C4WA 2OBMA 1OH6A 1CR2A 4TV8A 3ZBTA 1RE0A 1SQ6A 4OP3A 4B17A 5FPQA 1A69A 4KAJA 4RPLA 4AP5A 2AYXA 3FMGA 1I5OA 3P94A 4KDCA 3GUVA 3SKYA 1IMJA 3RD5A 1F48A 2XBUA 1OIXA 4RLQA 5K2OA 2RD2A 1PW5A 9MHTA 3KQWA 2VXYA 4LTMA 2CV2A 3FPHA 3KBOA 3ROZA 3WNCA 1JHDA 3RT9A 2IZ5A 1JWAB 1N1GA 2KE5A 4L2IA 4IIEA 4NG4A 1BROA 3DOHA 4FMDF 4WXPA 5AK5A 2OGUA 5DN9A 2QQ0A 4AG3A 3U5ZB 1GQ2A 1ML4A 1TIBA 2PRJA 2HHAA 3OFKA 2WT8A 1KFJB 2Q1XA 3EVZA 5CX1B 2FN9A 3FPGA 3WWOA 5AJTA 2KBFA 1P2BA 2PFGA 1CEQA 1MT3A 3HDHA 1O6FA 4C43A 2Q3BA 4Q9HA 5AT1A 1K08A 2DUJA 4BB6A 1PS9A 1ZIOA 3JQFA 2PWBA 3D0OA 3KBBA 3OD5A 2EKZA 4HFMA 2WKSA 5HFNA 1EWVA 3T7IA 4CHTA 3J81A 3BQNB 4NU6A 2I4IA 2JIOA 2YV4A 3F49S 3M34A 2V6MA 2XYHA 1P7VA 3CZ9A 1Z28A 3D4PA 3DBRA 1CY7A 4DREA 3E0QA 2WG2A 4IOKA 4R41A 5JIBA 1SC4A 3AYXB 1H4TA 1WSBA 3EYAA 3MWDA 1OZ0A 1QQ6A 1RXCA 2C7BA 1C3EA 3N70A 3KEMA 4YIHA 2BWJA 4QDUA 4ND7A 4K9OA 5SV2A 5H81A 3R75A 3UNXA 3SHQA 2QD2A 4PC2A 5F73A 1V8ZA 3WYAA 3O74A 3RSZA 3IE2A 4PRKA 4P32A 1P19A 4Q4HB 4UOEA 5IAAA 4CKCA 1NBIA 4I66A 2A7XA 5JWHA 4OQFA 2R6ZA 2A84A 5AYVA 5LQDA 1ZH2A 2C9BA 1E0SA 1B2LA 3RS4A 1F06A 3BXZA 3QFRA 4Y0NA 1QKJA 2ZP1A 3ZHTA 1WB5A 1UXOA 2J31A 2ZRJA 4RXMA 2Z0MA 5F1YA 5CLFA 3IDSA 5TSDA 2EDCA 2JFVA 1LJLA 2C94A 2R47A 2R96A 5HJ7A 1L5RA 1U3UA 3S2UA 4M9RA 5K3AA 4YEDA 5TNXA 3PGA1 5D7NA 1IBCA 1WAMA 4Z2AA 3QPWA 1K86A 5DI3B 1O5TA 4IWYA 4IV5A 4C0SA 2GBPA 2Z83A 4H15A 1DIBA 2QTVA 3M6LA 1GV0A 4L5YA 2OAGA 1T9AA 4LCEA 4MW7A 4P22A 4Y18A 5CURA 5PNTA 5KOYA 5EEHA 1E2JA 4WERA 1V4BA 1SZCA 3SVLA 4E1VA 2G1UA 5E9WA 3EC2A 5CJJA 5TT0A 3PVZA 4ND8A 4KLCA 4E30A 4ZI7B 2QSZA 3EOBI 4O2AF 2QJRA 1X9GA 4D3DA 2I1VB 2JZNA 5CB4B 3MXTA 2WWWA 2REXB 4MRPA 3NMUF 2R751 2VCYA 4BGIA 4IS2A 4NJEB 4D44A 3KSUA 4XUEA 1ZK3A 1O96B 1TZBA 1M2VA 3ML1A 4GLBA 4X71A 4MWEA 2X0DA 1QQ7A 4MHOA 4L8FA 4A03A 4CG2A 5B55A 4RTSA 1AV7A 5C7OO 5TARA 2K5UA 2QVGA 3AGPA 1BMFD 5EIFA 3TSYA 3P26A 4J4BA 3WL6A 4C0QC 4AU1A 4DT1B 1UBMS 2XQGA 2GMWA 3E5NA 3UJ9A 1USGA 3R5SA 4O4HF 1L7PA 5JMOA 1LW6E 1QZTA 5D00A 1UBKS 2Z5GA 2HNAA 2RGUA 5CXSA 1M0SA 2EHJA 2I71A 3DE1X 3GRVA 1ILEA 5EFZA 2NYUA 3JTMA 1HE1C 3RBAA 1JMVA 3HRHA 5LBTA 2OHIA 4DDMA 4XDGA 4EWLA 1ZP6A 3ZUGA 3CONA 4G5XA 3WLTA 5B2FA 3ERCA 3ZU2A 1JDUA 3AVPA 3K0EA 3NKVA 3NNSA 3BDVA 1HT0A 4HDMB 1YS2X 2BJVA 4PHCA 5DHUA 2OUIA 1L5KA 3UKOA 3X1WA 1E3TA 1VJ5A 3D3EA 3FETA 3HDTA 4GQBA 4EO9A 2V1UA 3A3KA 2IPXA 2N0SA 3GB9A 3RASA 3AINA 10MHA 2C4MA 2PQMA 4BO6A 2YN0A 1OPXA 1NVWQ 4QGHA 1O95D 3ZS9A 1YFKA 1WTAA 3ND7A 4BFUA 1XEWX 2H1FA 4TKVA 1LF5A 3LE8A 1BGXT 3EZNA 5J2UA 1SA0B 2J41A 1DAKA 2W2TA 3DEAA 3EJ6A 4ND2A 1O6ZA 3B3JA 3FIUA 5KS2A 1YIDA 3J7TA 4YN3A 3QXGA 4H0FA 4DKJA 4C2BA 2C4TA 1LRJA 2TSYB 3EHDA 3FA2A 1NVDA 5F76A 1BE6A 1BO6A 3P27A 2YINC 4IKOA 5KNBA 4B6SA 2EW2A 3HEMA 4C20A 2YIVX 2PS1A 4L74A 4Z0TA 5HF6A 4F5DA 2WQ7A 1DQRA 3DMHA 4BLWA 4GSKA 4QKQA 1T9GS 5DLYA 2EBFX 1MJNA 4I46A 5REQB 4X9XA 3BWVA 5A06A 1MQSA 3FF4A 4CU5A 1DUSA 2AJBA 1UEXC 2HRQA 2QM3A 1UPAA 1QFXA 1NQUA 2LDXA 5KYNA 1RLMA 1JGTA 4WN3A 2JF0A 4CDGA 1OIVA 1NURA 1C5KA 1V5FA 3H11B 2D3TA 1VMEA 4BQQA 4REQA 4L3OA 1CJVC 1UDCA 2K87A 2PSHA 4I4CA 5ELXA 1QP4A 4RA9B 4RMNA 5JCPA 2G4CA 1QG2A 3FYCA 3LECA 3D4OA 3T5TA 1LSJA 5FTKA 2AV6A 3VYVA 2PUBA 2PDAA 1XVUA 4MWTA 4PR3A 5DU2A 3DS8A 1LZLA 1OH8A 1FJ2A 2O57A 4MULA 3OZDA 5JWOA 1Q0HA 1TB4A 3AHFA 3OIUA 4YT8A 1F8UA 2OB1A 4Q9AA 2A7QA 2G9UA 2Q49A 1K4YA 4X6XA 4GBED 1DBPA 2I4OA 3EGOA 2Q62A 3UN1A 1TU0A 5BQXA 1PTJA 2ZITA 3G2HA 3AC0A 3X2SA 2Q2QA 4DA0A 1JILA 1KFEB 2FMHA 2W8BB 4IZOA 3TAHA 2G8NA 4ZDIA 2C1XA 4AJEA 4UTRA 1T9KA 2HWKA 3IV7A 2JIBA 2DF8A 2X7HA 1KYWA 1BWQA 4KNVA 4F3CA 1AQ6A 5KVCA 2UKDA 3E7DA 3OUTA 2OB2A 4CR8A 1R66A 1GPMA 2UXDB 5CH3A 2B34A 4GMKA 4N9WA 1JFVA 2EG9A 3UB4A 3PDIA 2JGDB 3D6MA 2ANBA 2Z6VA 1MJHA 4K6CA 4CLOB 1AKTA 1XPUA 3LC0A 3I6IA 4BVKA 4DJ5X 3JZAA 3IAM6 1G7CA 2E18A 3LQ4A 5K51A 1C1HA 1WULS 4RK7A 4CV0A 2P9GA 4E15A 1GNQA 1JXMA 2I6UA 3EODA 5BSVA 2I9PA 1RPAA 4B7UA 1PWXA 1XLVA 2V7EA 3ZXUB 4TRMA 4E2FA 3BHMA 2DKFA 2JGNA 3F5DA 4ZZ0A 2INGX 3HXMA 5AI6A 3UAZA 3LKDA 4E03A 3H4MA 3N58A 2Q2NA 3GN2A 2DLDA 3O3OB 1SC9A 1LSSA 4R1SA 5TVGA 3GA5A 2VPPA 5CB0A 4IOJA 4JROA 4YJFA 4OQ4A 4ZJUA 1QGUB 3R5XA 4CKYA 4AICA 4B3CA 4F2HA 4OXYA 3WA6A 1GTMA 1WUKS 3JD2A 5B64A 4AKEA 1L7DA 4JYCA 1Q0QA 5JNSA 3JQGA 2SICE 1MNAA 4EFLA 4L9WA 5HIIA 2O8CA 3AEUA 1L4GA 2PZGA 1QDLB 2CXRA 4PSUA 3RR2A 3PEFA 3ZCRA 4KFRA 1W52X 3OM8A 5D86A 4DMGA 2LD4A 2WBLC 2VJMA 1IMOA 2SCUA 3JZIA 4R2IA 1D5CA 2W2LA 4UDNA 3T34A 3JTEA 2POCA 2XVYA 3W3AA 3WOVA 4Q3NA 1XWFA 5JDIA 4ZCPA 1ZD5A 3W8FA 5DM1A 2OZLA 3KZCA 5TQ0B 4GUAA 3RC8A 4J7XA 2XDQA 3UHPA 4E3WA 1AUVA 1O5IA 1E3QA 4Z49A 1EH5A 2OCPA 4B76A 2Q6OA 2C9DA 3K5PA 1TEHA 3MJHA 5K4AA 4BLSA 2GWRA 1GUBA 1GAQA 1Z56C 2ORIA 2VUUA 3C3EA 1NYQA 2FF5A 2ORWA 3AI3A 3AONB 3HCCA 4I8IA 4B7XA 4DDUA 2VAMA 1G9TA 3ZWOA 3Q85A 3ICWA 1E9BA 1SQSA 4ECAA 3AI7A 1T6BY 3F78A 3PFHA 3W5UA 4ES6A 3HXOA 1C14A 1N2SA 3GUCA 1EU1A 4DR2B 2QMYA 4MKGA 3QHPA 1TQ2A 2IYPA 4TMWA 4PYJA 4P33A 2FPPA 3KR2A 5K0TA 4PZLA 2PWPA 1G60A 5EUQB 3V7YA 1PCXA 3EZXA 3MELA 4DTCA 2Z6QA 3QNMA 5EIWA 1CQIA 1Z8FA 4N39A 3U3KA 2BFDB 2B69A 2J33A 2JB9A 2WFMA 3Q0EA 4HX2A 4V0ME 5C3MA 3K31A 3BBPA 3ZV4A 3IIIA 2AXNA 3RYHB 721PA 1YQDA 1OH7A 1T4CB 1LLFA 3UK7A 2BONA 2B35A 3H1EA 3HP4A 4BS9A 3W9YA 5CU7A 4RIIA 1LPOA 2D5IA 2VDVE 3GRCA 1RMTA 2ISSD 1R16A 1EGVB 2IV2X 6REQA 1LRKA 3GPCA 4ZQHA 1U0EA 4QXMA 4BGUA 3NC4A 2Q4DA 2X77A 2IBSA 2PY6A 1GY8A 1I5RA 4G9BA 3CO0S 4G24A 4LYGA 2ZPTX 4PG4A 1JJIA 1JHAA 4JL6A 4ZVVA 2QY6A 1JEQB 3GI1A 3H1GA 3OBBA 5BW6B 4A10A 5B5SA 5K8CA 1I30A 2XYPA 1Y5RA 1RHKA 2V9CA 3E1SA 3ANYB 2BR4A 3B48A 3NKLA 4TWJA 1NG9A 2V65A 3PDCA 4YRZA 4PG6A 1PLKA 2P79A 2YZKA 2GILA 4FFMA 3N6RA 1PVDA 4I50F 4LSZA 5C34B 2QPLA 2CJXA 3GARA 3W90A 4CBVA 1GRRA 4LC9A 1PGQA 3DMTA 3PSHA 1LLCA 3IAAA 5D5PA 3W34A 4BUJA 5JCXA 3SOPA 3DBHA 4OXIA 1UT8A 5A0FA 3V33A 5DP1A 5FBVB 3KKKA 1E9FA 3CRVA 4MS4B 4C2TA 5JATA 1JFLA 3GPLA 4IUDS 2WJHA 3G2OA 4GOKA 3VO2A 5AW2A 2NP6A 2NZ2A 4J0DA 4NJMB 4EB6A 2DUWA 3ESYA 1Y8CA 4Q9DA 2B36A 1YL6A 1BX0A 2GCGA 3LT5A 4UXIA 5IT4A 4LVNA 3V8VA 1FMFA 3DL7A 5B3LA 1SBZA 4A8TA 1FMCA 4G5RA 3LQYA 1RADA 2HH9A 3MT8A 4XB6B 4Y1EA 2XT0A 5ALKA 2OG2A 2VJDA 2EZ9A 4QVGA 2EQ5A 1ZUHA 3ZN2A 2HK7A 2ZU0C 4FPXA 3DM5A 3DAHA 3KYBA 1Z4OA 3ACDA 1PZHA 3C1UA 4NOKA 4XOIA 5MN4A 4F84A 3LIIA 1KDOA 4O08A 5B37A 1JN0A 3A9SA 1YNSA 1XQ6A 3H2ZA 4TQAA 4FYHA 4NL4H 4Q9IA 3C85A 2CJPA 5BR7A 4KREA 1VSUA 2PR2A 1AXEA 3R9KA 5CM2Z 4C4RA 3FDIA 3GQBA 3Q3IA 5CXQA 5HZKA 1ZSYA 5I8PA 2ZYHA 3TI9A 2QAGC 2BGWA 3WDSA 2PX2A 2J6IA 1PD0A 4HLCA 4KHPB 3FMFA 2HXYA 1I6LA 5JD5A 5LZ2A 4IIYA 3ZGVA 2FP3A 4NU0A 3EF1A 3GPIA 1FFDA 1X8LA 2Y1GA 2FW6A 3RT7A 2DWUA 3RHFA 1HRDA 5G40A 5A5EA 1EVLA 4PAWA 1ZH8A 4R8MA 3C7AA 5BO5A 1KJ9A 5E4FA 4UEOA 2AK2A 4JIGA 1ZD8A 1ODKA 5LOVA 4BFTA 3DYBA 3VR6A 1ORIA 5HKBA 4D6YA 3VR6H 2H4FA 2X7XA 1G0NA 1NBME 1DIOB 1YUMA 3GCGA 3IFSA 3KPYA 2PLNA 4HXFB 2BELA 4WFJA 2CD7A 3SLRA 4D6XA 1GGHA 3II6X 5IZ4A 4HGZA 3PNOA 1Z7BA 1SZDA 3C2QA 3Q2KA 4BZQA 2I2CA 3GNLA 1SC1A 1Y4AE 4DDTA 2JAXA 2RB4A 3KQYA 2NU6B 1TRKA 4EFDA 2WD7A 4QQ8A 3A1WA 2DHDA 4GYKA 1KP3A 2C4NA 3KYIB 1K89A 5H80A 2ZUUA 5JJ5A 3COJA 3ROKA 3AB3A 3NV9A 1QGZA 3D5EA 3G8BA 2ZEJA 3ZWNA 1HL7A 5KNCA 3I4FA 2C00A 1OWPA 2XMBA 2DU8A 4RE6A 3UHFA 2GRJA 3UM9A 2CLMB 1FYVA 1TD9A 1B76A 2ZAGA 3C1AA 3HZZA 3D8SA 2E2WA 3GEDA 3H75A 1KEUA 1RM0A 3I53A 4PPYA 2XW6A 2C7PA 1V5GA 4BQPA 4G86A 1J97A 4DUZB 1DKOA 1N0IA 3JCZA 1YRBA 4OIMA 1A27A 2QQGA 2KB0A 3OCJA 1P5JA 2W2QA 2QORA 3L6RA 3LPDA 1UKEA 2XDAA 3GFPA 4R6XA 5C37A 3Q72A 2GQ0A 3PT9A 1HMPA 3ZD8A 1L0BA 2XUKA 4XFKA 4QBTA 3TIFA 4EA9A 1NATA 1R5NA 4ZCLA 1DADA 3FGZA 4H3VA 3HXKA 3IQWA 5BWLA 1Q11A 1XZFA 3G1TA 2ATVA 1H4SA 1JIUA 2DULA 3C14C 3K16A 4ATNA 2WINI 1QORA 5TQ2A 4CNBA 3NHRA 5EIEA 2Y2UA 1T5DX 3F74A 2QG6A 5C8VA 2IUUA 4IUYA 1E8DA 1EJ6A 1W6UA 4HRAA 4MCHA 1RYZA 5A2GA 4WHMA 2ZWVA 2QRLA 3F7NA 3FMVA 5IUNC 2JBAB 3ZWCA 2CJWA 3BEDA 1HLFA 4IJWA 1RWWA 1MTZA 3N8NA 2OCDA 3ZGZA 2A0WA 2VK2A 2AEEA 1OIWA 1J0EA 1ZCFA 1G4HA 3TX6A 5EJ9A 5CA0B 1QNLA 4KMSA 4KAXA 3MFQA 3L77A 3N2KB 3OPMA 4LOAA 3LXXA 3O0TA 4FKMA 4ND6A 3EGXB 1R0RE 2UYYA 3K9WA 2I6TA 1XEFA 2PUFA 4QPCA 1E1RD 4ZVPA 3WKEA 5D87A 4URVR 3JQDA 4KXVA 4U6NA 5FAXA 3RRBA 1QHHB 2SHKA 4JWTA 5DLPA 5EWMB 3ZWAA 5IKXA 1Z8NA 2W83A 3G0IA 3WLIA 4ACBA 1WNTA 4HZUA 4JLAA 5GZ3A 1SXPA 2YNMD 3O03A 3QNUA 3FUWA 4MVJP 3ESXA 2ZE8A 4IHAA 3AVTA 3GAMA 4GSLA 1YGYA 4FW9A 1HV8A 3KFVA 4GI5A 5CB4F 5AP9A 3AF6A 2V0NA 3OA2A 2RK3A 4HNAA 2EW8A 3PNVA 1V25A 4U0KA 3GGJA 2ZSAA 1O54A 3DOEA 4KC0A 5JZBA 1QZZA 2VKQA 4BQFA 1JDSA 1NBWB 2PH5A 3L7IA 1N2CB 2CKDA 4JQCA 4PGGA 3R5TA 1CY2A 1M33A 1ACLA 1MMFB 3DTVB 2ZDGA 4IDEA 2I3DA 1DG1G 4P3PA 1N5OX 4PLGA 3GLFE 3A4VA 4WOJA 3ZZ1A 1QQ5A 1NBEA 3NDPA 3JALB 4YAEA 4QJBA 1O03A 3KQHA 4NCJA 4BLTA 1GNTA 1PZGA 1OU4A 5LZ5A 1C2YA 1FSFA 1ESNA 2Q8PA 4QATA 2ODTX 3T7EA 1U6KA 4ZGGA 2BZ1A 5JC8A 3PEYA 3C5VA 5A04A 3LWDA 4NZNA 4EB3A 1I51A 3OFSA 3IUYA 1N9KA 3BJIC 5FUVA 3IBSA 3QYAA 5KX5F 2BH9A 4KX5A 4B3BA 4UTXA 4B40A 1Q83A 2A9PA 2R8ZA 2OL4A 4OLHA 1HA3A 2VJLA 3A6GA 1ZR4A 1DRUA 3UJCA 4AM8A 2XCTB 4JP1A 3KETA 3R7DA 1P0FA 1A4IA 5BYBA 2HA7A 1DEOA 3M1AA 5EJ5A 3HJCA 3KPWA 3MCTA 1EGQA 1UL1X 4I5FA 4YALA 4CF3A 3DTTA 1PGJA 1P2SA 1G1AA 4M37A 4NBNA 3TKYA 3M33A 2QX6A 1O4WA 3CNHA 2ATXA 3LSTA 4OA5A 2W6OA 4OLFA 3MPOA 4J3JA 4P34A 1HZJA 4KOEC 2XMDA 3MXOA 1XQ9A 3N5KA 1DAPA 4HWTA 4H77A 5CVEA 4DZTA 1V8DA 2JJ1D 1ZI9A 1RI5A 1UEIA 2RH8A 4A6XA 3KQNA 2V3VA 1EFKA 3GGOA 3N0WA 3TMYA 3TQIA 2XF8A 2A30A 3QBJA 3UT0A 1GAWA 3OPYI 3CNBA 3RTGA 3W1VA 3WNQA 5T8KC 4R1MA 2DX7A 4BZWA 4X45A 3USES 1V71A 3GFSA 3BMXA 3DUFA 2I3AA 2H8KA 2HAEA 1Z06A 4N3BA 4O2BF 1T8SA 1ZSVA 2WKPA 5M3BA 4NAUA 2GBIA 3PYXA 3DEKA 4HRXA 2IYSA 2OAEA 5L3ZA 4QLBA 5AKLA 3REOA 4C06A 1AA9A 3L7NA 5AKXA 4DILA 2DWPA 4OFZA 1Q0LA 3CB2A 3ZQJA 5EGNA 2HF2A 3OEYA 3X1XA 2NO0A 1JHQA 3H8VA 2ID8A 4HXEB 2QJWA 3BMOB 5FEMA 1R7RA 4O8CA 4HNUA 1VHTA 4I6JA 2QS9A 4NENA 2G1KA 3GVIA 1PE0A 1XU4A 2FZWA 3E22A 1QTNA 2YV1A 4ZXPA 2A5YB 3NBKA 1M6WA 3WADA 4DJDC 1TEZA 1RKUA 3O2SB 4YRRA 1NPTO 1N7IA 2BJHA 3DKRA 1JG3A 4BX2A 2O4CA 4C7VA 1GO2A 2W8ZA 1DZ3A 2QRJA 1Q7GA 3TAXA 4UAJA 2BRUC 4FKZA 2PYZA 4IIJF 1PNOA 1UBFA 4RKWA 3WO1A 2QTMA 4BUCA 3MLEA 1AKUA 1XTVA 3GXOA 4DV1B 1PJCA 5C1PA 2GFIA 4DLXA 3QNWA 4E1BA 4IL5A 3ZD7A 3HDQA 3B9QA 5AM5A 4WCFC 2XV1A 3HB0A 3ROXA 4F56A 1EVZA 5FLYA 2OC9A 4D7AA 3VA7A 4DRZA 2IYYA 4BO9A 4CCWA 1XP8A 1Q22A 2H8GA 1DMSA 2OCKA 3MK31 3LT2A 4KFCA 4U8HA 1PR2A 2DY1A 1OF1A 3EWIA 4I4TB 1XVIA 4WKBA 4JBHA 4HB2A 3T4PA 3AFGA 4KJXA 3OQ1A 1X80B 4F4CA 4WBNB 1QV6A 4DR4B 3TRFA 3PKIA 2G67A 2ZAIA 1M8GA 6GPBA 3UAGA 2AG6A 3LKZA 5GTDA 5ILOA 1EESA 3GT7A 3F5QA 1J56A 1P33A 2BN4A 5BPHA 1UBJS 4U2CA 4BQOA 3MD9A 1DTSA 1GD1O 5JARA 1P7WA 1WHTA 4MVJG 5CITA 4P86A 1NU6A 3P32A 5LN1A 5JNLA 5BRNA 3K0SA 3E84A 2Q6IA 3AVOA 4HNHA 3E05A 3R3SA 4TM7A 3ZGXA 3RVSA 3ZI0A 1A5BB 3WRXA 2X0RA 3NH6A 5L53A 1TRHA 1C3LA 3WP0A 3G0OA 1T5HX 4WESB 3WDMA 2VXBA 3IMCA 3WJ7A 2IL1A 3WWCA 3Q41A 3LPCA 2JFYA 3DMDA 4TGLA 5G0VA 2B4QA 5LA6B 4MARA 4BZZA 4CLXA 1A96A 4AQYB 3PJDA 5AJWA 4B7ZA 4JB3A 4YAFA 3RYIB 5FI3A 4BMOB 1VP9A 2CCGA 5A3RA 1YRHA 4Z9YA 1SELA 4BVBA 3OFJA 2JD0A 4I3FA 5KVSA 3MIIA 3GCWA 1GXSB 1T2FA 3QP9A 3MRXA 3I37X 4M9CA 3O4VA 4R2WA 1NXTA 4G0PA 1Z13A 2I65A 3RKUA 1I24A 5AW8A 4K9RA 1I3KA 2FZVA 3R40A 3ELUA 4JC8A 4YUWA 2IHNA 4D26A 2HF7A 2HCTA 4RZIA 4G67A 5TGZA 4PRZA 3NFRA 4HAXA 1FY2A 3EGXA 4LWOA 3VC3A 4R1UA 4ZICA 4Z7OB 1C7RA 3V8BA 4FGZA 3STUA 3ZWKA 2X8AA 3QKRA 3WXBA 2H1RA 4JHXA 1ORDA 4WADA 1ZH4A 4QU0A 5BORA 1HNWB 1K6JA 5EJ8A 5JMTA 4JA0A 4A27A 4ZOAA 4BO1A 1ODFA 4CVNA 2DP4E 4FVTA 4M8IA 4CE6A 2EKBA 1SG9A 2FPOA 3AWIA 2E1PA 3CUKA 3EQ9A 5JCOA 5JVDB 2J9ZB 1NW4A 2GEUA 2YY5A 4MWOA 2AL7A 2FRDC 4FT2A 5EHGA 1ZW6A 1AKEA 1ULBA 2BFFA 1SXJB 3OAAD 5LP1A 5F2NA 1LK5A 1G8FA 2HLPA 1HG0A 1JSLA 5GJCA 5DISB 3IOBA 3EGCA 4DZZA 3M82A 5AD1A 3C41J 1XAIA 4KGXA 4KP7A 4PX9A 5YASA 3TCXB 3O3NB 4DQDA 5A0TA 4FUTA 4KL8S 4DDKA 4ITRC 4MCIA 3U4DA 3PA6A 2UZ1A 3LRXA 4AW9A 1CQXA 1U3TA 2ZRKA 3L0ZA 4JP3A 5IUKC 3TTTA 1HX7A 1SGWA 2ZRQA 1E79A 3DKIA 5C53B 1HFJA 4AKTA 4NY1A 1N6KA 1W2WB 4M0DA 1RMYA 3LXMA 3AVWA 1FEZA 3RYCB 1KJQA 4JU8A 2SECE 2OD7A 2XJ9A 1L7XA 5C7LO 4AUMA 2R1TB 1VDMA 2ZROA 5I3CA 5MGNA 4PFSA 1E6MA 2AVNA 3HNOA 3P2MA 4AVYA 1T9ZA 1DEXA 4JEUA 1XD9A 2ZRPA 1GU7A 2O3JA 4Q3DA 5AKHA 1DKMA 3HABA 4WH0A 3R6GA 4Y1GA 5G4KA 4PZDA 4KH0A 4KQEA 4G0VA 3ZWWA 2J07A 3WC4A 2PGLA 3B6IA 3WVNA 2IX3A 4WZBE 3HYLA 4L4ZA 4Q4JA 3TLYA 5DYNA 3O8DA 4XFJA 5LYJA 3V2HA 1MQ8B 2H2GA 2ID4A 3IDZA 4UHKA 4X0EA 1S7CA 1SXJE 2EWVA 1X0XA 3OCCA 2RAUA 4TLAA 2ZUSA 4LQ4A 1I4WA 3GLUA 1JNYA 1XF1A 3RV4A 3UUFA 4LYHA 1S7GA 1Q1QA 5KOJB 2XYRA 3OCWA 1JEYB 4X61A 1HC7A 5A4MS 4Q3KA 3BUSA 4IKEA 5KVVA 5AO9A 1RSZA 3QXHA 1IBKB 1W29A 1LDMA 4N40A 4WECA 3KPVA 4IDGA 3MEQA 1E1LA 4XR9A 5E0KB 5F2OA 3CX8A 2J67A 1L7EA 1I14A 2X9VA 2E7ZA 2LCFA 3ETJA 3PFFA 4CL8A 3ZOZA 4MHTA 1T8TA 2ZJZA 3DULA 4J16C 5KQGA 2LPMA 1Y8QB 4YP6A 3V8QA 2RKOA 2ZIWB 2GAOA 3PR1A 3TWOA 1C9MA 2G4LA 2JARA 1N5LA 2QZSA 3SX4A 1NQ5A 5BOSB 5LQMA 3BVPA 3AFOA 6Q21A 1JAXA 2D0PB 3T5MA 4R5HA 4V0RA 2GJ8A 3FRJA 3LYAA 4KVGA 2BFWA 5BN5B 3V4ZA 5LU9A 1VBKA 2VT2A 3I52A 4ZAZA 3I9JA 3KUKA 5LQSA 3VSCA 2XGGA 1FDUA 2JAPA 5FHRA 4E5DA 4ERNA 5IAGA 1XE3A 3I5UA 1CIVA 1NWCA 1KDYA 1F6BA 3HCAA 1FTQA 1CS4C 3O5AA 2YICA 4HLNA 2G1AA 4OU5A 4Q16A 3QRWA 5DNEA 3LLVA 5EGSA 2IHVA 5I01A 1ZKMA 1OX4A 4M8KA 1IDOA 3PG5A 1J0DA 1XHEA 3R6TA 4JL5A 1W87A 4TSFA 4XQ9A 4CNQA 4RMHA 4S35A 4AMBA 3LWNA 4RCVA 1QBGA 3W7AA 1MW9X 2I34A 4MA0A 2W2PA 1SXJC 4Z4FA 2W6CX 1GDDA 3CTMA 1K2WA 5EJMA 1ZAYA 3C3XA 4DB2A 2YJ3A 6ADHA 3PI7A 4B6EA 5ALZA 5FXMA 1V4VA 3HRKA 2DLNA 4JT4A 4Y9SA 3FG9A 1KMHA 2G0TA 2YWJA 3PQ4A 5A1TA 2BGIA 1JVBA 1IDN1 1RXVA 4UPDA 2IBTA 1ES9A 5GWXA 5B3AA 2ZANA 1I6MA 1RQXA 3X43A 4NMXB 4CFSA 2J6HA 2AN3A 4R9VA 2EFEB 3AHDA 3FJYA 4H4CA 2PX3A 3E0XA 2A67A 3MTIA 3PWTA 3VDQA 1LLQA 5B6IA 4ESEA 3ETEA 1E5DA 2B37A 3I58A 4K9NA 4YP9A 3FCAA 4O3MA 4X93A 1KVTA 1QLJA 3OZSA 4UATA 1PHRA 4RLFA 2LCIA 1LX7A 2Y93A 4LQLA 4QUKA 5CVUA 4FHDA 3JSXA 3ZE1B 2ZT8A 1DUIA 1FTYA 3GIWA 1E20A 3H0KA 1SVIA 1Z0UA 4Q4HA 1G6OA 1QK5A 4W6ZA 3I04A 2QD1A 1G5PA 2HTEA 4DAEA 1OA1A 1JWLA 3AP1A 5JXIA 1Q20A 1EK1A 2VYND 4NRDA 4BOYA 2ARKA 2HB6A 3MTEA 4BV3A 2GVDC 4NWIA 1UPXA 1QB7A 1ZLYA 4QU8A 4D1YA 4WGGA 3FOBA 4FU0A 1WDLA 2N1BA 1GCUA 3KFXA 2H0QA 3PUZA 4NCKA 2MMGA 2VWGA 3EN0A 3FVQA 1THTA 2OWEA 3QKSA 5C8DA 1ECBA 1ZM4A 4EG8A 1H9AA 1U02A 1TM1E 2NZXA 2XOXA 3PL1A 5HVNA 2ZJ2A 4ZD6A 3GGPA 1ODLA 4O8ZA 2PD4A 3C8MA 3OSUA 4MI1A 3U31A 1OB2A 1GZ7A 3NR2A 4JD5A 4MW1A 3G7UA 1T3TA 2QTNA 5COAA 4GICA 1Q3HA 4ZO9A 5JS1A 1SHKA 1A2OA 4KSCA 1X6VA 1H8EA 3H86A 2FUKA 1E9DA 3KWLA 4B82A 5JUWA 1A9XA 4YCBA 2HTFA 2IJGX 3KLBA 1VCNA 2OV4A 2WEKA 3UWDA 4WA8A 1V4NA 3ZQKA 5B7GA 1AURA 2CFRA 3WKCA 1W96A 3SJZA 4NZMA 2G07A 3FGPA 1T4GA 2PX0A 4LY3A 2VI5A 1C0IA 3IP3A 4NDAA 1KEPA 1ZEMA 3VHQA 2NQ8A 1E5TA 1ZWLA 2VP6A 3FBGA 3GA0A 3NRCA 1FW6A 1VE6A 2NSYA 2F3PA 2P65A 1O94D 1XLTC 1CVIA 1GL6A 4LJ6A 2Q3EA 3T99A 1JG4A 2V7XA 3E9CA 4JI4B 4YRSA 5DHTA 1DJMA 1ZN8A 2JFOA 3JRXA 2QM7A 4BMCA 3ETGA 2Z1MA 2QRPA 3GFQA 4A9AA 4ABYA 4IO1A 3NU1A 3AL0C 4MOWA 4WXRA 3WLEA 5AKIA 4EUKA 1EVEA 2ZIZA 3DONA 4MGHA 4N76A 1YVRA 2EJUA 5L3RA 1GTG1 1YDMA 1TYAE 1YR8A 4UUPA 1D6NA 5EWLA 3T7RA 4EJMA 1RC1A 3E5RA 5LMCA 1NBAA 2D4HA 5EZYA 2YS6A 4PPNA 3IQHX 2NO6A 1GARA 5NULA 1BGWA 2D1FA 2E4XA 1B42A 5F1KA 2YWRA 1CJMA 4K1XA 4ZK6A 1KAMA 1TOAA 1T9HA 1YRAA 3R0QA 4AC9A 1G8HA 1Y80A 4YFVA 1O08A 5EZ5A 3IVCA 3UJDA 1CUAA 4WQMA 1RJFA 4KSYA 3HACA 2HPHA 5CM9C 3AUKA 1LDEA 3QITA 4NF2A 2WUWE 1QWOA 2NU9B 5JCOC 4HFNA 5ALEA 1QRRA 2JJ1A 3W6ZA 3T52A 1MU0A 2OXEA 3IAEA 4HDKA 3Q10A 1OHHA 2CD9A 5C8YA 4PWYA 3UG6A 3M6MD 2QTCA 4QJ3A 5FOTA 3T9BA 4MQ5A 3TN7A 5JCJD 2I9KA 2RCYA 3ETLA 4IDOA 2BEJA 4A5OA 3C3CA 3G9TA 1O7JA 3TLKA 2JLVA 2TMDA 4ENPA 3EQ8A 1DKUA 3IP1A 1TYZA 1DC8A 4MDFA 5JY1A 2XKJE 1XRRA 3CPEA 2PH3A 2YWEA 1L5GB 4QQNA 5JAPA 1UJMA 3PNMA 4KGDA 3T94A 4UMDA 1TVMA 3DBRB 3FVVA 3QWAA 4GE0A 4UULA 5ALLA 5KU1A 4K6FA 1AUQA 1Z38A 2V4MA 5FWDA 1FFYA 3IURA 5DWQA 2ST1A 3FGNA 3GBPA 5DLQC 5F64A 5FWAA 2CJFA 1WCIB 3OWHA 1G8AA 4OOEA 1FQJA 1WEKA 1QHEA 2PIAA 3R44A 1CVRA 2DR3A 3NIGB 4M6WB 2OHGA 2QYTA 3FLEA 1Q15A 2GBGA 4BBJA 4YJ3B 3VR5D 1GTSA 2C5BA 2QM8A 3WISA 2N42A 3DP7A 4B8ZA 3E27A 4LF9B 3FYTA 2DBYA 3I9MA 2Q29A 4QGAA 1N1MA 3BMQB 1PR9A 3U7RA 1VC2A 2ANCA 4W5HA 1SU8A 1QFJA 3BCRA 4PPFA 3ORSA 2FR8C 4OBEA 1E4OA 1KQ3A 1UKYA 2Q3LA 5DSXA 2WHEA 4BHTA 4X94A 4MKZA 1KI6B 3ZEIA 2G5TA 1IU9A 3RVMA 2BMAA 3ZGNA 4WCVA 1GNSA 1Z0IA 1W4RA 3DQZA 4PFJA 2DBVO 4X1IB 3WNZA 4EA6A 3NBXX 4EFKA 3Q2OA 1AKWA 1W2GA 2PRYA 1F38A 4L6CA 1DTEA 4MB6A 4YP5A 4ENRA 4ZYLA 5CD1A 2VNIA 4NH0A 3IVRA 1KQGA 1GUZA 2DB3A 1DWPA 1ADFA 1WU8A 2B4RO 2RGYA 1RYFA 4DARA 5BYKA 3PQ7A 4L4RA 1T4DA 1WW8A 2HMWA 3INNA 5F51A 3SNKA 4S2EA 5IK2D 5CW1A 4IJMA 4NCHA 3E1KA 1Z7EA 4IV8A 4P31A 3UPDA 2J3IA 1QIEA 3G89A 3BXFA 5JW6A 3B12A 3WLOA 1E96A 2Q3CA 3ZDXB 1PT8A 1BE8A 4NIMA 1JUDA 5SY4A 3CVUA 3RI3A 1F4PA 2VL7A 3L92A 5EMLA 2XXAA 4ZMBA 3H8JA 1WXDA 1AJEA 1SKQA 1G18A 2HJWA 3DLTA 4ZJYA 4Q3EA 1XXLA 5H82A 3FCYA 5HZMA 1S2MA 2ZT6A 4LHWA 2KLHA 2Q50A 3HR4A 1Y9ZA 4KO8A 1JDZA 3T7TA 2JBWA 2IYQA 3UJ8A 3ZE6A 1JAZA 2WSSD 4N0MA 2PL9A 3CT6A 1J8MF 2N75A 3A7DA 5K3SA 2WF5A 2I67A 4U6QA 3DMPA 3H9JA 1MKYA 4QD3A 2IUSA 5M2QA 1QQBA 3NBMA 5BSTA 1G59A 2XUDA 1JBKA 1IN8A 2G72A 3AHGA 3G2LA 1DLIA 1Y89A 1OLUB 1JJFA 1HE8B 1Z9BA 2O7SA 3AF2A 2AE2A 3D1VA 4MI6A 5EP1A 4FYVA 4UQLA 3T7SA 3C43A 2VAPA 1DBVO 3M49A 2Q5CA 2I2FA 3B1FA 3TE7A 5JTUA 1OFTA 2JLQA 4N18A 1J90A 1CJCA 3LPLA 1GCGA 4OHKA 1PR5A 1KDPA 3SR0A 1DJLA 2JK0A 3P2YA 3LXUX 4OVKA 3H2SA 1EEXB 1SOUA 4NFSA 5E6UB 4AURA 5HHTA 2P8JA 1EA5A 5K3BA 4DJJA 4HL6A 3WBFA 2Q21A 4Q00A 1VKNA 3EA4A 3B5IA 3ECSA 3N5CA 2GBFA 4I4IA 4QGFA 4X00A 1UK9A 3ND6A 4WBNF 1H2BA 1V11A 3K5HA 4HDQB 4Y2XA 2HQBA 2VLBA 5IM4F 1DEHA 2P6PA 2F1OA 3WA7A 4AJOA 1NPDA 1NF9A 3AESB 3DHEA 4D4KA 4EO4A 3VO9A 4UXJA 1VLVA 4F9TA 5DGIA 1CY6A 1C30A 2EYUA 2QVZX 4RWEA 5DW3A 4DQKA 4LYFA 5JNVA 3RSSA 1YZNA 1AQLA 2J0VA 2DBRA 2C82A 3BM5A 4YLEA 3HU5A 1T35A 5TQJA 4HB0A 4D0SA 2AR0A 2EFGA 5AJYA 5SYNA 1X1BA 3QBDA 3UAXA 3QQPA 2VLIA 2QG9A 3BEOA 3JX9A 5KNCD 2YHSA 4BQIA 4RD4A 2ZSKA 3M9XA 1WIWA 3VRHA 1O5OA 1T9BA 4BU0A 2BUBA 5THQA 3GLFB 1U28C 1VMKA 4QXRA 1M8KA 4LVUA 5KX5B 5T4BA 3KTDA 2HMUA 4K6MA 3VNAA 5TQVA 3K9HA 4J2OA 2IGBA 4E5PA 2R44A 2ZSUA 4NNPA 1EQ2A 2JFNA 2NV2B 3G2NA 3TRHA 4RHFA 1XJ5A 1D8TA 3JQBC 3LP6A 4PCLA 5TPZA 3IR7A 1Z6YA 1U2ZA 5FCDA 2GD0A 4ARZB 2EIXA 3MGCA 3G79A 3D6HA 2Q4TA 2AEMA 4CRWB 5J23A 4WE3A 4BVFA 1P0QA 1VRWA 2Z04A 3IGFA 3IOMA 4XM1A 3RVNA 3NHSA 1NP7A 5LL6P 3Q3CA 1F9AA 1AZSC 1FCJA 5CNMA 2GX6A 5A5VA 4WLFA 2X1VA 2WHXA 1GRVA 3K9CA 5IJAA 2KW5A 1THMA 1KMQA 3IA7A 4HPJB 1KP9A 3TUJC 3UMYA 2C5LA 3H9EO 4PSDA 1E18A 3ASVA 4RTOA 3JAWA 3AKDA 1RZ3A 4RESA 4YUXA 3WGTA 1NBOA 3FOEC 4V0KA 4DJEC 2WUDA 4UEKA 4OHVA 3S4YA 2Y0EA 2R7LA 3B6MA 3ADKA 2YW9A 4YJHB 5CPBA 1TECE 4QPNA 4ERXA 4JLPA 3I01A 4HAUA 1R6AA 1BMQA 1JSCA 2BUCA 1T4BA 3A6KA 5I7WA 1QB8A 4MQ6A 3JASB 2NUAB 2Q27A 4B34A 1RCUA 3FB4A 4XWWA 3LVBA 3CUSA 1FBTA 3O8QA 2FVYA 4U7WA 3TUIC 3WMGA 4E5YA 2QR3A 3C3WA 4RSHA 2ZUWA 2FEWB 2JIZA 4XX0B 1GZUA 1ZN2A 2WKWA 1UJ5A 1K8RA 1UJNA 3PFWO 1E61A 5LJIA 3G1UA 3KXIA 2A8YA 4U39A 1IE3A 1DPGA 1JKMA 1WP4A 4RCZA 1VJ0A 1D4ZA 1WLYA 1E4EA 3TE6A 2NTJA 1NE2A 2AFIA 4O02B 5EKXA 5HM6A 2PRZA 2HF9A 1U9JA 3FFAA 3SJ7A 2DFPA 3DEFA 4PCVA 1BCSB 3ROEA 4A1OA 1AOXA 2IUTA 4KIGA 4C3VA 5JYEA 4CG3A 4ZAYA 2J3DA 2WJVA 5D1HA 3NO4A 4II2A 1PWHA 4I1IA 4W5WA 2RK4A 1RQ7A 3OOHA 4QU9A 3KQSA 3UUEA 2REQA 2LUOA 1U3GA 3VUEA 4NYMR 2ZM6B 5EWJB 5IDQA 1U5BB 2AJCA 1DMRA 3STWA 1ORTA 2W98A 3WYBA 4PYQA 1HE2A 3FTNA 1JECA 3OZCA 2H1IA 4KI7A 1KAEA 1Q7TA 3HRIA 1BGVA 5LQNA 4TYYA 2YY7A 4C30A 4JJ4A 4DM3A 2XCRB 3DTVA 5DNWA 4NZOA 4EITA 2D74A 3AP2A 3UT5A 3VH2A 1LC3A 4KDFA 1QOPB 1YR7A 1CB0A 1RM4A 3LKBA 1NW5A 2GDZA 2ENUA 4F5ZA 1PFKA 2O2YA 4WZAA 3WL5A 2Y2VA 3CRZA 2X40A 1O2DA 2O6LA 3WAGA 1PO7A 3I9NA 3EIHA 5E2BA 1SZPA 3QJ5A 1JH8A 3MCZA 1SG0A 2X6TA 4PZZA 3WFIA 3D8BA 2IS1A 2BDTA 2DM6A 2QRVA 3FPKA 3DFIA 5ALIA 4RTLA 1UFVA 2VJYA 4FIDA 2V6JA 3SM9A 7REQB 2WJYA 3PWZA 3GGDA 5L6MB 1GR1A 1CRLA 1XLWA 2ZRCA 5K6AA 3D8HA 1A9QA 1AGXA 1PGOA 3CPHA 3LL7A 4H7KA 4O4HB 4BMDA 1GNLA 2QGFA 1VRVA 1ZM2A 3V7NA 1AXRA 5FTLA 1DLJA 1UXHA 2CW5A 2OOSA 4PAMA 3RYHA 5AI8A 3WWEA 2P4SA 9ATCA 2QK4A 2QTBA 1IULA 3B89A 4YJKA 3D6VA 5FADA 1S2IA 3I5AA 4Q21A 2QBYA 1G4UR 4BNHA 3LQKA 2AKEA 3S8YA 1EX9A 4DYVA 4OFBA 3QWIA 1QH9A 2P9YA 4LMAA 1WXXA 3PRYA 5JT1A 4Q7QA 3L8ZA 3SHWA 3M2TA 3AKZA 1EKXA 5JG7A 2PGAA 4UU0A 3B3QA 1E66A 3K35A 4UM5A 2CLEB 4PNZA 4LGMA 1ZIPA 4D5EA 4F6RB 3ZKWB 1CQJB 1BCSA 4GSYA 2ZB4A 1OTYA 1M5UA 3THWA 5IHPA 3PHGA 2B99A 4HG2A 4JI5B 1G8MA 3MF4A 3CURA 1EB8A 1HRKA 1XP5A 2Q6VA 4NHEA 4P5PA 5DHRA 5K8UA 1Z4PX 3FB1A 1IPFA 1XKQA 3EDRA 3HSSA 1Y7PA 3IVAA 4F7DA 1P9OA 3HCNA 3JPWA 2FI1A 1P2VA 5ERXA 1BKDR 1EFDN 1H69A 5HIJA 3V7UA 4L0MA 3NBZC 5KSYA 1B0PA 3N7UA 3SQWA 2BH2A 1UOPA 2G9QA 1ZN9A 4M38A 4X24A 1NJ5A 3DDCA 3MW8A 3GLGE 2UUBB 5AUPB 2PUHA 1X7ZA 1WXEA 2R85A 3OX4A 3OQBA 1V9CA 3EXHC 5JSHA 1DCFA 1B6SA 2C5AA 5ALUA 4X63A 4GKKB 3QG1A 4GVPA 1UZNA 2C7GA 2WJJA 5DI3A 2XDYA 2WJ3A 4RK0A 4W5JA 2C3MA 2Z5FA 4G4JA 4F93B 1M6NA 4ENVA 4C04A 4JVNA 5G3ZA 3WLJA 3D4NA 5DTMA 3A1VA 1V47A 4LXGA 1HL3A 3N2ZB 4KO1S 2P3OA 1JF8A 1Z63A 5GGXA 4LV5B 5U9CA 2ZXEA 3RLIA 2G1PA 3VU9A 4JY7A 1COWA 2ZBVA 2QRZA 1NW7A 2NZVG 4Q02A 5DNUA 1DO0A 1NM5C 1NVAA 4OP1A 4LJ8A 1EFPB 3S2FA 1EJ0A 2Q3DA 5H02A 4DG9A 4GEGA 3H65A 4RAQA 1U2RA 3RHTA 1J8DA 2HREA 4XIYA 4GBJA 4ZQEA 2O48X 5HKOA 1A9OA 1XXHA 5K9ZA 1YTUA 1QGUA 4BMSA 5HRAA 4UMFA 5JXHA 3EVTA 3VKHA 4YV0A 2DPGA 2E21A 3ZWQA 3ABSB 3OECA 4GMDA 4D9NA 3AOGA 4V03A 2REBA 4XLTA 2WVJA 1ZCJA 4IIJA 4O0LA 4BFCA 1PJBA 2ZUBA 3PC7A 2PQ0A 4NU8X 2H4YA 2X1MA 2P2ZA 3L8GA 3LVRE 3TVTA 3FNHA 4BKPA 4DIKA 3DLPX 3PP8A 1VQ1A 4JLDA 4X3OA 2QTTA 2B1QA 1D07A 1KEZA 2VTVA 5ELLA 3TCKA 3O82A 2BTOA 5DBHX 5IBRA 5M04A 5AVXA 3TVDA 1U1FA 1KH3A 2ZB2A 3G02A 5DEOA 4WXHA 1ZJ6A 4ZFNA 3L82B 2HT1A 3JQ8B 4OQZA 5AM2A 4CEHA 4F21A 1PX2A 4W5RA 3DWFA 3GDWA 4NE9A 3DMNA 4W99A 2H6EA 4RE5A 3KSMA 3I9KA 2R0QC 3P4UA 2WIGA 2ZSDA 1NAHA 4MV9A 1MEJA 1M0WA 3W2EA 2PO5A 1ZHOA 4G4SP 5BRJA 4RVUA 3QMPA 2LV8A 4RYDA 4GECA 1TKBA 3SICE 1H9BA 2QVLA 4PINA 5GONB 2JASA 1M2NA 2WMYA 5K0NA 4YP1A 3MQ4A 1PG0A 4DIBA 2QUBA 2YFYA 1RCFA 1TJYA 3EPRA 4KYIB 3LU1A 5CLGA 3CVYA 2PRIA 4F4FA 4DHWA 4QTUB 3DFUA 1U7PA 3DFFA 4BE4A 4HAZA 1NASA 4MI3A 2X86A 1QKKA 2QVCA 3ACCA 1J07A 2WLSA 2ZIXA 3EUFA 4A8JA 5JS6A 1JI3A 1LZKA 3KZXA 4KRFA 1SQFA 3DHWC 3AIIA 3I2HA 3EW7A 4MP3A 4H1UA 4JGGA 4Y2VA 1I3NA 2J9FA 5JD3A 1J8VA 1GSIA 3JXEA 4D81A 5HM8A 1SIOA 5T5QA 2B4KA 2BEUA 3ZNNA 2GBCA 1S8OA 3EXHB 2A9KA 4MRNA 5ALYA 5ENDA 4FFPA 3UYLA 3C6XA 4L8LA 4BNXA 5BXQC 4OLBA 1BEUB 2WNSA 2YFKA 4OEHA 2R6HA 2GAIA 2G28A 4PE5B 4ARAA 4WY5A 3DVRX 4JYZA 3BILA 1F20A 1AQJA 1KI2A 2YXDA 1LNSA 2I7DA 4L5CA 2GJSA 3GLKA 3WNBA 1Z29A 2I54A 1BU8A 3CM0A 3G23A 3L43A 4M8SA 5ALRA 3JWEA 3OU6A 5K3FB 3HYTA 2RJOA 1GDHA 3INRA 2BCEA 3AHJA 1I9CA 4LXIA 3TOCA 1YJAA 3IIJA 421PA 1L1QA 3TJZA 1IUNA 3U7JA 3VR0A 3GP8A 4C7OA 4KH1A 2ATEA 3C3MA 4W63A 5JPIA 4NJMA 1GZVA 3MCUA 4N3NA 1LBEA 1ODCA 5M34A 3RJMA 5D8DA 4HMOA 1PJ8A 3C6ZA 3WAKA 2IXFA 1NN3A 2YWCA 3OOWA 2VQFB 2FPIB 2QVBA 4DXAA 5BUCA 2QU7A 2QJOA 2H2WA 3TQFA 4YDRA 2J3MA 2A35A 4HJXA 4EW1A 3EPLA 1BMFA 3PC2A 1UMBB 3SQNA 2JJ2D 1EHYA 1NUHA 2V4ZA 2G71A 4HZGA 3ROGA 3C6YA 4K0KB 3EIQA 3IJRA 2OMKA 3TNYA 4OBXA 1IY8A 5BUSA 3ZHBA 3C5WP 2VDOB 1M2VB 5K7SA 5FR1A 1IHYA 4DGSA 5F7XA 1T43A 2IDKA 1IOZA 4HQOA 3UH0A 3KQUA 1M1XB 5FTNA 3WIDA 3IEPA 4J0HA 1AHHA 3KXDA 1V3VA 1GPNA 2IIPA 1K7FB 2TRSB 2Y1DA 3PHIA 4NPCA 4R7GA 5GGYA 1JPNA 2FSHA 4BTEA 4BV8A 5HQTA 1NPYA 3X1JA 2FFJA 2YCLA 1PQUA 1BEEA 4EPTA 3QVSA 2Y0PA 1JMYA 3HCPA 4IRUB 4C4TA 5BV0A 1ZCBA 1E5LA 3AUFA 4BJ3A 2ZRMA 2AMYA 3BFKA 3U4IA 3EVCA 1WF3A 5KREA 5IYZA 3FMPB 2H92A 1C1YA 1W8DA 1TQHA 2DH5A 2C8LA 3LW8A 3OZBA 4FZ5A 3DLCA 4RHUA 4KFUA 3GG2A 3UOWA 3STXA 1KO4A 3LYHA 5K0CA 1VPTA 4HJRA 1JBQA 3NTVA 4FNOA 1HO3A 3G68A 3UT6A 3VC1A 1ZICA 2CDAA 5JJIA 3M5PA 4S1NA 3TRIA 4PBTA 4X44A 5AVQA 5JAZA 3P0IA 1ZHHA 3TB6A 1YKGA 2YDXA 4FMBB 2R48A 4ILEA 3TTYA 1QRAA 3H2JA 3WYCA 3E5HA 2X41A 4DS3A 3U4AA 1S8NA 1X1DA 2ZWOA 3DLIA 2VP4A 2OM2A 3JV7A 2GM3A 4OYYA 2WAYA 1XB2A 3EMBA 2E4YA 2IHKA 2J9YB 4IR7A 1T0UA 2GZDA 1OILA 1ZVJA 1OFIA 2WM2A 3CKLA 3OWOA 2DHQA 1E9AA 2H63A 4FDMA 3PQFA 1J5EB 2DGDA 2DPLA 4WJKB 4HAVA 4LA4A 3PPYA 3LF1A 1AUPA 2YR0A 1KQPA 1G41A 4QYIB 4B7CA 3ZY4A 1IN6A 3BRQA 2HA6A 2XRZA 5FI1B 1TLTA 1U0RA 1BXRB 3TBFA 2NU7A 1Q0TA 521PA 5A6SA 4FDLA 4IF4A 4OKIA 3O90A 2RBEA 1PGNA 2R6FA 2CDCA 4HR7A 1XTZA 5ICGA 4EP1A 1U1DA 4NFYA 5C81A 3V4VB 3WICA 4QT4A 5ADHA 1BS9A 2M9MA 3F3MA 1P1HA 5ANRB 1G3MA 2NT4A 5DPMA 4HUTA 5CNJA 3KOUA 3OIWA 1H0RA 4K6OA 4ZTBA 4B3XA 1EUCB 4MIOA 2H11A 1PFYA 3OJFA 4B3FX 1M1NB 1P17A 1Z8HA 1JJBA 5CJ2A 2YX1A 1VL8A 1GAXA 5E1OA 4HO1X 5HQ3A 5BN4A 4D9KA 3ENZA 3PHCA 4KQ1A 5M29A 1L7VC 2PRKA 3K3PA 1M7GA 3O4JA 4MYHA 1PYOA 3WLFA 3R5FA 2FHSA 3EXFB 1V3UA 5HF9A 2IQIA 3ZU6A 3CSSA 4X97A 4UTOA 4M7PA 5A4DA 1CS0B 1PDOA 1E63A 5A7HA 4MW0A 1G42A 1JKIA 4TROA 4JX9A 4M1YA 3U37A 1JZQA 1GPH1 1JXOA 2A9OA 2G76A 4OJMX 3U40A 1HYHA 2AGVA 4CN8A 2YVAA 4N03A 3P20A 3T5CA 2QN8A 4PF1A 3H5TA 1QJCA 2OHXA 2VP0A 3BK2A 3IELA 1ZS9A 1HTTA 1ZUNB 3FBTA 2J3LA 1CUDA 1LPSA 2FK8A 2KYRA 2YDYA 4QUAA 3DPSA 2ID9A 4RA6B 1SBQA 4FNGA 4YROA 1YR3A 4JH0A 3TQQA 5CDUA 3EA0A 4OQMA 4GKBA 1GKLA 3CUEF 2I78A 3H99A 2V7TA 1YQWA 1J7JA 2DVMA 3F7OA 2ZBPA 1GPYA 3BCUA 3HWSA 3MS7A 3NONA 2O8VA 4YC7A 3T8YA 3H7AA 1DFHA 5FFNA 3G2MA 1UK7A 3GYGA 5I7FA 2WIDA 1E3DA 2YH2A 4ZC1A 4Z3KA 2IP4A 5FORA 2FLWA 3O8LA 3ROFA 3IJPA 3W8NA 1FSPA 2N46A 1SWVA 4BP8A 2HW8A 2ZYGA 1JPUA 3EEOA 2A1UA 3R3UA 1O0SA 1GL3A 1Z3CA 2XNKA 2V7QD 4C0BA 2NQ2C 3THWB 2RH9B 4JI8B 4G97A 3J7AC 1LA2A 2YVUA 1F7VA 1AKQA 1SHJA 2QX7A 4KBFA 4ALNA 5LZ9A 3HNRA 1ZPDA 2DFTA 4RL4A 1YWGO 4QPZA 1OC4A 2AQKA 4R3WA 3DM9B 2OORC 4TZKA 1JAIA 5ESXA 4FWTA 3K6RA 3WYNA 4IMRA 1XTUA 3O4RA 5E95A 1FK8A 2I2XB 4V0MA 4OXXA 16PKA 2YMMA 3R3JA 1XO1A 5CH8A 3CCCA 2QRQA 1FRNA 3V8EA 1D1PA 4EIWA 4OSPA 2YWGA 2WPNA 3EPKA 4C5CA 3EVNA 3H4TA 2JGMA 1YS7A 2D1SA 2Q5IA 3AV3A 1MC5A 4EW3A 2HU5A 5K6RA 1CUSA 1UC5B 4FN4A 1RJWA 4M53A 1ZQ1A 3AFHA 3HYCA 1DEAA 4L95C 3RYIA 4D9FA 4NU5A 3D8TA 3P9YA 4MGYR 4XIIA 3JAMA 3W6NA 2O8BA 4O25A 4C89A 2NUPB 1NG1A 1ZC3A 1CJSA 3EXEB 3EDQA 1XEWY 2P3QA 3C4JA 3FYUA 1QE5A 2GBLA 4JA2A 1M2KA 2UYHA 2Z57A 2Z2ZA 4H7EA 2IPOA 2VP2A 2WA2A 4LG1A 3L40A 5IWAB 3GJ5A 5FBKA 5HZGA 4EKEA 2ZBFA 3WQSB 4LC1A 4ZRDA 1TVEA 3HL4A 2WY2D 2KI5A 1TU4A 1C41A 5LR6A 1WY7A 3GP5A 4CDMA 2HRCA 5JZMA 1VKZA 2NX2A 1LVUA 3ZXXA 5EHXA 1V8OA 1QS0B 5KTKA 4I0WB 1RZRA 2VRCA 2YN2A 4OGGA 3YASA 5MN5A 3MT0A 4H3KB 2WICA 3D43A 4XX1A 4GBGA 2BFBB 1BKYA 2PZ8A 4F4HA 3S81A 4OI0A 2FEPA 2ZJ4A 5HJ5A 1PT6A 3KDAA 2PYDA 4MINA 3I3OA 5HJEA 1CWUA 1UQRA 2FGKA 1Z73A 3IHWA 1ZUIA 1JKJB 4LBZA 5AK4A 4MVJH 4HP8A 4RFVA 4IJ6A 1D7OA 1QF9A 1I36A 4RD3A 4LMRA 4A26A 5JS2A 3PHJA 2O8CB 4PZEA 4RPGA 4CFYA 1KVSA 3VR3A 2W71A 3WY9A 1KYTA 1Z22A 3PL5A 5CYOA 4CMHA 5HRCA 1XZJA 1KS2A 3RFUA 2EYQA 3NCHA 4MUHA 1E0DA 3KALA 1RXUA 2O1EA 3KZMA 3R0IA 5GP1A 3TLAA 5A3QA 1I1QB 4NULA 3RAFC 4WEQA 1W35A 2FDRA 1TEVA 2YJ6A 1DQYA 3ND8A 4IMJB 4IXTA 1FLVA 2Y0CA 4MV5A 4CEJA 4N4AA 2IYRA 5JWRA 1E4YA 4XAQA 2GPWA 4MTLA 3ET5A 1JR3E 1RRGA 3A1FA 3PLNA 2NXNA 4CM7A 3DEZA 4JOQA 3HKEA 4RY2A 4JI2B 2Y6VA 1XRPA 1ISGA 2Z8YM 3U61B 4ZIRA 2B3TA 2EZ8A 2H07A 4BRUA 3U09A 2VDUE 1WWKA 1ZGCA 3I4LA 1PWZA 3AJ9A 3HDGA 3QFFA 5IJ0A 1GFSA 5DTRA 3OLWA 4JC4A 5A71A 1B1CA 2AG8A 1GZSA 4BXOB 2HIGA 1A88A 3DCIA 1M8JA 2I4LA 4FC7A 1OFUX 4FHCA 2HMAA 1YZUA 2PUTA 4M1EA 3OIFA 4PPGA 1EAYA 4F45A 1ZGAA 3T3PB 5IU6A 1KMNA 4YCAA 3OP4A 1C3JA 1QIJA 1M1YA 1IPEA 3C7CB 4HSGA 2PAAA 4P80A 5AJXA 2HKIA 3IVGA 5FQOA 3A3NA 3W8RA 4BPBA 2FKAA 1EPUA 3NHJA 4G0XA 5A5FA 4G0WA 4A7PA 1XMQB 4DE5A 1YZHA 3UXHA 3CPJB 2QY9A 2YIDA 3CC8A 2WJIA 4G4GA 1TJ3A 3IOYA 5T4EA 3WZLA 1NVVR 1J0AA 1K27A 1HDIA 1C0EA 2YWDA 1SKBA 1M0TA 3FX2A 4KQ2A 1FU8A 3I05A 2P11A 1ADYA 3IUQA 4BFWA 1EZZA 4KO4S 1QFSA 1CR4A 2G80A 4OV6B 4JJAA 1FZQA 3OLQA 3IQXA 4YRCA 3VZPA 1O0BA 1ZMOA 4NBVA 1Y1QA 4H16A 5E4JA 1XKTA 4X7RA 5E2AA 1ULHA 4IJVA 4RXTA 2NZYA 3C1TA 3UBMA 1E3EA 1SCUA 2B4AA 3PDHA 1N5MA 3L84A 4JR2A 4NV1A 3L02A 3PD1A 2GZAA 5EP2A 4L02A 3AUSA 2XUZA 3GQBB 5ALJA 1SEPA 2B2NA 5TB5A 5DMHA 4AB1A 1H3NA 3L06A 1X7ZB 4YCNA 3VOBA 4GG1A 3WGHA 1JTVA 2FNAA 3IRVA 4TMXA 3G2QA 4MV6A 1ZESA 5FB3A 5HP4A 4EEZA 1MAUA 4F86A 3DD1A 1Y1KE 1W19A 2P67A 1U9CA 3IOEA 1DAEA 3R41A 4YYEA 1POWA 3WGUA 5IJ9B 5B2EA 4RDXA 2FPIA 2ZRBA 1V11B 3TDNA 5DE3A 2P9FA 4C0LA 2NU9A 4J49A 3NWEA 3NHUA 4D8TA 2R6DA 1YA6A 3ZQUA 1EEHA 2O7RA 5BNIA 3DJYA 1I7DA 2L42A 2JKYA 4HD8A 3QY0A 3QEBZ 2QZ4A 4PO3X 1FMTA 3KOOA 2QTZA 1FX0A 2F6RA 1E2LA 1W4ZA 4KQKA 1W49A 1E77A 4UHBA 5KVAA 4GDFA 2OV6A 1WQ1R 4EI8A 1OBCA 3NVAA 1N36B 2XB8A 3EDCA 1H3EA 4A36A 2AH5A 1A04A 2L82A 4PQEA 2FK7A 3LUHA 1EFVB 3GZNA 4RLSA 3HVJA 5BN1A 2CNWA 1YHZA 2Z43A 3GELA 2GJ4A 3WRWA 2CLFB 1SVKA 1XA0A 2BEWB 3GC6A 3I64A 4WNIA 5HJ2A 3UV3A 2ZSJA 1MFZA 3DZBA 3L6EA 3MWFA 4N5NA 3RU7A 3T7AA 1K7XB 4B75A 4DC1A 1LH0A 1N9GA 3U56A 2NOAA 1STOA 1T3ZA 2FFAA 4TKUA 4X62B 1TUIA 1YJ5A 3BD9A 5AFSA 2GPYA 5FP0A 1QHGA 2RAFA 2Q4BA 1CY1A 1Q0UA 2VH5R 5FYQA 2CL5A 3ZWXA 5CLLA 3M5DA 2IYZA 4DXHA 4TTQA 2EC5A 4DCNA 2DLCX 2EU8A 3VYTB 5JPCA 1SCUB 5EUBA 5HIKA 1YD7A 2P2GA 3K96A 1K2VN 4PYIA 3RUFA 1IJKA 1FP4B 4DIOA 4S1VA 2GI4A 3I28A 4IRMA 4U1RA 3IPRA 1JHPA 1K5PA 2HJRA 2J9XB 4YJ2F 1KNXA 1NT2A 3BXHA 4LRUA 5DWVA 3UXMA 2R4QA 1DO8A 1R0LA 4C2AA 4MR9B 1P44A 1NVTA 3AH8A 1KOLA 4ZU6X 1P9NA 4Z0HO 1GR0A 2XT6A 4GDMA 4X7BA 4ZEOA 4BNZA 3LT0A 3JQPA 4PZCA 1UMDB 5AM1A 5BP7A 1KAOA 2FMXA 2HBRA 4HUJA 3KTAB 2V74B 1J2TA 1QHSA 3RVBA 3BMOA 4M1WA 4FWBA 4RV4A 4CHGA 1RKVA 1HBJA 3OQHA 3RWMB 3UJPA 3JQQA 1N6NA 2WA1A 2QP9X 1VE5A 2IP2A 3O91A 5AKZA 4C4PA 4EB8A 4FX2A 3DNMA 4IXNA 2E1RA 1EDBA 2E4WA 4BNFA 3FSGD 2GM9A 3RC1A 2FP4B 3BWCA 2FWNA 3ADOA 1AQYA 1GYQA 1NIJA 1E7WA 2P2DA 1KR2A 4C4AA 3W05A 3LLUA 5ALVA 5CFLA 1W5SA 1Z82A 3WLPA 1AD2A 1KXJA 3NOOA 4Y9DA 1EG2A 1IZ9A 1FUYB 4YVFA 2ZZMA 1QHIA 1TKCA 1T36A 4ENSA 1Y63A 1MCZA 1OHHD 1X39A 3AFNA 1BCRA 1EP9A 1KSJA 3LCJA 2GAAA 4IZIA 2FW9A 4JLVA 3KOYA 2VJAA 3GT4A 3R6DA 1PEYA 5AVZA 1YJXA 2F1RA 3EXG1 4NR0A 3CEJA 4PSCA 3D2AA 2RAPA 4TLBA 3ZCTA 3EG9B 2VDJA 4JP2A <