4GOSA

Crystal structure of human b7-h4 igv-like domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
HSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and cancer immunotherapy of the B7 family member B7x.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords V-set domain-containing T-cell activation inhibitor 1
total genus 29
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gosA00
4HLJA 1J0ZA 4GXUM 5I73B 5DTFA 2AK1L 4P2OA 1QRKA 2ICEA 3EYFA 1KGCD 1VSCA 1MRFH 5JMOC 4Q9CA 4BSVB 5D7JD 1H8NA 1IAKA 3BP5B 2C3VB 3EOAB 5E5UB 4ZFZB 3B8YA 5DVKA 1BIIB 3MRDB 4PRPE 2V2XB 3G5ZB 3DX7A 5DRXB 2BMKB 3T09A 4PR5A 5HPMB 1KT2B 3JWDH 2OLDA 1YEHL 1P5UA 4UDTB 2R69H 5LCVH 2WNGA 3HR5B 1T5WB 3OKOA 4YIQB 4YE4L 2DTML 1EA9C 1K5NA 5CJXC 4XHJD 4KKLC 5FYKL 3HPJB 5IB4B 3LKNB 1T1ZB 4G80A 4Y7MA 4GRWF 4PJBF 4X4YB 1A5FH 5ABDE 1D9KA 3ARGD 2IH1B 1JZ2A 4Y2DB 4UZGA 2NXZD 4PG9A 5C0EB 3T0BA 2CDEA 1FL6A 5GRVL 3CDGB 4HCRL 4D9RE 5FUZL 1CD1B 3E6HA 3SQOL 3BQUC 1NEZB 3X12B 5EIIB 4ZQKB 2WV3A 2VQUA 4MQSB 4X4ME 1MIMH 1RHFA 3LCYA 1NCUA 3C60A 1KIUA 2IANE 1NGXB 1UT9A 3QWQB 1RUML 4U6VH 4LDLB 4FQQB 4G6AC 1CFTB 4OLVL 4G9FE 5KS9A 4GJTB 1KNOA 1FL3A 4Y16D 2VDQH 2OXHA 5H35A 1ED3B 4KI5E 5GXBB 3OKKB 3QXAA 5A2KH 4WFHE 3VFRA 1QBML 3O81A 1NH6A 4M7LH 1JZ8A 2WUCL 3D48R 4HWEL 4ZUSB 3QT2A 4NKIH 4HWNA 4HLZH 4M5YH 4OZ4B 1IEAB 3QUKA 1KPRA 2IAND 5T1KD 5JQ6H 3KDMB 2GJ6B 2OZ4A 1NCTA 4ELME 3Q1SH 3P73A 2FB4H 5ICXB 3L7EA 4TSCH 4CL7A 3C08L 4NUGH 3HG1B 4X6EB 3LHPL 5IVXB 5CUSL 5MP6L 3WNOA 2VITA 4OF7A 2Z91A 1J8HD 2EYSB 3RVVC 5BS0B 4YEEA 1WWCA 1ACYH 1EHAA 1BMGA 2A6DA 3LEXA 2AP2A 4APQD 2W0FB 1UZ6E 3FT3B 3LD8B 2HLFD 3ZSTA 3ULUL 5C0AD 3Q5OA 5JOPD 3Q6GL 3EW3B 1CDCA 3SDCD 2G5RA 5KSBB 3SE4A 3FCTB 4W4OC 1BX2B 1CS6A 2IFGA 4LHUD 4OZGF 4KRMB 3QDMD 4KVCH 5FGSA 2D0GA 4GQ9H 3WNKA 1NGZA 4UINL 4M1CC 2WP3T 4PJ5E 1UEYA 5DHVH 4FRWA 3RL2B 1FLRH 3NIFF 4ZUWA 4MJIA 1YMHB 2F53D 2BVQB 4HQQL 3W0WD 3LVEA 1IZJA 4U1LB 1FYTE 5ALCH 2Y7QB 2MWCA 4JRYE 4OLUL 1A6VH 4GRWB 4J1UA 3LD8C 3S4SA 3P3YA 5D5MF 5F71A 1SJXA 3AS2A 3OAZH 4JANB 2F58H 4I77L 1P53A 4I2XE 4PJ5D 5GS1B 4J3OC 2ZPKH 3U0PA 3GSNL 3C60D 3HA0A 2B1AL 4PRPB 5D2NA 2JJTA 3KYOA 4HIIB 2VN7A 1RQ5A 4WU7A 1J0IA 2BDNH 4WNQA 1BZ9A 1C12A 3TZVB 3VMOA 4OIIH 2FL5A 2DDQH 4EDXB 3RIFK 5I1JL 4P57B 1VEPA 4WWKC 4L8SA 4ZUUA 5F97E 2W38A 3JZ7A 1T22A 4QGTA 3TM6A 4JZJA 4ZS7H 4L4VA 3RKDC 3ZDZE 4AIZB 5K59E 3VGGA 2L4OA 4RGNB 2FL5B 3A6BL 4RA3A 3RTQD 4KRNA 4Z7UA 3CVHL 3M8OH 5IW6A 5GJTL 1VESA 1A6PA 3REWA 3V9FA 4IS6B 4IDLA 3EYSL 4MZ3A 1PQZB 5CJ8A 4GRLB 1ZSDA 4NWUL 7FABH 3TEUA 1XGQA 4FQJH 5LQBH 4NC1C 5FO8B 2DM3A 4XPAH 1CT8B 2B0SH 4NKMB 3E3QE 1KJ3H 3K2MC 3UBXI 2EDWA 3IETB 3OKNB 3WYRA 2X4TA 2FGWH 1QOKA 2D0HA 2I26N 2WQ8A 3FN0H 3BESR 4JPKL 4OF3A 3UTQA 4YQXL 5JXAL 1KUMA 2DLGA 3H9SA 4UAOC 5CBAA 4RNRB 2HMID 1B0RA 2W60B 4JFZL 1X9QA 2QTEA 4DEPC 3C87A 3HUJE 4ZUSA 4J3WA 4Q58C 4NNPL 2AJ3A 4ZNCD 4JPWL 4D0DB 2WIIA 3QCUH 1CF8L 3MGTA 4Z7NF 1KXQE 2F19H 2AJZB 3B6SA 4AYFA 1TVBA 4HUMB 4XBGA 4QTIH 4WENB 2EH7L 5GIRA 2PNDA 1RUKH 2XACC 1G6RA 2VLJE 3QO0A 4QEGA 4YPGB 4PJCF 3VXTA 2ZCHH 1DQQB 2VERN 3TV3H 1LD9A 3TNMA 2EH7H 1P4IH 4JY5H 4BK4A 2YD5A 4N9GB 4X9FA 4F7TA 5IMOB 1NBQA 1KJMB 1I7UA 1W0WB 4EIZC 2CKNA 1MCWM 1U58A 1RJLB 5EOCH 3RAJL 4N0RA 4J7RA 4RWHA 3INUL 1PY9A 3PHOB 2EXYC 3BGMB 3OGCA 2PYEA 5DK3A 1DBJL 1F8TH 4NRXA 4NJAH 1EDQA 3SDXE 3WHXB 1A2YB 2E9IA 4JO3L 3AAZA 1R5VB 3L3OB 3SDDB 2DWEA 1MCIA 3DO7A 4FQXB 1NMCB 1C5BL 2X44D 1G1YA 2AABL 5GGTH 3SO3C 2JK5A 4M62L 4LFHG 3UP1A 2EDYA 2Q86B 3EFFA 1CDHA 4RX4D 1Q38A 3T2NH 2GY5A 1YDPB 2IWGA 5GZOC 5C0DA 4IIQA 4X5WB 2QV2A 1U2HA 3IDJB 3B9AA 35C8L 3F58L 3ABZA 3EO9H 2R2EA 4XPAL 1KPVA 3DOSA 4LF3B 3NFNB 2GJZA 4PPTA 1L9NA 5TH2B 2CJUH 1UH4A 1A6AA 3OHXB 1BFSA 3KWWB 3V2AR 3V95A 4S2SB 3RWFA 2YHGA 1E4KC 3BPOC 5DJAA 5B21A 1NPUA 5JO5B 5KN5B 1PX4A 1JK8A 3RX7A 3G9AB 5HVGB 4P46D 2CK0L 4UTAH 1T7WA 2UZIL 1WIOA 3OKEA 3CK0H 5SWQB 5E1AB 3UTOA 1KLUB 2EDOA 3QNZB 3UBXA 4S1SH 3CU1A 3PWNA 1MCOH 1RJYA 1T4KA 1M6OB 1OAKL 1X5JA 1OW0A 3WIHA 1CLOH 4NN6B 3VFUA 3HRZA 4XT1C 5EU3B 5DHYA 3LEYH 5D2LE 1GZQB 4EI6A 1EX0A 2E8ZA 5CAYB 3C5SA 3TFKD 2LAAA 1CLZL 4GKSA 1IILE 5C0CD 2ILLA 1WGOA 5CZXD 3QQ4A 5T3ZH 5HHOA 3WL9B 1UZ6F 1HSBB 2EH8L 2HN7B 3BDYL 3QHZL 1I3UA 2ZP0T 1DVFC 4AIOA 3UTSD 4HC1L 4NQCA 1VACA 3OKEB 4AM0B 2OJEB 4AH2A 3BIKB 3NZHH 5HYJE 2FECI 5C70A 3U7AA 1OLZA 1QRNA 2GFBB 3TCLA 3VDAA 5MI0C 2Q8BL 4RGOL 1DBAL 4RA0C 4JZNA 4OAWA 5JORB 4G9FD 3CXDH 5SV4A 3NACL 4HH8A 3PWUA 3BJ91 3ZT6A 4P4KA 3SHSA 2YXFA 4NQUA 4PP1D 3BH8B 1S7WB 3I6LE 4M3KB 4BZ2H 5BS0E 5IG7A 3DVNB 2ZUVA 4NCDA 1D9KB 1ROWA 4QO1A 1E27A 2R0WL 2AJ3B 2DJ4A 1YJDC 3MLSH 1V5JA 2V7NB 3BDYH 4LLWB 5DFVC 2YMXH 1QFWM 4I18B 2H2PD 3B9VA 3TO2A 4YIQA 1KCVH 3VXRE 2IH3A 4FQCH 2FO1A 3I6KA 2VDRH 4U6HB 1FVCA 3D39D 3TIEB 3IJSA 5KTEL 5JUEL 4HJGB 1TNNA 4NO0A 1JGLL 2XN9B 2XZQL 5TF0A 4PJAE 1ZA3B 3MLTB 5FO8A 4ZFGL 2VL5A 3RVWC 1AHWC 3VXMA 4U33A 2V2WB 1HH6A 2YN5A 3CLFL 5DDHA 1G7MB 4RGOH 2Q8BH 5JOPE 4RGMC 1QEWA 3VXRD 5J89A 5EULV 3SE4C 4L3CA 3RWIB 5DMGD 2JJTC 1KN4H 4B0MM 1EEYA 4PJ7B 2OTUB 4JFEA 4X8JA 1Q9LA 4K2UH 4U6XB 3HS0B 5HDQL 5CMAA 1P9MC 3S35H 4OZGE 1CE6A 3U46B 3AU1A 3PL6B 1BFOB 4MXVF 4HX1B 1F6AA 3UYOD 2UUDH 2FBOJ 4U7KA 1DQLH 3IVKB 1F4WL 1JCKA 4GW4B 4DZ8A 1DQDL 4K7PL 1IGML 2EE3A 3QUML 4HIHA 3R0MA 1H15B 3PIQB 2EZ0C 5J12C 4BSVA 2NY0B 3GI8H 1JPSL 3MBEA 3HNSL 5IHLB 4G42A 4HC1A 5IR1A 3WNLA 4NQCD 4P9HH 3AREA 4OLXH 4N1CA 1M4KA 4PRID 3TF7C 4NFDA 4LVOC 5ALBL 3RUGA 4M4RA 3PL6D 4WJ5A 2VZTA 5CILH 2W0PA 1T1YB 1TZIB 1JWUA 1NQBA 2IADB 2QSVA 2DQIL 1J1OL 1MLCA 5EBGA 2CJUL 1EJOH 3UO1H 4LP5A 4CRPA 1D6EB 3U46A 3ZE2E 5IFHH 3MUJA 4MD4A 1BBJB 2BZDA 4HF5H 2P5ED 5BRZE 3ZE2F 2A83A 4PRIE 4JFFE 3ARVA 5HGGS 2CGRH 1FN4A 4J6RL 3FCTA 5TE4H 1GIGL 2NW3A 2JCCF 1F11A 3BD4A 1IM9A 1LNUB 4DUVA 1YEEL 1K2DB 2W9DH 5K9OA 5J6HA 3MRLA 4PB9H 4H0HB 1I7TA 1UGNA 3ORJA 1JN6B 5HDBE 3RPIB 4ODTL 1FFRA 3GBLA 3CLFH 1A6ZA 4P2RE 2Q1EA 3QRFM 2LVCA 3FOMB 3PXJA 4MDJB 4ZFGH 3SDYH 2LFGA 5EUKA 4WW2B 2F74B 4JJHA 4JGJA 2XZQH 4KKAD 1OTSD 5EZIH 2Q6WB 4M6ML 4IRSB 1J1OH 2WBKA 1MQKL 3EYUH 5INCB 4XP1L 1MJ8L 4QTIL 1EAJA 3CPLA 5DSCA 5M95B 3TH4T 4LPWA 1ZVSB 4GRWH 3MLSL 2F5BL 5IVZA 3GRWH 3KGRA 5AWNH 4DUWA 1SJEB 3SO3B 1F4AA 2VLLB 4UIMB 2LU3A 5HY9B 1QLRA 1RJZB 1TMCB 4X6CF 3P4MB 5J11C 3G5YB 4QNPF 1ND0B 1CZ8H 3X13A 4LRIA 3MUHL 1IGMH 1FYTA 4TNVF 4LLMB 4JFZH 2X05A 1FNSH 3UTTB 3WUWB 1BVLA 4FFZL 4G8FA 5E08L 2V5MA 4HBQA 4HWBH 3TCLB 5T1MB 4HIJA 4HKXA 3ARGA 4JO4H 1KIPA 3QO1B 3BW9B 4F7CB 1KOAA 3A6CL 2J8UE 4MA8L 1NCCL 3FO2B 3S37L 1RFDH 2MQCA 4Y16C 4XNZB 4PGBA 3CPLB 5DSCB 2EIZA 5DZOA 1KPRB 5E6ZA 3QRGL 4P49A 4UDUB 1DN0B 1RMFH 1T5WA 5GGVY 5BO1L 4FZ8L 4LLYB 4P2OC 3JTSB 4MJID 5EORH 5H94A 4RAUB 2YS4A 4X9HA 4JFDA 1NGWB 4LEXH 5ESQA 4E0RB 4UOW0 3OG4B 1MPAH 5DEGA 4P2YA 1XF1A 1IC4H 5SWQA 1T04B 2NX5D 4JREB 1D5XA 3BP7B 2A0LD 4JDVA 3MRPB 5BO1H 4N1HB 5E94A 2UZIH 2BDNL 3WXWL 4XP4H 4NKOA 2RQ8A 2O26U 3VFWA 2ERJB 4XP1H 4KTDH 1NKRA 3VMPA 3MV9E 1BD2A 4HG4K 2EXWD 1EFQA 1KACB 4M93C 4C4KO 5E03A 3GMPA 3U1SH 1L0XA 3JWOL 4JRWA 3QNXB 5KSBE 2MCPL 2RCSH 3ZKMD 3JV0A 5BV7B 5F7WC 5GGVH 3RVXD 4F8QA 3GDBA 1Q9OA 2OXGA 2XKNB 3ARTA 3OGOE 5C0CE 4QYOB 4O00A 5HYQA 1CTNA 4QRPB 3F7YB 2FYYA 4O2CA 5DUBB 5KBNC 1UFUA 1F8TL 5C6TH 4UINH 1HWHB 3F65A 3G5YA 4NQEA 3QDMA 5GS0D 4DCQA 1CTOA 5DK2A 1Y6KR 3PHQB 2YPVH 3RP1A 5D7JC 4PJHA 4HAGA 3MRMB 2AJXH 4X5XB 5DK0B 5IB1A 5FF6A 2X9YA 1UACH 4CN6A 1JNLH 3QO0B 1T3FA 3MBED 2I9TB 3QUZB 4NZTH 4GW4A 3MLXL 4MNQB 1A0QH 1OPGH 4XH2B 5CILL 5DJ2B 3CU7A 4NUGL 1SMOA 3PL6C 1A3LL 3MV7E 1Q94B 5FKAA 4PJGF 2IPUG 1QTYT 1UKSA 2AQ3A 4GKNA 1VHPA 2CK0H 1DBBH 2Y36L 3SDXA 4QRSA 3QCUL 4CN4A 4I1NB 4AEIL 3B9DA 3F12A 1ORQB 5L2JA 2QBWA 1GVIA 1LVEA 4YZFF 3H3KA 5A2FA 2OSLB 3MLZH 3ZDYE 1NKOA 4Y89A 1AC6A 3VD3A 4RWYL 4BQBA 1EGJL 1FORH 3L3KB 4JCMA 4I4WB 3S36H 5JXAH 2RAMA 3UTPD 4IJ3B 3HUJA 5CD5C 3DVIA 5JOFB 3HAEB 4M62H 4OFYA 4YNYB 1KJ3L 3CFDB 3QQ3B 4OLVH 3S4SB 1RSFA 3SKJH 2A73A 1D6EA 1U3HA 3P9LB 4KK8D 4U6VL 2Z8SA 4FQJL 5IVXF 5LQBL 3GJEA 3ZDZF 2ADGA 3GMNB 3HMXL 2NXZB 3B3IA 3T65B 5HBBA 3L6FB 5JDSA 4D94A 3ZL4H 2A9MH 1L0QA 2ZZUT 4G6FB 1FO0H 5TGBB 4I0PB 3P11L 3PJSA 1FVEA 2X4UA 5EC2B 4F15C 5IV2B 4R4BB 4HUWB 1EV2E 2GUOA 4AL8L 3IDMB 3LPWA 4JY4A 3VA6A 4P57A 5KOVC 5CZKA 1JVKA 1KLGB 2VLRA 2LVEA 1G9ML 2C4XA 1F4YL 1C16A 4JHAL 3MCLH 4U3CA 3DSNA 1KCUL 2JELL 1UZ8A 3SDAD 5GS0H 3A67H 2I9LB 1ZHLB 4GMTH 2IH3B 2W0FA 4OZIF 1MJ7L 4ZS6D 4BK5A 3TVMA 1JTOA 2ATKB 3MZGB 1TENA 5E24E 3HE6C 3WIIH 4C83B 3ME0A 2NZIA 2AGJH 1XH3A 1WFTA 4JRXB 2ADFL 2GYSA 3U4BL 5EC2A 4X8JB 1OP5K 4ZDHA 2BNQA 3CH1A 1O0VA 1ORSA 2DWDA 1CU4H 4JLRB 3G9VA 4MNQA 5HYEA 3EZ8A 2JB6A 3GMRB 5DJ8A 1RHHB 4KPHH 4OZHE 3VXSA 3BHBA 4UV4H 1T1YA 2RBLA 4BFEA 1S9KC 4OTXH 2MCPH 5SX5H 3FRUB 5FB8A 2PYFB 3PWVB 1SY6L 4MNQD 2X1PA 2Z4QB 5IG7B 3BZ4B 5JW3L 4I4WA 1F3DJ 4D3CH 1IKNC 3QDMB 7FABL 4P2OD 3TT1H 5KS9F 2Y6SC 5AZ2H 1X6NA 4KK6C 3FO9A 4KFZC 1JRHH 2MHAA 1V7MH 4G8IA 4ZYKB 5FYLL 4JFDE 3IVKA 5F7EH 4OLWH 4S1QH 4OZGA 3RY6A 2A6DB 4NZRH 5I1LB 1PGRB 3FHAA 4YDLC 3ARRA 1C7TA 5EZLB 5E6IA 4OFYD 5C3TA 1YMME 1IGYA 3RL1B 1FL6B 4K3HA 1HIML 2AJVH 1ZS8A 2DDQL 3NAAH 4XPHL 1KLUA 1S78D 5CZXC 3RWGA 1VGKB 1YY8A 3EO1A 3QUXD 1KTKE 3GO1L 1C5CL 4NO2A 5D1QA 5KW9H 4BUGA 2PXYB 3AAZB 1LEGA 2C3WA 1NANH 5B38B 4A6YL 2JJUA 2PYEB 5ESAA 5EPMB 5EU4A 3HZYA 5C8JA 4M1DL 1CI5A 4NQDA 5I1AB 4M7LL 4MNGA 4OZIB 2ZSVA 4NQCB 1CR9L 5FO9A 1YMMD 3EOBA 2GCYA 1XMWA 4KJWC 1A6VL 5GRWA 2BVTA 3QISA 1OSZA 4EQ3A 1EIBA 4PIRF 3QHFL 5DQDH 3O6MH 4M5ZL 4RGND 1FNSL 4DGYL 1HQ4B 3LQAL 4W6YB 3V5DA 4NGHL 5L2KB 1MRDL 4HHAA 2NY0D 4JPVH 3U30B 4M4PA 3KPNB 3BP4A 32C2B 1EZVX 1BP3B 3LQZB 4Z5RB 4NM4H 5F9JA 3D6GA 3PF2A 3PDDA 1ADQH 4YFDB 3G6AB 1KEGL 2EDBA 4PJEB 2VDMH 2WM0A 3GJFB 1X5YA 2QADB 1D5ZA 4J4PA 1FGVL 4PGZA 4N9GA 3ZDYF 5IWLC 5DO2C 4NJ9H 1NL0L 4NCC2 5CLWA 1YECH 4MX7A 3WHXA 1BFVH 5F44A 4HGWA 3MRFB 4MJIE 3BE1H 2F5AH 4M7JH 3EO9L 3TWCH 1RUKL 1BREA 3U82B 4P5KA 4PV9B 2YD4A 4S10A 1RZ8A 1BIIA 1AGCB 2PF6A 3W0WB 2P8MA 3DSFL 1I8LC 1HINL 4OCLC 1R3HB 3VXUE 1AI1L 4LSQL 2CXGA 2CMRL 1P7QB 5GHWH 3O6FB 5D7JB 3OR6B 4NKIL 1NFDB 3C8HA 3O9WA 4P2QA 2FSEA 1MRFL 4WUUE 5FYKD 5C0GB 2I24N 1LK2A 3INUH 1WBYB 1VGEH 5D5ME 4EXKA 4PP2A 2BNUA 2P7TA 2PN5A 4Q2ZA 2VLJA 2ZG3A 2BRQA 2VC2L 2NW2A 4OQ1A 3QJFA 4EIGB 1INEL 4JPKH 5DMGC 3C8DA 5CCKH 2VLKB 4LK4A 4OBSA 2EXYD 4QY8B 4W6XB 3K46A 1K8DB 5F7YC 2F54B 2B0SL 3DMMB 2NY1B 2WUBH 4XWOD 3QG7L 3UYRH 2R29L 3MRGA 4U1HB 3OKMB 3VXRA 1PZ5B 5T5FL 4P46A 4GRLA 4MQXC 3FTGB 4IHOB 4L4TB 1MHPL 1F45A 3P4NB 3FO9B 2BXZA 4NDMB 5LG1A 4YHIA 3VXUB 1YN6A 2YD2A 1G7HA 2BY2A 5BV7C 4LAQL 1VENA 1KB5H 1ADQA 3PV7A 4DQOH 4RMQA 3UCRA 4WV1A 1DSFH 4JZJB 2EEDA 4NNPH 4YFEA 1E4XH 2XKUA 2IPKB 4K55A 4RGMB 3H3PH 4ODWA 4S0TD 3ILQC 4R97B 4HKZA 4I0PA 5JLZA 2BCKB 3TIDA 1F6FB 7CGTA 1FPTL 1DQTA 1DQLL 5EA0L 4PREA 4I0PC 1S7VA 1HYSD 1AXTL 2DM2A 1OT1A 4X6DE 5DDHB 3QUYD 4X98B 3UJIL 2HTKD 5D2NC 3C5ZC 4LGSB 4V2BA 5ADPH 1VERA 4J4PD 4GRWE 1EZVY 5AAMA 3MPCA 2FX9L 3I50L 3S3JA 4MDIB 3SGEI 3C2SA 3E8UL 5F89B 3T4YB 2DQJL 3CZJA 4NRYA 3EHBC 4X0KB 3SGJA 1XAUA 4U6HA 4HQQH 2GSGA 1IM9B 3T0XA 4OGXL 4MDIA 2ZOLA 5IHZB 2PW2B 3KHQA 3A0OA 4R8WL 5DJYB 3VFSB 2VH5L 3VXME 2BY1A 4HUWA 4KMTL 3FMGH 4AENA 4V1DE 4MD5A 1A7NL 3BP6A 3RI5K 4ODXA 5EUOF 1XR9B 4Y1AE 4GLRH 1A4KB 1HHJB 4WWID 1VGEL 4U6YA 4WVRA 1RIHH 1Q0YL 4AQOA 2YMXL 4O58L 4RCAA 3BSZH 1RK1A 3QDJE 4G6JH 5K59F 1UM5L 2CUIA 1CT8A 4KHXH 3VXMD 4Q6IC 5HSFA 3VXNB 1QFWH 2I25N 3PWLA 5IVXA 4BKLA 5C0IB 4RIRA 2AJUH 5DI8A 1R5IB 5B8CC 3WFBH 2W65B 4NP4H 4MAUL 4FQXD 3LEVL 2OCFD 2FHFA 5DA4A 4TQEL 2APXA 4WEBH 4GSDL 4MCZB 3IGAB 3PWPA 5JHDA 1NBVL 4L4VB 4L4TD 4LVOB 5FO7B 4KVCL 1NGZB 2X1WL 4BH8B 1AGDA 1QBMH 2X7LB 4OLYL 3WFZA 4JFEB 2R4RH 4O02L 2VDQL 5DD6B 2ITDB 3FN9A 3GHBL 1NJ9B 3M1BA 3O45B 2GAZB 1UB6B 5AEAA 3E6FA 1DL7H 1JPTH 4XVJH 2P1YA 3LDBC 2YD6A 5DJAB 3MLWL 1ZHBB 3LQAH 5HYJB 5CLTA 1CN4A 4PGJA 5DO2D 4AM0A 4L9LC 4UTBL 2VLME 4O02H 1JRHI 3LKOA 2O5XH 4NQEB 5FECA 5KSAD 4Z95H 5FA4A 3VFMB 3KS0J 5EH1A 4QHMA 4GUPA 4TYUA 4KZEH 1DVFB 2KBGA 4QHLA 1KIQA 4M1DH 2VDPL 1ETZA 3DO7B 1P6FA 5F8RC 5DQ9B 2DAVA 3DMMC 2NYYC 1X3DA 2NY4D 2H32H 3MGOA 4NO2B 4AMKH 3RX8A 5KSAA 5FHBH 5CJXA 3MACH 4L3EA 3TGXA 3VGAB 3VD7A 4BFIA 2CDEB 1Z9LA 2XFXB 3GMLA 3GSXB 1KV3A 15C8L 4TSAL 1Q9WB 1IGJB 1KFAL 2H9GA 3EOTH 2ORBH 4PJFA 4G7VH 3CMGA 4NJAL 3ES6A 1FP5A 4PJ8A 1IAII 1T0NB 4RZCB 2IQAB 2JB5L 4CGTA 4YPGA 4FTVD 3MLVH 3VXQA 5IP4A 2AEWA 5I1IH 5I1KL 5SX4I 3QI9C 2DQGL 2VXVH 1SVZA 5A3ID 1CGTA 1MF2H 1CGSH 5DEGB 1G9EA 1WWAX 1T5XA 1SJEA 4N5EC 5I8OL 4LL9A 3D2UD 2DQHL 4OFPA 1IAKB 2PYFA 3EOAA 1SY6H 1S7UB 3QIWB 4LQFH 5FYLD 1HXMA 5I19H 3KPPA 4P5TC 2ICEB 4L5FL 4N90E 1ZLVH 4FP8L 5TDOA 1WCBB 4R3SA 4OZGB 4RFEA 3GZKA 2A74B 4DKAA 1S7UA 1A7PH 4M8QB 5ADOL 2C26A 1DBML 4IRZL 4PJAF 5FHAL 3PGFL 2FX9H 1PLGL 3I50H 4JKWA 3VI4E 1UM4L 3K1KC 3I75B 1WBXB 4EN3C 4JN2A 5DVNA 3MSPA 1J0YA 4JRYA 4YEFA 3D0LB 3QIBB 1NCAL 5FHAH 1TVHA 3B2VL 1A22B 4KK9C 4LCWD 1I7RB 5AYQA 2PXYA 3M45A 3B5HA 4LAJH 3N1FC 2IALB 4Z0BH 3S3PA 1T03L 1KCUH 1H3PL 3IAGC 1NEZG 3MGAA 3WO3B 3UZEA 4OFDA 2WWMC 1F3JA 3MV8A 2E7MA 4KDVA 3S5LB 3GJFK 4LSRL 3OJ2C 2HFEA 2VLKD 4YHYC 3LY6A 1QFWI 3QUZD 3HC3L 4U0RB 3THML 5KSUA 3EYQD 4BA8A 1JYNA 1T7XA 3MNWB 4LGPB 2DI8A 5DVOA 1SHMA 2DQCH 1J5OH 4ZSOE 3L3OA 1GGIL 1CL7I 4I3RL 1CGUA 3D5OF 3FFCA 3H0TA 3PDGA 3RVTC 4HFWA 2Q87A 3VXPB 1SM3L 4JFFB 4HK0B 5C07A 2DKUA 3TVMC 4M93B 2BVEA 5T1DH 2L7UA 1KIRB 3EBAA 4UDTA 2AJYL 4X6CA 5D2LF 5F3BB 2R29H 3UTQB 1B4JH 2P8LA 5SWZB 5T3XD 1G7JB 3IJHB 2ZUTA 4WCYL 4QRRD 1ACZA 1S9VB 1W0VA 4QXUH 4RFNB 1S8DB 3VFGH 4UB0L 1J7VR 4EI5A 1QSVA 1J1XH 1CFSA 3OMZA 3ECBB 1U8OB 1QR1A 3TBYA 4U2YA 4K8RH 2Q8AH 5FAAA 3B3IB 5ICZB 3F12B 2VABB 1MCKA 2VRAA 3MRKB 2SEBB 3BGFC 2QADD 5E00B 5JLZB 5IB3B 1ZT1B 3AU1B 3H9ZA 3PL6A 3QPQD 5EO0A 1MCDA 1IQWL 2EIBA 1DBBL 1LK3L 2Y36H 5EG6C 4IRZH 1GPOL 1P5VA 5HJ3B 2Z0BA 4EOWL 4HUKB 2XWJB 3VFTB 3QQ9D 4NKDA 5E2WL 2QJDA 4OUUA 1U91A 4FQPA 2F5AL 1INDL 4WW1A 3VRIA 5D7IF 5C0BD 3TNNB 3ECBA 5T1LD 4P46B 2ZSWA 4JM4H 4PBVC 1D5IL 1FNGA 1VFBB 4LP4A 3FONA 4WDIA 3RVXC 2EYRA 2ZUUA 5D70L 3TH2T 1OL0A 3KPMA 4XB7A 3GRWA 1DLFL 4QY8A 3FQNA 1CBVH 2R4RL 2R0KL 5FCSH 1NLBH 2YBRB 4K3JL 3QJFB 2G9HB 4LARL 1MEXL 1N6UA 4POYA 4PJAA 3D87B 5KAQF 3EJYC 3JXAA 4YHOL 5B39A 3WJLA 4PGCA 1H8SA 4G7VL 1A4KA 3CMOL 2OR9H 2D4DA 3QDJB 4LHJB 2OTWB 5HI3D 4X8XA 1CDBA 2YZ1A 4ELKB 5IGXH 3OPZL 3QEGH 15C8H 1IQDA 5GGUB 3STLA 3DTXB 5EBLB 1A7OL 2Z8WC 1OAZH 1DLHB 3S88H 5J4MA 3GGWA 4I2XB 4UILH 4X80L 1S9YB 4U6XA 2JLLA 1PKQA 4AK1A 3B9KA 1FHGA 3R0NA 4A2MA 5IGXL 2YD7A 2B20A 1ZLSH 3BWAA 4TTGA 2JJSC 3IJYB 5EU5B 2BOBB 1QEWB 2FYYB 4O2CB 5DJ0A 1AO7B 1NGYA 2NY1D 5F8QC 4AJ0A 4WUUA 3WV0A 1N4XL 5C7XL 4OT1H 4P3CH 1CL7L 5E2TH 1YEIL 4BSJA 2DKSA 4TSBH 2OJEA 3X12A 1UKQA 2FJHB 4UB0H 3TN0B 1ZVYA 2WLZA 3BD3A 4L3EE 5AG8A 3BH9A 1EEZB 4GMSL 1I8KB 4NO3A 5ESQB 3HCVA 3QWOB 4NHCL 1WIPA 5CZVL 3QQ4B 4XBEH 3WIHL 5FGCB 4XMPH 3QUYC 4M7LT 1DL7L 1JPTL 4LSTH 4KKCC 1MIML 4X4XA 1DN0A 3RIAK 4L4TE 3I02B 1ZLWH 4ZO8A 5E2WH 3VFWB 3O9WD 1K6QH 3IDIB 1FAKT 4EUPA 5SV3A 3FO2A 3OR7B 4XCEA 4L3ED 3P30H 4N1EA 5BRZA 2Y06H 1BLNA 4FXLA 5FO9B 2GT9A 5EC1A 4JDTL 2FD6H 4NNYB 2O5ZL 4POZC 2NY2B 5SWZE 1K8IA 5IFJB 4KI5F 3K2UH 4LSPH 5HYQB 1H3PH 3G08B 3I84A 4Y5XC 3VE0A 4ESKA 4UV4L 1Q9OB 1GOFA 2P45B 5D9SB 5IBLC 2P5EB 4LSUH 4Y4FC 5C08B 3RWHB 5L6YL 3GIVA 2EYSA 4R7DA 3PQYB 2PETA 3BPNB 3VRJA 4ODSL 43CAB 4C54A 5IB5B 1CWVA 1MHEA 4UU9A 1MSPA 2D9CA 2XIDA 4LCCC 1I7ZA 2HT4D 4OGYH 2AGJL 1N5AB 1T89C 4XP9H 2CLRA 1LEIA 1DBMH 2NR6D 1R6VA 2FSEB 4QHNB 4ZXBD 3RY4A 4N9OB 3NIDE 5J7CC 2VIRB 1YPZF 4LCCA 2HT2C 1UWEH 1N5AA 4FZEL 2MHAB 3FQRA 5CP3A 3D3VA 1A6TA 1EVTC 4JDVB 5DUMH 4QWWD 4L29B 1INQB 4PRPD 1ITBB 2BY0A 1MI5D 3RWCB 4R7DB 4OTXL 3NMEA 4YWGH 5DXWA 5ETUA 1T03H 5C0CA 2VXVL 5HDLA 4FQ2L 3BVNA 3QWRD 3TBTB 3U0WH 4HEME 4KMLB 1XR8A 3WDIA 1TVDA 5J6HB 3P0GB 2KZ1B 4ZO7A 3OF6A 1JHKL 1MHHA 3IJYA 4S1DC 5HHOE 4ONFH 4I3GA 3GHEL 4ZOCA 4ODSH 4JB9L 3AB0C 1BD2E 2DL2A 4IMLB 4F7CA 2FEEI 3MCKB 5D96C 4GW1B 1RUPL 2PO6A 3DNKA 4LCIH 3GSWA 5E5MB 2D31A 2E7CA 3RKPA 1MFNA 1WFUA 3L9RB 1EJOL 3UO1L 4IRJD 1FPTH 1ZE3C 4XGZB 25C8L 1EEUA 4QHLB 2H8PB 4HS8H 3NCFB 4FMKA 2CPCA 4RMVA 1H5BA 3K8LA 5C0RH 1IAMA 4UIMA 1NDGA 3RVWD 3UPRA 2R8SL 3NABL 1DBKH 5GGTA 4QHKI 4K94H 2RR3A 4C4KT 1EERB 2YUXA 4JN1H 1JGEA 3VG9B 3FB5A 4BZYA 2FATH 1U92A 1JPSH 1ZSDB 1JYXA 3V4PH 1KJVA 5D7LB 5T5FH 5D1QB 3MRJB 3HC4H 2ORBL 3MA9H 3PE9A 2HTLD 1L6XA 2VLKE 4ODVL 4DGYH 4LVHC 5DEZA 5IEHB 4M5ZH 1AH1A 3UMTA 1BFOA 2WWKT 1R0AL 1GZPA 5CCKL 4HS3A 4OZFA 4LKCB 2XNAA 3DYPA 1YEIH 2BNRD 1CL7H 2OM5A 2YPVL 4N68A 4UT6L 2PW2A 4WWKB 3OX8A 4NBZB 4ACPA 1YYMH 2F8XC 5ERWA 4F7MA 5EUOB 5ITFB 4R2GD 3RA7L 4EI5C 1QZ1A 1UZ8B 2E6PA 3VG0H 1JNNL 2OSLA 4BH7B 1FSKB 1UJ3A 5KZCD 2KZWA 2JIXD 1NAKL 2Y4SA 3R8BB 2NQCA 1QFHA 5ERWB 2W92A 4DZBB 4IEFB 5CD3A 2OTPA 4MB5A 4NO0D 3MX0A 5DJCB 1R3IL 4R96A 1K8DA 2FWOA 1V8HA 2N4IA 3GGWB 1UH2A 4I2XA 5EO0B 1HI6A 4NWTH 4HS3B 4HDIA 4OZFB 3P9MB 3FFCD 4R2GB 2WQRA 4XC1L 3JBG7 3HI6L 5IEHA 2CQVA 4DW2H 3DXAA 4PJ9C 3V5KB 2IQ9L 4CJ1A 3BKCL 1OF2A 1HHJA 3ARSA 1T3FB 3H0TB 4OLWL 4P2QB 1LO3H 2AJXL 4S1QL 5TPWH 3L95B 4PLJC 2XWJA 5JTWA 2FECL 1DEDA 3IDNA 2NY6B 3CFCL 2BHUA 4JRXA 1BVZA 1N2RB 4UIKH 5CINH 4R97C 2ZJSH 4F7PB 4UBDC 3Q3GA 4QHKJ 4ZOBA 1MUJB 1PYWA 3V6ZB 2DKMA 2R0LH 3L3JA 3MRCB 4WEBL 2HP4A 4YXKH 3SKNA 1U8PB 4KXZH 5FYJD 4FZ8H 1X7QA 5IFAL 3LEVH 4KQ3L 3E2HC 3QHFH 3FT4A 1B6DA 2P5WA 4XP5H 5A2JH 5C0AE 4FQLH 4U1KB 1SEBA 1IFHH 2HFGH 1TCRA 3KR3L 4HWUA 3FRPA 1WQVT 5F1KC 4A6YB 3CZFB 5HHOB 1HHIA 2FLBT 2J2ZA 1BD2B 3BXNA 5HYSG 1J10A 3DIFA 4QRPD 2CR3A 3T04D 4KV5E 3T0VA 2H41A 4D9QD 1R5WA 1L0YA 4CVXB 2Y9RT 4YXLL 1SBBA 5EWIL 4JRYD 1W0YT 4KRPB 1JNHA 1BIHA 1ZGLB 3U4EA 5DZLA 1W72H 3HUJB 2HFTA 4U1MA 4UQ2B 1I3RB 3QUXA 3DPBA 2R2HB 4HPYL 4QNPE 1VEOA 5BV7L 5CSBA 1CGVA 4GAJH 4DVRL 1XGTA 4S1RL 3BRFA 4GG8B 3AGVA 2FO4B 1MAML 3PWUB 1OGAE 3AB0B 3DRQB 4PJ8C 3U2SA 4HUXB 4JAMA 1WITA 4Y19E 3F7YA 1NCDL 3CVIL 1X5LA 5HD8D 4RDQF 1KCRL 5TF1H 4U1HA 4D9QE 3EYUL 1YJDH 1U8IA 3TT1L 3MRNA 5TH2A 4M6MH 1KYOJ 5FFLA 5IMLB 4U0QB 2WUBL 2VOTA 5FKAB 1RV6X 1J11A 4YDLB 1UB5A 4M48H 4J23A 4BFIB 3DI2B 3P4OB 3RWDA 3JSSA 1JHLH 1I9IL 1FO0A 2W1NA 4X4YA 2AK4A 3BFOA 4LBEA 4KRLB 3CVHA 1U8NA 1A7RL 3QUZA 2AABH 1JK8B 1AJ7H 4KC3B 2HVKA 2V7HA 5TDPA 5FGCE 4PJ8B 4S1DD 3LKSB 4BSWB 4AY0A 5C0CB 2FRGP 2Y5TB 3DVFA 3Q5TA 3LH2H 1E4XL 2E27H 4M1CD 4M43L 3V6OE 3PWNB 1RJLA 2HLAB 3OXSB 3KXFD 2QKIB 4J6RH 5IEKB 3GMLB 3GSXA 4I0KA 4LSVH 3BI9X 4NSKB 5ANMB 1HYRC 2OZ4H 3QDHA 2HN7A 3B5TA 3P40A 3HE7C 4GG6A 3BP5A 4ZFZA 2ESVE 1KG0A 4BQCA 4Q9QH 1F4XH 1MQKH 3NA9L 5TE6H 2OQJA 2ESVA 5TFSH 2VR5A 4U3XA 1JFQL 1ZEAL 4PJ8D 4QHNA 4JJ5A 2ZCKH 5EZIL 3ESUF 5GGSA 2JKXA 3TJEH 4XCFL 4ERSH 2DM7A 4Q7DA 2BNQB 4OCRL 3KXFE 2A9NL 2EO1A 3LKOB 5J1TC 5F7UA 3ARBD 3LOWA 4MNHA 4CVUA 2IEPA 1O7SA 4P9HL 4XCNB 3QIUB 1AFVH 2AQ2A 3UROR 1YMMA 4M6AA 1YQVL 3RPIA 3HNVL 3MROB 5BOPA 1OVZA 1F4WH 1HH9A 2X9XA 3CC5A 2BNRA 1EPFA 1PG7X 3BP7A 2A6KA 2VB5A 1EK3A 3TVMD 1R24A 3KLAB 3RTQC 3AS0A 3JWDC 3F7VB 2VMFA 3O11B 4O9HL 1Q0XH 2FGWL 3FN0L 4OZIA 3OR7A 4YDIH 5GSRB 4K3DL 4KKCD 5EN2B 3WN5B 3WIFA 4IIQC 5DMJB 4J3TA 5EBLA 5DD0L 5DMKB 3V7AE 1BFVL 1KB9J 3WMSA 3BHBB 3NBNA 5KSAC 3JUYA 3D3VD 1UENA 1MOEA 1HHIB 1BEYH 1G9NC 3CVIH 1K4DA 5D6DC 1TCMA 3QUXC 2ICES 1QBLL 3QAZC 4PJFF 1WEJH 3DROA 1MIEH 5FA3A 4ZDHB 4WJ5B 4NBYB 2ZKHL 4DUXA 3NAAL 1GL4B 5LGHH 1CFVH 1DQML 1NFDF 1LEKB 3KXFA 3MUZ1 5HVHB 4HIJB 4HKXB 3RBSA 2ZUQB 4LEXL 1JGDA 4XAKD 1YNKL 4KJYA 4DZBA 2APFA 2Q7YA 1MRDH 4NGHH 4YGAB 4OIIL 1ZHBA 1FV1A 1Z3GL 2I9LA 4UBDD 2VDRL 2X4QA 5GIRB 1D5MA 5FYLH 5C07D 5MHSE 3HHRB 5DJDA 4D9RD 4LMQI 4E9LA 3T8XA 1W8NA 1EXUA 3ZYZA 4P2CG 4RMUA 4HBCL 3BD5A 5C0AA 1A1MB 3IFLH 4KGJA 1TTGA 1S5IL 1QHPA 1WTGT 4KHTH 4EDXA 4JZJC 5FM8A 1WISA 5TE7L 3FQXA 1FH5L 1PVHA 5JW4Q 4U6YB 4XNMB 3CDYA 4FA8A 2V5RA 4GLRI 4G7YL 3MOQA 2F74A 5DR5H 4YXKL 3KLHD 4CU7A 1L7IL 4W4OA 5GRXG 3IDGA 3UTSE 2GK0B 4K7PX 5HHPA 3CGTA 2CXKA 3UPRB 3O3BA 1KC5L 1XGQB 3EIFA 5FYJH 3DURA 1SJHB 4IJ3C 4XX1G 4P46C 4HJGA 2BNRB 4AT6A 2DQUL 5I71B 2PYED 3U7YL 3O3DA 1WT5C 4HK0A 1WAAE 2Q3ZA 2C1OB 2IG2H 4OUUB 4TOYL 4AG4L 4OKVA 1KC5H 4DTGH 4B50A 4I18A 5ENWA 3BEVB 5FM4A 4AENB 3QDGE 4KV5F 1ZVHA 4P5MA 3MYZA 4N8CL 3IDNB 1I3GH 1MJUL 5IJVB 3B2UD 2YA0A 4NOFA 5FA3B 2OI9B 1N0XH 3L95A 3O9WC 3S5LG 4XBPB 3FHQA 1KF9B 2X89A 4L8SC 3V8OA 4G6AD 1YUHA 4WW2F 4PBXA 2P4AB 2VR9A 3P4NA 1XF4A 4WTXA 3BISA 3AS1A 5LXGH 1WICA 4WUKH 4EZMA 4QRRA 4QTHA 3FB5B 1RFDL 4KZDL 5DJZB 3EYQC 4ONOA 2EYTA 43C9A 2XN9D 4IRJB 1KB5B 1ZHKA 1YC7A 4N8VG 4UT6H 3QHZH 2V2TB 2VLKA 1Z2KA 3UJIH 3CIQA 3LPGA 3KLAA 1INQA 3PIQA 1D5MB 1CLZH 2F53E 2WP3O 1GJIA 4WRLA 1Y0LA 1S7VB 1T66C 3ZKXB 1U8KA 1FVDA 5DT1L 3DX8A 5JW4R 2V7HB 1K85A 1U8JA 5DMKA 4O5LL 4YHML 3TYFB 4MA3A 1UADC 5DZNA 3SDXF 2ZCLH 2CIKA 4RAHA 5C0AB 5F6IB 1KB9K 1DSFL 2BSSA 2XN9E 5D6DA 2P5EE 5BRZD 3WFDH 3BPLB 2HFEB 2IGFH 3P11H 2X41A 1CGWA 3RY5A 3SOBL 4WV1C 1OD7A 4P59L 2GTWA 3ROOA 1A02N 3DECA 3FTGA 1MELA 4R9HA 5DD0H 2NY2C 3VE0B 2Q7YB 3OKOB 2H32B 1UACL 3H7LA 4YAQB 1CE1H 4XCCL 1BQHA 4K3DH 3DRQA 3R06A 1I1CA 4NQSA 3VD4A 2DMCA 3RWCA 1I8MB 3HZMA 3MJ6A 3EOBB 4PY8I 4JY6A 2J5LC 2V2XA 5KOMC 4NN5B 1GRWA 4L29A 2DBLH 5C0EA 1AQKL 1HHKA 4QRUA 2J8OA 4QRPA 3LH2L 4M43H 3VGDA 2D7TH 3BDBA 3B83A 1OTUD 4NYLB 4NBXB 2XWBB 4LSQH 1G84A 1HXYB 4OV5A 1A7RH 3D2UA 4PJCB 2VLRD 2DYPD 5F9AC 3GFUA 4MNGE 1MHEB 4RQQA 1BF8A 3F7RA 4PG9B 1S3KL 3BH9B 2UV3A 3O11A 4I5BA 3QZWG 4OGAD 1CE1L 5HVFB 1KXVC 4DVBA 3BE1L 4UI2A 2EZ0D 1T80A 5EPMA 1M7DB 2BK8A 3S96B 3B4NA 1IC1A 3VFPB 4K9EC 1IE5A 5DTFB 4FQCL 4GAFB 5DJ0B 3HR6A 1KCVL 4F3FA 5GJTH 3C60C 4N0CC 3W9EB 2VJXA 1TDQA 2APBA 1G7QA 2VXTL 1KEGH 5FYJL 2FIKA 4ODBD 2X9WA 4Y5YC 4GAJL 1CIUA 1I3RA 1NMCC 4DVRH 1PKQB 1IC4L 4OGYL 5F96L 1A6TB 4JFPB 1KXTB 4Y5XB 5A2IH 3PGCA 5ANME 4PJGE 1CDGA 1JTTA 4P2OB 4G6KL 2MNUA 4NC1E 5AAWA 4GBXC 1AY1H 1G6RH 4RGNE 3H3BC 1RJYB 4HUXA 4WFGD 2C3GA 4KQ4H 5FK9B 4YHZH 4LDOB 2X70A 5HHXH 2NMSA 2IPUK 1DQJB 5BQ7A 2LE9A 3U1SL 3G5ZA 1URLA 3SPVA 2MCG1 4OD2A 5BJTA 4ONHB 3MJ8B 3LKRA 2PTUA 1WUNT 5E95B 4KH2A 3EGSA 3NGBB 5D7SH 3ALPA 4YHZL 2HVKB 1UJ3B 5CEXA 4FXGB 4DFIA 3NPSC 4KQ3H 4LBEB 5ITFA 2X5PA 2EC9T 1GC1L 4U4BA 4ODXB 1MCRA 3GSRB 1MFEL 4NOBA 5D7IA 4C55A 5EO1A 4OCNC 1VFMA 3MRQB 1QLEH 4LLQB 4EJ1C 4DOHE 1C5DA 1G7LB 5LWYH 2FBJH 3RZCC 4EDWH 3Q2CA 3ZO0A 3JWNC 3D3VE 2CLZB 3V79C 2DQUH 2JJSA 3ULUH 4PRPA 3B9KC 3MOAH 3GSOB 5D1XA 2XQYG 5DI8B 4RFNC 3BRDA 1AGEB 4I0PD 3G5VB 3IAPA 4Z7OF 1L7IH 1MUJA 1M71B 2HYMA 4JEGB 5AZEH 5I66B 1RU9L 1ZANH 2IBZX 3VWKD 3U4EB 1AP2A 3QEQB 5ALCL 1SYSB 4G6MH 3QI9D 4NQVA 4PJIB 2KUTA 1MCJA 4HUVA 4HKJA 5GZOD 1AO7A 2G75A 3VRIB 3D69A 2IFFH 3BXNB 2GEEA 4LDEB 1U8PA 1FNFA 2UZXB 4MD5B 1GH7A 1GIGH 5IK3A 2E7LC 3SDXB 1OOAA 4QRQA 2AV1B 1YEFL 5K9JL 2WIIB 1A9EA 5LBSL 5MENA 5F93C 3HS0A 3VI3F 5D93B 1V3MA 4P23A 1TJGL 3HKFA 5DJDB 2XG4A 5C6WH 5EBWB 2JE8A 3HPLB 4RISL 2K7PA 5J1AA 4PGCB 3G5XA 5J1SC 2AXFB 4WU7B 2D7QA 1DE4A 1XGUA 3MRHB 5DRWB 3GUTA 1QFOA 1CLOL 2G75B 4P23C 3U0PB 1PZUB 3QA3B 1U3HB 1U92B 3LEXB 5DK0A 1F97A 3V4PL 5DVMA 5DRZA 2WBJB 4OM0L 4P59H 5CUSH 4KI1A 4ZFOB 3WFCL 4FQXC 2YWZA 5AUMB 4MLIA 1V3JA 2XN9A 3I75A 4XNYL 2X2YA 3F6LA 4POUB 1FVEB 4IRJC 1K9TA 2Z31D 4G9DB 4JG1H 2ZCLL 3FOLB 3N85H 2DMBA 2YUWA 1A1NB 4YHMH 2VZ1A 3RWJB 2BVQA 1LK2B 1LO2L 5J12B 5C0JB 2WINA 4Z7UB 4LSDA 5E8NA 1JGVH 5FF6B 4HXBH 6FABH 35C8H 3N50A 3MJ7A 2FCBA 3SJVE 2Z31A 5D2LB 4PFEA 3WFEH 4HF5L 1U3HC 5CEZH 1GZPB 4HLZG 2OTUA 3KNBA 1R3LA 2WBJC 4HG4J 4ZNEA 3QIBD 4PJDA 2EEAA 5CKGA 5J6GB 3R8QA 3TZVC 3D85A 3QXVA 4HIIA 4IHOA 3MRJA 3GK8H 5LXGL 3KYAA 1AO7D 1NMAL 3ZE1F 2AK1H 4HZLA 3VXMB 1AR2A 3UEZA 4JFOB 4BFGA 3M8OL 2EO9A 4ZTPH 3RHWK 5E2UH 5FV2A 1ZLWK 4WFED 3E6HB 4NRZB 3AY4C 5EC1B 4F9LA 5L7XH 1B0WA 3GI8L 2R15A 1IRAY 3SY0B 1ZLUH 2VDLH 1NFIB 4LCWA 5I2IB 5ITBL 3I85A 5DUBA 3D2UB 4NZTL 4M61A 5K9KB 2NLJB 3QUMH 2MKWA 4K7PH 4H0GA 1FZOA 1YEKH 3NA9H 3KPLB 1OP3K 5JIHA 1MFAL 4G8GE 1B88A 2OZ4L 4NQCE 3GSQA 2NLJA 1QSED 3KPOB 5LBSH 3ISWA 1ZLUK 1RIVL 5DJXA 1KEMH 1UG9A 4HT1H 1KN2H 3FO1A 5E1AA 1I8MA 4CVZB 3MRDA 3ULVC 5IMOA 4CBPA 5JZ7D 1MCBA 1VFAA 4NFCA 3JTTA 1PG7W 3MROA 4FQLL 4RZCA 4Z7NE 4I8DA 5IFAH 3QG6B 1YY9C 4Z7VB 1S5IH 3TYGH 3W2DH 3DETD 2NY7L 4WU5A 1E0OB 1GGBH 2AXJA 4R7NA 1LE5B 4Y2DA 1KELH 3JV5A 2Q86A 3VWJD 4ZUVA 5I15L 1I1YB 4KJPD 1P4BH 2BSRA 1F4HA 4H1LH 4PUBH 1FFNB 2W0LA 3MXWL 3ET9F 4IOIB 1D6VH 3BKCH 4YLQT 2CO7B 4P5TD 2R0WH 4X7TA 3W11D 4ZS7L 4QF1A 4XHJC 4QXGL 5CEZE 1HSAB 4BKLB 5SWSA 1UXSA 1KYOK 3TP4A 2FNBA 4S1SL 1CLYH 5DR5L 5C2UB 3TBWA 4U1MB 3LHPH 3I3DA 3JWOC 3VWJB 2HG5B 4LLYA 2W9EH 1RD6A 2FB4L 4R0LC 1EFXB 1WCQA 2UVEA 3DUHA 1EHLL 4JFDD 12E8L 3G08A 3OHXA 1RZGB 4E41E 4Y4HC 1H8OA 1CG9A 3DVGA 1U6AH 1YY8B 3EO1B 3IFLL 3M1BB 2DRUA 4DGVL 2CH8A 4ZUTB 4K23L 2WUCH 1I7ZB 3QUMA 4L9LA 4NKDB 1YYML 1KTLA 5CS7A 4ETYA 6CGTA 2I07A 3CX5J 5JW4N 3OZ9L 4Y16A 2GSIA 1K6QL 2H2SC 2WWMD 3B9KD 5IBTH 1UA6H 5K9QI 3NCBB 1CXLA 3I02A 2OTWA 2YXMA 2EDKA 4G6KH 5F7MC 5J56B 4N0UA 3WKMH 2A6IB 3SE3A 3ILQD 3P77A 4QHMB 1BZQK 4YO0B 5I75C 3AREC 5DD1L 4NT6A 4JZOA 5E0QA 5DMYA 3RAJH 1I7UB 1W0WA 1KTDB 3GHBH 3QH3A 3CFCH 1TITA 1W0VB 3DRTA 5E2TL 4B41A 43C9B 1LD9B 2XTJB 3TNMB 4OLYH 3GSQB 5CGMA 5TPWL 4GXUN 3MJ7B 4P2QD 1WZKA 3EYFB 1MI5B 3PDOB 3C8KA 1E4XI 4PRHA 5CEYA 1PQZA 3B9EA 2R9HC 3Q6FA 4X4XB 2AXFA 1OTSC 5IVXE 1JPFB 4J8RA 5L9DH 3BP6B 1AR1C 4HJ0D 3QFJA 1S3KH 2I5YL 1IGTB 3H6JA 3GBMH 1OARH 1RZ7H 2GTZB 2HJFA 1WF5A 2EE9A 4PJ7E 2A1WL 4G42B 1HHGB 5T5NG 2CRIA 1RURH 3BSZL 4K3GA 1AD9A 4Z77B 3O2DH 2VZOA 3WHE1 1JWSB 4F57L 1YYLH 2LAGB 4EVNA 1RIHL 1GGTA 4M00A 3SO5A 1Y18A 4KXZI 3HN3A 4NUJA 5JW5B 1SQ2N 3ULUD 4R4ND 4PJCE 3ARBC 1HDMB 2ENYA 1KSRA 3NN8A 1I9IH 1T6VN 4GQPH 5HJ3A 2GK0A 3TT3H 3BX7C 4I18C 3V4UH 4DGIL 1JYWA 4K9EH 1Q9LB 5EOQL 3TZVD 4PB0H 5C0BA 1BM3H 5JXED 5F3BA 2J8UF 1WT5A 2NW2B 4MQ7A 4YDVA 2AS5M 3RU8L 3MRKA 4YXHH 2PCPB 1LHZA 5C3LD 4AQ1B 3REVA 5T1DL 3VRLF 4JE4B 1F4XL 1T21B 1JI2A 3GJEB 4MCYB 2KQMA 1F6AB 1KCRH 5TF1L 4JN1L 5F72S 4MQ7B 4HKJB 2A73B 3E8UH 3IRZA 3O8XB 1DBKL 3NABH 1HNGA 3LIZH 4OSUH 5B4MC 2JIXA 3KYNB 4M6OH 2AKRA 5GSRA 5BV7H 1G9NL 4HJ0C 3G5VA 4JKPL 4ETQB 3LAFA 2SEBA 1YN6B 4TRPH 1Y18B 4NUJB 3VI3E 5BCAA 1UWGL 5JW5A 4UT9L 5E2VL 5GGRA 5C86A 4N0FA 1VCAA 4ZNEE 3BPCB 1JF1A 4NN7B 2D7OA 1MNUL 2AXGB 2CLZA 1JHLL 1I3VA 1IKFH 1J0JA 3WS3A 4JRYB 3A6OA 4KRPD 5HHMB 2RFXB 2DIBA 1Q9WA 1OP5H 3ULVH 3AFLA 5CJBA 1T1WA 1CGYA 4GKOA 1KN4L 3P30L 4PJ7A 3GSOA 1UM4H 4XH2A 2FIRT 1S7WA 1KB5L 4FMFA 1MFDL 5I8CB 2R1XB 4GS7C 2BFVH 4FQ2H 3HAEG 2WAHA 1JZ6A 3SJVD 1NLDL 1MFBH 2FZ3A 3L1OH 3LPFA 1VKXB 4FP8H 4WHTA 5EDXA 1ETZB 2D7PA 1F90H 4LLAA 3HC3H 4XWOC 1F58H 3NCCB 1S9VA 4GFTB 1ZA3A 4C56D 1L7TH 1S7SA 5DK2B 3CFEA 2PXYC 4YXLH 3VGAC 3S9DB 1WIUA 4MA7L 1FZKA 4I9WD 4Q9RL 5I1KH 1HKLH 3QEUA 4GKSB 5FOJA 5D71L 1T2XA 3MLRH 4Z7QF 1NUGA 3B2VH 3U9UA 1M7DA 1MCEA 2M2DA 4XC3L 4LSSL 3GSWB 3MODH 1WJ3A 1VACB 1CD1A 3HG1E 4TUKL 3IDJA 4PD4J 2CKBB 1SMAA 3DVNA 4NWTL 4UU9B 4JKMA 1J8KA 3EFFB 5HGHA 1JJUA 4LIQE 4F58L 2XG5A 1S7RB 4U1NB 3S88L 1NGPL 1A21A 4MCZA 3EZJB 5CD5D 4PJEE 1Z0MA 3RDTD 5L9DL 4RBPH 5CJQH 5KN5A 4ODHL 1FVDB 5IWLA 2GKIA 3PWPE 5JHDE 2P49B 3KWWA 4M5YL 2FD6L 4MVBD 2HG5A 1CXFA 5FV1L 3O41B 4D9LH 3TJHC 4NNYA 3QI9A 1MAKA 2FO4A 3WS6A 5HI5D 1X4ZA 3IXTA 4RX4A 2QKIA 4Z95L 1AKJB 3QUXB 4ZXBA 2Z4QA 3SDCC 3CX5K 3MLVL 5ILTH 4HWZB 5DJ6A 1GHFL 4J2XA 3GMMB 4S2SA 3RWFB 1RUMH 4JPVL 5EU3A 4QKXB 1INDH 2R1XA 1KFAH 1MCOL 3EOTL 2GAZA 3SBWA 1M05A 4KVNL 1AE6L 4KK9D 4ZMAT 4HV8B 4QXWA 2DQDL 4NN5C 5HHQB 4JQXC 5C0DB 3N9GH 1VB9A 4XPFH 1MIEL 1BQLL 1WVZA 5IF0A 3BOVA 1L9MA 1IQWH 1T66D 4JM2F 4XCYB 5JIKA 3VFSA 3ZLQC 4Q6YA 4OCYL 3WS3B 3ZYOA 3V0WH 1EVUA 3QDAA 1P7KB 1IGFH 4YHKL 4BELD 4MA1C 1BVLB 1NGYB 3SJVA 3UXFA 3MNVA 3VWKC 1B0GA 1P7QD 3LZFH 1K2DA 5CEZD 5KANI 1C16B 3T4YA 1S9XB 1OGAB 3LN4B 5DRXA 2IAMC 2XTJC 3TPUA 4PJXE 4GW5B 2AJUL 4IDJH 2GITA 4U05A 5HD8C 2OP4H 2C4FT 1A7OH 4Z0XB 3WXVH 4ZSOB 1C5BH 4KHXL 4JDZB 3VRLE 3MR9B 5ESAB 4TUKH 2IPTL 5KANG 1IQDB 5GGUA 2VNCA 4XC3H 4JPIB 1SEQL 2CK2A 2VQ1B 1MCNA 1JIBA 1OAQL 5FUCE 1FC1A 4LCYB 2BCKA 2HRLA 3RX5A 1U58B 1J5OL 4K8RD 4I13B 4H1LG 5IJVA 5JZ7C 5AZ2L 1DP0A 4FXKA 2R8SH 5JA9A 3W39A 2DLTA 4NRZA 2VAAA 4OCWH 1P4IL 1XZ0B 4NKMA 2IMMA 1A5FL 1HOCB 4R0LB 5M7QA 3GKZA 4HS8L 5I0DA 1VEMA 4KDTA 3TBSB 1BZ9B 2D9QB 2Z9TA 4J3XA 1UWEL 1HCFX 3KPSA 1RZKC 4KPHL 1DTUA 5B22A 1LO5A 3D39A 4F80A 1CICA 3ARYA 4DOHB 3OQ3B 1IM3A 4LSVL 1GGCL 2BJML 4OQTH 5MEND 3N06B 2EYTB 3SCMA 4X5LA 3VXSE 5I8KL 1MCFA 2IC2A 3O3UN 5FYLE 3D0VB 5EBMB 3IF1B 5CP3H 4FG6C 4TPRH 2ADGB 3GMNA 1AXTH 1PG7H 2APWA 3MV8E 2FH8A 3FO0L 2K7QA 3NCMA 5D5MA 4PJAB 2EEBA 3ALXA 1MI5A 3PDOA 5LAXA 5IHBA 1BVKB 1P7QA 4YC2B 2VH5H 4YNYA 1QRND 1ZHKB 5GRUH 4CAGA 3MBXL 2LV4A 5I6XB 5GISL 3TPUB 1UEMA 1YNLH 2F8VA 3GNML 3QDGA 1RIUL 4X6CB 2Y7QA 4GXVL 2IBZY 5EIQA 1SM3H 4WFHD 3GM0A 2AEPH 5DRWA 2YPLD 3HC0A 1OAQH 3SGKC 3VXRB 3GK8L 2ZUXA 2NY4B 4MX7B 4LHUB 3SQBA 4S1RH 5ACZB 1OSPL 5CZVH 1A1MA 1IC5H 5GRUL 5IW3A 1W72L 4X4MA 5DJYA 4DGIH 4PJEA 5KVFL 2P8PB 4Z7UF 1IGTA 4PRIA 2IF7A 1J05B 5ACZA 1LO4H 4IDJL 2YR3A 4OBRA 4LSUL 3JVGA 1J8HE 3KYKH 1MHHB 4OD1L 3UC0H 3D69B 4PJBE 3K2UL 4XVUD 4BJLA 1S7TA 1JGEB 4JDTH 3KR3H 4QRRE 3IU4L 4OF5A 3PGFH 1Y6NR 1TQBC 4XNYH 2GCYB 5IBUB 4YK4B 4OLUH 1B3JA 5L8LB 1U95B 4PJFE 2NXZC 4LOUC 1KIRA 3TJHD 5HVWA 5D4QA 4MSWA 4M8QA 1AE6H 3V6OC 2D03H 1G7IB 5J13B 1NC4D 3DETC 3DGGA 1FV1B 2C3HA 4PJHE 3MRGB 1QFPA 1PX3A 3D0VA 5KVEL 2FHCA 1QHOA 4N0UE 4PJHF 1BJ8A 4Q6IB 3QIUA 4GQ9L 4YUEL 1H0DB 5AG9A 1HQRA 1WFOA 2Z93A 3BEWA 4YBLC 5ILTL 3EFDH 4JFPA 1H5BC 2R0KH 4ORZC 2WK2A 1IGYB 3RL1A 4U3HA 4Q2ZB 3BJLA 3SDAB 4HD9A 5HGBB 1C1EH 1FG2A 3CC5B 3KLHC 4D9LL 2CUHA 1YYLL 5CKAA 1A1OA 4WI7A 3H42L 5KVEH 1TIUA 4HGWB 3ZZ1A 3UTTA 4P99A 2NY5C 4HUUA 1X4YA 4ZYKA 5MEOB 2HJKB 4R4FL 1AI1H 4PJFB 2J5LB 4KROD 3WXVL 3GEWB 2VWEC 1KPVB 2DIAA 3LKRB 4I5BB 2DYPB 3G04B 4X5WA 5IIEB 1OQXA 3V4VL 4LCYA 3D25B 1TPXC 3FFDA 4DGVH 3FKUS 3TESA 5B38A 1YECL 3EUUA 4OFVA 1FFOA 3B2UC 1MEXH 3K4ZA 4NZDA 3V6BR 3QIWA 1HKLL 1D9KC 3WXWH 4P2RB 3X3GL 5ID0A 5KSBF 1A3RH 1OAUH 4LASL 4CN1A 4ORGB 3FT2B 1CLYL 3BKJL 3QFDB 4ZPVA 3GIVB 4MJ5A 4O2EA 3MA9L 5IB4A 1KPUA 4JFYA 5C09A 3ARDD 5EORL 3L3GA 1U8IB 1FNEA 1T89A 1X44A 3MXWH 4PJEF 1MQ8A 1P4LA 1N59A 1KPUB 1BOGB 2H9GB 4O4YH 2CDFB 5E4EC 4XBGB 1OAXL 2CKBH 2E9BA 3BGAA 1VPOL 2H1PH 1ZS8B 4XWGH 2AKRB 4Y4FA 4HIXH 3HE6D 5HDOA 1OAYH 2COQA 2Q76A 1U8JB 2Y07H 1OB1B 4G3YH 4N8VA 3BQUB 4Y19B 4R26L 4HWBL 3P0YL 1CQYA 2R69L 5DJ6B 4Z7WE 3C6LB 2NY3C 5E6IC 4PY8J 4GUPB 4PGDB 2VLMD 4Z8FL 1QFWL 2YBRA 4NSKA 5HI4D 4JB9H 4FABH 4YHNB 4LPTA 2HKFH 4Z7VE 3V5HB 2V2TA 3DI3B 3GMQB 4Q74A 5F96H 3QI9B 1KJ2B 1CDIA 3DUUA 5CJOL 4M6OL 1JHKH 5I1GL 4XPBL 3U6RB 1WWWX 2VXTH 3VGBA 1JMXA 1CIDA 3NPSB 2VDOH 4QRRB 4PUBL 1MFAH 4YBQD 1I9RL 2APVA 1G1CA 4XP6H 2IANB 3BKYH 4TNVK 1XGYH 1U91B 1FQ9C 5E99H 3IDYC 3TA3D 3UYRL 1CYGA 3LV3A 1GGBL 2OR7A 2DI9A 3OX8B 3HZVA 4Y5VB 1EJ6A 3ZE0E 3RDTC 3KJ4B 1H0DA 3NCJL 2YPLA 1XGYL 3FZUC 1MF2L 2YRPA 5E00A 5DC0A 2W07A 2VC2H 3PV6A 1NAMA 4Y4HB 1R3KB 2VO5A 1MY7A 2PCPA 5F7LB 4XPBH 4NRYB 5I1GH 4TULH 1CFSB 3HMWH 2DQEL 3MRCA 3OKNA 2A77H 2XTLA 1HI6B 3MV01 1WFNA 4ZPTB 2EDJA 1A9BA 2MQ0A 1XF3A 3B5GA 4FFWD 1MI5E 2ARJQ 4TVPH 5JQHC 4N90D 3DX6A 4YHYB 2YSSB 1VFBA 3CSBA 1I85A 3S36L 1AQDA 3UDWA 1CD9B 4NQEE 5I75B 3MLZL 3REVB 1T83C 1JZ3A 3CDCA 4F9LC 1IGFL 2HT4C 1A6WH 4ZOAA 4FHBD 2D31B 2V17L 4KWUA 1K4CA 1PYWB 3QQNA 1TJIL 3P2TA 1T1WB 4GKNB 4AL8H 5BVPH 4MB4A 2I07B 1TZGL 4KMQA 5SWSD 3JV4B 1IM3B 1CQKA 5IBLD 2XTJE 2NZ9D 4Z78A 1C12B 3TZVA 1U8QA 3RWIA 3HNSH 2X6MA 3MLPA 4L4TA 3O8XD 3LKQB 3ZKQD 4NQED 1NC2A 4XMLH 3W9DB 3L5XL 3QG7H 1BWWA 4PYGA 4WHCA 5GS1A 1BGXL 2PXYD 2ARJB 3OKMA 4FFYL 4PB0L 1P9MA 2L0DA 1DDHB 2HFFA 2G60H 4RISH 3O3BB 2Z31C 1UM6H 4GO6B 5GSVB 3WNNA 4NHUB 4NN7C 5IBTL 4AH2B 5KVGH 3WNPA 3TA3A 1OHQA 3IJHA 3SPVB 2CLVB 3MLYH 2OL3H 5F6HJ 4YDJA 4WI6A 4OZHB 3TO4A 1LO2H 5I16B 4DZ8B 2VXUH 4PV8B 2JCCE 4R6UA 1KENL 2KDGA 2QLVB 5C0GA 2GY7B 4WFFD 5T5NF 1FRGH 3O3AB 2DBJA 12E8H 3O6FA 2G5BA 4ZAKC 5HGAA 1BQUA 2CLRB 3WFBL 3DSFH 4TUJB 5FM5O 1OARL 1QNZH 1RZ7L 1LILA 4XVTL 3WFCH 3QDME 1HKFA 3IU3A 2BNRE 4L4VE 1YPZA 2R1WB 3QDGD 4PTTB 2W91A 3V0VA 3F5WA 3QEGL 5IJKC 1MCPH 2BNQD 3O6FD 1X5AA 3MREB 2X4QB 2A6IA 1CCZA 3EDKA 3ARFA 3EJZD 4MAYA 3UAJC 4AG4H 1GGUA 4Z77A 5T1KB 1ITCA 4U31A 4F2MA 1BJ1J 2DQFB 4KJQC 3L3GB 1T6WA 2YD9A 5I73C 3AVEA 5J9PB 1EO7A 1JRHL 5AD0A 4L4JA 4V1DA 3ARWA 3MYJA 3TBWB 4MVBC 4FXKB 4HAFA 3V7MA 2YA1A 3G6AA 1MPAL 1MFEH 4TTDC 1XGPA 3FFCE 1K4DB 3L5WA 5BZWB 4GAYA 1JZ4A 5C0BE 4JR9L 4GT7A 4QRPE 2XKNA 1MFBL 5KVDL 3WUZA 4JFQB 2AEQL 1EFXA 4D2NA 2VDKH 2YD3A 2R0ZL 3NH7L 4DKDC 4GAYB 3PNWA 1MFDH 4Y2DD 5DFVD 3IXAA 3I3EA 5EN2A 3FQWA 1O5DT 2QSQA 3UPAA 3NZHL 3T3PE 3RJDA 4RRPA 1NCCH 4WW2A 4IBLT 4HC1H 4BYHA 4ZO6A 3K7UA 4NKQB 1FCGA 3CSYB 4K8RL 4F3FB 4PP1C 1MAJA 2YEZB 4HFUH 4KQ4L 1CD8A 4P5TA 4PLKD 5DF0A 4QYOA 1C5CH 3PP4H 3ES6B 2R2BA 2X1XR 3DYMA 2LU4A 2OMNA 3QQ9C 1YMMB 1HE7A 1LEIB 4ZQKA 1U8NB 2AQ1A 1EMTH 1OQOA 2VZSA 1YNKH 3MV7B 5DGRA 3ZE1E 2XFXA 5JR1L 2NYYD 5ISZA 1ZWIB 2N7BA 2NPLX 4JGMA 5LGHL 4OV6F 4F7EB 3N1PC 2Q3AA 1QSZA 3IYLW 4X6BA 2IBGA 4X6CE 4UTAL 1QBLH 4JFFD 1JMZA 1RZGA 3G6JF 1ZHNA 4GRMB 1HQ4A 1RIUH 3G6JE 5C0JA 1IEBA 2B4CH 1G0DA 3HMXH 1MFCH 3U2SB 3VH8G 5GISH 2Z92A 4JREC 4YHLL 5J06A 4JO1H 1SVCP 3A6CH 1BM3L 1E6JH 3NIGE 3TYGL 3BZEA 3RGVB 1WLHA 3MC0A 1UYWL 4M7KH 1AC0A 3O3EA 2HVJB 4DKEL 2JJWA 4F33B 3FQRB 2E7BA 5ECJE 2ESVD 1LO0H 3BAEH 5IUSA 3W5MA 4UQ3B 3CFKA 1N6QH 2DLFH 1MVFA 1FORL 4MAYD 2CDGA 2DS4A 1JN6A 4ODUA 1H15A 5ELIA 2E7HA 1UWGH 3UTZA 2YRLA 1U8QB 5HY9A 3BN9D 5EBWA 1E4JA 4KGLA 1AIFA 4JG1L 3UTSB 5MERA 1ES0B 1GGCH 2QHRL 1K3IA 2EE2A 5DRNB 4LAQH 1S9YA 2R56L 1NCNA 2WW8A 5D7KE 5I8EB 3PQYA 3ARDA 5FO7A 1ZMYA 3DTXA 4O51B 4XTRC 5C08A 1E6OL 1ZT1A 3MRNB 3U30C 1R5VA 3D18A 5ID1A 4OKVB 3LQMA 4NZJA 2ZCHL 3GSVA 3ZKMC 3MCLL 2D0FA 4G9FB 5I76A 1UWXH 1XF2A 3T1FB 4LQFL 2C9AA 1IZKA 4ZTOH 1U8OA 1XF5B 3C2AH 1ND0A 3VFNB 4KUCF 2X4TB 1SJHA 4WTZG 3UPCA 5I8OH 3CFEB 2C1PA 3WDHA 2FJHA 2N56A 3O4OC 3QULA 5DJXB 4XXCC 5IOPB 1ZGLA 3BIBX 1KBGH 2A9ML 1FDLL 1QPXA 1FSKC 1NMAH 1RZJL 4XXCA 5DD1H 4NO0B 4HPOH 4OM1L 5GS3A 5E5RB 4NQXB 4O5LH 3KPLA 2MTPA 5B8CA 1B6UA 3O2DL 1YEEH 3WKML 2DL9A 5BZWA 4BQ8A 3FFCB 3U7WL 3SE3C 1NC4A 1UCBH 1CVRA 1CE6B 4YQXH 4Y8AA 3S7GA 2OP4L 3WFHA 3MOBH 3SCMB 3U36A 1RU9H 1ZANL 4NHUA 3DBXA 4BZ1L 2D4FA 3T0DA 2VSCA 4OZFH 1JGVL 1E6JL 1IAOB 2BOCA 3F8UB 3LN5B 4HUNB 4H8WL 2DQIH 5EOCJ 2VDNH 3GUTB 3ZTNH 3MRIB 1TJHH 2PKDA 3VG9C 2BVYA 2X4NB 4OCYH 4POZD 5EZJA 5HGDB 2BVPB 4QXTB 5IHUH 3L3JB 4MXWH 1NAMB 4Y4HA 4Z7QE 2QQKL 3RUGB 1JGDB 5D1XD 5JPMA 2PUQT 3OF6D 5CFHA 5ISZE 4PJ5B 3UAJD 1X6LA 2NR6C 3GMQA 4NM4L 4CADB 2H26B 2XWTB 3NIFE 2FEEL 2G5BB 5HGAB 5HYJD 4JQVA 2V5SA 1X5GA 1JPFA 1JNLL 3T77B 4M7ZC 3L5JA 3IFPB 4G8EB 4QWWC 1GHFH 3TBYB 4JPIA 1UQSA 5LGJB 3PP4L 1YEGH 5E1HB 3HRZB 4XPGH 4PJHB 3OZ9H 1E27B 4MJ4A 5K9JH 3VGEA 3DLQR 3LMJL 4B7LA 2D2OA 5DMIH 4Z0XA 4OLEA 1ZT7A 1PBYA 4WDIB 2NY7H 5C08D 4CU6A 3MBEB 1G7JA 4GSDH 4MMXC 2CDFA 2J12B 3W9EA 1QVOB 1RZKL 1GXEA 2IFFL 3P77B 1AHWA 5CEXB 3QCTH 4WHYH 4XP5L 3KPTA 4X9GA 3WJJC 5DFTA 4Z7WB 1N0XL 3KPSE 1FH5H 2GFBA 5TE7H 2Q76B 2RCSL 5EZOH 3O4LB 3MLTA 2F54A 2X4RB 5MENB 1UM5H 1KCSH 4DN4H 4OQTA 3W39B 1HK6A 3WSQL 3MUY1 4QXGH 1UVQB 4UNVA 4HT1L 1NMBL 1EEYB 1FL5A 2VWEE 5T3ZL 3HI1B 3HMXA 4HFWB 1PDKA 3VXPA 3Q6GH 2XOTA 2QSCH 2VXSH 3DX9B 2HKHL 4XP4L 2E8YA 3QSKB 1I7RA 4YBHA 3CUPB 2Q7NA 1BJMA 3KPSD 2YC1A 3HR5A 3C5ZA 4WO4B 4Y1AA 4DW2L 1ERNA 5E4IA 3WN5A 1OAKH 5I66A 4P4KC 1L6ZA 1WZ1L 4YHPA 1S7XA 4WGVB 2DYPA 3EOYG 2ZKHH 2VKWA 4U2ZA 3WE6B 3AY4A 2QR0A 4HK3J 3QCTL 1DN2A 2A74A 2RHEA 3MRFA 4MWFB 4X99B 3ULVD 3C60B 4OGAC 4Y19A 1CFNA 3PUCA 1JPGB 1ZAGA 3ILPA 2R4SH 4O51A 2GJZB 2W9DL 4Y5YB 2ERJC 3NTCL 3CX2A 1I1YA 4XZUB 1AXSB 1T4KB 2ADFH 1S7RA 3KJ6L 4U1NA 3ARFC 3U4BH 1QACA 3RWEA 4QOKB 3P0VL 2CGRL 1OTUC 3LV3B 4NZUH 5J13C 2Y5EA 4PRAA 5K93A 5L0QB 5CSZA 3ARGB 5GGTL 3TYFA 1YEKL 1FFPA 4PTUA 3V5DB 5L2KA 3GSNA 3RRQA 2CDGB 4JO3H 4FQHB 4UT7L 3O2WL 3FFDB 5I9QB 1ZGLM 3VWJA 3LRGA 4E5XB 3WLWC 4EI5D 1I1AB 1QSEA 1NSNL 3P4MA 1CGXA 1HILB 5SWSB 1E28A 3TH3T 4FNLH 2HLAA 1S7SB 3OXSA 1AKJD 2V9RA 4HCRH 1BFTA 5CP7A 1KJ2H 4IRJA 5GRYA 3WL9A 2BX5A 4YAQA 3TA3C 3ZL4L 5JNYB 5C0RL 3ZKND 1T7VA 2FZ3B 1LEGB 2E5EA 3O2WH 2V9TA 1YA5A 1ZEAH 5IBUG 1G6RB 4CMHB 1WBZA 5EO9A 5EIIA 4NC0B 3ROOB 3IDUA 4WGWB 1HHKB 2VLRE 3RTQA 3UZQA 3V4UL 1E6OH 4DK6A 1J05A 4BUHA 3SE8L 3JWDL 3GB7B 5HI3C 4NZUL 1Q9KA 3EJZC 2R39A 2QQNL 1YEFH 5AD0B 4ONFL 1A6ZB 1TZHA 2I60L 2DQEH 3FQTA 2UWEA 4PJBA 2IQAA 3HNVH 5DQ9A 3DGGB 2R4SL 2H2SD 2ADJA 4J4PC 3N85L 3T4AB 2YEZA 4N5ED 1FIGH 1K8IB 2Z35B 2AW2A 1VA9A 3X13B 2DOCA 5A1AA 3AS3A 1FAIH 4G6ML 5DD6A 3SE8H 3BZ4A 1CDYA 2XZAL 1QLFB 3H9SD 4ETQA 3QIUD 5B39G 1JBJA 3HAEH 2ICWJ 2JJVA 1UYWH 2EDHA 5AZEL 1WK0A 4MD4B 1JHTB 1HXYA 2P47B 3C5ZB 5FM5M 4TUJA 2XY2A 5L8JB 2XRAL 3ARZA 4QTHB 1WAAA 2ADIA 3QNYA 4JQIH 3DIFB 1T21A 5JIPA 2VZUA 4NCC1 1OF2B 1I9RH 2FEDD 5D1XC 5IW6B 1IKNA 1NBZA 4D0CA 1B4RA 2H6PB 1NCDH 3H9SB 5CBAB 1TJGH 3IKKA 1TVBB 5FA4B 3VFMA 4ZS6C 1MAMH 2QHRH 4NIKB 4LVHB 4L8DA 1IGCL 1JGUL 4PRHD 1QLEL 2QQQA 4XX1E 4F7TB 5E7FA 1NAML 1LGVA 3QUZC 3VMNA 4R4NC 3QCVH 3B43A 2W0KA 1EUTA 4MLSA 2NCMA 3REWB 1M7IB 1IL1A 4TUOA 1UA6L 3K74B 3DURB 3PABA 4YPJA 4KK6D 1FG9C 3X11A 3ULSB 2OL3A 5JXEC 2EC8A 4P23B 5D1ZB 2OJZL 3MFGB 3U9PL 5BMFL 1DLHA 4MZ2A 3WFHB 5DMIL 3K81A 5HHXL 2J8HA 4WUKL 5ENWB 2EKSA 4OCSH 3PGDA 1MCLA 3NH7H 3ULUC 3RNQA 4OLZL 1WBYA 2Y6SD 5AYUL 1G6RL 5I1EH 3KDMA 1QBBA 3DXAB 3V5KA 5MEPA 3X14A 2VQ1A 2VZ3A 5C09E 4ELMA 5TQ0H 1AQDB 4YX2L 3EDDA 4OCXL 2ZUYA 4WFGE 4U0RC 3FQNB 2FWOB 1S8DA 2NY6D 5GPRA 4ZSOA 2AI0L 2ZJSL 2VAAB 3U0TA 1HN1A 5AWNL 2DMKA 2XICA 4OF6A 5JUEH 5KTEH 3L3KA 3RDTA 1OAUL 3LN9A 4X98A 4LLDA 4OT1L 1BEYL 3K1DA 4G9FA 1P4BL 2XV6B 4HFUL 2J3SA 3UBXG 4MJIB 5KS9E 3SJVB 5D7SL 5ISZD 4P4KD 8FABA 4D3CL 3DV4A 2HLFC 4H8WH 4MB3A 3S34H 3EJJX 5E8EB 2JTDA 1HCVA 1KCSL 1IT9H 2XKSA 4XPTL 5EFIB 2NXYD 4Y5VA 3SDYL 3MA7B 2C3XA 2Q20A 1ZXQA 2XZAH 4TSCL 5MEQA 2VLJB 4J3SA 5D6CA 3LQZA 1AY1L 3DVGB 4JKKA 4Y0GA 4HZAA 4WO4C 4KRPC 1QR1B 2O61B 1JPST 3EDJA 4LLDB 4RMSA 4KHTL 4XRCA 4PJBB 5T3ZE 3QR2A 1TQBB 2IPKA 5IMKB 1WC7A 4HCRA 5HYFA 1J86A 1FGNL 3DRTB 3LMJH 1RIVH 2F5BH 3RQ3A 4IMKC 5EIVA 2QEJA 5IVNA 2Y72A 5F1IA 2A6KB 5IFHL 3WLWD 1B0GB 2JELH 1XIWA 2VISA 4P9ML 3WEXA 3L5XH 3L9RA 4GRMA 4L9DA 4YFLF 1V7NL 3NFSH 4XMKL 2VDLL 1MCPL 1AGFB 4WTZA 3N0PB 4HK3N 4UNUA 4Y88A 3FN3A 4H0IA 5CSZB 1RI8A 3SDDC 3UTPE 4IMLA 3CK0L 1GC1C 1U93B 1UWXK 1FAIL 1WEJL 3O4LE 3UBXB 3WFDL 5H37H 2NTFB 2QQKH 4FNLL 1E28B 1BX2A 1FO0L 3RTQB 3BH8A 4WEMB 4LNRA 2C7UA 3C5JB 1KIPB 4CW1A 4PJIE 5F3HA 5T1LA 3ZTNL 1G7PA 2BSTB 5GZNC 5HPOA 5D9SA 3VJ6B 2ZG2A 3QIWC 4ODUB 4HWEH 4GRLD 1MWAL 5KZCB 4KTEH 2AK4E 4KJYB 1RZFL 3F58H 4LPUA 2DN7A 4RMWA 4R90H 4OD1H 1R3HA 5I9QC 4PR5B 3MMEA 1OP9A 4G6FD 3HG1A 4X6EA 3JUZA 1RPQA 1R0AH 4C56A 3VXOA 5HYIA 2G60L 5J3HC 4ENED 3RFZC 5GS0C 4M9PA 2JK5B 2V6HA 4IOIA 1PEZA 3BP4B 4H1LB 2FJFA 4LCCB 3HMWL 4NQDD 3GI9H 5GGSY 5F21B 3RVUD 3BQUA 3HRPA 1R5WB 2NX5A 4Y1AD 2OQJB 1ZV5A 5CHNB 1DVFD 4NRXB 1VFUA 3S97C 4ZD3H 4G8GD 3WE6A 3SQOH 2JB6B 4PRAB 4PJ7F 5D7LD 4QRUB 3GJFA 3MQIA 4OF0A 5ALBH 3GKWL 3EYOB 1CFQB 3IFOA 5IB5A 5F7NC 4XXDA 2FEDC 2IH1A 4OM0H 1R24B 4CJ0A 4V1DB 4NQDB 4ZTOL 3O4LA 32C2A 2J4WH 4UUJA 3PWJA 3RHWF 1P4LB 3OTTA 3U9UB 2XPGB 4O2FB 5D1ZD 4DTGL 1TQCC 3QIUC 2P5WB 1XCTB 5MI0B 3ARFB 2J7LA 4LQ1A 5I1HH 3D85B 5LCVL 3WO4C 3K4DA 1RULH 2B7DT 2DQTH 3DX7B 3VD5A 3EHBD 4LLUB 3PQYD 4DFHA 4Y4HD 1J8HA 4OF8A 3IXAB 2GUOB 5FCUH 2Y1VA 4QT5A 4P23D 4LVNB 3O6LL 2ITCA 2UVFA 5TGBA 4Z76A 1NCBH 2RB8A 4JM2A 3QDJA 5E6YA 4MWFA 4WTWA 4X99A 1XGRA 3ZHKA 1DBAH 4PRDB 5I16A 3OGCB 2R23B 3T77A 4MS8D 5GGVL 3S4SG 1JUFA 1ORSB 4JLRA 4JR9H 3T0EE 2CIIA 4WI5A 1QSEE 4M8VA 1I3GL 3HCVB 3QWOA 1AKJA 3QB7C 1QFUH 3JVGC 3PQYE 1JF6A 4BQ6A 3TN0A 2YUZA 1QP1A 3S34L 1NFKA 5F1NB 1I9JL 1PD6A 4G5ZH 4YBQC 5C8JB 1A47A 4B53A 1CGSL 4MHHI 1YJDL 2YK1H 3FJTA 1FFPB 2JF1A 2X4NA 3NCYP 4PTUB 5C0FB 4PLNC 3T0AA 1NANI 5J6GA 3GMRA 1C7SA 3EDFA 5D1ZC 4P3WA 4NNXB 1NBYA 5BW7A 4MYWB 3V6ZA 4FABL 2XWTA 2H26A 1DQMH 1M7XA 1QUNA 1EMTL 1R3IH 5IV2A 4PJ5A 3BEVA 5EU6A 1D9KD 4X4ZA 1U42A 3T0EB 5CBEB 2PW1B 2X10A 1QSFA 1RVFL 2WIMA 4HXAH 5DC9B 4XNUH 2DJUA 4P3DB 2A6JA 2AJSH 4AT6B 1TZIA 3DHJA 1EO5A 4K07A 4YHKH 5C1MB 4XWGL 3DX6B 1B9ZA 1DUYB 1JTPA 4KZEL 1P84J 2VQTA 1J18A 5IMKA 4FG6D 4D0BA 2PR4H 1QR4A 3T2NL 2B5IB 3O8XA 4OD3L 1QKZH 4UOW1 2AEQH 3QUYA 4A2LA 4YO0A 3HZKA 4GKZA 3HI1A 3CFJB 4JFFA 2XZCH 2CSPA 1BAFL 3HPLA 3D18B 5ID1B 4XI5D 5KAQG 4PGEA 4HPOL 4OM1H 4NFBA 1RZJC 1JGUH 1IGCH 3CAFA 4KDTC 5FUOH 4TSBL 1CBVL 5IROA 4L8SB 2N7AA 4ZUUB 1DLFH 1ES0A 1MCQA 4X9BA 4OCRH 3X11B 2BC4B 1LQSR 4CKVX 4J8RB 2VABA 1TJIH 1TXKA 2VDNL 3IB4A 5C09D 1IAIH 4ZFFB 1AHWB 3AM8C 3FT3A 2IMNA 4KUZL 1XCQA 4YE4H 2B39A 5SX4H