4GOXA

Sulfotransferase domain from the synechococcus pcc 7002 olefin synthase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
275
Chain Sequence
b'KQWQKPDHKNPNPIAFILSSPRSGSTLLRVMLAGHPGLYSPPELHLLPFETMGDRHQELGLSHLGEGLQRALMDLENLTPEASQAKVNQWVKANTPIADIYAYLQRQAEQRLLIDKSPSYGSDRHILDHSEILFDQAKYIHLVRHPYAVIESFTRLRMDNPYALAESIWRTSNRNILDLGRTVGADRYLQVIYEDLVRDPRKVLTNICDFLGVDFDEALLNPYSGDRLTDVGDPNFLQHKTIDPALADKWRSITLPAALQLDTIQLAETFAYDLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyketide synthase
molecule tags Transferase
source organism Synechococcus sp.
publication title Structural basis of functional group activation by sulfotransferases in complex metabolic pathways.
pubmed doi rcsb
total genus 98
structure length 275
sequence length 291
ec nomenclature
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4goxA00
5JRZA 3ADBA 2R65A 4EQ6A 4M1OA 3K09C 3Q72A 1E96A 4BGDA 4B73A 2FX3A 2FSFA 3MFYA 1P2VA 2GZDA 3QF4A 3K09A 1Z6YA 4BZQA 3PQCA 2JDID 3A6PC 3C7KA 1P6XA 1A2BA 3PG5A 2BEKA 3I73A 2J0QA 4M9SA 3X1ZA 2V1XA 3OFND 5FH9A 3GEIA 3U3JA 1HT1E 3DEFA 5FPTA 3PV0A 5H68A 1CR0A 5J4VA 2D74A 2EYQA 4KYUA 2C03A 2GJKA 4PTLA 3T5DA 3BXZA 3SBDA 2JLYA 2CNWD 3EPLA 2P65A 3FKSD 1Z6GA 2PH1A 1RPZA 4Q9IA 2QEQA 3E2IA 4PR0A 1IN4A 5EJEA 2IYSA 1SXJA 4LHZA 5K8TA 2ZAOA 2GEUA 2ZI5A 4GL2A 3DKVA 3MJHA 3X1YA 2GCOB 2ODNA 3RABA 1T3SA 4NDZA 4UNQA 1TPZA 4FCTA 2VLIA 1PJRA 1DOAA 2OCPA 1IN8A 3PXGA 1B23P 1RVDA 3H1TA 3U7FB 4B3DA 1WQ1R 1GUAA 2OT3B 3ZVMA 4IOMA 2EFEB 4QBGB 1UKVY 1D9XA 1ZC4A 2B8WA 3B85A 1W49A 3C14C 3UG6A 3MSXA 2FFHA 3LAWA 4PHTA 2BMJA 1Z0IA 2OM2A 2RGAA 2EWVA 3K53A 3KXIA 2P67A 4JJKA 4LJ8A 4NZYA 4QHSA 4M9XA 3A37A 2NMVA 4TLDA 4Q21A 4G5OA 3DZ8A 2YKGA 3QI2A 1FTSA 4RD2A 3G82C 3EIQA 3L82B 1G8YA 4ASUA 4LBVA 1IY1A 3W6PA 1GM5A 3A36A 1Y63A 3MJRA 1SVSA 4HDOB 4DEXA 1KAOA 4LYJA 5BWMA 2ZI6A 3TBKA 1GL9B 1G6HA 1A2KC 2HLDA 1XBTA 4GMDA 4JYBA 3EC1A 4RFSA 2ZSAA 4D0NA 1KDOA 4BLQA 1R0ZA 2D62A 4MRNA 1P7CA 1SKQA 4F4IA 5E3HA 1EFTA 4PQFA 1X6VA 5K8UA 4WOPA 1QVAA 4TTPA 2FG5A 3SHWA 3VR3A 4IJMA 1S1MA 2BIFA 2EYUA 3AKEA 3N5CA 1WBBA 2CK3A 1KIMA 3THXB 2FEMA 2VQSA 5AJXA 2ZRHA 2OAQ1 3AF2A 2NO1A 4TZ6A 3EZ9A 3B9QA 4NPHA 4ACBA 3ZD6A 1G18A 3BBPA 3R8CA 2YWGA 4LBYA 2NO9A 3SOPA 1VKJA 2AXPA 2JJ2D 5FOVA 2XSZD 3I3SR 4RZ3A 1PLLA 5DLQC 1XB2A 4RJLA 3KKOA 2PJRA 2ZANA 2NIPA 2BMFA 2J41A 2DFNA 1UAAA 3QPUA 5FUXA 3ONWA 1N2CE 4TQAA 2VIIA 3W3AA 3HDTA 2K5UA 4JLMA 2I4IA 3SYLA 2P3SA 4G5QA 4Q7JB 4TMWA 1CF4A 2VP9A 4UNRA 1UF9A 4JKYA 3R20A 1R0WA 2ZE5A 5FR1A 4PHHA 1MOZA 3LFUA 3OZXA 4IEEA 2KWIA 1G5TA 4GBMA 2DB3A 4C4PA 1BYIA 3ZGXA 3MG9A 4IDOA 4P4UA 3DM9B 4C0HA 4UNSA 1J70A 2CVHA 4A6XA 5EP2A 1ZU4A 3FMIA 2W6JD 3WP0A 4TLAA 5JZVA 1OT3A 1CXZA 3QF7A 4RD1A 3RS2A 1T4GA 2DFLA 1R8QA 4TMKA 4HAXA 4PC7A 1SZPA 2DR3A 5DGXA 4A0GA 1YR7A 2ZJ2A 4L9WA 4BRWA 3K70B 5JJLA 3PFIA 1WE2A 4X8MA 3U44B 1MR3F 1ZMXA 4ASUD 2CE7A 2QBYA 1UFQA 4HUTA 3PEVA 2XZLA 1W0JA 5L3VA 5TB5A 5FBVB 3O8CA 1CKEA 4HYYA 2WWIA 5EQTA 3T61A 3CZQA 4E03A 4QM6A 2JLVA 2CL0X 2RGDA 1E1RA 3RS7A 2ZJ8A 4DDWA 2ZROA 3BK7A 2R62A 3FKQA 3OIUA 1GSIA 1QBKC 1II0A 4DDTA 2O5VA 4IDQA 3SHFA 4CIDA 2QAJA 2IEZA 1OKKA 1I4LD 4NYIQ 3P4XA 4B6FA 1NP6A 4D4KA 2FE4A 2FGJA 2P0EA 4WXPA 3SJZA 4DCTA 3I1FA 5P21A 1OLOA 1DPFA 4Y0AA 1WMSA 2QRNA 5BW8A 2RGEA 4Q7LA 1XEWX 3GQBA 2EU8A 2GRJA 2Q0HA 1IM2A 5AK0A 5EZ5A 3KQUA 2WJJA 2UZ3A 1S2MA 2D4HA 2JJ1A 3Q9LA 4IOJA 1E2KA 4W5WA 4DWJA 3VR1A 1OF1A 1P62B 3NBFA 4XD7A 4TQ9A 3FFAA 2VP2A 4LYAA 2HT1A 3SDZA 3LRPA 5AUPB 2N42A 3EA0A 4EIWA 3AVQA 1ZBDA 3UANA 3MAAC 1E0SA 2AL7A 3SYKA 1BOFA 3MMPA 3LA6A 4ZCLA 4NYJR 3LQRA 1P9WA 5FOTA 5B64A 4V0OA 3LW7A 3NG1A 3P26A 4LPSA 4EJSC 5L3QA 3KQHA 1DBSA 1GNRA 3EC2A 4M1KA 1W4RA 2B7CA 4EPXA 3IPXA 2WKQA 2J7KA 1F2TA 3DOEA 2CCKA 1XEXB 4FN5A 3RC8A 4B71A 4DRZA 4PPNA 1N6PA 2A5JA 3EZ7A 1PVOA 1Z28A 2WKRA 3LH5A 1DG3A 1FNMA 5J47A 1J99A 2JLQA 2GETA 2IYQA 3C5CA 3K0AB 3M6AA 4HB3A 4MGKR 4B3XA 2R6GA 3GLHA 5AJVB 2VHQA 3VNUA 3CW2A 2JLUA 2PX3A 2RHMA 4ZPXA 1YQTA 3R7WB 3T5GA 4JLKA 4B2IA 3TRFA 5J4HA 4IDNA 1P5ZB 2I3BA 4KAXA 3SQXA 5DO9A 3A1TA 3B60A 3BGWA 1UADA 1Q1EA 1U94A 2CLCX 2GDJA 4PPQA 2C5LA 4A2WA 1VMAA 2CCGA 4E5UA 5FBWB 1BO6A 1E9FA 1F3OA 1LW7A 3CNLA 4D4MA 3LVQE 1WA5A 2EW1A 2VF7A 3NIBA 4OQNA 3WY9A 3QNUA 4P4SB 1ZRHA 2WHXA 1LF0A 1T8TA 3X2SA 1UEIA 2HUPA 4BZPA 4CT4B 4MGZR 1Z47A 2WSSA 4RFSB 4EPYA 2FEOA 3Q3JB 1YHNA 2NGRA 2ZXUA 3D8BA 1Q21A 4XIGS 6Q21A 4QM7A 2GNOA 4D25A 3TH5A 4UXHA 2OXRA 4C2TA 2VPPA 4OL0A 2Q3MA 3TK1A 2ZJZA 5SZIA 2NO7A 1M7BA 3G5UA 2ZRFA 2ORVA 4YMUA 4OI4A 1YRBA 2X77A 1SKYE 5KDOA 3HR8A 2HF9A 1NIPA 3QKUA 2R6AA 4DDUA 1XCPA 1AN0A 1ZUNB 2WJIA 3LBNA 4PQYA 1C9KA 2IWRA 4BFWA 5FPYA 3QIAA 2G1JA 4ZV4A 5JSZA 4V0NA 1X8JA 3QEOA 3C15C 2D7DA 1E0KA 3A4MA 2AN9A 1E94E 1XNJA 3ICQB 3IHLA 1KI8A 2FWRA 1KNQA 4QHYA 4MUAA 3NH9A 3AH8A 2IXFA 2GCNA 3MWJA 4DKXA 3CF0A 4Z8YA 5AUNB 1N0WA 2IXGA 1XX6A 1EFUA 5G53C 3AGPA 2VSFA 2CLSA 3BFKA 5CLLA 1QG4A 4BFVA 3TLXA 3VAAA 4DLTA 4Q1BA 1NBME 1PZNA 3ND8A 3QE0A 1YR9A 5B58C 2PZEA 1R2QA 5IF9A 1SXJC 3BB1A 1FOEB 4M1SA 4LHVA 5DI3B 1ZNXA 2O8BA 2JA1A 4TTQA 3TR5A 4QGHA 1Z29A 4UQOA 3VX3A 3P32A 2H16A 1VCMA 2XB4A 4FMDB 4C3ZA 2RMKA 5CDFE 3AKYA 2FA9A 3AEZA 4LJ9A 4KITB 4JBYA 1N25A 4PANA 3EXAA 4M53A 2NPIA 4TMXA 3CR7A 4WIAA 2NO6A 4YC7A 3A1SA 3B1YA 2ANBA 2XX3A 2R8RA 1ZW6A 1G3UA 2GKSA 1S8FA 4KU4A 5E7JA 4LGMA 4XWKA 4TWZA 3SFVA 1RRFA 1EXMA 3I8XA 4MRPA 2OUKA 4K46A 4C7OB 2MSDB 4IFBA 4W5JA 5FOSA 4XH9B 4ZKEA 1VTKA 3MD0A 3IO5A 4M1WA 4AKEA 2JJ8A 3CO5A 5AJWA 3WYAA 2ONJA 5C1BA 4YXWA 5CYOA 4DVGA 2RGNC 2F9LA 4LHYA 5AJZA 1BIFA 5FL3A 1OH7A 1A4RA 3JVUA 4O25A 4LYHA 4V02A 3CWQA 3IO3A 2IYLD 3CONA 3MUFA 4WXRA 3IUYA 5SZJA 4PSVA 2GWHA 3QXCA 1Z6TA 4DB4A 2FPKA 2ZSEA 3QKSB 4NKRA 4DCVA 1GRQA 3Q5DA 4B48A 2QAGC 2DHRA 5L8VA 1NMXA 1Q20A 4DSUA 1LNZA 2O0HA 2WICA 4JT2A 4BFUA 2ZS8A 3IIJA 2OFXA 4LOAA 5DNYB 2H18A 4XWOA 5FL7A 1F2TB 3RWOA 2YWEA 4B2LA 1NRJB 3WMFA 3ZVRA 1G7CA 2RGXA 1J8MF 1JJ7A 3ZQJA 4TL9A 2D06A 1E4YA 3Q85A 3KB2A 1Z0AA 5GVRA 1XP8A 4P32A 5HTKA 4TSFA 4UJ3A 1NLYA 4OJQA 3QBVA 1TL7C 1H8HD 3X1XA 4YMWA 1W36D 2BMDA 4FINA 2WWGA 4JYCA 1FFHA 2IXEA 2CJWA 2XXAB 2R2AA 1KI9A 3AKDA 1MO3A 1NVXQ 4Q1DA 3VR6A 4OYHA 5JWOA 3QKRB 4U5XA 3KJGA 4JVLA 1JAIA 4Q1EA 3JZMA 1NBMA 2H92A 2IUTA 4KFUA 5DE3A 4XVUA 3W8NA 3HP1A 5FBLB 3RYTC 2JLSA 4M1YA 3TR0A 4B33A 2F1IA 4OHZA 1FMLA 1II8B 1OW3B 1HA3A 1ZCBA 3NC1C 4RD3A 3N70A 4WVFA 3UMSA 4JLJA 4DEYA 3ZH9B 1NI3A 1ZUHA 4GOXA 4BFZA 2XNSA 2X1VA 1JQJC 3PJRA 2J59A 5D3QA 5J4KA 4MDEA 1DAKA 1N6IA 1P2TA 2IK8A 1NG9A 4JLPA 4E07A 2VBCA 4FWIB 4RZUA 2ZI9A 4C0BA 2ZI3A 5KDDA 4AYWA 5C46F 3RRZA 2WWWA 3CKLA 1TAGA 4BLOA 4HLUC 1U0HC 2XZOA 4LHWA 3IILA 1OB2A 4A0FA 4QJ3A 3VHLB 2JCSA 3W8RA 1XTQA 3U7EB 3CX7A 2I1QA 4A4DA 5D3MA 2GBLA 1NN0A 3THOA 2R6CA 4DHEA 4JSYA 4LWZA 121PA 1NVVR 5EXTA 4NL4H 2FPMA 1ZCAA 1E2MA 3BD9A 2QZ4A 2V8OA 4F4JA 3EIHA 4O2LA 5JEEA 3AVVA 1ZU5A 5H1YA 2AFHE 1DAGA 1VDZA 3DDCA 3MLEA 3RAPR 5LDDC 4PQRA 3UIEA 5JEDA 3FHTA 2GAAA 1OXSC 3B2EA 1F60A 1LVGA 3Q5EA 4IEIA 4X8OA 1C1YA 1KSGA 1OPXA 2C9CA 5JFGA 4DB2A 1HTWA 2QI9C 5SZKB 2JLWA 3LLUA 2O8FA 1VCIA 1KMHB 3KFVA 2QMUA 3NHBA 4CW7A 1NLZA 1FQJA 5CYPA 1CBUA 2C9OA 5HCIA 2NOAA 4DLSA 2P6NA 3CZPA 1DTSA 1LY1A 4KVGA 4MGYR 5DH9A 4TZ0A 3WXMA 4LX0A 4BLRA 1KSJA 2DCUA 4QJ4A 2W0SA 1IONA 5J40A 3CR8A 4JVMA 1R4AA 2QT0A 4FWTA 4Q9KA 1SHKA 3W3ZB 1XD2B 2REOA 1XXHA 2IYTA 3DMDA 2ZE8A 3CNOA 1E2IA 1R10A 1RRCA 3V00A 3FPAA 5KSZA 1N5LA 4G1UC 4GP7A 1NVVQ 2R44A 5E7IA 4BZXA 1XTIA 3ZQ6A 3GLFA 2V3CC 3L0OA 5FL7D 3ASYA 5IT5A 1WDTA 1EGAA 2OG2A 3NEJA 3BC1A 1OH8A 2Q3FA 4V03A 3SZRA 2NZ8A 3GLGA 4G0NA 3TQFA 4GDFA 1G9XA 3KZ1E 2DFKB 3LXXA 2ZRKA 1P9RA 2ZIAA 2FV8A 2YJTD 4GRAA 4FCVA 4YXWD 1KI2A 1J90A 3FWYA 1KI6B 1OSNA 3W5IA 2EFGA 2H57A 1C4OA 1KTVA 5EXPA 3R7WA 4C0KA 3EG5A 1IXRC 4IW3B 1CJTC 3BJIC 4EFLA 2GZHA 1UBEA 1XXHB 2A5DA 2REBA 2ZR9A 4RZ2A 5AJYA 4EPTA 4D26A 2IS2A 3K0AA 2FFAA 4KJZA 3VTKA 2OFOA 4JL5A 2LCFA 3EA5A 4Z54A 4IDHA 4QRHA 1IJFA 3SJAA 3AV0B 4Q4AB 1JXMA 4Z8XA 3OAAA 1OIXA 1E69A 1Z2CA 4Q4HB 3I5XA 2OO7A 4C0SA 4PZLA 1XEXA 2WJGA 3IKJA 3N2EA 2VSXA 2WAXA 1NVUQ 5TY0A 1YZGA 4D80A 4NP6A 1OV4A 2OAP1 3SU8A 4AWXA 1GITA 4US1R 2A7QA 1TX4B 2J9RA 2X8AA 4IVPA 3ZZUA 4I1VA 4PC6A 1GRNA 1XCGB 2Z4RA 5ANRB 1Z0DA 2QGNA 3K8YA 3NDPA 1T0HB 2KE5A 1ZD8A 3U61B 1XWIA 4Q7MB 4W7SA 2PL3A 2HJVA 1FL9A 2J3EA 3CPHA 1S9DA 3UWOA 2BHRA 3RSOA 3WYFA 1ZM9A 2J46A 1M34E 4JS0A 3EIEA 1WBDA 1O87A 1P3JA 1AIPA 1SULA 4HSEA 1E9AA 4NONA 3GJ5A 1ZINA 4HATA 5JCZA 1Z3IX 2ZQ5A 5AUQA 1SXJB 3B1XA 1IAQA 2ZS7A 3GJ8A 4DLVA 2GXAA 5JBQA 4YMVA 4CT5A 5LD2B 1G8FA 3U6KA 3R9WA 2FF7A 3QVUA 721PA 2QAGA 2W2TA 3L2OB 1CTQA 1EFRD 2GXQA 1ZVQA 3FGNA 4R9UC 1HT2E 5GJVC 2IYUA 1Z83A 3TVDA 2F6RA 3H86A 4GMXA 1EX6A 2WM9B 3R9IA 3CH5A 1P2UA 1S4QA 4BFYA 1E79D 1XEFA 3W90A 3B6EA 3HYTA 4RCZA 4A0RA 3M4YA 4FMCB 4XSGA 1FTNA 4LV8B 2CL7X 2H1LA 3QF4B 4QOSA 1NLFA 4L5BA 4MKHA 3RRMA 4IVRA 1YR8A 1JEDA 2XTZA 1E32A 4LC0A 1UM8A 4IOLA 1M2OB 2F1JA 3AP3A 2A78A 2JJ2A 3OIYA 1BH2A 1QG2A 3D31A 1RC8A 1JI0A 3QUSA 4G5SA 5BN5A 1FX0B 3FMOB 1J8YF 3FVQA 4DIDA 4PO1A 2TMKA 3AP1A 1YE8A 3GD7A 4GOKA 4AIIA 3ZS8A 1P60A 1XPOA 2N46A 2Q9CA 3R9XA 3OEHA 4F38A 4DLYA 4U7DA 2F43B 1GRRA 3A8TA 2SHKA 3DHWC 1S3GA 4MYUA 5GJCA 4ZIRB 1X3SA 4OK6A 4PO9A 2EQBA 4ZDKA 2WVJA 3F0TA 3EAQA 3QKTA 4I99A 1CRQA 5BQ5A 2PCLA 3VKWA 3TW4A 1CJMA 2JDIA 3UXMA 4YQFA 5JCPA 1QDEA 5TDHA 5HR5A 3AM1A 1ZD1A 1NN1A 2WV9A 4TLBA 5FBRB 2PEYA 1TUIA 4Q4HA 3D6TB 4C2UA 1T9HA 1YZTA 5EP1A 1IHUA 1G3MA 4PPFA 4ZDIA 4KXFB 2Q3HA 1CR1A 4O2RA 4RD0A 5HCNA 1QHHA 2HDNB 1OHHA 2OBLA 4PSAA 2O8DA 2JLZA 3M0EA 1VYTA 1IQPA 3ZS9A 1XJCA 2VHCA 1U0LA 3BERA 4DLUA 3DM5A 1DS6A 3QQ5A 2C04A 3HR7A 3LLMA 3KXKA 1JPJA 1J7KA 3K70D 4B3GA 3RRNA 3TVTA 8OHMA 2HCJB 4HAYA 4Q66C 1WCV1 4XWAA 2G0TA 1N6KA 3GLGB 2CE2X 1VYVA 2UKDA 2IYVA 4A2PA 1V43A 2ATVA 2IYWA 3SBEA 3TGPA 1D2NA 2Q9AA 3JZAA 5FPSA 2EFCB 2ZI4A 4QC2A 3ZIAA 4CVNA 3IGFA 3UK6A 1JQLB 1ZNZA 2J5XA 4LJAA 4LRWA 4LJ5A 1XMSA 2KBFA 3DMNA 4DSNA 4RD4A 1FUKA 1RRGA 2ZJOA 2W0MA 2B92A 3AUXA 5TV2A 5GADl 1GIAA 4NCHA 3KKPA 2A5FA 1R8SA 1UDXA 4LV6A 3GFPA 5DHFA 4LUCA 3WRYC 3E5HA 4Q4JB 5EE9A 3VNVA 2W2XA 2RGGA 3EWAA 4DLWA 3BAFA 2RB4A 2P6RA 2XGJA 2ERYA 1W48A 2O8BB 4GNKA 4GT1A 5HZHA 3PIRA 1I2DA 1T6NA 1U98A 3ASZA 2BBOA 3TSWA 4B3CA 1E2JA 1P61B 2ZRAA 3CRVA 3I32A 2VHUA 4L8GA 1XXHE 5TVKA 4G5RA 3BS4A 5CIQA 2O8FB 2C8VA 2PEZA 3V4RA 1TQ6A 4UJ5A 1KI1A 3T1OA 2J0VA 4JLDA 5BXQC 2Z0MA 2G77B 3UATA 1KMQA 2ODWA 2HF8A 4M4SA 4QKQA 1JB1A 5KNDA 4QG7A 2UZIR 5A0FA 3RS3A 2WSSD 3FHOA 2L0XA 4A36A 2O0JA 3K0CA 2IWHA 4EJSA 521PA 5C4GB 1P9NA 3GJ7A 5CM8B 1PV4A 2PLRA 1OFIA 3M1IA 1DG1G 3WNBA 4I4LA 1VPLA 3WYGA 1VG9B 4FCWA 4KFTA 4AKGA 3LBIA 3FTQA 1RFLA 1L8QA 2RCNA 3U2QA 2E1RA 3NEYA 1U0JA 3QXXA 4A15A 2Z5FA 3RWMB 1E3MA 5JHHB 4GOJA 1LFDB 1G4UR 3OESA 3H4MA 3KDSE 4KV9A 1E1QA 2Q6TA 3AUYA 4P4SA 2Z6VA 1FW6A 3SS8A 1VG1A 1R0XA 4CRWB 4Q03A 3SN6A 3HPRA 2FZ4A 1RZ3A 2YVUA 3VU9B 4AK9A 4TSFD 2GESA 4QHTA 3VR4A 3B5JA 2RKOA 4B35A 421PA 4O3MA 1PLJA 1CJVC 1F6BA 3AKCA 4TTRA 4AG5A 1FP6A 3TSOA 1BS1A 1VIAA 4EQ6B 1MO6A 5HZKA 2C77A 4QBHA 4A8JC 4EPWA 4MRSA 4ESHA 2QRZA 3LBHA 4TMZA 2HYIC 3D3QA 2VL7A 4IFEA 3SNHA 2XSZA 3CX6A 1ZAKA 4Q47A 1TTTA 2YWHA 1U2RA 1ESMA 1F2UA 1PUIA 1G8GA 1HV8A 3QKRA 4CZ2A 2QSZA 1TQ2A 3KQKA 1L4UA 1KO4A 2OCYC 2QN6A 3FB4A 3FMFA 1N0VC 3AVPA 4EDHA 1CLUA 2E9SA 3KKMA 1US8A 4KFSA 4HLCA 1N3BA 1X86B 1TMKA 1EFRA 2QMEA 3B1VA 4EKDA 3L0IB 1Z07A 1A1VA 5DISB 1FZQA 2IF0A 3CF2A 4TYWA 3K70C 4XTCS 4M1TA 4PX9A 4DSTA 2C99A 1YZKA 2AD1A 2EFDB 2IC5A 3QSYA 4MQBA 4JBWA 2IHBA 4OQLA 3HYRA 2WJYA 5F98A 5KDLA 4W9MC 4BRUA 5FUVA 2B7BA 1AS0A 1US8B 1AGPA 4KLZA 4KO8A 1NSTA 2GBLC 2HXSA 3B7GA 5FUWA 3PUWA 1ODFA 2HXYA 2ZETA 4KSCA 4V0LA 5IHPA 3PUZA 1FPMA 1WP9A 2YOHA 2WIAA 3QBTA 1SXJD 5E95A 5DYGA 2GK7A 2RGNA 3PUXA 3BORA 3Q7QA 1OHHD 2OSBA 1OIVA 3GLGE 3TAUA 1E9RA 2CDNA 4F7WA 2PBRA 4IXMA 5JWHA 5AWFC 2IS4A 1XTSA 2IBMA 4KVAA 1IXSB 4R2HA 4G3XA 4DLXA 1X8KA 4Q1AA 1OH6A 4B34A 2X19A 3OAAD 4EUNA 4HUQB 3DVLA 4PO8A 4C0JA 2P2LA 2ORWA 2G1KA 1SVWA 4BFTA 2B6HA 1R7RA 4D6PA 1JBKA 1TF2A 3T15A 4C7OA 3HU3A 3O47A 2QPTA 1TQDA 1DELA 1AK2A 2Q21A 1E2EA 1U8YA 3BB4A 5SZHB 3PEWA 2QM8A 1G7RA 1KSFX 2ZRMA 3BFXA 4LZZA 2D3WA 3K0SA 1HUQA 3CBQA 4U00A 1E0JA 1LF5A 1JR3E 4UXJA 3KTAB 1G7SA 2JIZA 1HH4A 3WBKA 2CHGA 3ICEA 1CRPA 2IHYA 4M9ZA 2WWXA 1S1CA 1U8ZA 2CNWA 4OQXA 1KK0A 2MSEB 5IK2A 2A2ZA 1FQKA 4EJSB 1JPNA 2LWIA 3VR5A 3AQ4A 1XTRA 5J5CA 1NY6A 2QG6A 4TL7A 4EPVA 4CEHA 1XU4A 3S1AB 1JALA 1R0YA 1X1SA 2QUZA 2CLDX 3OF5A 4PXAA 3PITA 4Q1FA 1LTQA 1Z08A 4LC1A 3QXJA 1LS6A 4Z1MA 1LV7A 1Z0JA 3A58B 2QPOA 4HEJA 1ZUIA 4ITRC 1BKDR 3T34A 1S96A 1KO5A 4B47A 4Q48A 1G4AE 4G5GA 4OI0A 2A5YB 1P73A 1F48A 1XD9A 3L43A 4ON9A 1DAIA 1KGDA 4FXPA 2V9PA 4TMTA 1M7GA 1E9CA 2G6BA 4B75A 4BUJA 4C0QC 5JSZB 4P4TA 1X1RA 3GJ4A 3OE7D 4BFXA 5BN4A 4Q4JA 4TYNA 2BEJA 4JLVA 4QNMA 1KK1A 1XEWY 1Z6XA 3B8HA 1HE8B 1BYUA 2ZR0A 3OEED 4LI0A 4B3FX 2J45A 2UVQA 3J81k 1XMIA 3FYHA 2G0NA 3T12A 3WMEA 1G291 4KHZA 1NVWQ 3OHMA 5DN6D 2EFHB 3RRYA 3FOZA 1ZP6A 2DWPA 4NHOA 4URXR 5KOYA 3WNDA 1IY0A 2QE7A 3X1DA 5EP3A 2J0SA 2VTKA 2ZRCA 3BWDD 2FPLA 4NE2A 1AQYA 4WA7A 1AZSC 1Z06A 2QSYA 5EZ6B 1H8ED 3UKDA 2PT7A 3KJIA 2GJ8A 2VH5R 2OXCA 4H1UA 2AR7A 3ECCA 4W5HA 1W4AA 3REGA 1MH1A 3DZDA 1AA9A 4AURA 3FMPB 4QGGA 4GP6A 4UNPA 4B76A 2NG1A 1OJLA 1XPRA 2QQEA 4NCKA 3LNCA 1E2HA 5CDFA 3LW8A 1NNEA 2FNAA 1D2MA 1G41A 3P1JA 4HDQB 4LBZA 4M1MA 5LB2A 4MKFA 3NKVA 3C4JA 1U90A 2YHSA 3TMKA 1CR2A 3CF6R 1B0UA 2WOOA 2IYRA 2ODEA 3UWKA 5CIWA 4L4UA 3WBJA 5JMTA 3VHXA 1W4CA 1W1WA 1W5SA 4EPRA 3AVUA 5FBQB 4AG6A 4FIDA 2AK2A 1JR3A 1Y3AA 3DPUA 2IYZA 1KK3A 1NMYA 2ZAMA 4BLSA 1D2EA 3KQNA 1U9IA 1XFAA 1GTVA 5TARA 4ABYA 3ZYCA 3CNNA 4US0R 3R8FA 3LX8A 1NG1A 2ZR7A 3TIFA 2VA8A 4DJTA 1K8RA 4HZIA 1S3SA 5DSZA 1HE1C 2ZSDA 3U3RA 2GEVA 4HB4A 1N5KA 2GF9A 2YC4C 4PAQA 3TJZA 1ETUA 3NBYC 1N6HA 3B1WA 4X8LA 5JS8A 2WAYA 4HI0E 2XNDA 4CEJB 2QROA 2W58A 1O3YA 1E4VA 4V0KA 4AI6A 2HEIA 3OE7A 4GZLA 2ZM5A 3S1AA 3BFVA 1ONBA 3U5ZB 1GAJA 2YOFA 3C8UA 2JASA 1BMFA 2VP6A 3OEEA 4FMCF 1Q12A 2QMHA 5A4JA 1T5LA 3CRRA 1RJ9A 3B1ZA 3EWSA 2NPFA 2G3YA 1E99A 3U60B 1GL6A 3L8ZA 5G3ZA 4E09A 5JJIA 4L9SA 5DHAA 4PSKA 5CK4A 3AF4A 4R2IA 2G9NA 3E70C 1L4YA 5KYKA 5B57C 1ZD9A 4LYFA 4GZMA 1I4TD 4FI3C 1GP2A 2ERXA 4ILEA 1QHNA 3KQLA 2X2EA 2W6ID 2WBLC 3GEEA 3CPEA 2NO0A 3B9PA 4LY6A 3IQXA 2FSIA 1JJVA 4A8JA 2LKCA 2XJ4A 1OKKD 1SQ5A 1Z63A 3TE6A 3OFNA 1KI4A 2HT6A 3K9LA 1NN5A 4R98A 4UKDA 4HUQA 4RCYA 1KJZA 3Q7PA 3U7GA 5JHGB 1AJEA 1I2MA 1T3LA 1ZIPA 3T1TA 3KB1A 2C78A 4DBLC 2OE2A 1Z5ZA 4EFMA 4F91B 2OFWA 5CJ2A 2JGNA 1IJEA 4NBSA 2IA5A 1VHLA 1EFHA 3TUIC 5BN3A 1JAHA 3I72A 5JECA 4BWYA 3U3MA 3GJ6A 1KKMA 1U81A 2XZPA 3CB4A 4U02A 2BJWA 2FSGA 1SGWA 2OLJA 3GMTA 1UEJA 3C16C 4S2EA 3W6OA 1KNXA 4AYTA 3NWJA 1OFHA 4N1AA 4DT1A 2V4ZA 1TADA 3GFOA 4CEJA 2OZEA 4GSYA 4D4JA 1LB1B 3NBXX 1SVOA 1XTKA 3CRW1 5JLJA 1QZXA 2V6JA 5BYKA 2REXB 1EFCA 2QTHA 4QFMA 2J87A 4M9QA 3ZD7A 4AKHA 3T1QA 3K9HA 1E2DA 3GLIB 2GILA 4OK5A 1NMZA 1KJYA 2IUSA 2OLKA 2XNDD 1S9HA 4LPKA 3EZ6A 2W83A 4F93B 5H70A 4Q4AA 1RW4A 1W7AA 3UMFA 2P5SA 3LV8A 5G41A 2BBSA 2KBEA 2IYXA 1DARA 2KI5A 3EPKA 3LY5A 4H9GA 3TQCA 2BCJQ 2Q9BA 3SEAA 3ZDQA 4TLCA 4I1SA 4ZI3A 1FP7A 821PA 2IS1A 2ZRPA 2OCBA 4GFDA 1F2UB 1HURA 1JR3D 4N3NA 4Q19A 1RIFA 5HPYB 4AD8A 3AGQA 3VKHA 4XTRA 4LHXA 1NL3A 3X1WA 1AZTA 2ZU0C 4B74A 1G5RA 2GXSA 3EZ2A 2N1BA 5DYIA 5FOXA 4D0LB 1DAHA 1GKYA 4LJYA 4MH0R 2OBMA 4Q01A 3RSLA 2DBYA 1E9DA 621PA 4AKIA 4RSGA 1Z0FA 3THXA 3CPJB 1HYQA 3PVSA 4URYR 1G5PA 2ZSBA 2E87A 2YYZA 1W0KD 3UG7A 2ZTSA 1G16A 4HAVA 1OXXK 4ACAA 2A3RA 5BYJA 4C30A 3CM0A 5ELXA 4A82A 3KX2A 3L0SA 2J0UB 3NC0C 1ANKA 4DIEA 2XJ9A 4OI1A 4G01B 3TAHA 1ZIOA 2FMXA 2MSCB 4JLNA 3I92A 1VCNA 5B30A 1Z2AA 4XD7D 4D82A 2GHIA 2AFIE 1Z6AA 2RHDA 4JKIA 2VP0A 3LX5A 4TQUS 1MABB 5DN6A 1AS2A 1XF9A 1K5GA 2BV3A 2JLRA 1KKLA 1N5IA 1EESA 4A92A 1KY3A 2YV5A 2AXNA 4NTZA 2R6FA 1CU1A 2QGZA 4D0GA 1YKSA 1ZC3A 4QGAA 1W46A 1KJWA 1KMHA 1KK2A 1Q22A 5FR2A 3RLFA 4LCBA 2P5TB 2VO1A 4I81A 1G3RA 2MMCA 4ERNA 4TT3D 2FZLA 3MWYW 4IKEA 2KB0A 4NCJA 2PZFA 2V1UA 2HV8A 3KJHA 2W2VA 1VECA 1NKTA 3BH7A 4AC9A 3BRWD 1DAFA 1YJ5A 2GCOA 3GP8A 4CEHB 1P2SA 2CL6X 1GL7A 2YNMA 3IBYA 3AF1A 3QOFA 1KY2A 1COWA 5KSPA 5IDVA 1ZM3A 2ECKA 1E9SA 1UJ2A 2AK3A 1JEEA 4MRRA 5K8LA 3H2YA 1MKYA 1Q57A 1L2TA 3LQQA 5EE1A 5L3SA 2IL1A 2B21A 3TUZC 1E9EA 1Z0KA 3RNLA 1KI7A 2C96A 3FDIA 1KI3A 1ESNA 2QP3A 2J0UA 4M0LA 3AVYA 2F7SA 4K81B 1SVIA 3LVRE 2A5GA 3RS5A 4DC9A 2DFTA 3QG1A 2ZRGA 3CUEF 4LV5B 1A5TA 3VMFA 4PHGA 1YVDA 3GLHE 1E2GA 3QENA 4MGIR 4MDFA 5F9HA 3U7HB 3RC3A 1F5NA 1ZJ6A 3LDAA 2XITA 4N0EA 3E1SA 5FTKA 1D5CA 1QHIA 2F3RA 2HCBA 3LXRA 2DWOA 3F8TA 1MO5A 2XOKA 4B3BA 1Q44A 1QF9A 2ZE6A 4B2PA 1K5DA 4ARZA 1MRSA 4A2QA 2IT1A 4URUR 3CRMA 2AD5A 1L7VC 2AWOA 2GF0A 2WIBA 1R5NA 3O8BA 2Z4SA 1OB5A 1EG7A 1KZ7B 3NBZC 4L15A 3PCRB 4JBXA 4A0HA 4QGFA 2GXUA 1D9ZA 1TU4A 2CJWB 1W44A 4MA4A 3GLHB 1N0UA 4RFVA 1M74A 4OHXA 3O8RA 1KDRA 1T0JB 1W5TA 2QY9A 3ZLJA 3QXHA 4HB0A 4YMSA 2Z83A 3OEHD 1GNQA 4CDGA 3UPUA 1UDWA 2FFBA 5C2JB 1SKYB 3SJBA 4DZZA 3WP1B 4BEJA 4Q9HA 3SI7A 3IEUA 2GJAA 2WTUA 3THYA 4IVQA 5JS7A 4DDVA 5EP4A 4CYMA 4DSOA 5JI3E 3QXSA 4KLNA 4A9AA 2ZREA 1IBRA 1M8PA 3FHCB 4Q02A 4Q18A 4QL3A 4BEBA 2H17A 1GVNB 1KAGA 2AKYA 1Z8FA 4Q9LA 1AS3A 4TYYA 4K8OA 2RGCA 1UBFA 1TF5A 4BLPA 2VP4A 2C2HA 2NTYC 2GK6A 2AX4A 2OBNA 4JMPA 4MITA 4DT1B 4KSBA 1NBMD 1T91A 2ZRBA 4NCIA 5EUMA 2C9YA 3EW9A 1PUJA 2PLFA 4MUBA 1DE0A 3BE4A 1AKYA 1KHTA 2HLDD 3MWKA 4OHWA 5FI1B 1E2QA 1RE0A 2PX0A 4OJKA 4D81A 2BBTA 3I61A 3N2IA 4BQSA 1DVRA 3ZZTA 3DO6A 2O8CB 3U3KA 4DCNA 2WZQA 4FW9A 1ZM4A 3A4LA 2QP4A 2WPDA 4PC1A 1G20E 1XMVA 3A1VA 3A4NA 3JVVA 1QHYA 2R6DA 2WJHA 1VG0B 4LJ7A 1G3IA 3IIMA 3MGCA 4NMMA 1IXZA 2FN4A 5FOUA 2DYKA 2W6JA 1VYUA 4HDCA 4WZ6A 1K6MA 4YONB 2OEPA 3IHWA 4POAA 2X2FA 3A1UA 3CX8A 4JVSB 4XVQA 1MO4A 3I62A 4TYQA 3CH4B 2IX3A 2V7QA 5CM9C 1II9A 5DIFA 3UMRA 2HYDA 1JXOA 2QAGB 3KKQA 3O8DA 1NJFA 4I1UA 3U4QA 5KUTA 2ZUDA 2FU5C 2ZJBA 3H0KA 3EX7C 1GWNA 4V0ME 4TL8A 2V55B 2OHFA 1DADA 5LBIA 4MKGA 1G1MA 5DI3A 5C18A 4P31A 2F1HA 2G88A 1DEKA 3GEHA 4MYCA 4DCUA 3K0FA 2QBYB 3BB3A 1XMJA 4RVCA 1NSFA 2A30A 3WHKA 4ZCMA 3U44A 4Q7KA 1EX7A 1R6BX 4J0QA 1R5OA 5J4LA 3KUDA 4RKFA 1D8TA 5JJKA 3NVAA 1OXVA 2O8EB 2WPDD 2BOVA 3PEUA 3BIFA 2BWJA 1W0KA 2GCPA 2BKEA 1W47A 4ZCIA 5FPKA 1HY3A 1RYHA 2P6UA 3FFBA 4OKSA 5AUOB 4URZR 1E2PA 2D7CA 3MCAA 3CLVA 2C98A 3EPJA 1ZYUA 4UNNA 4D4LA 4QNRA 2QU8A 1DAEA 4H1VA 3ADDA 4LJ4A 2OILA 4P0TA 1MABA 3PEYA 2ODBA 1G17A 4C0LA 3TW8B 3MWLA 2ZE7A 3TUJC 2YOGA 4YLGA 4HB2A 3SC3A 1U9IC 2RH5A 4TN1A 2FGKA 1HQYE 1WXQA 2ZRDA 4XOIA 1KO8A 1GFIA 1YZQA 2ZJ5A 3F5FA 2QP9X 2VF8A 1W2GA 4LSGA 1XCMA 1W4BA 1XD8A 1G19A 4IRUB 3ZJYA 3THWA 2VHTA 5H8WA 1TEVA 1KYIA 4URVR 4F4CA 4JT4A 2PMDA 2OESA 1HEIA 2QA5A 3L8YA 4RY2A 5FTMA 4KFRA 5TMPA 3BOSA 4ZDWA 4DUGD 1TQ4A 2ANCA 1FMJA 1NN3A 4FMBB 4P3YA 3ZIAD 2W00A 1XZPA 3WHLA 3G0HA 4IDPA 3RDPA 5FUYA 3QEJA 4CEIB 2V6IA 4LJ6A 2A9KA 2FSHA 2VSOA 3AB3A 2BMEA 3GLFB 2FOLA 3QPVA 1M7HA 5KNCA 1M6NA 2XOKD 2AHOA 1YR6A 5HKKA 2BDTA 1TF7A 2WWHA 3D7MA 1T8UA 4YDSA 1COWD 1HQCA 1W0JD 2QENA 4Q1CA 2ZVQX 5TXGA 4B6EA 2J7PD 1OH5A 1UBGA 1QHHB 1WF3A 2ZITA 2ZU6A 1UBCA 3A1WA 4NU0A 4UXIA 1GILA 1JNYA 3Q8XB 3BH6A 4IOKA 4RKEA 4JL6A 1YZNA 3QPWA 5GJWC 2FFQA 1W36B 1RKBA 5J4YA 2PZGA 2XTNA 1IOZA 3GPLA 2V54A 1E98A 1NIJA 1R5BA 2W6IA 2KJQA 4JIMA 1I4DD 4WAUA 4TT3A 4JJZA 4OBEA 3P27A 4PHFA 4QBFA 4V0MA 5L3QB 4Q9JA 4WZAE 2GJSA 5LB4A 1FUUA 2YZ2A 2WKPA 1QRAA 2GA8A 4HAZA 2ZEJA 4A1FA 4CF7A 2IW3A 1MV5A 2JAQA 4YDHB 3HJNA 5FPHA 1E2FA 4QBIA 3W5JA 4QXAA 3SR0A 3AVTA 1CJUC 2XTMA 2ZSFA 1NKSA 2IEYA 4BECA 2VYFA 3K0FB 3I5YA 1YZLA 2RGBA 2ZUBA 1XTJA 3RVBA 3SFZA 1FX0A 1OXTA 4TL6A 4MRVA 4IHQA 1OFTA 3V4FA 1CS4C 1TUEA 2JEOA 1PLKA 4OQMA 2XEXA 2ZRLA 3WRXC 4B44A 5CB8A 1TEXA 1N6LA 1IY2A 4II7A 5D3MB 1X8LA 1E2LA 1EWQA 1D6JA 2WSMA 5IRCD 1QHSA 2O0KA 4KBGA 2H5EA 4PZYA 4IXNA 2BVNA 4XVRA 4A8JB 1E0AA 3SYNA 5FFMA 2PCJA 2EWWA 1G6OA 221PA 1Q1QA 2PT5A 4HLUA 3W34A 4CGZA 2ZVPX 3RS0A 5CB6A 4EFNA 1GKUB 3HU1A 1SHZA 1M1YE 2ZJAA 3NH6A 1ZM2A 3PR1A 2ASEA 1OE0A 2PJZA 1UKZA 3KKNA 4EAQA 1NJGA 4ZDJA 4TLEA 3VX4A 5AR1A 2O8CA 1OFUX 4NYMQ 4HLDA 1IN7A 1VIYA 1G3QA 2QTFA 4OK3A 4NH0A 3BH0A 5G40A 1RJ9B 5EE5B 1OYWA 1U8AA 2Z43A 1TU3A 3DKPA 1EWRA 1KO7A 2JJ1D 3K1JA 2WJVA 3ADCA 1XZQA 3AP2A 3B82A 4M21A 4C9BA 3GLIE 3V9PA 2XXAA 1MRNA 5F3WB 1XJ0A 4Q4LA 1OYYA 1TNDA 1AGRA 2ZRIA 1ZNWA 1GZSA 2C95A 1N6OA 3HWSA 5LPNA 2ATXA 3H84A 2CEAA 4RZXA 1QVRA 2CK3D 2F1RA 3K9GA 1ELOA 2QM7A 4TYPA 2ZRNA 3GCGA 4URWR 1G21E 2IUUA 4P33A 4BLTA 3P20A 1N6NA 4JLAA 4LK2A 3THYB 3QG5A 3ADKA 1UPTA 5CITA 1KOFA 1WB9A 5B2ZA 4L16A 4M2LA 4DUGA 5JRJA 1H8HA 1QHXA 1QHGA 2IF2A 2F55A 1YRAA 2CHQA 1G7TA 2ZUCA 3K0EA 2QPAA 4B43A 2ZYUX 2GZAA 1G8PA 5LD2C 3T35A 4DCSA 3EPHA 1W2HA 3IIKA 4JVNA 1Q1BA 3IEVA 5FTJA 1FNNA 3C5HA 2XAUA 1KDPA 3QKSA 2VP5A 3I4LA 4GI7A 4BASA 4WZBE 3AF0A 3WNCA 3SE0A 2I1VB 3NHAA 4BE7B 1G64A 4JL8A 1AQUA 2NZJA 3FE2A 1KI6A 2ZRJA 4D2IA 4R71A 5GVSA 2F9MA 1RRPA 3CRQA 1YZUA 4X8HA 1VCOA 5EXSA 2ZYVX 2YC2C 2WOJA 2WWYA 3B78A 4CEIA 1E9BA 4ARZB 4HAWA 3NDBB 4LBWA 5KPJA 4GPTA 1GNPA 1KO1A 3QJYA 5E7MA 4JSTA 2YINC 3VU9A 3SJCA 4LDJA 2ZI7A 4Q00A 2BJVA 2GVDC 2Y8EA 1U99A 3AVOA 3GFTA 3ND9A 4Y0VA 4YMTA 3T06B 4DLRA 3THWB 1H65A 2ORIA 3IBGA 1UKEA 5DI9A 4MYHA 3HPQA 1OIWA 1RYFA 5HE9A 5HE8A 3RHFA 4OHYA 1DAMA 3ZZ0A 1XD2A 4M22A 3KFXA 1XDBA 1GDDA 3QY0A 3ZVLA 3OIVA 2QL6A 5C4MA 3AVXA 2NQ2C 4B32A 3IPYA 4PZZA 4DLZA 2ZS9A 3KXLA 1T3HA 3VKGA 2DY1A 3QVVA 5IK2D 5L3SB 3OIWA 2CCJA 2QT1A 1NF3A 5GJBA 3EZFA 3L0PA 1KSHA 2D2FA 5JI2E 3I8SA 3U6BA 3CIOA 2FH5B 2ZYTX 2QORA 1V5WA 2D2EA 4M8NE 3AVWA 4R7ZA 1E6CA 2VRWA 3AF3A 1H8EA 1SVMA 3K0CC 2XB2A 3NTUA 4KBFA 2ZJYA 4S35A 4HZUB 4O0MA 2BM0A 4WBSA 5KNBA 1N5JA 1KDTA 1P75A 4NCNA 3GJ0A 2O8EA 3MRSA 4E22A 1E2NA 1JR6A 5UKDA 4JZKA 4NYJQ 4KI0A 1SXJE 3B13B 3GLFE 2V7QD 3EARA 4HZUA 4DXAA 4JLOA 5CK5A 2RAPA 1CULC 3CWZA 3TNFA 2WMOB 3KJEA 2DWQA 1Q1ZA 4ZKDA 3W6NA 2GTPA 5M04A 2ZPTX 5CLQA 4A6PA 3RANA 4KCGA 1BMFD 1CR4A 1EK0A 1P72A 2IYYA 1IN5A 1YU9A 1Z22A 2YWFA 4PAOA 3P4YA 5K8IA 2OCAA 3ZVNA 3GJ3A 3W9YA 5JWRA 3U4QB 5G3YA 1UKYA 2G83A 5FTLA 1S0UA 4WW0A 2BKUA 2GEDA 4ZO4A 5EE0A 2BBWA 1ZM7A 1LS1A 1N6RA 2BCGY 3PUYA 3KTAA 4PC2A 2F3TA 1CJKC 5CJPA 3T1VA 1A82A 2AWNA 2OV2A 2QE7D 4HAUA 4KYIB 4C0AC 4N0DA 1E1QD 1P4SA 1ZNYA 3IQWA 4MKIA 5FOWA 1GOTA 2QQ0A 2WWFA 4NYIR 4Z1MD 4BPBA 4JLBA 4OQFA 5A5GA 1T5IA 2WMNB 1A7JA 4OI2A 4KODA 2BC9A 2CMKA 3PENA 4Q5IA 1IN6A 3LWNA 2JLXA 4FMDF 2FJUA 4OHVA 4MYTA 3VFDA 4AY2A 2GJ9A 1MT0A 2B8TA 2QTVB 3HU2A 1NY5A 2EVWX 2JATA 3WMGA 3IDQA 2DPXA 1II8A 2VHJA 4XSHA 3C41J 1Q0UA 1VHTA 2QNRA 1GKIA 4I1OA 5KU1A 5F9FA 5EXXA 2CXXA 3ETLA 1Q3HA 4PFSA 4US2R 4F92B 1XRJA 3EASA 5KSOA 3SQWA 1SVLA 2PMKA 1OXUA 4XJXA 5KPDA 3VQTA 2R9VA 4PC3A 2HJGA 2O52A 2O8DB 5L3RA 1XPUA 3U3OA 1XJQA 1GG2A 4ESVA 1SVKA 3NXSA 2QMOA 2CVFA 3K9NA 3DOFA 1CIPA 2CBZA 5E4FA 4NYMR 2VEDA 3TKLA 3TSZA 2GAOA 5KO2A 1J2JA 1WRBA 2J1LA 4ZI2A 4PAMA 3GLIA 1W36C 3PUVA 1E79A 3KL4A 2BM1A 1CEEA 2IS6A 1DO0A 5FI0B 1Q3TA 1VG8A 5F2EA 2LKDA 3KUCA 5HKKD 2AKAB 2JIZD 2H7VA 4ZIRA 1AKEA 3REFA 4PPGA 3RS4A 1CP2A 3F3YA 2F43A 3FKSA 2GVZC 3VR2A 2CHVA 4QJ5A 5EUQB 1KZGB 3GJXC 4HLQB 2ZYWX 2FDCA 5FTNA 1AM4D 2ONKA 4AYXA 2KSQA 3DL0A 4BFSA 2H8KA 4Z51A 1DO2A 5KTYA 5EE3A 2J7PA 2MMGA 5KSYA 1E1RD 1G8HA 4FD2A 3LO5A 4RD6A 4TMVA 3LD9A 5KHOC 1JECA
chains in the Genus database with same CATH superfamily
5JRZA 3OLYA 3ADBA 1YKGA 4AQ7A 1L6IA 1A5ZA 2HPAA 3BSWA 1NV9A 1NBAA 2NUBA 4M1OA 4BZWA 4EDFA 3PQ3A 3WGNA 4BGDA 1QQ5A 4ZVLA 2FX3A 2FSFA 4KVFA 3VDMA 5L40A 1J5EB 1QK5A 1P2VA 3M49A 5I45A 2Q50A 1T2CA 3F6CA 5JY6A 2SKEA 1SG6A 1GD1O 2GZDA 4D9HA 5B1YA 3UMMA 2JDID 5HFNA 3RC2A 4MVJM 4H7DA 5CFRA 3C7KA 1LPSA 4ZCSA 4EG8A 2B4KA 5SY9A 4V1CB 5IDXA 4B6QA 4HOYA 2J0QA 3X1ZA 1D6MA 1AT1A 2VDLB 4IIJF 3FOFC 1TM2A 5BQXA 2BN4A 1CQZA 5EJ9A 4H7PA 4ZC1A 3GEIA 2QRQA 1HT1E 3DEFA 3MRVA 3ESYA 3GFGA 2AMJA 1A4IA 1ESZA 4LYGA 4P53A 5DX1A 1DRJA 5H68A 3WTBA 1IRIA 4EUFA 5J4VA 1ADFA 2C03A 4IJWA 3NEPX 3TMAA 2ST1A 4IHJF 1QK4A 2QTRA 2Z04A 2XGGA 5IPFA 3EEBA 1GKLA 5AXBA 4OOFA 3EPLA 1K8ZB 3G2OA 4CFZA 4EHIA 2PH1A 3KZVA 1GLGA 2QEQA 2XLCA 2ZIEA 3E2IA 1IN4A 2R7MA 1GEGA 3EFBA 3OFSA 1GSOA 1XROA 3JTMA 4S1WA 3TPZA 5LJIA 2GEUA 2ZI5A 3C1TA 5KJEA 3DDHA 1B14A 2P75A 2QVBA 1SEPA 2ID9A 1LDEA 3AL3A 1HDGO 3G1TA 1CK4A 1U02A 2W2LD 3DKVA 4CQJA 4DQVA 4BX8A 2WJ6A 4F9GA 5I01A 2ATIA 5LNK1 1ZN8A 2VSNA 1H5QA 1X70A 1DQZA 4PG5A 4NDZA 2HSJA 4NULA 1QOPB 1EDBA 2WSLA 3VZSA 2VLIA 5TPZA 1M72A 3E84A 3TTTA 1B23P 1SUCA 4HJXA 3H1TA 2BGNA 3D6JA 1GUAA 2OT3B 2PJUA 1RPTA 4II3A 3G1UA 5J1TB 4IOMA 3C1UA 3IA2A 3NZEA 1UKVY 1D9XA 5FUMA 2QVYX 3B85A 2H08A 4WUVA 2R3SA 3MSXA 3SJ7A 5CURA 3SSMA 2KHZA 2BMJA 4HWSA 4KMRA 1RACA 3PX3A 4OXIA 4QHSA 3LBYA 5J2UB 2XKKA 1Q83A 1L1RA 1N57A 2RBEA 1DMSA 1LU9A 3I1IA 3G82C 4KQHA 1CW2B 1P4AA 3M4XA 2XQKA 3OHSX 5KNLA 1XAHA 2BONA 2WJWA 3W6PA 1GM5A 3A36A 3DYIA 3N39C 2R8YA 3ZDRA 3AW9A 3SP1A 4L5CA 1FMTA 2OQIA 2EV9A 4OP3A 3PPYA 4YCBA 5BWMA 2ZI6A 4QG3A 2YIDA 1XBTA 2O3SA 4KR2A 2QNBA 2CJPA 4RFSA 1V37A 1KDOA 2QE6A 1WIWA 2Z2IA 3A28A 4IQ4A 3T4UA 3UOGA 2AYYA 1MOPA 4E1BA 2VNKA 3H97A 2D62A 4KQKA 4CTMA 1A95A 2BZ1A 1SKQA 3ELYA 5EG5A 3DAPA 4LOKA 1FYXA 3NO4A 4PQFA 1ZRMA 4OCZA 2Z5LA 3PNSA 1QVAA 5DYIA 5EPUA 3SEZA 5HK8A 3SHWA 4IJMA 4IZOA 1S1MA 3ZCQA 5BSGA 4YP5A 1KIMA 1XU7A 2VAXA 4R8VA 2D7JA 5DKFA 4JQZA 3IS3A 1RQ2A 1RPJA 2VQSA 2ZRHA 3HS3A 2TSYB 1L7NA 4EM6A 4XRGA 3PD7A 3TTSA 2EGGA 4G6ZA 3B9QA 3U3ZA 2WSYB 5FLKA 4BLWA 4F71A 3R8CA 3URMA 4FBMA 3TRHA 2W4QA 2RHBA 4R1TA 3MTAA 4MQFA 4RDCA 1PNOA 4PAWA 3E81A 3W2FA 2AXPA 2JJ2D 1QU3A 3I3SR 1TA0A 3ASUA 3FFTA 5DLQC 3DBVO 4CIVA 3KTDA 4WZAB 3SZ3A 1KQNA 4ZEXA 5EGNA 2ZANA 2NIPA 2J41A 2F64A 2JA2A 2V3WA 3I3OA 2ECQA 1NW6A 1TAQA 3FPFA 3GPIA 4WVLA 3GBSA 3W3AA 1EUDA 4GM1A 4HH0A 1X7GA 3PA6A 3RW9A 3ZOZA 3L1UA 4Q7JB 3VDXA 1AGXA 1VBKA 1HFEL 2ZJ1A 2M6KA 1J1UA 4C14A 1NJSA 1GZ7A 2WZBA 3FSRA 4TXNA 3JARB 5FR1A 3HA3A 4MPRA 4PHHA 3EEQA 4FZ5A 3EUWA 3OZXA 4EI8A 3NETA 1G5TA 3M5CA 4FZRA 2GPYA 5E8RA 3WV5A 2VJCA 3HY6A 1L5GB 2NVBA 4C4PA 2OQVA 1RFGE 3BIXA 4QUJA 4PYQA 2E1PA 3DM9B 3KEFA 3JD2A 4PYNA 1TM3E 2CVHA 2VDUE 2X40A 3OECA 3H19A 3AFNA 3D8HA 4ZICA 1LBTA 2JAHA 3FMIA 5AK4A 3GUVA 3WP0A 3N2KA 3RADC 4W5NA 4EEXA 5D84A 1T4GA 5F51A 2DFLA 2P1DA 1R0SA 3RQSA 4PC7A 1SZPA 2DR3A 3EFEA 5HFAA 3K70B 2ZJ2A 4ZN6A 3FD8A 1RQ7A 3DD5A 1VSBA 3PFIA 4WD3A 4X8MA 5GV7A 1V48A 1ZMXA 5C8XA 3H5WA 1OZ0A 2C7QA 5TF0A 4UBKA 1HG1A 1C0KA 4ASUD 2UXCB 5CD9A 1RTKA 2UV8A 16PKA 1CDZA 4IG9A 1SHUX 5DTRA 1W0JA 3FKJA 2F3UA 4MCAA 5TB5A 1JSXA 5DP2A 3STYA 1L8XA 1I1NA 2BSAA 4RWZA 3U7RA 4Z1OA 1L5RA 4ER6A 2XY4A 3BDIA 2NZXA 2W2NA 5JYEA 3P9RA 1JSLA 1SHJA 3GQVA 2RGDA 5IBCA 1E1RA 3RS7A 1Y6GA 1GRCA 2O6LA 4EB8A 2DMRA 1ZI9A 3QELA 2VPZA 1V1RA 1I6LA 3GDGA 3VZDA 1H2BA 4R3NA 4RK7A 3FKQA 4D42A 4DDTA 4YLYA 2O5VA 4IDQA 3SHFA 3UV7A 2M9MA 1K5PA 1UBMS 2IP4A 5HF6A 5KVCA 1TXGA 1IN1A 4NNPA 4NYIQ 3P4XA 4RL4A 1NP6A 1KJ9A 1RM5A 2FE4A 1WXWA 4BXOB 3Q88A 2P0EA 4WXPA 5EFZA 3SJZA 2CNKA 1GUBA 3WC4A 3FTNA 1VE9A 3G8AA 4UM8B 4DCTA 1OLOA 4E6EA 3G2IA 1X19A 4J0CA 4FKBA 3H1FA 2BUBA 1VGRA 3OOYA 2QRNA 3EZXA 3H5AA 4OLBA 2H63A 3HCRA 4Q7LA 3UMYA 2PX2A 3TLKA 3ZWWA 2O2CA 3QVGA 1H4SA 1IM2A 5EZ5A 3RB8A 3H99A 2WJJA 3UJNA 5D01A 1S2MA 4B4WA 1TFRA 2D4HA 5ESXA 2OAGA 1D8AA 1LGYA 3Q9LA 1PQWA 3TGWA 4YYZA 2I7CA 2WSIA 1GVHA 1YT5A 1YWGO 3LHDA 3PHBE 2PUVA 3R3VA 1RSZA 3KOZA 2PRIA 4LYAA 4MV3A 4ARVA 5B3KA 5AUPB 2HT1A 2EL9A 10MHA 2B8NA 4QELA 2YHUA 2ZT5A 1J09A 1MP0A 1E0SA 3KWJA 3MAAC 1RM0A 4K88A 3MMPA 1GCOA 2GKGA 3EIFA 4ZCLA 1HC7A 4NYJR 2PL1A 4MVJG 3K4PA 4NQRA 4D9JA 3EVZA 2HA7A 3WSVA 4V0OA 2VJPA 4GEGA 4C7KA 2GM9A 4UTRA 1J39A 1YCGA 2FCRA 4HEHA 4R1SA 3EC2A 1W4RA 2FHPA 1RM4A 3A6FA 1QB8A 3IPXA 3U3DA 5KMGB 2I2CA 4YO7A 2Q4EA 3UGKA 3DOEA 2JFQA 1G4HA 5EMNA 4O4LF 1G20A 4HYTA 1N6PA 3X0DA 4HNRA 2XE7A 1FUEA 3PQ6A 1PVOA 2QLTA 4ARUA 1SCBA 5C8VA 1FNMA 3R74A 1Y9EA 1V47A 4ZYUA 1PFQA 3MIZA 4R2JA 1I4EB 4ZQEA 2JLQA 2GETA 3K0AB 3C5CA 4HB3A 1JR4A 3D6VA 3TXAA 4DM3A 5AJVB 1DCTA 4HH4A 2BP7B 1EJ2A 2PIAA 3JYOA 4Q9DA 2RHMA 2XQVA 3QVLA 4OFXA 2UUOA 1YQTA 3L01A 1GPKA 4G1VA 4XXHA 3R7WB 3R0JA 1U5AA 3AY6A 5DV9A 4CMKA 4BQIA 1JKIA 1IY8A 4UTVA 1CIVA 2IEGA 3Q41A 3MT7A 1GAQA 1WBJB 3A11A 2HRQA 2C4TA 3AHJA 3DLIA 3ELDA 4IDNA 2I3BA 1TJPB 4GZ3A 4EW3A 3KG2A 3FZYA 1GPYA 5DO9A 4DLKA 5K3BA 3A1TA 4JB2A 3BGWA 2XCIA 1WXHA 2JARA 3DXYA 1GLNA 1UADA 2F8MA 1Q1EA 2ZULA 5FWNA 3DW1X 3AR7A 4IFTA 4IJUA 1VMAA 1RXSA 2CCGA 2WJ4A 2Y0DA 3Q3CA 3F3KA 3GOHA 5CLHA 1SUEA 1BO6A 5FBWB 1P7WA 1LW7A 4G4GA 1XNRB 4ER5A 1WA5A 5EIBD 1LDGA 2Z2KA 3WY9A 3QNUA 3T3GA 3QV2A 4O2AB 3BWMA 3TSCA 1TC2A 3E3OA 1T8TA 3NGXA 4P5EA 4ZOBA 1YXMA 5M34A 3BE6A 3T0FA 4CT4B 2XCTB 3JQRA 3R3ZA 3Q3JB 2Y1EA 1H69A 2ZTHA 4Q3LA 2ZXUA 2DC1A 1X7YA 4UHHA 5CLIA 5JSHA 3N6VA 4DDKA 4UUBA 2OHHA 5C8ZA 5FV4A 2IHZA 4X92A 3KRTA 5AMXA 4OL0A 3NCHA 4F4DA 1OU4A 3L6DA 1M7BA 1YZHA 2ORVA 3ZCRA 2H1RA 2BFCA 1GZVA 1V35A 4OI4A 2R79A 2I80A 1Y8QB 4ICIA 1GT91 2OZLA 4UZEA 5KDOA 2R6AA 3M2TA 4HCJA 3ICVA 2H4WA 3S70A 4YAKA 3CEAA 3WIDA 1L5QA 2MOKA 1NBHA 2EJVA 3ORHA 5B3LA 2G1JA 3P96A 3Q9UA 3GVIA 4QYIB 4RIEA 4HFMA 4V0NA 3QEOA 5EYPB 3SQNA 3DEJA 3A4MA 1XNJA 3ICQB 2ZIZA 2QRPA 1KI8A 1VSUA 5HJEA 1GPUA 1KNQA 3U0BA 1QH9A 1LPAB 4W5RA 2D5AA 2I03A 2GPAA 2DT5A 2GCNA 2IXFA 3AH8A 2I78A 3CF0A 1TGVA 3ILYA 4GPEA 3S3TA 1VL8A 3A1CA 1YKFA 5G53C 4ZO6A 2H48A 4CGYA 2OV3A 3OZGA 1YI1A 1RYYA 2FDXA 5T6MA 4CCWA 2IUFA 3RV3A 5JY1A 1NWHA 1YJQA 3BPSA 1NUQA 4XLTA 1PZNA 4W7IA 4BB9A 4FNGA 5F4ZA 1POWA 3ND8A 1SOVA 3IEPA 2WTNA 2C4HA 1YR9A 3K6JA 1ISIA 5ERGB 1QU2A 4Y2JA 1Q0TA 4AO6A 1V6CA 2W6MA 2QW1A 3VDRA 3D5QA 4RGVA 3MTJA 4ZVTA 3ROQA 1Q6ZA 1PDWA 1OBHA 3IODA 2PMBA 1X2BA 2D0DA 2TMDA 1VCMA 2XB4A 2Z57A 2UZ1A 4G0ZA 2M98A 4Q39A 4ZWNA 2C94A 4UM7A 1ZS9A 3EAFA 3ET5A 4C3ZA 1GUYA 4AL4A 3N76A 2H0QA 1QIGA 5CDFE 1G5IA 1J8VA 2FA9A 3BMCB 4FSHA 4LJ9A 2CMHA 3W7BA 4B3RB 3LXMA 3IIIA 5DASA 1Y4SA 3CR7A 5L53A 2NO6A 5BV1A 3A1SA 1H3NA 1J25A 1PTKA 2XX3A 2ZXEA 4B83A 1P3DA 1ZW6A 1GR0A 2OO5A 3MBIA 1DINA 5AW9A 1N92A 4TWZA 2FR0A 2NV6A 2H29A 2B37A 1GG5A 2FWIA 3QLUA 3H6GA 2MSDB 4Q82A 2EW2A 4DA8A 4XH9B 4ZKEA 4G41A 3ZXXA 3A4TA 1R9JA 1C50A 3HCEA 3Q6IA 1A9TA 3QUCA 2RJ3A 1ATIA 4A8PA 1JDPA 3DV0A 3IO5A 4IIFA 1WCYA 3TOXA 2HQOA 3CO5A 4IH9A 4ZYWA 1ODTC 3MUOA 4I5GA 1NPYA 1T1SA 4LKRA 5C1BA 2IDKA 5DGIA 2PKQO 5DFAA 5JASA 5AJZA 2F9LA 1ZQ9A 1MAWA 3GUZA 3T3DA 2B3DA 1A4RA 1OH7A 1H93A 3ZZMA 4O25A 4I9NA 4LYHA 3ETGA 3QFFA 3SOZA 5GTDA 1U1EA 2V7UA 4MINA 5DHQA 4HH1A 3I5AA 5T3UA 2FRXA 2IYLD 3IUYA 2XWSA 4PSVA 1Z6TA 4IJQA 4DB4A 5EHZA 3UGJA 1GRQA 3BXHA 4RK4A 2P4HX 1F5SA 3NNDA 3PRJA 2GF2A 2AG1A 2MR6A 1Q20A 4EBFA 4OF4A 1SZJG 4D9GA 2O0HA 4ZQFA 3D3JA 4QOFA 5G0TA 2ZJ0A 4RMIA 2W6OA 4BAGA 1H2FA 2ZS8A 1CP3A 1K2VN 4FGSA 2AEJA 3FGPA 1J21A 4RE6A 3ZY3A 5K2OA 4DPMA 2H18A 4NATA 1TYZA 1L7MA 3U49A 3WHPA 1L5ZA 1C9NA 3DCJA 3GI1A 3BKXA 1GGFA 3WMFA 5EJIA 3R5FA 1OLUB 3UC9A 3I83A 1O0SA 3OIFA 3RFCA 4YCMA 1E4YA 1V7QA 2AZ4A 4OSPA 3KB2A 5D7NA 2AYXA 5HTKA 3H75A 4P32A 1YIAA 4P3PA 1ESCA 1Y6FA 3ORFA 4IXDA 1JHQA 1H8HD 1Y1PA 4W82A 5AJHA 4KE6A 2C0CA 3KYDB 1JHOA 4UM9B 5K0BA 1GTSA 2BMDA 2Z2XA 1AY0A 1XKLA 1BROA 2D1FA 2V98A 2WWGA 4H6WA 1G66A 3IALA 4FYMA 4OFBA 2YJ6A 3CVYA 2PY6A 1MO3A 1NVXQ 1YBFA 2Q5JA 4JJFA 3PB3A 4QYXA 3M5DA 4U5XA 2BFFA 1RDFA 2V5UA 4V24A 1XZKA 1MX9A 2Y1GA 3V1KA 4X71A 1U2PA 2H92A 2JFVA 1AB6A 3PPVA 2X0KA 4CM4B 4Y2UA 3HP1A 5ALTA 1GGJA 2F1IA 3DBIA 3S2YA 4XDHA 4GYWA 1OW3B 4BNJA 4RD3A 2Q7DA 3ORQA 3N70A 2AZMA 1J0DA 2Z9DA 1AZLA 4GL4A 1QQ6A 1JHAA 3B7PA 1NI3A 3PIIA 4V2UA 2X1VA 1JQJC 4ZHQF 3DEZA 1SBYA 3IQDB 4MULA 5D3QA 3QYFA 3G0OA 1N6IA 1P2TA 5DNAA 3P0EA 5J4KA 4DV7B 2PGXA 4D8UA 4ECEA 5FULA 3FDXA 1UJCA 4QJBA 5L9AA 3H05A 4FWIB 5CHEA 3VO1A 4UVHA 3TL2A 4PCAA 4PGMA 4RHUA 4Y18A 2ZI3A 4C0BA 3JQ9C 3CKLA 3DXFA 3H5VA 2ZB4A 4Z49A 2JBWA 1OB2A 5ALIA 5HWSA 5JZ9A 3H0CA 3CB2A 3U7EB 2I1QA 2WILA 3AJRA 2GBLA 3RVLA 3FCSB 2R6CA 4OXNA 4U7GA 4XB1A 2WF8A 5TGZA 3TZLA 1KWKA 2PA0A 4HD8A 2Q41A 4AJLA 1OUMA 4KIJA 2VKQA 4UCXA 1NXPA 4XIYA 4BNZA 2OPBA 2PG3A 2V8OA 2VHYA 1HKHA 1CQIA 2D1QA 3EIHA 4IICA 5BPHA 3S55A 4PW0A 4KOAA 3ETHA 3DDCA 3N6RA 1L5LA 1G6Q1 5BRJA 5A02A 3B3JA 1F60A 4JI6B 1D4ZA 2H1IA 2OV8A 3D6AA 4EGJA 4YCCA 2C9CA 5D2CA 2GRUA 4DB2A 5SZKB 2D4AA 2CXRA 1O6GA 1R66A 1EFDN 1VCIA 2FCAA 2HSZA 2ONCA 4OH7A 1VIMA 5EKTA 1NQAO 4F56A 2UUPA 2PVCA 1SXQA 1BZYA 3KHTA 2Q1YA 3UAYA 1CBUA 3D3WA 3DEIA 4BMYA 4FNOA 2HM7A 2J6HA 4N5LA 2NOAA 1RBZA 3ESAA 4KIFA 5EYPA 5ALVA 4LZJA 4R5MA 5A05A 1ZGZA 5EUCA 4EKYA 3F73A 3GA0A 1EFKA 2WA2A 1PJSA 2AMVA 4R1NA 2ZBEA 3UN1A 6LDHA 4XJTA 2P3LA 3MWDA 5DK4A 3TINA 1R0CA 1Q3KA 4ZJUA 1AKQA 1IONA 3TS1A 4L2IB 3UAXA 2JJYA 4YN3A 1BVYF 4FWTA 3GL9A 1X2EA 3NHZA 2VZLA 3Q87B 3W3ZB 1UK7A 1TW3A 2P3OA 4RVFA 3ZW9A 5CM2Z 4KRYA 2QRHA 5K0GA 2ZE8A 1KZ4A 4F3KA 1RRCA 3FPAA 4ZAWA 5KSZA 1N5LA 3M7IA 2QXYA 3ET4A 1AHIA 2EFYA 4GP7A 1ZW1A 3HM9A 1JA1A 1XTIA 2JFUA 2PLWA 2X76A 4O2AA 1N9ZA 2XA9A 3ASYA 1JLRA 1U0NA 1M6VA 1EGAA 2OG2A 3BC1A 3FNBA 5IVIA 4MV0A 2JZOA 5L45A 1JQKA 4TV9A 5A9TA 4DNFA 5DM0A 1E5XA 4TOIA 4UATA 4BVFA 2VUTA 2G4LA 3R7BA 3KZ1E 2H1OA 4FSXA 4JK3A 2BHNA 4CMIB 1LBEA 1DC7A 1ISHA 1M9NA 1OYOA 1C3XA 1VLJA 3FPGA 4TV8B 4R0MA 5CA0F 2OB2A 4RC9A 1PR6A 4HT3B 3FWYA 2GPTA 2EFGA 2QN7A 3O82A 3CMCO 4O4HB 4X20B 4BO0A 5CRIA 1KTVA 4CMEC 2YNMC 3R7WA 4C0KA 2QX9A 1IXRC 3Q0IA 3UYKA 1UBEA 2A5DA 2REBA 2VTDA 3K0AA 1X94A 4KJZA 1OBCA 4MV8A 4QDXA 4RESA 1IEVA 3N7TA 4JL5A 1ETHA 4HC4A 4Z54A 1N9KA 3OFJA 4X7MA 4OJMX 4L27A 3D2CA 1BMQA 3KK0A 4YLEA 1IJFA 4Z9FA 4Q4AB 3WL3A 1JXMA 4ROTA 1CV2A 3KOMA 5ALZA 3IT0A 2B8EA 5AM1A 1OIXA 1E69A 3FROA 3LC1O 4N47A 5FAKA 4E33A 3IKJA 4NESA 4ER3A 2PBFA 4X97A 3V1NA 4D3YA 2OYRA 1S7CA 2OAP1 1J0BA 4AWXA 1SA0A 4ZQGA 4M99A 2J9RA 5HGXA 2J3QA 2NVWA 1N5OX 3PJFA 3FCUB 1OCEA 2ZK7A 3NDPA 1QONA 2C83A 4YMLA 1T0HB 3IBFA 2R84A 5K0FA 3BYZA 2RSLA 3FPSA 3DLBA 1ZD8A 1XWIA 3H65A 4Y2QA 1U1CA 4KQIA 4O1MA 3E1GA 4HDMB 4NENA 1T4CB 4Q3NA 4Q7MB 5GONA 1E7MA 1E1NA 3CPHA 3KBOA 1QTNA 2X14A 5C5CA 1L8LA 1GZ6A 3GRCA 3TOVA 1A7KA 2XCRB 3K35A 3QA3E 3OPYI 3BGIA 1KKUA 4BO4A 2R68A 1XALA 1P3JA 1FS6A 1PG0A 3IAFA 2W42A 3F2IA 3G2QA 3JPYA 3K92A 2Y92A 1ODCA 1U0OC 1SXJB 2SKCA 3FH0A 3GJ8A 4OA5A 3VX3A 4A10A 4DLVA 1P2DA 2YJZA 3REQB 4DR5B 4NBUA 1DC4A 4QEDA 3TZHA 2NUPB 3U6KA 3W5DA 3R9WA 3GJRA 3NHSA 5AK3A 1FBTA 1X1QA 3L2OB 5FLYA 3T99A 1J2RA 1Y8RB 1J22A 2GXQA 2WM8A 1OFGA 1FS4A 3FGNA 4LF6B 3UUEA 5GJVC 2DE0X 5C81A 2PM8A 5K6AA 3G8BA 2F6RA 2P35A 3T9FA 2Y68A 1NMSA 4PG4A 1EX6A 2WIDA 4IIUA 1CEQA 1GU1A 3LX4A 3N0TA 3CH5A 2DQKA 2FZKA 1QYWA 2VJKA 4XX0A 3WLFA 4BFYA 2QQ5A 3QFRA 2C2BA 1WMDA 1G5FA 1MG5A 1N9GA 1CPYA 1EZZA 4YRNA 4YMGA 3DAHA 4D5EA 4MS4A 2D2IA 4JJ4A 4KWCA 2R1UA 4Y6OA 3GLQA 3H3FA 1NLFA 1V1RB 4MKHA 4XJVA 1NUUA 4XRRA 4IVRA 1GPJA 2I6TA 2XNKA 4HXYA 5B2EA 3CLRC 5CG2A 2QI9F 1E32A 1PYGA 2WUEA 3EMVA 1ODJA 2RHJA 4NWIA 5ALMA 3S5UA 1M2OB 2A78A 4BNDB 4BE9A 3VNSA 2JJ2A 3EQZA 4NU8X 1A8SA 2DFVA 3ESCA 4GQBA 3ZV7A 4CODB 1J5PA 1T10A 2WJAA 3WS7A 4IILA 3FVQA 4LNHA 1OC2A 2MYNA 1M2FA 1RI4A 4FVTA 4DZRA 2OD9A 3L05A 4PO1A 1F4LA 4RBNA 2JC3A 2Z6QA 4FEYA 4XM2A 3GD7A 4GOKA 4AIIA 2YHIB 4ND8A 1DQYA 4IYRA 3WLAA 5LFAA 2ILTA 4GX0A 4ZQCB 1A1SA 3G0IA 1ZESA 3OEHA 4F38A 3PKJA 1V16A 2YWDA 2F43B 2XEDA 2X0FA 4U7DA 3RIGA 1S3GA 1Z0UA 4TSRA 4MPPA 2PZLA 3ZYZA 3TE7A 2FZEA 4PVCA 2CEKA 5LZ7A 4RV5A 2XRFA 4YBRA 4DC0A 1A88A 3BHNA 4QPNA 4K87A 4IO0A 4PS1A 4ZDKA 2AKEA 1XSEA 2VDNB 2WVJA 3F0TA 3KZNA 3DOJA 5BQ5A 3VKWA 4ARIA 1YR2A 2J31A 4YQFA 5JFOA 1L4EA 2G17A 3BHJA 4COOA 1AUPA 1JJFA 3DEHA 1NVDA 1ZD1A 2FMHA 2WV9A 5FRDA 4DDHA 3DV9A 2K7ZA 1G38A 3MB5A 3D6TB 3S2IA 3L8CA 1DEXA 3OEYA 5CT6A 1G3MA 3OH8A 4I55B 4PPFA 5B1DA 4Z9YA 1EUDB 1O7JA 1PX2A 1CR1A 2Q3HA 1D0IA 1U0RA 2AQHA 4O2RA 3WDMA 4XA8A 4RD0A 4E11A 2UUCB 1OHHA 2CZQA 2VDWA 2O8DA 3NGMA 2RC6A 4WZAA 2A1TS 1HM5A 4LWQA 4URHA 2AUTA 4MEAA 5L7YA 4DYVA 4DR6B 5MN6A 1UDAA 2XMZA 4P81A 2V9CA 1WDLA 4LECA 1JSZA 3CLSC 4UEJA 1PD0A 3TB4A 1VSQA 5DRTA 2HA0A 5E9WA 4BBAA 4FP9A 4LXQA 4R81A 1RJWA 3RO7A 2NZWA 4X9XA 3UTDA 1YULA 5PGMA 4XEHA 8OHMA 3HFRA 3O1HB 1WCV1 1F20A 3GWGA 4LDQA 1GA4A 3PIDA 2XMSA 3GLGB 2ZCJA 4FDVA 3LU1A 4GPAA 1H6CA 1N2ZA 5KB3A 1GCGA 4LZWA 1M34B 2RG7A 4UUAA 2PPVA 3ZW7A 2E6KA 2Q9AA 3JZAA 3TQIA 2QUBA 2A5LA 2ZI4A 3BD8A 4EMSA 3NC4A 1PW7A 3HDYA 4YCDA 3ZBQA 3E53A 3GLRA 2PJDA 4HNVA 5FNVB 1I9CA 1OGIA 1LTHR 2J5XA 1SO8A 5BO5A 4ZI7A 4LJ5A 3NT2A 2IHVA 4C07A 2QW8A 3ZQUA 3KSBC 4ZYXA 3BHMA 1JVSA 4MAAA 3LA8A 1FUKA 1RRGA 1XRPA 3P9XA 4MXDA 4TUYB 4ZC8A 1ZWLA 4I5DA 1BDJA 2B92A 3HBNA 1WLSA 4A1OA 3TL6A 4QXRA 2VK8A 1HSOA 4OKIA 3NHWA 2QTZA 5BW6B 1GIAA 1DQSA 1L5WA 2EKDA 3HA5A 1X7WA 1UMBB 2ENWA 1TI7A 1ZVKA 4GUDA 4GR5A 4O5OA 5LXTB 1NE7A 4CMJA 4LHSA 3EBLA 4Q4JB 5K03A 4CDRA 4X66B 4DLWA 1O5TA 3BAFA 4RVUA 4S3MA 4WLVA 2P6RA 1W48A 4JENA 4GNKA 4F3NA 4UDNA 3PIRA 4PGGA 5FHRA 3U1BA 3SKXA 3JQ8A 4L8GA 4RQTA 1WNTA 4RU1A 5CXQA 4GS5A 3ITEA 2GUWA 3H2HA 3TTXA 2P9FA 5CIQA 5EAIA 1EG2A 1ZOOA 3KVVA 3KL2A 3L7DA 2QG9A 1CE8A 1N1MA 4J0GA 2PHZA 2QQGA 4JLDA 3IDZA 3SDBA 2G77B 2R2GA 2PTGA 1MB2A 1KMQA 2IPMA 3T5CA 3LF2A 1Z5UA 3RV4A 1RBQA 3WA6A 2FPGB 4ZRNA 4A36A 4RM3A 2IZ0A 4UMDA 1E58A 3QLVC 2OENG 3QX8A 1T9CA 4EJSA 4AJHA 5ITSA 2J08A 4KDCA 3SF8A 2N1MA 3LS2A 2PLRA 2BT4A 2RHWA 4BCCA 3B8EA 1LK7A 4H35A 4E15A 1MH9A 3C3XA 2WF9A 4HEA6 5T4EA 1X1EA 1U0SY 1Z7GA 2VDVE 4AMBA 4IYJA 3U37A 5CGQB 2JFPA 4TUYA 3TOZA 5HIJA 2AQ8A 1EZ4A 5JAUA 3U2QA 5ER6A 5I7RA 3QXXA 4AMZA 1HDXA 4A15A 1VPWA 5LBTA 3DTTA 4GOJA 5CVCA 3TDKA 1G4UR 4A03A 1RXUA 4UAGA 3WQRA 2IH5A 4YUYA 4V1CA 4MP3A 3K0HA 3TRJA 4RO0A 1TRHA 1E3QA 5WRFA 3HKDB 1Y33E 4KNVA 3OY2A 3Q3VA 4Q03A 4EG5A 1F38A 2XR1A 1CY4A 1XKTA 4TMYA 2E2WA 5F78A 3VU9B 4QHTA 4HLNA 3UB4A 3VR4A 3VVMA 4ZZ3A 1PVVA 3R5HA 5FIUA 421PA 2A84A 1CJVC 1KBQA 1F6BA 3IHTA 2ZYHA 4TTRA 4ZP1A 2REQB 3KR0A 5HZKA 2AVNA 2C77A 4BO6A 1QOZA 2AVDA 2GAFA 4NF2A 5AK5A 3W6UA 4MRSA 4F86A 3TI9A 1SBIA 4ZJYA 4MUEA 5AD1A 2HYIC 2XVZA 3SNHA 4PY2A 2XSZA 4RKYA 1L5FA 2VDQB 4U4AA 5LQNA 4RE5A 2QSZA 3KQKA 3HUEA 2OBXA 2V7XA 5JS1A 1L4UA 3D8RA 4C08A 1AKWA 4PR3A 3DEYX 5K20A 3A4YA 2X5JO 4LF8B 5M2QA 4NDAA 1OD6A 1V5FA 2IIPA 4G97A 4YQYA 1CLUA 1K5HA 4EDHA 1US8A 2G08A 2GO7A 2NXWA 2QM3A 2C82A 3ST7A 1J1IA 4W8OA 4W1PA 4XUCA 2Z95A 4WLFA 2FPSA 1M1YA 2Q5QA 2DLCX 4YVFA 4M1TA 3FX2A 2RBGA 5FWDA 4FDTA 1C7EA 1GDTA 3EOAI 2EFDB 2I3ZA 2I71A 2JK1A 4ZVVA 3QSYA 4JBWA 2UYYA 1H2RS 3HYRA 3OTGA 1ZR2A 3KXDA 3AWDA 3NATA 4RSHA 3PRKE 5KDLA 4NZOA 3TIXB 5GPBA 4BRUA 3HVJA 4OA8A 1CYEA 2ATEA 4M7OA 4OQYA 4LFCB 5I7SA 5J3JA 2YDYA 3DOHA 4D8TA 2HXSA 3GWZA 5HSGA 3B7GA 4AJ2A 3PUWA 1VBFA 5IHPA 2O2GA 3A9CA 3I1JA 3QFHA 3PUZA 1FPMA 1WP9A 2YOHA 3AY0A 4Y6GB 3UK2A 5EOVA 2GK7A 3WK7A 4DUPA 3O8LA 1SCJA 3PDIA 4H3KB 2HHAA 3N58A 3BICA 4LF4B 4FLMA 1N4AA 5CPBA 1O0CA 4X90A 4RPJA 2IS4A 1V2GA 5JH7F 4KVAA 2C58A 1IXSB 2A0KA 4R2HA 4Y6PA 2PKYX 4YEDA 3RARA 3RYIA 1U8CB 2G5TA 3EIOA 3UJ7A 3UGTA 3UT5B 1OH6A 4B34A 5EKSA 4UEQA 4ZT2A 3OAAD 4EUNA 4CFYA 4Q7QA 3Q3GE 1EQAA 3CLTC 4JOSA 2WVAA 3D4OA 2J3JA 3IC5A 5DTQA 4UOZA 3U39A 2B6HA 3DTYA 3D2BA 3A1FA 4LXHA 3SC4A 3T15A 2R00C 3KSZO 3AEXA 3PXBA 1U8YA 5SZHB 2Y1DA 5CAEA 4LCJA 2LE0A 2ZRMA 3U9LA 4Z3KA 1BE0A 1USKA 1E6LA 3DCYA 2WZDA 5HJ5A 2MSWA 1AKUA 5FD8A 1LF5A 2VTEA 2ZP1A 3UJ3X 1XLTA 4K6KA 1MDFA 1MQ9A 1QH8B 4RHCA 4FR0A 2OOKA 3H2JA 3HXPA 3I30X 1R8JA 1CRPA 2CHGA 3FAKA 4DQDA 4EG7A 2MYTA 4F96A 2RAFA 4GSKA 1N2GA 3SQDA 2A6PA 3I37X 2I4LA 2DLDA 3WFIA 1UC4B 4OQXA 2MSEB 1WR8A 2XH8A 5DM1A 2A2ZA 2HQSA 2QK4A 5IK2A 4EF6A 4EJSB 1JPNA 1V3QE 3WIUA 3DZCA 2HHCA 3AQ4A 1RAEA 2BF4A 2FG7C 1NY6A 4RK0A 5MFZA 1KEPA 3IV7A 1VDMA 3PEEA 3V8BA 4JP1A 3IP5A 1WW2A 4EZIA 3S1AB 2OXFA 1R0YA 2J8ZA 2CLDX 3OF5A 4PXAA 5LLTA 4QUEA 5AQ1A 4Q1FA 1EINA 4MZDA 3QXJA 3ZHVA 1VJ5A 1BX0A 2X1MA 4KXLA 4DMHA 2BPOA 4ZEVA 4EO9A 1Z0JA 2PVSA 1ZUIA 2XB8A 2CJFA 4ITRC 3ROKA 3T34A 3DKIA 3GAMA 4LTMA 2W11A 1TC1A 2GFHA 2R4UA 3H1GA 5FQNA 2LIVA 4Q48A 5KAPA 1G4AE 4G5GA 1NOKA 2A5YB 3HI6A 4HDNB 4TS1A 4OI0A 1HG0A 3ORYA 4FEAA 1AKRA 3AR9A 5DF1A 2H2DA 3DT8A 3H2KA 1PJQA 4Q1VA 4BMDA 1C8BA 2PWAA 4P3OA 1R50A 4DCGA 3PL5A 4C0QC 2WU8A 5JSZB 4O5AA 5KJ1A 1YAHA 1B8PA 1UQRA 2YVQA 3O9VA 3H18A 4Q4JA 1V4BA 2EJTA 3HRKA 3HXTA 4Q3AA 1Q2XA 4JLVA 4KO3S 1Z6XA 5LXTA 2PUBA 3D6NB 1XE3A 1EGHA 2FYTA 4IKPA 4QYTA 2YIVX 4Y1RA 4UD6A 1Y8CA 3D7SA 3GVPA 2J45A 3KJFA 5IYZA 3JQGA 3J81k 2QYTA 3O7WA 3PX7A 3FYHA 4BQEA 2PH5A 3WMEA 3HKBB 2HDHA 5EIXA 3O73A 1NVWQ 2WE7A 4TV8F 4I1IA 5CA0B 5CDTA 1DQPA 1UXKA 1YCHA 3SXUB 1E3SA 1SFRA 1WEHA 5LQJA 4PCUA 1QE5A 2V7BA 4NHOA 3UCEA 3EUEA 3DG9A 4EF4A 3WNDA 4N01A 1IIBA 3ICOA 2VTKA 5AO9A 4BU0A 3PC8A 3BWDD 2FPLA 4NE2A 1AQYA 3GIWA 2JK0A 2ZM6B 5JZMA 3OJOA 4R1PA 2F8SA 1H8ED 3PYLA 1PX0A 5K6TA 3UKDA 1UPBA 3KJIA 4FFBB 2GJ8A 2VH5R 5C37A 5G02A 1DCMA 4IUBS 3O84A 5EHIA 3S2EA 2AR7A 3HFSA 1B42A 2XB9A 4FYJA 4FE3A 3VYWA 5JTUA 4YACA 5B5SA 2O8BA 1QKJA 5AK6A 3KEGA 1IBMB 5INTA 4QGGA 1M6VB 1MMFB 4GP6A 4UNPA 4B76A 2NG1A 5DGCA 4CG2A 4F1WA 1OX4B 3I2GA 4F1KA 3AUFA 2J9YB 3MYRA 4DNPA 1J0XO 5CDFA 1M5TA 3DVAB 5T8KA 3TLJA 4QPCA 4KNWA 4BN5A 1R3DA 2WJZB 1D2MA 1B4DA 3P1JA 3V4OA 1JQAA 5AW3A 3C4JA 5E2AA 2YHSA 1HDYA 2TYSB 3TMKA 3CF6R 4CEJA 2ODEA 1XYGA 3UMBA 3N7AA 3VHXA 3WGGA 1C9YA 3BK2A 3AVUA 2QD3A 4D9KA 1GPWB 2JLCA 2VJMA 2DY0A 2YWXA 1GTL1 3RT9A 3LGXA 4ZCTA 4BLSA 2IYZA 1KK3A 1NMYA 4OQDA 2PFKA 1D2EA 3E9CA 2YVLA 1ODLA 4Q15A 4BMXA 2CXPA 2OP1A 4PG6A 1XFAA 5B7NA 3GZJA