4GOXA

Sulfotransferase domain from the synechococcus pcc 7002 olefin synthase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
291
structure length
275
Chain Sequence
KQWQKPDHKNPNPIAFILSSPRSGSTLLRVMLAGHPGLYSPPELHLLPFETMGDRHQELGLSHLGEGLQRALMDLENLTPEASQAKVNQWVKANTPIADIYAYLQRQAEQRLLIDKSPSYGSDRHILDHSEILFDQAKYIHLVRHPYAVIESFTRLRMDNPYALAESIWRTSNRNILDLGRTVGADRYLQVIYEDLVRDPRKVLTNICDFLGVDFDEALLNPYSGDRLTDVGDPNFLQHKTIDPALADKWRSITLPAALQLDTIQLAETFAYDLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of functional group activation by sulfotransferases in complex metabolic pathways.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Transferase
molecule keywords Polyketide synthase
total genus 98
structure length 275
sequence length 291
ec nomenclature
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4goxA00
1HT1E 3KL4A 4Q03A 4DZZA 1A5TA 1MOZA 1M2OB 1JI0A 1FPMA 1L4YA 2OFWA 3P26A 1F2TB 2H92A 1S3SA 1ZC3A 4WVFA 3AUYA 4EJSA 4HATA 3T5GA 1G3QA 4PSVA 4IDQA 1UDWA 5JRJA 3OEHD 5FOTA 3L0IB 3QF7A 2XZOA 2EU8A 3QPVA 3ZIAA 5CITA 4X8LA 1N5JA 4PPNA 4A0GA 1JBKA 2J3EA 2OBNA 4AG6A 2Y8EA 4ZIRA 3OE7D 4HDCA 1E69A 4J0QA 3M1IA 2P0EA 3BXZA 2EWVA 3W3ZB 4OK3A 2CL6X 4JL8A 3U7FB 3H0KA 3QE0A 2C9OA 3V00A 2LKCA 3OEHA 3K53A 4E5UA 4QJ5A 1S96A 3RAPR 1U9IC 1M8PA 1D2EA 2J7PA 2O8BB 3F3YA 4QHTA 2J46A 4D26A 5B57C 2DWPA 2FF7A 2REOA 1BIFA 2ZVPX 3OESA 5FTMA 3DMNA 5AWFC 3AH8A 4R7ZA 1RIFA 4I1VA 5FOUA 1ZUNB 2ZR7A 4Q7LA 3W34A 1OH7A 4CEIA 4GMXA 3BJIC 2AWOA 2QMOA 2WJJA 3FDIA 2HLDD 4V0ME 2NMVA 4D2IA 4RVCA 1E79D 3ZJYA 3RS2A 5HR5A 3AVTA 3KQLA 2O8EA 1DG3A 1A4RA 3DPUA 5KDOA 2B6HA 3WHLA 3PR1A 4W5JA 4D80A 5AJWA 5FOXA 1RPZA 2IYZA 1JAHA 4LGMA 1K6MA 3VKHA 5KU1A 2CNWA 4PC2A 3R8FA 3I62A 1LS6A 5DISB 1R6BX 2QE7D 3P27A 5HKKD 3UANA 4LOAA 4Q47A 4XSGA 2GJ8A 2VSFA 4DDWA 2R8RA 4ZCLA 1VCMA 2HT6A 4TSFD 4ZKEA 3M0EA 3O8RA 4B2IA 1GFIA 3H2YA 4G5QA 4HB2A 2L0XA 1NP6A 5HPYB 3TR5A 3FKSD 1NIPA 4G5OA 1LFDB 1AS2A 4PPFA 4PZZA 4LSGA 3I92A 4X8OA 3T1VA 3WY9A 1RYFA 2ZRJA 1KK2A 3X1ZA 4LV6A 4P33A 2AXPA 3DM5A 1KO5A 4BFXA 2H5EA 3GJ0A 3IPYA 1T0JB 1L4UA 5BYJA 2JLYA 3TQCA 2QROA 2XGJA 1DAEA 2OBMA 2J0VA 4KLZA 1ZM7A 1X1RA 2QPOA 2IXFA 3O8DA 1Q12A 2NZ8A 4IXNA 4EFLA 3NDBB 1FTSA 3A1VA 4EFNA 4YONB 2YOHA 2FWRA 3LBIA 2OZEA 4DLXA 1YZGA 4A15A 3KXKA 2OESA 3UKDA 2NQ2C 1HURA 3WHKA 2ZJAA 3I3SR 4IOJA 2ZAOA 3B78A 1MRSA 1EESA 2OFXA 1YE8A 4D4LA 4A8JA 4LYHA 1Q1ZA 2CLCX 4MDFA 5JFGA 2GCNA 4EKDA 1NMYA 1TEVA 2X19A 1FOEB 4NPHA 1ESMA 3PUWA 2I3BA 1II8B 3P20A 2G0NA 3K0FA 4LBWA 1TU3A 1D2NA 1P61B 2OAQ1 3U3JA 4EJSB 1R4AA 4QBIA 1CR0A 3AP2A 3SJZA 3ZIAD 2CJWA 4Z51A 2FSGA 2YC4C 1FUUA 5TVKA 2DB3A 3U61B 1KAGA 2ZR9A 3TSWA 2J41A 2GXUA 4IKEA 1YZNA 5H1YA 1P7CA 2ERXA 3R9IA 1RKBA 3IPXA 5JHHB 4RZUA 1H8HD 2IYSA 4BEJA 3HP1A 2J87A 2JJ2A 3LFUA 1JR3E 4CIDA 4WZBE 3TBKA 4KO8A 4RD6A 3GP8A 1PJRA 1QZXA 2V54A 2SHKA 4DSNA 1NNEA 1G41A 4NCJA 3TLXA 2K5UA 2WJVA 3EC1A 4Q4JB 2HCJB 4KFTA 2BMEA 2QP4A 2AHOA 2DYKA 4A8JB 3QXJA 2J9RA 4IW3B 4Q1EA 4TTQA 4UNPA 5SZHB 4MYTA 1KKLA 2IX3A 3I1FA 1UKYA 2D06A 2IEYA 5AUOB 4MH0R 1E1RD 1T3LA 1KNXA 1T3SA 1VG8A 3B2EA 2EW1A 3QKSB 3GJ8A 1B23P 1TADA 5CIQA 3KTAA 2GKSA 1F5NA 2QORA 4RD4A 1G6OA 1P3JA 1Z29A 2QNRA 1OLOA 4AURA 2JLZA 2WIAA 2JLRA 2ZRFA 4O25A 3CR8A 4ABYA 4PSAA 4GT1A 2QRNA 4N0DA 4PQFA 4D0LB 3P4XA 1XMSA 3K0CC 2VP0A 3AGPA 5DH9A 2ZI3A 1FX0A 3BB3A 1EGAA 1R5BA 2QENA 2DCUA 1KTVA 1OB2A 1X6VA 1P73A 4M1KA 2ZYTX 1CRPA 2ZI6A 2ZROA 1IY1A 3EC2A 4Q4JA 4NCIA 5KNCA 1QHXA 4Q9JA 4XTCS 5FBVB 4B71A 3IO5A 4LJAA 4M9SA 4PO9A 4DLYA 2D7DA 2OCBA 5EXXA 5GJWC 1EG7A 1ZD8A 2ANCA 4KODA 2D74A 5TB5A 3L0OA 2RGEA 2WSSA 2GCOB 3DOEA 5FTLA 2YHSA 2QT0A 2NIPA 2VYFA 3E1SA 2R9VA 1W36C 3RRMA 1YRBA 4LV5B 3CRVA 1KGDA 4QJ3A 5HZHA 3RWMB 1XPUA 1P62B 3QEOA 3QVVA 2FEMA 3K9NA 4H1VA 2MSCB 1OXXK 2NPIA 4NU0A 1FUKA 3AP3A 4UNNA 2EFDB 2QI9C 4DB2A 221PA 2O52A 5DYGA 3W8NA 1YHNA 4H9GA 5LDDC 3SYNA 1YZKA 1G4AE 4QC2A 3DM9B 5J4YA 1OH6A 1FL9A 4TTRA 1Q0UA 2BVNA 4PC6A 5FUXA 4DCNA 4TLBA 5E4FA 1EFTA 2ZSAA 3TH5A 4AC9A 2GDJA 1AQUA 1ZNZA 1GP2A 1C1YA 1O3YA 3BB4A 5HCNA 3IEUA 1CJVC 1VG0B 1N5KA 4HAWA 3LW7A 3LV8A 1XEWX 3ZVRA 1CF4A 1RJ9A 2QN6A 3O47A 1AS3A 4YMWA 1CLUA 3NHBA 3U4QB 2F1JA 3SYKA 4GOXA 3I5XA 1XF9A 4F4IA 1XU4A 1JPNA 2CDNA 1KOFA 1W7AA 3U3KA 1U0JA 1Q20A 3C15C 2N42A 4U7DA 2OILA 1IBRA 2WJHA 3E2IA 2W2XA 2QQEA 1F3OA 1QHIA 3EPJA 3TE6A 3LVQE 3MWLA 2QAGB 1E2GA 1M7GA 2BOVA 2OFOA 4XWOA 4B6EA 3LH5A 2QMEA 1AS0A 2D2FA 2QEQA 3I8XA 4A8JC 4MRPA 2VHQA 1W1WA 2HEIA 3Q5EA 1J2JA 4HZIA 1MO4A 4KFUA 3GLHE 5CJ2A 1FFHA 3Q72A 4UXJA 4HZUB 1AGPA 2JAQA 3A58B 3AKCA 4DEYA 3H84A 3VHXA 1VYTA 2GCPA 2XB4A 1Q1QA 3RRZA 4B75A 1RRCA 1YVDA 4JLKA 2GEUA 2GJ9A 2WICA 3RRNA 5JS7A 4W9MC 3T1TA 1X3SA 4CEHA 3CBQA 2AKAB 4GNKA 1J70A 4FINA 4LV8B 4HAZA 2W83A 1TU4A 4Q4LA 2H8KA 5G3ZA 4DCSA 1TF7A 4PQRA 1ZNYA 4BUJA 2CHVA 4A6PA 4DUGA 2ZVQX 1N0WA 5G3YA 4B3BA 1WRBA 2OLJA 1NJFA 1XJ0A 4LHWA 1NLZA 3K09A 2IHBA 2VHUA 3LDAA 4DKXA 4TSFA 5DGXA 1PLKA 1RRFA 5JSZB 4WW0A 1QHHB 1DTSA 2DFKB 3IO3A 3ZQ6A 4DIEA 1ANKA 1SVMA 3Q7PA 4M21A 3ZH9B 3VR3A 4A9AA 3X1DA 5JEEA 3AGQA 1Z63A 1OXTA 2W6JD 3AP1A 4TMZA 2FN4A 3HWSA 4OK6A 3TUIC 1ZW6A 2J7PD 4KBGA 3KKQA 5B2ZA 4I1OA 3AVYA 1EWRA 2O8CB 2HXSA 4CT4B 2QU8A 2PX3A 1UDXA 3BFKA 3SZRA 2ZE8A 4MRRA 1Z2CA 1ZP6A 2BMFA 3OEEA 2GNOA 1FNNA 1KZ7B 4ZDKA 1MR3F 1TQ4A 3B5JA 3RS4A 2X1VA 4GMDA 3EW9A 4NONA 3T34A 4A0FA 2W2TA 4Q1BA 4AKHA 2FPKA 1N0UA 4EPVA 1RVDA 2J5XA 1WA5A 2KI5A 1QVAA 5KHOC 2ORWA 1D9ZA 4OHXA 1E2IA 1T5IA 4V0LA 2JLWA 1KO8A 4GL2A 1M34E 2GZAA 4Q1FA 1NMXA 4OQFA 1F48A 1BO6A 5CDFA 2J0UA 2ZE7A 3VU9B 1VHTA 3KFXA 5JJKA 3GLIB 5JSZA 3KX2A 1Q57A 5K8UA 4I1SA 2Z43A 4MRNA 3ZZUA 4B44A 3QVUA 1U9IA 1YR8A 2LKDA 3K9HA 3KUCA 3QQ5A 4MUBA 1KK1A 4A0HA 4CRWB 1JJVA 2R44A 5G40A 4CZ2A 4PZYA 4LYJA 3IILA 3AVUA 4R2IA 2WJGA 4LCBA 5JHGB 3L8YA 1MRNA 3FHOA 1GUAA 3F8TA 3KZ1E 4B3DA 1A2KC 2G83A 1NF3A 3VKWA 4JLJA 4NYMQ 1R7RA 1CJTC 3LXXA 1G1MA 1RJ9B 4KVAA 1SULA 1CR2A 1TQ6A 3OIWA 5JRZA 2RGNA 4B33A 5EE1A 2ZYWX 1OFTA 1U81A 4HAUA 2QAJA 1G291 1UBEA 1XMIA 2ANBA 2HF8A 3N2IA 3OF5A 3GPLA 2P6RA 4JIMA 2C04A 2PMKA 4XVRA 4Z8YA 3REFA 2JATA 2IWRA 3W3AA 3IIMA 1MO5A 2ZRNA 4MGIR 5FI0B 1ZAKA 1CJUC 4FXPA 3GJXC 3W8RA 3NC1C 2WBLC 5KSZA 3RS0A 2JLVA 2FMXA 1LF5A 3P4YA 2W2VA 4JYBA 4LJ8A 5DO9A 1NVUQ 3BD9A 5KPJA 4OK5A 2A5FA 3THXB 1E9DA 4EIWA 3UG7A 5DNYB 2KE5A 4BFZA 2E1RA 1NVWQ 4M1SA 3P32A 3L2OB 5AJXA 2WPDA 5A5GA 5F9HA 3LX8A 1BMFD 4ZIRB 1XZPA 1GL6A 2WWWA 4X8HA 2ZM5A 1EFRA 2AFHE 2GXSA 1XCGB 2FPMA 3IHWA 3ETLA 5ANRB 4C9BA 2IS4A 2ZETA 1GNRA 1SHZA 4B3CA 3C8UA 2XB2A 1OB5A 4M1YA 3HJNA 2HYDA 4G5GA 4Q7MB 5DHAA 5KSOA 1P4SA 4R2HA 4DLSA 2V1XA 4BLTA 5DSZA 2KWIA 4S2EA 3CH5A 2Q3HA 1PLJA 4P31A 2QAGC 3CM0A 4Q4HA 4C2TA 4JJZA 3HYRA 5HE8A 1II8A 2PZFA 1AN0A 4RD0A 3VX4A 4A6XA 2W0SA 5UKDA 1AA9A 5FPSA 2EYQA 3DOFA 2B7CA 3KJGA 3D3QA 4JT4A 3L82B 2WMOB 1W4AA 3R7WB 2NO0A 1VG1A 1ZUIA 5EP1A 3TQFA 2H1LA 4I99A 2IS1A 2VP9A 1CP2A 5G53C 2ZUDA 1I4TD 2ZRCA 1E9CA 3TNFA 1OPXA 4CW7A 1OFUX 3OFNA 5FR1A 3AB3A 2N1BA 2P5TB 1J90A 3NHAA 4HDOB 4DRZA 3NIBA 4KFRA 1JR3A 4B43A 3PUZA 1WF3A 4ZV4A 4WXPA 4EQ6B 1KI6B 2ASEA 3D6TB 3R9XA 1F60A 2NO9A 1XTRA 3EASA 3N5CA 4OHYA 1D9XA 1F2UB 2IA5A 3REGA 1P5ZB 3OIYA 1Q22A 1JXOA 3GFTA 2DFLA 1R8SA 4DSUA 3K9LA 1D8TA 4IOMA 4AKIA 4Q1DA 4P32A 1IJFA 4B2PA 5EE0A 1VCIA 3AM1A 2O8EB 3KJHA 3TVDA 4TMXA 3VHLB 4RZ3A 3ZD7A 4DCUA 1Z6XA 1BMFA 3TUJC 5L3QB 3KDSE 4ZDIA 1ODFA 4C0AC 1AK2A 4LHXA 1P2SA 2CMKA 2F1HA 2O8DA 4TTPA 1KJYA 3GFPA 1G8HA 2R6CA 4KXFB 1DAIA 1GKYA 2XITA 1NLYA 1NSFA 4M8NE 3T61A 2H7VA 1QHYA 3SYLA 4GDFA 3K70D 3LW8A 4BFVA 1Z07A 4BRWA 1YZTA 4TT3A 2ZSEA 1NVVQ 2D4HA 4M53A 4QBFA 5C46F 3LRPA 4Q9LA 2B21A 4EJSC 3ZVMA 4TZ6A 1E2MA 4AK9A 3BS4A 2D7CA 2AKYA 2REBA 3ZVLA 3MFYA 2EFEB 2GEDA 2RHMA 1EFHA 1I4LD 1LTQA 1IONA 1E32A 3WNDA 5FR2A 1GNQA 5FBLB 2ZU0C 2QE7A 2V3CC 4ILEA 2REXB 1OF1A 3FMPB 3KJEA 4IFEA 4JSTA 1UADA 1IN7A 2FNAA 1CJKC 1GRRA 3CNNA 2O5VA 1SVOA 521PA 4MKHA 5HZKA 4POAA 1E99A 1ESNA 2VA8A 3BOSA 4NCHA 3I8SA 3I73A 4WAUA 1Y3AA 1QRAA 2F9LA 1E2KA 1UKEA 2QSYA 3RC8A 3WYAA 1PUJA 4HUTA 4D4KA 2ZYVX 5J5CA 3NWJA 2JJ2D 2JLXA 1W2GA 1XBTA 3CPJB 2Q0HA 3HYTA 4KV9A 4RKFA 4A1FA 4DLWA 3G0HA 4O2RA 3J81k 2PL3A 1R10A 4IDHA 2ODNA 3L43A 3TMKA 3U4QA 2I4IA 2EFCB 3CZQA 4IHQA 5DHFA 4V0MA 1X1SA 2IUTA 1FW6A 3EIQA 2WJYA 2QPAA 3GEHA 2IF2A 2HCBA 1G8PA 4L16A 2FH5B 2GBLC 2V4ZA 3CPEA 4AIIA 2KBFA 3GCGA 4KBFA 4WA7A 1N0VC 3RYTC 3P1JA 2OCPA 3MGCA 4PAQA 3MG9A 3PEVA 4LJ6A 4LPKA 3G5UA 4DC9A 4R71A 5KNBA 4MDEA 2B8TA 4K8OA 1YR9A 2W58A 3IGFA 1N5IA 4HLCA 3RVBA 3FVQA 1R8QA 1CEEA 2F3RA 1Z6AA 1P72A 3OHMA 3DHWC 2GXQA 5FBWB 2WV9A 3THWA 1W4RA 1WQ1R 1SXJA 2ZRAA 4R98A 4I81A 4B2LA 1WMSA 1TF5A 2XAUA 4M22A 4EUNA 1T4GA 3B9PA 4DUGD 5DYIA 1TUEA 3IEVA 3NC0C 3FMIA 4WXRA 4WBSA 2G1KA 4LHYA 4IVRA 1JECA 3VNVA 1OHHA 1TUIA 2EWWA 2O0HA 2QAGA 3SU8A 5JCPA 3VR4A 3U7GA 5BN4A 2ZANA 2ZS9A 4Y0AA 4F4CA 2IS2A 1DOAA 1OXSC 4X8MA 3FOZA 5KOYA 2FG5A 4M2LA 2BIFA 5GVRA 3BC1A 3PXGA 2NZJA 2ZRLA 1IN6A 3MWKA 3U3OA 1TQDA 1UEIA 2NG1A 1G3IA 5KO2A 1AKYA 1UM8A 2YWGA 1RFLA 2AR7A 4RCYA 4CT5A 2B7BA 1GITA 5DN6D 2RHDA 1N2CE 1QHSA 3IIKA 3OAAA 4KFSA 2HUPA 2JLUA 4WOPA 3S1AB 1Z8FA 3EWAA 1P2UA 5FUWA 4H1UA 5DI3B 3QPUA 1XRJA 3RS5A 3PG5A 4B3FX 2QMUA 1E79A 4C0KA 5LB4A 3SJCA 1ZU4A 1N6PA 3U5ZB 1ONBA 2ZRIA 3OIUA 1UF9A 4RKEA 4QM7A 1JQLB 5KPDA 2OSBA 1X86B 1XMJA 1L2TA 4BLSA 4P0TA 1J99A 1NJGA 2OCYC 5FPKA 1VCOA 4QBHA 1GNPA 3M4YA 3MJRA 1QHHA 5CLQA 1XXHA 1XB2A 4TYPA 4XVUA 4QHYA 4M4SA 2FFQA 1KK3A 1T9HA 3GLIA 4JBYA 3R20A 4TMWA 2RGAA 3RSLA 3GJ5A 4RJLA 4D4JA 4QFMA 4RZ2A 4PHGA 4A2PA 2YWFA 4DT1A 2EYUA 3C4JA 4PC3A 2BBTA 1RZ3A 2V9PA 3NXSA 2C9YA 2ZXUA 3L0SA 4LJ9A 1BYIA 4BLQA 4M1TA 2RGGA 3CUEF 5EXTA 1Q3TA 2ZJZA 3FGNA 1SXJC 3X1XA 2XJ9A 3AF4A 2VP4A 2G6BA 2OO7A 3DVLA 1XPOA 3FB4A 3NKVA 5JEDA 4GP7A 4YMTA 5HKKA 1E96A 1US8B 2GAOA 1U2RA 1DAKA 4NH0A 2C9CA 2DHRA 4XOIA 3TK1A 4A4DA 1W5TA 4DXAA 1P9NA 2WOOA 4LDJA 2FDCA 1E2DA 1W36B 3U2QA 3VU9A 2F3TA 3UK6A 2GVDC 1UEJA 1HQYE 2WWGA 2QMHA 1R0WA 4Q9KA 4NYIQ 1NL3A 3AF1A 4BECA 2W6IA 1KO1A 3B13B 3U3MA 3TSOA 5EE9A 4JVSB 5JWHA 2ZRDA 1ZD1A 3BERA 2F55A 3K8YA 4JZKA 1GM5A 4M1OA 4LWZA 5AJZA 4HSEA 2QPTA 3B7GA 3HU3A 3CZPA 1JQJC 1VYUA 1VYVA 2VHTA 2BM1A 4TL6A 2IYRA 2ZQ5A 2WVJA 3IUYA 3LD9A 4LZZA 2W6ID 1SVWA 1WCV1 2GWHA 2VP2A 5FI1B 1E9RA 1GAJA 1M74A 2TMKA 3IDQA 5J4LA 3TUZC 1QG2A 1OSNA 4L5BA 4LK2A 4URUR 4CDGA 1P75A 2BMJA 1TMKA 2VPPA 5C1BA 4Q9HA 1CTQA 1OFHA 2AD5A 3SFVA 3PJRA 2IYXA 3CIOA 4TLDA 2IS6A 2QP3A 4O2LA 1U99A 3W9YA 721PA 4GFDA 1OFIA 3U6BA 1A1VA 4QRHA 1GKIA 4ARZA 4BLPA 1N5LA 5AUNB 5JI2E 1WDTA 3CW2A 2PT5A 3K09C 4C0JA 3QG5A 1I4DD 3U44B 4U5XA 4MYUA 4CEIB 3A36A 2WWYA 2FJUA 4NP6A 1ZVQA 4BWYA 1GIAA 2Z4RA 1YZQA 4JBWA 1UPTA 1CS4C 1OKKD 1DADA 5KDLA 4O3MA 2OXCA 1N6RA 2A78A 2GZDA 2IYYA 4HYYA 3R7WA 1E1RA 4XSHA 1XEWY 3LAWA 3EZ2A 2V1UA 3GMTA 4Q7KA 1G7TA 3BWDD 1DO0A 1ZIPA 1X8JA 1GILA 4OI4A 1GWNA 621PA 5TXGA 3KJIA 2LWIA 5LB2A 3GD7A 1KK0A 3A4NA 3OFND 2HV8A 2RCNA 2FU5C 3CX8A 3LLUA 5LD2B 4CGZA 4EQ6A 3OAAD 1KDRA 1RRPA 4OQXA 2NPFA 4QKQA 3GLGA 1NN3A 2CEAA 2YC2C 2MMCA 2RH5A 1BYUA 1F2UA 1XEFA 3B82A 1O87A 2A9KA 3MUFA 3QKSA 3QXSA 1XTSA 1F2TA 1U90A 2FEOA 3H4MA 4MUAA 1FQJA 3DKVA 4O0MA 1E9SA 3LX5A 2NGRA 5BN3A 3GLIE 3BH6A 4Q18A 4Q7JB 1P60A 1S2MA 2FX3A 1KJZA 5HTKA 2PT7A 4US1R 4TL9A 3CH4B 1K8RA 3TJZA 4TWZA 2VP5A 4URZR 3C16C 1HH4A 4QGAA 4Q4AB 3CF0A 3RWOA 1IXZA 2JDID 1AZTA 5CB6A 5GVSA 5DE3A 1GVNB 3VTKA 3OZXA 2Q9AA 3GEEA 2IC5A 3BAFA 2ZE6A 3T15A 4A82A 2ZJOA 1US8A 1VKJA 2PX0A 3QXXA 4PHTA 5H68A 3W90A 1Q1EA 1ZJ6A 5BYKA 1Q21A 1RE0A 4FMBB 4JJKA 2GAAA 1OIXA 2HT1A 2MMGA 4YMVA 421PA 1E9AA 3BBPA 4C0BA 1M7HA 4DVGA 3K70B 1DAMA 2CCJA 3OIVA 1OXUA 5FOWA 2WHXA 3THYA 2X8AA 5IDVA 4HAXA 1F6BA 3ZS8A 1SZPA 2G3YA 2XZPA 4WZ6A 2XOKD 2A3RA 1I2MA 4B48A 1JR3D 3KB2A 3T12A 4DWJA 1QF9A 4AYTA 4D4MA 1G5TA 2YOFA 4QJ4A 4TLEA 1MH1A 3CNOA 4OQMA 1IOZA 4KAXA 1VG9B 3AVVA 1IM2A 1AJEA 3B1VA 2XEXA 3FTQA 4RD2A 2DY1A 4NKRA 3QSYA 1TF2A 4US0R 1G5RA 5IRCD 1YR7A 1MT0A 2CE7A 2GJAA 3LXRA 2OM2A 1LW7A 4G3XA 2ECKA 4HLUA 3IBYA 1E2PA 4E22A 3UATA 4LJ4A 1QG4A 5D3QA 2W00A 4FMCF 2QM7A 2Z0MA 4YXWD 2A5GA 2ODWA 3R8CA 4NBSA 2WWXA 1E4YA 5TV2A 4NL4H 2DWQA 1JB1A 4G5SA 1W4BA 2Q3MA 3AEZA 3KTAB 5AJVB 1N6OA 4BZPA 1CXZA 5JCZA 2QP9X 4OHVA 1V43A 2JIZA 4C0LA 1TTTA 3A8TA 1Q1BA 3GJ4A 3MMPA 4D0GA 1OH8A 3PITA 1Z08A 3LBNA 821PA 1N6HA 2CBZA 4S35A 4ZCIA 2QT1A 1FP7A 4G01B 1FX0B 1W44A 3KKMA 3ZGXA 4UNQA 3NG1A 4P4SB 4KU4A 1Z0DA 2J59A 4TT3D 1XWIA 4DLZA 2W0MA 3OE7A 1C9KA 3SBDA 1XZQA 2OE2A 1E4VA 4IOKA 1E98A 2G88A 4NYIR 3W6PA 4B74A 3VKGA 1ZM2A 5BWMA 2R6GA 2P67A 2OAP1 3NH9A 3BIFA 4EPWA 2JJ1D 2XOKA 4QNRA 1W36D 1P6XA 4DLRA 3ICEA 2GCOA 1HTWA 1J8MF 4G0NA 1ZINA 1XEXB 4LHZA 4KYUA 1XJCA 2WKPA 3CO5A 4ZPXA 3SOPA 4N0EA 4BZQA 4CEJB 1NSTA 2ZI5A 1NN5A 2JIZD 4TL7A 2BBWA 4OQLA 2V55B 1MABB 2VF7A 2B92A 5GJVC 5EZ5A 2VHCA 3TAHA 1PUIA 3JZAA 3U60B 1KAOA 1K5DA 4RY2A 4BFSA 1IQPA 1GG2A 4Q5IA 3AUXA 3WRYC 2ZS8A 1SQ5A 4QNMA 4YDSA 1R0YA 4FMCB 4TMKA 3UG6A 3A1SA 4YMSA 5JBQA 2IW3A 3FMOB 4TYQA 3ZDQA 1FP6A 3AKDA 3BORA 3SEAA 1W0JD 3C5CA 1HY3A 2FV8A 3CR7A 2VHJA 3X2SA 1P2VA 4ACBA 5CDFE 2AD1A 3WP0A 3K0AB 4URVR 4KHZA 3G82C 5GJBA 4IEEA 1UBFA 4GRAA 2ZJ5A 3ZD6A 5DI3A 4DCVA 1UBGA 2IYWA 2MSEB 4JLPA 2YOGA 2GRJA 3QXCA 3U3RA 1SXJE 1TX4B 3V4FA 4C3ZA 4QGFA 2NO6A 3LBHA 4OL0A 4Q02A 5IHPA 3FHTA 1OJLA 4HI0E 1PVOA 1OHHD 5FTNA 2R2AA 1T6NA 3PEYA 2GETA 2KSQA 1E2HA 4PQYA 2ZRKA 2CE2X 4JVMA 1MKYA 3ZZTA 2J45A 4IFBA 3K1JA 5E7JA 2D3WA 2QBYB 3CWQA 4LYAA 1U8AA 3ONWA 1NY5A 1IXRC 5DLQC 3LO5A 3UMRA 5FFMA 4DHEA 5TMPA 3BGWA 2PEZA 1R0ZA 2C8VA 4LHVA 4OJQA 3V4RA 1Q3HA 4XWAA 2C96A 1U94A 4RD1A 4GP6A 3EWSA 2JJ8A 2XJ4A 3EXAA 4PAOA 1YU9A 3SDZA 2AK3A 4FMDB 2VLIA 4ERNA 2AXNA 4C7OA 4A36A 4ITRC 1GOTA 2ZRHA 1YJ5A 1XNJA 1G64A 2RGCA 4RFSA 3RC3A 4ON9A 2ZJ2A 1AM4D 2WZQA 2CNWD 3ZS9A 5FL7A 4G5RA 3SS8A 2EVWX 2RMKA 2YNMA 4PX9A 1E2JA 2WPDD 3EPKA 5ELXA 2QSZA 4UJ5A 1QHGA 2ZI7A 2JA1A 1RYHA 3AVPA 3LY5A 4D0NA 1II0A 4XD7D 3QBVA 3GLHA 1EFCA 2H16A 3KFVA 4ESVA 2XTNA 5EP3A 4UNSA 2RGDA 3PENA 3N70A 4JLDA 2VQSA 1Z2AA 2XSZD 5F98A 1T8TA 3QKRB 2QY9A 1OE0A 5KSPA 3LQQA 2NO7A 3NEJA 4W5WA 4MRVA 1W0KD 1X8KA 1YR6A 1KSJA 4HDQB 4DLTA 1W4CA 2BKEA 1ZIOA 4BPBA 4HB0A 1Z6GA 2CCGA 2WWFA 1XTKA 1BH2A 1N3BA 1NKTA 2FZLA 5FPHA 5C4GB 2GBLA 2WJIA 1Z6YA 2ONKA 2XTMA 1OKKA 2QGZA 4DBLC 2P2LA 2JJ1A 4LYFA 4U00A 4ZI3A 1NBME 5F9FA 4K46A 4RFSB 4JMPA 1TEXA 2C99A 1Z28A 4C0QC 2F6RA 4I4LA 2ZIAA 2CHGA 3C14C 1JAIA 1FMJA 1CKEA 1KJWA 4PAMA 4Q19A 4V0OA 5FPTA 1GKUB 1DAGA 1XJQA 3D8BA 2WWIA 1GTVA 1DAHA 2GK6A 3VR2A 3VNUA 4GBMA 4PZLA 2QL6A 4BZXA 4F4JA 2DPXA 3CPHA 3Q8XB 1G8YA 4TQAA 1KY2A 3B85A 1DS6A 3QKRA 4Q21A 5GADl 1MO6A 3EPLA 2PCLA 4UXIA 4UXHA 4OI1A 3KKPA 4DLUA 3RDPA 3SE0A 1U8YA 4Z1MA 1GL7A 2EFGA 1OT3A 1QVRA 1KI7A 1E3MA 2BEKA 4KITB 3PEWA 4TYYA 2FOLA 3Q5DA 4PO1A 3KXLA 5HE9A 3PUXA 1H8HA 2IF0A 2IXEA 4LC0A 1LF0A 4ZCMA 4MRSA 4TLAA 4BASA 4Z54A 2O8BA 1Z5ZA 3IIJA 4AYXA 3HU2A 4C4PA 4MITA 1KIMA 1PV4A 4F93B 1KI4A 1KO7A 4BQSA 1KI1A 2FA9A 1AZSC 1OV4A 1VPLA 3IHLA 4TN1A 5TY0A 5CM8B 1JEDA 3PUYA 2XNDD 5CB8A 3CRRA 3CF6R 1SKYB 5EE3A 2A5YB 3SR0A 4B3XA 2PH1A 4HAVA 3BFXA 1LVGA 1LY1A 2AL7A 1DO2A 5BN5A 4UJ3A 5IK2D 2H17A 4N1AA 2JGNA 2X77A 3RABA 5EXSA 3QJYA 4Q4AA 4DDUA 5L3SB 5LD2C 2BC9A 5FL3A 1ZU5A 1NBMD 4NHOA 3SC3A 4PC7A 4B6FA 4QXAA 1T3HA 2ZTSA 3I32A 4JVNA 5JI3E 1A7JA 1J7KA 1N6IA 3SN6A 2BDTA 3X1WA 2GVZC 2ZI4A 4URYR 4TZ0A 1TL7C 2NTYC 4KCGA 2C77A 1W2HA 2GF0A 3B9QA 1E2FA 4L4UA 3I72A 4URWR 4B35A 4F7WA 1YZLA 2NOAA 3B6EA 2VP6A 4ESHA 4DDVA 3UIEA 3BK7A 4ARZB 1S9HA 3I4LA 3QI2A 3X1YA 1PLLA 1ZD9A 2ZRMA 3VFDA 1KI2A 5AUQA 4QOSA 4MKFA 3CF2A 2G1JA 4LC1A 3D31A 2YJTD 2GXAA 4F38A 2FE4A 1DAFA 2C98A 5CK5A 4LJ5A 3KKNA 2IWHA 2IXGA 2ZRBA 4IRUB 1W47A 4PO8A 2OUKA 5LPNA 4D82A 1OH5A 3K9GA 4PR0A 5C2JB 1GRNA 3CKLA 4FN5A 4MYCA 4AKEA 1ELOA 3WRXC 1Z0KA 1E9EA 1EFUA 4FCWA 3HR7A 2OHFA 2YVUA 4AKGA 2ZUBA 2V7QA 1WB9A 3DDCA 1KDOA 4IVQA 4Y0VA 2C95A 2PBRA 4L8GA 1WXQA 4JSYA 4DIDA 3V9PA 3QF4B 3E5HA 5H8WA 2CVFA 1W49A 4HAYA 4M9QA 4R9UC 5CIWA 4C0SA 5FL7D 2P6NA 3NVAA 3GFOA 4KSCA 2ZSFA 2Q3FA 3SBEA 3WXMA 2HJGA 1E1QD 3KUDA 2GF9A 2J7KA 3DKPA 3FWYA 1SXJD 3B1YA 1E2EA 1OW3B 4C0HA 3LNCA 4JLBA 3BE4A 3FFBA 3WBKA 3QBTA 1OYWA 3UMSA 1QBKC 3GLGE 4FWIB 3I5YA 2A5DA 2FGJA 4YQFA 3K70C 4XTRA 4B32A 5KYKA 1ZUHA 3K0SA 4N3NA 5SZKB 5AR1A 1HEIA 1S3GA 3TW4A 2V6IA 3RNLA 1Z06A 5GJCA 1TPZA 2CK3A 3U7EB 1GL9B 2WSSD 1NLFA 1P9WA 3Q3JB 3I61A 3ICQB 2BCGY 2EQBA 3TSZA 1G7CA 1ZNXA 2VSXA 4HB4A 2DFNA 2Q9CA 4LBYA 1NRJB 2ZSDA 5FH9A 1LB1B 2A5JA 2GK7A 1DELA 1VIAA 4KJZA 2P65A 3GQBA 1VCNA 5J4KA 3KXIA 3HPRA 3SQXA 3EZ9A 1LS1A 5KSYA 1EX7A 2Z5FA 5JS8A 3O8CA 4BFYA 5EP2A 2DFTA 3KQHA 5LBIA 5C4MA 4PANA 1E2LA 3WMGA 5BXQC 3VR5A 1MABA 3QUSA 3ZZ0A 3U6KA 4LBVA 5L3RA 1IN4A 4PSKA 1VIYA 5D3MB 1IHUA 3TIFA 2YYZA 1ZM4A 3RLFA 4A92A 4MGZR 4Q1CA 2HJVA 8OHMA 1G8FA 2XTZA 1ZC4A 1U0HC 2A2ZA 2VIIA 1HE8B 1VMAA 1FNMA 4JVLA 3OEED 1K5GA 4YC7A 3JZMA 4Q01A 4KSBA 2FPLA 5FOVA 3AVOA 3EIHA 4DCTA 4PFSA 1KYIA 1W0KA 4HZUA 3QEJA 2CK3D 4MA4A 4D81A 4M1MA 2C5LA 3FKQA 2XSZA 1T5LA 4MYHA 5TARA 2VEDA 4HUQB 2BWJA 4P3YA 2F7SA 2WKQA 3CB4A 4CEJA 2JLQA 5JECA 4CEHB 4TMTA 4DSOA 5EUMA 1CU1A 2ZYUX 1IN5A 2KB0A 3EX7C 4ASUA 1DVRA 4IOLA 3ADCA 1G3RA 2BV3A 1UKZA 4OHZA 1JJ7A 2QA5A 2BKUA 5KUTA 1OIWA 5BW8A 3RS7A 3KQKA 2YV5A 3CLVA 3PEUA 4GSYA 2XZLA 3B1ZA 3CNLA 1NMZA 4YDHB 2OG2A 6Q21A 1KDTA 2B8WA 5FTJA 1RC8A 1XD9A 1JPJA 1QDEA 5JLJA 1W46A 2PZGA 4JL5A 5A0FA 4P4TA 1KMQA 4BGDA 4TQ9A 1S9DA 1SVLA 1X8LA 3CONA 3K0EA 3H1TA 5K8LA 1JXMA 3C7KA 1AGRA 1KSHA 5E3HA 3W5IA 1UJ2A 4FMDF 3QF4A 3THWB 1UAAA 3NDPA 4W5HA 1MV5A 5FBRB 3ZLJA 1VECA 4HUQA 1XCMA 2Z4SA 4M9ZA 3BFVA 4PHHA 5H70A 4GZLA 2VH5R 5EP4A 4DB4A 4E09A 4RD3A 4Q9IA 1TQ2A 3ZVNA 2QTHA 3H86A 1H8EA 1C4OA 4JLVA 5DI9A 4ZKDA 4BLOA 4D6PA 5EJEA 3NBFA 5JZVA 1A2BA 1SKYE 4EPXA 1KI8A 2J0UB 1G16A 1Z22A 2OBLA 3E70C 4BFTA 3LA6A 4QBGB 3MAAC 3ASYA 4BLRA 3AF3A 1HQCA 4L9SA 3WNBA 3QG1A 3T5DA 1EK0A 2FZ4A 4IJMA 4XD7A 4DLVA 1R5OA 2NO1A 2CLDX 5IT5A 3BB1A 1SVIA 2R62A 2UVQA 1DBSA 4US2R 1KKMA 3HPQA 4AYWA 2MSDB 2VO1A 1G8GA 3SFZA 3D7MA 4K81B 4TQUS 4M1WA 2YWHA 2OXRA 2Q6TA 3IQWA 2Q9BA 4KLNA 2F43B 3FKSA 2BMDA 3ECCA 2VRWA 5G41A 3T1OA 2OV2A 1LNZA 1XP8A 1DE0A 1G9XA 1IY2A 2WTUA 4Q66C 3UWKA 2WMNB 2AX4A 2HYIC 1VDZA 4WZAE 1XD2A 5E95A 3CX7A 1SVKA 4GOJA 2KJQA 1N25A 3NH6A 4PHFA 1H8ED 3MCAA 1ZM9A 3NBZC 3CRQA 3VX3A 4LPSA 3TKLA 1S4QA 3VAAA 4BFUA 5M04A 1OIVA 2A30A 1G18A 1B0UA 4FD2A 3LVRE 5E7IA 4DT1B 4B3GA 1GRQA 2GA8A 2ORVA 3KKOA 4IDNA 1JNYA 1AIPA 4IXMA 2CCKA 4JBXA 4PXAA 5J47A 1DG1G 2ZPTX 3AVXA 2GILA 1CR1A 1E0KA 1CRQA 3AVQA 4FIDA 3CRMA 1SGWA 1RRGA 3AF2A 4PC1A 4JKIA 2PZEA 1HT2E 3BRWD 4HLDA 5FUVA 5CYOA 1GSIA 3MJHA 1AQYA 4C7OB 1UFQA 3WP1B 4GI7A 1N6NA 2RGBA 2O8FA 4KVGA 2D2EA 5CJPA 5P21A 3SQWA 1XTJA 3MLEA 5FPYA 2N46A 2ZRGA 4DSTA 1XCPA 2C03A 1G21E 2PLFA 4JLAA 3AF0A 4UKDA 1ZM3A 4TLCA 2X2EA 4ASUD 4RFVA 4RSGA 2ZITA 4OI0A 4MGKR 2ZAMA 2P5SA 3B8HA 4QGGA 1M1YE 1EX6A 4FI3C 1ZMXA 2FFHA 3DZ8A 4MGYR 5J4HA 2Q21A 2JEOA 3A1WA 3ADKA 3GLFE 1DPFA 2OT3B 2LCFA 5A4JA 2ZSBA 1W48A 1HE1C 1KSGA 2O0JA 2BEJA 4AI6A 1SVSA 4V02A 4PTLA 1M7BA 3K0CA 1VHLA 2BBSA 4Q00A 4EPYA 3DMDA 2ORIA 2QM8A 3EA0A 4DEXA 2OLKA 5E7MA 1NIJA 3RANA 1XPRA 4LY6A 1NN1A 1SHKA 1G20E 2PJRA 2I1QA 2O8FB 4LUCA 4MKIA 3NTUA 1S8FA 2RGNC 4EFMA 1CULC 2CVHA 4JYCA 1QHNA 1R5NA 2VBCA 2ZI9A 5J40A 1W5SA 3ASZA 5FUYA 1U0LA 1AKEA 1XXHB 2ZU6A 4M9XA 4BFWA 3NBYC 1Z0AA 3HDTA 2ZE5A 4C30A 1WE2A 2D62A 4HEJA 1ZCAA 3QPWA 2I1VB 2JLSA 2DWOA 4KYIB 3PQCA 4LJ7A 1XXHE 1G5PA 1H65A 1P2TA 1R2QA 4JT2A 3JVVA 3IQXA 3VR6A 2WKRA 2H57A 5BQ5A 4GPTA 2QG6A 4E03A 1COWA 2R6FA 1E2NA 2QRZA 1JEEA 5EXPA 4EPTA 2O8CA 2W6JA 5L3SA 2IK8A 1E2QA 4FW9A 1S1CA 2VSOA 4NYJR 2F43A 2YINC 4L9WA 4LI0A 2YWEA 1KY3A 4YXWA 5TDHA 3RS3A 2JDIA 4XWKA 2QTFA 3BH7A 1E0AA 2QZ4A 1G4UR 3W5JA 1PZNA 2CLSA 5K8IA 4YMUA 2E9SA 3K0FB 5AJYA 4OKSA 1CIPA 4Q4HB 1TNDA 2GJKA 3LLMA 4XJXA 4LRWA 1D2MA 4IVPA 4UNRA 1G7RA 2CJWB 3L8ZA 4JLOA 2IUUA 4ZDJA 4AY2A 4JS0A 2BJWA 4OQNA 5CLLA 2F1IA 2ZJ8A 2WWHA 3L0PA 2AK2A 3EG5A 3AQ4A 5IF9A 3IBGA 3AKEA 2ATVA 4BRUA 1EWQA 5DN6A 1HYQA 4B73A 2FSHA 2XNDA 3WMFA 5SZJA 3HU1A 2ZUCA 2V7QD 2VF8A 3FPAA 1W0JA 1XFAA 4HB3A 4HLQB 4QG7A 5CYPA 5EE5B 4V03A 5CK4A 3AV0B 4JL6A 2J0SA 2DBYA 2X2FA 3SI7A 3EARA 3EZFA 3SJAA 4QGHA 2HLDA 4AD8A 2CL0X 1T0HB 3DZDA 3LWNA 4ACAA 3VR1A 1WBBA 1KI3A 5EQTA 2J1LA 3GJ6A 1G6HA 1COWD 3GJ7A 2EFHB 1G19A 1OXVA 3THYB 2WIBA 1FZQA 1KI9A 2C78A 2XX3A 1E9BA 2WAYA 3DO6A 2WAXA 2OEPA 4TYWA 1ZRHA 5AUPB 3QKTA 5F3WB 3GJ3A 3TVTA 3MWYW 2XXAB 1Z83A 5FTKA 3UXMA 1A82A 5HCIA 1D5CA 2ERYA 2PEYA 3MWJA 4V0NA 5L3QA 3A1UA 3THXA 3F5FA 4OI2A 4PPQA 4Z8XA 2YKGA 3LQRA 3NEYA 2E87A 1KNQA 1Z0FA 4OJKA 1Z3IX 1GDDA 3ND9A 3T1QA 3TGPA 3UMFA 3U7HB 1EFRD 3C41J 1BOFA 3DL0A 3CWZA 3A4MA 2FFBA 2ATXA 2RKOA 3QNUA 1IY0A 3WBJA 3WMEA 2GJSA 2Z83A 4M0LA 1KZGB 1I2DA 1NI3A 5CM9C 5J4VA 4F91B 4TMVA 1NN0A 3AKYA 4B34A 1IN8A 1ZNWA 3THOA 4W7SA 5EZ6B 4AWXA 2ODBA 3FE2A 2BBOA 4NDZA 4GOKA 2BM0A 1Z0JA 3W6OA 5KNDA 1NKSA 1N6KA 3W6NA 3Q9LA 2Z6VA 2ZEJA 2XXAA 1KDPA 2FSIA 2IYQA 2AFIE 2V8OA 1ZYUA 2ZJYA 4IDPA 2JCSA 4NZYA 4I1UA 1KMHB 3SJBA 4TL8A 5KTYA 1E6CA 2IT1A 4FCVA 2CHQA 1P9RA 1TAGA 4A2WA 3FYHA 4GZMA 1XDBA 1CR4A 3WYFA 3GLFB 5B30A 4OBEA 2ZREA 1N6LA 2RAPA 4EDHA 121PA 3QXHA 3MSXA 1DEKA 4RCZA 4RZXA 2QQ0A 1JR6A 1JALA 3PIRA 2CXXA 3ADBA 3KQUA 2IYVA 2RGXA 2GTPA 1KI6A 4EPRA 2KBEA 4QM6A 4JKYA 3A37A 3RSOA 3EZ7A 2IBMA 1CBUA 2QUZA 1XEXA 3QIAA 4LX0A 3N2EA 2ZRPA 3SNHA 1KSFX 1XTQA 4P4UA 5K8TA 5B64A 5F2EA 4HLUC 2FGKA 4XVQA 4IDOA 2PMDA 3T06B 1FTNA 3ZYCA 1XTIA 4Q1AA 1WP9A 4CF7A 1Z47A 4CYMA 5C18A 1CJMA 4LBZA 2IEZA 1E94E 1J8YF 4II7A 4NTZA 2DR3A 1YQTA 2BJVA 2PJZA 1Z0IA 2CL7X 5D3MA 1ZCBA 1KHTA 4JLMA 2O8DB 2GHIA 4Q48A 3T35A 4UQOA 3WYGA 4JLNA 3GLFA 3C5HA 1G17A 2QTVB 3HR8A 3A4LA 3TRFA 2VTKA 2C2HA 1L8QA 2WOJA 2ZJBA 3QKUA 3QOFA 5JWOA 3TR0A 1MO3A 5JJLA 1ZBDA 3CX6A 1E0JA 4OHWA 1M6NA 2IL1A 2ODEA 2UKDA 3KB1A 4G1UC 3VMFA 2BCJQ 4NE2A 1YZUA 1D6JA 3PV0A 4A0RA 5L8VA 4DDTA 4PPGA 1SXJB 2PLRA 3UWOA 1HV8A 4NMMA 2V6JA 1T8UA 1HUQA 4A2QA 2R6DA 1KO4A 3FHCB 4NCKA 1HA3A 1NG1A 2FSFA 3PFIA 4BEBA 5JJIA 2P3SA 4QHSA 3A6PC 2J0QA 3B1WA 3FFAA 3WNCA 2WSMA 4F92B 1Y63A 1RW4A 5KDDA 4B76A 5B58C 4NCNA 2AWNA 2ZR0A 2VL7A 4OYHA 4AG5A 1E1QA 3IKJA 1IAQA 2JASA 3ZQJA 4LJYA 5L3VA 1WBDA 2QBYA 3EPHA 2G0TA 3DEFA 1OYYA 3MRSA 4MQBA 2GZHA 2G77B 1GZSA 2OCAA 4P4SA 3Q7QA 3SHFA 4EAQA 3O8BA 1XD8A 3PVSA 3NBXX 3PUVA 3QENA 3RHFA 2XNSA 4FCTA 3EAQA 5JWRA 3Q85A 3PCRB 4CVNA 3S1AA 1G7SA 1T91A 1S1MA 4WIAA 1NVXQ 1E0SA 3JVUA 5DIFA 2HXYA 4NYJQ 1G3UA 4V0KA 3RRYA 3TAUA 3EA5A 2AN9A 2IUSA 1FMLA 1VTKA 4NYMR 5FOSA 4C2UA 1NY6A 1YRAA 5AK0A 4U02A 3GEIA 1Z6TA 2F1RA 3ND8A 2IYUA 1II9A 1XD2B 4B47A 4TYNA 1IJEA 4BE7B 4KI0A 3M6AA 2F9MA 4XIGS 1NG9A 2H18A 2P6UA 2UZ3A 2FFAA 4QL3A 3SHWA 1KMHA 3ADDA 2IHYA 3CRW1 1UKVY 1NVVR 3GLHB 3R9WA 2RB4A 2HF9A 1E9FA 2R65A 3U44A 3F0TA 3A1TA 4D25A 1IXSB 1R0XA 2GESA 3AVWA 2BHRA 4ZO4A 2R6AA 1G3MA 1L7VC 2WM9B 4L15A 4URXR 3UPUA 5JMTA 4DJTA 3MD0A 1FQKA 2UZIR 4IEIA 3TW8B 3B60A 3K0AA 2A7QA 2YZ2A 1ETUA 3B1XA 4XH9B 1YKSA 1NBMA 4E07A 2QGNA 5SZIA 1U8ZA 1LV7A 3EZ6A 2IYLD 3QY0A 3EIEA 1BS1A 1DARA 4ZI2A 1EXMA 4FWTA 5IK2A 2O0KA 4MKGA 1V5WA 2PCJA 2HDNB 1BKDR 1U98A 3FMFA 4YLGA 5FBQB 2IYTA 4ZDWA 1XX6A 3BH0A 2ONJA 3VQTA 3KQNA 1UBCA 2ZS7A 2G9NA 1XMVA 1SKQA 4Z1MD 2GEVA 3GLGB 1S0UA 5EUQB 1Q44A
chains in the Genus database with same CATH superfamily
2A86A 4AF8A 3F47A 2F4NA 1MOZA 5GAJA 2M6RA 3DLAA 1BE8A 2XEDA 4QARA 3R3WA 1S3SA 1Y98A 4MICA 3UXHA 1RCTE 1B8NA 3N2GB 1KQ3A 3FSGA 1ETHA 1NQXA 2R7KA 2ATIA 4QUAA 4WRRA 3HY3A 1I1HA 4UULA 2B3DA 3F5QA 3D1JA 4UMVA 3QF7A 4IQ0A 4PHCA 5KCMA 5B12A 5EGNA 3I0ZA 2CSUA 5LNK1 2H5LA 2XZOA 3QPVA 5A71A 4EWLA 5CITA 3DC2A 1N5JA 2QOEA 4F5EA 4LQCA 1JBKA 2CXTA 3C3BA 3CZCA 1CY1A 3KQWA 4HXEB 5CW1A 2OBNA 5L4LA 2Y8EA 3V42A 2V45A 1OREA 1WLSA 1YUBA 3EZGA 1E69A 1JI3A 3OE7D 4J0QA 4BATA 3WGUA 3KPYA 4X94A 3G6WA 2BTEA 4EF4A 5T6BA 2P0EA 2VAVA 2EWVA 4IIBA 3DV0A 4OQEA 1JFSA 3AEUA 1XZFA 1MB3A 3ENZA 1VPWA 4IV5A 4UM7A 3I9KA 2L82A 3E0XA 3RYHA 1FFXA 3NBAA 3OKFA 1KVSA 3A3PA 4FC6A 4QX6A 1QIJA 4ZXPA 4D96A 3PEFA 1Z4JA 3BJZA 3NDRA 2G4CA 5B57C 5LZ4A 2DWPA 1K8YB 3GT3A 1BIFA 5LZ7A 1CEYA 1W93A 4ONEA 1V7PC 1DXOA 1AG9A 1ZUNB 1SC9A 1E3WA 2ZR7A 4Q7LA 1MEJA 3ESQA 3BJIC 1A97A 4GMXA 4S24A 4RU1A 1T5TA 1EDBA 1V5GA 2QMOA 2HAEA 2WJJA 3QWIA 3WWZA 4DL9A 1N7JA 2FN3A 2C83A 3LPMA 4AUEA 1FMFA 3U4IA 4XR4A 3DSRA 3IAXA 3AVTA 3ICCA 1A4RA 3WHLA 1SIUA 1B4DA 3PR1A 4IICA 2P8JA 4W5JA 2E55A 4D80A 4DIFA 3VSEA 1BJTA 3CA8A 5JDCA 3VKHA 2JGJA 3PHBE 5KU1A 3H8WA 4NX2A 2BFEA 2QE7D 1GEEA 2QT9A 3AQIA 2XUDA 5HKKD 2P9FA 1GZ6A 2W37A 4LJLA 4G5HA 3UANA 2FWNA 4LOAA 4RIFA 4UHKA 1ADCA 2YW9A 4AFNA 4DDWA 4ZCLA 3CH7A 4TSFD 4J4HA 4ZKEA 4G5QA 3EFEA 1PNTA 2O8EB 4BNNA 1YV9A 2B0JA 5LQMA 5JCOC 3TR5A 5F7XA 3R5JA 3P9QA 5AVYA 2IELA 4GG1A 3LCCA 3IEKA 5HRCA 1LSJA 4PZZA 3IMKA 4X8OA 3X1ZA 3L46A 1R1DA 3V34A 3CGWA 3L01A 5DF1A 3WG9A 4PBTA 4O2AA 4LV6A 1Z6PA 10MHA 1DHRA 3L0ZA 4IR7A 3KSAC 1GDTA 3GJQA 1N1GA 3MTJA 5I9MA 4C7JA 3WIEA 4EY7A 2H5EA 3IPYA 3R75A 2POQX 3STYA 5BYJA 2VJDA 4ALKA 2HZ7A 3NAGA 4RYDA 1DAEA 5ALRA 2J0VA 1ZM7A 1IOLA 3L79A 3B1JA 2QPOA 2IXFA 3HZOA 1Q12A 3FZQA 3RYIB 3TXXA 2PR7A 1K75A 4TRRA 1BJRE 3GUHA 4X3OA 1N1MA 2I6FA 4ZREA 5JSFA 1RCFA 5HX7A 1YJAA 2BFFA 1JUDA 4A15A 3VPGA 3KXKA 3WYNA 5DNVA 2I66A 4I50F 3UKDA 1IVNA 1GPAA 2BR4A 2GUGA 2ZJAA 3AZOA 4KLAA 4M86A 4IOJA 4G1BA 4YJDA 1RAEA 3MZ0A 2ZAOA 4E1BA 1MRSA 4AY3A 3VVLA 1MMFB 2OFXA 2DF8A 3VZQA 4XLLA 3CRNA 3EZXA 4LYHA 3MYYA 1C7FA 1PTJA 2CLCX 3O5AA 3HM2A 4FZVA 3SZOA 3OFVA 5KZMB 5JFGA 4NZOA 4FVTA 3ZG6A 3I2KA 1FLNA 3N0WA 2I3BA 5E6SB 3P20A 5JIBA 3WICA 2KPOA 3UQYS 1P61B 2A8YA 4HWKA 4BU1A 1CR0A 4KB5A 3AP2A 4J94A 1LA2A 3TQQA 3ZIAD 4E14A 4Z51A 2OZLB 4H6XA 2NVOA 2YMLA 2TRSB 4H15A 4G9GA 5LOVF 3T5TA 3WK7A 2J41A 2GXUA 2LIVA 1DJMA 3A6EA 3R9IA 1J9GA 1RKBA 1C8VB 3IPXA 4QNNA 1YGPA 3CC8A 3RROA 4DIEA 4EG5A 4G26A 3FTEA 3GRRA 2GFHA 3LFUA 4JFAA 4CIDA 3TBKA 2CF5A 2BJHA 3SF8A 3NETA 3U7JA 1ONOA 1QZXA 1MW8X 5FQNA 4MV4A 1PDVA 5C1OA 4R3WA 4WUTA 1CUCA 1S2OA 2HCJB 4C87A 1RYZA 2F67A 3CEAA 4HRXA 4BMZA 4KBYA 5L7WA 2G04A 2IHUA 3NTQA 3ETEA 4XXHA 5DTRA 4IW3B 3KOZA 5ALGA 3OKCA 5BWMA 1PJ3A 5E38A 1M6WA 1OI3A 1MDBA 3VPDA 3HJFA 2BGNA 1XCOA 2CVQA 4TLLB 5JYDA 2G9UA 5EKSA 1V1JA 4JJ6A 3HYSA 1B23P 5KB3A 1TJNA 3Q3CA 5CIQA 4G4JA 2GKSA 1G2OA 3GRZA 4F5DA 1I2BA 2ACKA 3F6EX 5E6RB 4A8PA 2Q5FA 5ISMA 4AURA 1T13A 3HBMA 1U7DA 2IOFA 3ZV5A 2CLLB 5GTDA 3LDFA 4MEAA 2RHRA 2V7BA 4O25A 1GRCA 4RVDA 1L5QA 4TWRA 4PSAA 4GT1A 2QRNA 2ZGVA 1WVGA 1PZHA 3CVJA 4IHAA 4IX1A 4G97A 5FAXA 2VP0A 3AGPA 4JBNA 2NVWA 3LWZA 3ZDYB 2A9OA 4C0WA 2PJDA 1OJ7A 1K6JA 1QP8A 3UC5A 1XDGA 1FX0A 2I55A 2XVYA 5DX1A 1R5BA 2JGDA 3KE8A 4PYMA 2DCUA 1KTVA 1LU9A 2AQKA 1OB2A 4M1KA 2FMUA 3NIWA 4MVJF 2Y66A 3WK8A 4H4EA 1UXOA 3FBTA 2WYVA 4CLXA 4NMXB 4IJ5A 4X3CA 3M4ZA 2XUKA 5KNCA 1XZNA 1QHXA 1ATIA 1K8XB 4Q9JA 5DNEA 4LJAA 4M9SA 3ROXA 4CN9A 2CJYA 3MJEA 3NT2A 5EXXA 3VYVA 1ZD8A 4DMKA 2XZDA 5HRAA 2YHSA 1ECFA 1NJ2A 2VDWB 1GPUA 5EIBD 3ZHCA 3RRMA 2HHLA 4IG4A 2AOUB 2I22A 4FZ5A 3Q8KA 1RKXA 1JQBA 3RHZA 1VL6A 1TW3A 1W8IA 1V8BA 2PYZA 3QEOA 3ZWXA 1USGA 4D44A 3K9NA 3CWCA 3O8LA 3T99A 2Z2YA 3U4DA 1Z7GA 2A57A 1M1NA 4MB6A 2B36A 3C45A 1F17A 2QI9C 4DB2A 221PA 1PKEA 3E7WA 3D4NA 2H4JA 1EK6A 1XR3A 3JQCA 1GXSB 3D54D 1X7YB 3T9CA 3PHJA 4TTRA 3GEBA 3NOVA 4YP9A 5LDGA 2Y93A 4DLNA 4CKCB 4ILKA 4AJPA 4ZQIA 4QYMA 3COZA 5F7JA 3QXGA 2ZWAA 4H3VA 2YCLA 3J80A 3TH5A 4U0JA 2VDPB 1AQUA 5L95A 4ZZ1A 3N3AC 5HCNA 1N5KA 4X1KB 1OLSA 3VPBA 2ZLBA 1GADO 5A3JA 2HA2A 1LRLA 1ML3A 1RJ9A 2QN6A 3KQYA 4X64B 1MVOA 4YMWA 2GEJA 3U4QB 3MWEA 1TM7E 1WEHA 2YYYA 2B2XA 1T25A 4B9EA 4XASA 1VJ5A 3S70A 1XCBA 2B78A 3ZW7A 1W7AA 4YUVA 5IPFA 1Q0ZA 1Q16A 4COKA 5BQPA 4AZVA 3MRXA 3E2IA 2FP4B 2ZUUA 3JR7A 4BIMA 2ZYDA 4R8LA 2E1PA 2IZ6A 3EEQA 3LVQE 1F5SA 1ZISA 3MWLA 4L08A 1E2GA 3C6ZA 2OFOA 3RU3A 3N58A 1H5NA 4MWTA 1AS0A 1YK0A 1UXKA 4PYLA 1EE2A 3FPKA 1XTUA 1W1WA 1D2HA 2VHQA 2JI9A 1E1LA 4MRPA 4J0DA 1UQTA 5CJ2A 2PUBA 4OMCA 2JZOA 1OGJA 2GI4A 1DT3A 4UXJA 3PKJA 2IP2A 1AGPA 3GN1A 3A58B 3AKCA 1JKIA 3CE9A 3H84A 1VYTA 2GCPA 5F77A 3M6UA 3S5UA 2FPSA 2DSNA 1ECCA 2EKLA 4FNAA 4JLKA 2GEUA 3NEPX 5LQUA 3D6NB 1SCAA 4LE1A 4AECA 3QJ5A 1X3SA 4KRXA 3ZK8A 5M2QA 1K6IA 1T0IA 1JSRA 1J70A 4JP2A 3TZ6A 4B87A 4HAZA 1R9JA 1TU4A 3WR5A 4KR7A 3ADPA 2H08A 2I99A 3ISTA 3UPTA 5JAZA 2G1AA 2HSJA 4PQRA 1NRIA 4CJXA 2Q4RA 3EZYA 4F5YA 1AE1A 2EEPA 1XDUA 1UZUA 4B3BA 1R0SA 1XJ0A 5FV7A 3FZGA 3FRIA 1HBJA 3K09A 3GGJA 3LDAA 4DKXA 4BQPA 1WXWA 1PLKA 4UM5A 3OEWA 2ZP1A 1QHHB 1DTSA 3AIOA 3ZQ6A 1IRIA 4JP1A 4E5VA 4GWKA 5K51A 3W2EA 5DX0A 4DMHA 3U4AA 2JIOA 4A9AA 1YRLA 2C57A 3AGQA 4X7RA 1Z63A 1BGXT 1IMOA 2W6JD 1O1YA 2Z08A 4B80A 5F7ZA 5ER6A 1SKUA 1ZQ9A 2J7PD 2WFLB 4KBGA 3W7AA 3ZWPA 4Y2TA 4CKWB 4XGRA 4ZEVA 4DTIA 1ZIXA 1EWRA 2O20A 2HXSA 3C1OA 4ZV7A 2PX3A 2C7RA 3SZRA 2VT6A 4N01A 1WP4A 4D7AA 2XODA 4DNPA 2IHVA 2C5BA 4MRRA 4L5JA 3HCFA 1Z2CA 2ZBRA 2QTMA 2J9GA 2P77A 2Q3BA 2GNOA 4M8SA 3O4HA 1TQ4A 1SKMA 3RS4A 4F5WA 5JVDF 1Y3DE 3OT1B 3HUDA 3EW9A 4NONA 1Z8NA 2PGJA 4AKHA 3I9JA 2BTQB 4EPVA 4GQAA 4CKXA 1OTHA 2XUAA 3E15A 3NIDB 1T5IA 3IFSA 1Z7EA 4V0LA 4IRXA 1KP3A 2TSYB 2A9VA 2FR1A 2GZAA 1EB9A 2MYPA 4OQFA 1F48A 4UAUA 3NGLA 4M76B 5JSYA 2RGWA 2ZE7A 1Z88A 1I8TA 2AZMA 2MT9A 3G79A 3G9QA 3IBFA 5JJKA 2CXUA 1NUHA 2RH8A 4MLCA 5IDWA 2FMFA 2YXBA 4MIOA 2A84A 1MRZA 5LCXA 3QQ5A 2SECE 3W6UA 4CMJA 2HHJA 2W2MA 3TEMA 3QSGA 4NZMA 4S0ZA 4PZ9A 3TLCA 1JSZA 2AYZA 4PVDA 1Z7YA 3H83A 4CZ2A 4B7ZA 1U28C 4LYJA 2FJ0A 3LLVA 2WJGA 2X15A 2XYRA 5JCJA 1LPOA 4X20A 4XQEA 4GOLD 3FHOA 3X0DA 4A03A 1GUAA 1A2KC 3MOSA 1L7BA 4OHCA 5A02A 1NF3A 4I8IA 3VKWA 2VTBB 1YL6A 3I2GA 1RKVA 4NYMQ 4ND8A 1XAJA 3VISA 3HXPA 4KVAA 3ZZ1A 1G1MA 1O95D 3HFSA 2C7QA 3PXEA 4MVJI 3LO8A 4O3FA 1TQ6A 2B4AA 4HDMB 2NUAA 2X13A 4MUYA 1W75A 4YMHA 5EE1A 2ZYWX 4ZT5A 8MHTA 2JCYA 1L3CA 4X6LA 1AV6A 2JI4A 1E20A 1G291 1AXRA 1E5DA 1XMIA 2ANBA 1ZI9A 2QTNA 4L57A 4N12A 1QM5A 1WM1A 7GPBA 2P6RA 2I3AA 5LU9A 4PGFA 4BKUA 2ZR8A 1RP7A 1ZA1A 2XMPA 1V16B 4QUJA 4YRSA 3UJBA 4BYMA 1PJZA 1XZMA 4YRKA 3W3AA 4EW3A 3IIMA 3WWOA 4O2BF 5E1DA 3J7AC 3LQFA 4MVJG 1I80A 4WEQA 2FQQA 2XUQA 2ZWVA 1WUJS 3PR2B 4LRXA 2WBLC 5ENZA 3LCJA 4KH0A 3VDXA 2FMXA 1LF5A 5CFQA 4LJ8A 5KSWB 1NVDA 3BD9A 1IC6A 2G63A 1CY8A 4OK5A 4V3CA 4Q1VA 3ZWKA 3JYQA 4YUYA 3QA9A 4PNZA 2CZCA 1TYDE 4BO0A 3IS3A 2REQA 1EFPA 3ILHA 1EBUA 3UG7A 2P35A 5HM6A 4B79A 5K0EA 5KNDH 5DNYB 3NWEA 1WZIA 4BFZA 3QU9A 4M1SA 1Y4UA 3L77A 3LIPA 2VDKB 2NZYA 5AJXA 2UYGA 2WPDA 5A5GA 1I10A 5EPEA 5KKCA 1KEKA 5C7YA 2HHCA 2WWWA 4X8HA 1H85A 1Q91A 2H2FA 2WG2A 1M6YA 2GXSA 3ZI7A 1CF2O 3GFQA 3GZNB 1MH9A 4ZVUA 3PI6A 1A9ZA 2ZETA 5LLTA 2AW5A 1BH6A 2YJ5A 1V47A 4M1YA 5IAAA 3D4BA 3E9RA 1HEUA 5ALVA 3OE1A 2E4YA 2X7HA 2ET6A 4JXKA 4BLTA 2P91A 1YR2A 2QY6A 2H1WA 2O1WA 4W4TA 5A03A 4B8YA 1WKCA 5TGTA 2RHWA 3UAZA 2WIJA 1YRYE 1Z68A 1SNYA 1YT5A 1AN0A 2ZBQA 3G85A 4RD0A 4J9UE 4JP8A 2J9ZB 3HCEA 4MVJD 5TQVA 2W0SA 3VX4A 4L8YA 5JSUA 2FI1A 1AA9A 3C3MA 4GO1A 3DOFA 2QUBA 1LTHR 4CKYA 4HDKB 4JT4A 4Q3OA 2NYAA 4G1MB 1JIVA 1QS0A 2WMOB 2NO0A 1VG1A 1ZUIA 4YCNA 1KARA 2H1LA 4J16C 4RH3A 3KFLA 5G53C 2ZUDA 4TRNA 2ZRCA 1E9CA 2V7TA 4WHMA 3TNFA 2WP0A 3IE0A 3P4UA 1PR1A 5H83A 1ND5A 3HN6A 4LWQA 4EATA 4C08A 1K4YA 2W2PA 3D6FA 2ISSD 4K8RB 5FR1A 2N1BA 4DRZA 1J90A 5HBRA 3HXKA 3LRTA 3NIBA 1ADYA 4UW9A 4AO7A 3G6KA 4L8FA 4PGAA 1EBBA 5EJ9A 4J4TA 4P7FA 4WXPA 3WLPA 2CMDA 4UZSA 1ADGA 1CUEA 2JCXA 1GGFA 2ABWA 1G5FA 2OPBA 4MAMA 4V24A 1D4AA 1XTRA 3EASA 4TWBA 4YCSA 3AB8A 4I9GA 2IH4A 4EA7A 4X95A 3CGGA 1JDVA 3IRUA 1U3VA 1EDDA 1D8TA 3CEPB 3K9LA 3NV7A 3U13A 4IOMA 2XYPA 2Y1OA 3EPJA 4AKIA 3DJYA 4Q1DA 5ABPA 1YQWA 3LC2O 2FVXA 2VLBA 2VJYA 3TLJA 5BN3B 1DQRA 5KAMA 3TSAA 4WI1A 4JGBA 2V65A 4ZOBA 1I0ZA 1JVSA 5AIAA 1SBCA 3ZD7A 4NJMB 1JEQA 1BMFA 1ZX1A 3R0XA 2FEWB 3DO8A 3OIDA 4ZDIA 1TFUA 1P2SA 2CMKA 2VS1A 3MTEA 4PZEA 4XYMA 4FUQA 5D86A 1AQJA 1G8HA 1BHSA 4V39A 4JI0B 4ZCSA 1GKYA 2WTBA 4EHAA 1N78A 4M8NE 3HMKA 4QFCA 3T61A 4DFDA 2UUAB 4C0XA 4YJ2B 1QHYA 1AB5A 5HUHA 3SYLA 4GDFA 2VPZA 5FUBA 2XLCA 2HDOA 4GD3Q 1Z07A 4BRWA 1NW8A 3BD8A 4KW7A 2PA0A 4M53A 1K0FA 1NVVQ 1MTZA 1ORTA 2D4HA 2X7XA 3G0GA 4IFTA 1FW8A 1V4BA 2B21A 3VKVA 1MCZA 1E2MA 4EJSC 4MIKA 4Y6PA 5BUSA 2QDKA 3EOAI 4IM7A 5EWMB 3O90A 1UBKS 3IVXA 1ESCA 1GJRA 4Q3LA 5EG5A 2R7NA 3RO7A 5K8VA 2RHMA 1EFHA 1GGNA 2FF5A 4QYTA 4DY6A 3CLTD 1QYDA 2C2ZA 2XWBF 3L93A 1JT2A 1WPRA 2ZU0C 4G41A 3VJLA 1E0DA 1JDBC 5KTRA 2PYDA 4JSTA 1K9SA 4EL0A 1GRRA 5F76A 4OIFA 1WXHA 2O5VA 3ULKA 2FMKA 1CUWA 1A9QA 2AJ8A 3B5EA 1SVOA 3IBTA 3TRJA 3UHAA 5LXTF 1Y8ZA 1YC5A 1JVNA 1M1NB 3OOHA 1YKFA 5EJGA 4CM6A 5HZKA 1E99A 1SUSA 3SK0A 1ESNA 3EIUA 3CZRA 2VHYA 3DGEC 3OCXA 4HADA 1SUBA 1K8QA 4NCHA 4OKNA 4P08A 1T3ZA 2GPJA 4FB5A 1Y3AA 3L7KA 3AESA 3NBQA 3JQ8B 2GZ2A 2VSYA 1E2KA 4IGKA 1FSGA 2FX2A 5DM1A 5KAPA 3SR3A 5CB4F 1EFAA 2IEBA 4YMGA 1IG3A 2UYHA 3LY9A 4MW2A 2ZYVX 2QRQA 1XQYA 5EXDA 1ZXBA 4RQBA 1AQNA 1VCHA 1RZRA 3R5TA 4R8KA 5IHXA 1MORA 2B94A 5F52A 2Q0HA 3HYTA 2BEUB 2OG1A 4A1FA 3SG0A 3G0HA 3BMQA 1KJNA 4X1KA 3KT6A 4CL3A 5M5BA 4BU0A 1J42A 2FDXA 1VA5A 4IDHA 2ODNA 3GG2A 3VSCA 4AW9A 3L43A 3WLKX 4UATA 3TMKA 4DRYA 1H6AA 1YC2A 1TZMA 3G5AA 3UAWA 2EFCB 2AMLA 3U4QA 5DHFA 1QIDA 3MVEA 1FW6A 4XJSA 4EMSA 4E4YA 3A1NA 1I3CA 2XYHA 3W2TA 4LF4B 3SXPA 2FH5B 3W3AH 1JLLB 3GCXA 3DYIA 3AF6A 4KBFA 2AEFA 5KX5F 1W9MA 2WSIA 3MGCA 4PAQA 1VJDA 3KR2A 4RTJA 2YXLA 2ZT8A 2IKQA 2WM8A 5GIOE 1AT1A 4HFNA 4LPKA 2YHUA 1QZUA 2ALJA 4CKCA 1N1EA 5KQLA 3H04A 1DV2A 1LSUA 4K8OA 1QQ5A 4RK7A 1BGWA 2E4VA 4HLCA 4YJFB 3WDSA 4CPDA 1NW5A 1L5VA 3AERB 5BRAA 3GCWA 4FEAA 4XOUA 3EOBI 1T10A 4G4SP 1A5SB 1N3LA 2QI9F 5EMKA 3RRBA 1EAYA 5IJAA 1FFYA 1NP7A 1JA9A 2WV9A 4I9NA 2NSYA 4RPIA 2WZDA 4FT4A 2GPAA 2ZRAA 4B2LA 4DCPA 3ZYZA 1WMSA 4AU1A 3D64A 5ECGC 1TF5A 4H0NA 1Z2DA 5HMMA 3PQ8A 3D8RA 3WGGA 3EYAA 2OFFA 4EJ6A 1SIWA 4D3ZA 2B82A 4Z0NA 5KSYA 1JXAA 3IKMB 4KG7A 3NC0C 4WXRA 1BS2A 3C7AA 3L0BA 3TLEA 1OHHA 1XZGA 4UHEA 4CCYA 5DHQA 1TUIA 5FCDA 2YZ7A 2QAGA 4F4FA 2CN1A 1QH1B 5LC1A 3PQ2A 5AD1A 5BN4A 5LVAA 2IS2A 1INLA 1KFCB 1DOAA 4J0KA 3W7VA 4DADA 4RLHA 3FPSA 4KREA 2FG5A 1RQNA 3UWPA 4QA9A 2J0EA 1U8CB 1SA0A 2FW8A 2ZRLA 3PIDA 4INZA 3UEOA 4YRMA 4YT4A 1TQDA 1UEIA 1LC3A 4AP5A 4CT5A 4RCYA 1JDZA 1UC8A 3NYWA 5L4SA 2G8LA 2HUPA 5ESDA 2JLUA 4NFYA 3PD1A 2YS6A 1A8HA 1IZ8A 4YRBA 3FDJA 2H11A 3K96A 4W9RA 5FUWA 1Y6GA 3NR2A 4QUGA 3RS5A 1XRJA 1TQHA 2PZKA 4PU0A 4DDHA 1YXMA 5AJUA 5LB4A 1N6PA 4MB2A 5C32A 3WK6A 3AUUA 3I83A 3K73O 2I8AA 3II6X 1ZMTA 1S7CA 3OX4A 3PQDA 1MJ5A 3H9JA 3IBSA 4G63A 4R31A 2F3SA 5FBZA 2GM4A 1F8UA 4MWSA 1XMJA 4JBIA 1GGHA 2J6CA 1KQPA 1NTRA 4P0TA 4BLSA 1L4EA 5LDHA 5ELMA 3P71T 4CCAA 5FPKA 4KQWA 5IKEA 1GNPA 2GRUA 1PWXA 1QANA 2FPXA 3FHJA 3TIVA 1QHHA 1KVRA 4JSRA 4QU9A 4KPFC 5ITVA 2C4UA 5CCBA 1HGXA 4HQRA 1KPGA 1Y9ZA 3C70A 3DFIA 5HK9A 5IVDA 5FO1A 3PTAA 1JG6A 2GF2A 2Z2XA 2GB4A 1JR2A 4DPLA 2QNBA 1MC1A 1KZ4A 4DV2B 2HMYB 1KTIA 1M34A 2NZXA 2FFRA 2EYUA 3DE7X 2WUFA 2V9PA 5GV8A 1ZKDA 5A4DA 3L4KA 4GKVA 1HFWA 1UWLA 4LJ9A 2XVXA 3VNRA 4EHLA 2ZXUA 2C4HA 2RGGA 1P9OA 1QV6A 1V71A 1RYYA 2ZWPA 5EXTA 1Q3TA 2ZJZA 3SLKA 4AUKA 1VGVA 5AK3A 3FGNA 1SXJC 2VDQB 3RUCA 5U4XA 3E8MA 5JEDA 4YMTA 3T4XA 4V2UA 1EVKA 1IE3A 3HNOA 2O54A 2JLCA 1PR4A 2C9CA 1GPJA 3PP8A 3DYBA 1LDBA 4OQQA 2P4UA 4YAIA 3IMFA 4IIHA 3SBXA 3TZQA 2H1CA 3CKKA 3U7QB 6GPBA 3WGLA 3DL7A 1S3IA 2GNAA 4CL2A 5E6UB 2F3TA 1O54A 1N2ZA 1R9GA 4WV3A 2GVDC 3LOUA 1QCZA 5EHZA 1HQYE 4H7IA 4YRFA 2WWGA 3R3XA 4Q9KA 2Y9PB 4FS8A 4H27A 2PUJA 2HMAA 4MI1A 4G4SO 4B85A 2C5AA 4HRAA 1IL0A 1FTYA 1QOQB 1BWSA 3B13B 3C6BA 4MO2A 1RWXA 2CLOB 2HWWA 3E05A 4JVSB 3CV3A 1J00A 3NNNA 4DDMA 5K9ZA 4EUFA 4YRGA 1Q0QA 1YFLA 1N2IA 4M1OA 1QTRA 2V6GA 4MEJA 1GQQA 2YIVX 3CZPA 2VHTA 2BM1A 3LUPA 4UHDA 4WOKA 4YACA 4XYGA 2GBFA 5F2OA 5JQGA 3K9CA 2WVJA 3IUYA 3LD9A 4QOEA 4FILA 3DCIA 2YIDA 3PFFA 1SVWA 4EVIA 5IM5A 4G2NA 4QTXA 1E9RA 1M74A 5FI1B 4BCDA 5J4LA 1W96A 1E60A 3TF5A 3K71B 1OSNA 3DTTA 2D0DA 3DV0B 4FK8A 4CDGA 4NOLA 2V3WA 3IB6A 4MS4B 1TMKA 4ZI5A 3AYZB 4NBNA 1UKCA 3ITDA 2H2DA 4JJ4A 2O3JA 4CQNA 3PJRA 5DNCA 5JYCA 5KOHA 4TLDA 3Q12A 5BMOA 4F8JA 3W9YA 3S8YA 2BTQA 3BREA 5I7FA 1OFIA 1DEXA 3F49S 2YMMA 5LOVA 2W2NA 4EKIA 3R8XA 2Z8YM 3C7CB 3NYIA 3E9EA 4MVYA 1G2IA 4QRHA 3UNXA 4BLPA 5C52B 1Z4OA 4QWMA 2OPHA 3CW2A 1N9ZA 2P6PA 5D6OA 3KWJA 1WXXA 4Z0PA 1EB8A 1K92A 3DOOA 2NUPA 1YIAA 1ZOSA 2I62A 1R3DA 4AJ9A 1T8WA 4M98A 4N8EA 1AVTA 4OPMA 4YJHA 5IVKA 4G5XA 2FJUA 4NP6A 4AKTA 1SH7A 4QE3A 1V7QA 1YZQA 4G1VA 1D04A 2VPWA 3SIXA 1CS4C 2QVLA 3W0LB 3HBFA 1AD2A 1HDZA 1UP6A 5JOQA 1WSBA 3AJEA 4N3BA 2OXCA 4AS1A 1AHHA 2A78A 1FNDA 1W76A 2IYYA 2Q6LA 3ESBA 4HYYA 4K40A 4WD3A 4AQDA 2OK7A 3ZX4A 5B3LA 2A1IA 3HGTA 3EZ2A 1DBVO 3BWBA 2CXRA 3R23A 3GMTA 4NJOA 5F21A 3UAGA 5K3FB 3BWDD 4BLUA 2CDRA 5C3UA 1H4VB 1I6WA 4B17A 2HBYA 1LQ2A 1PZFA 3E8XA 3GRCA 3ST7A 3VH4A 4D9JA 9LDTA 3N0VA 4R8VA 1QZTA 5DBOA 4GZ6A 4OJYA 2IXBA 5JNTA 2O50A 1G20A 3LLUA 3PQ6A 2N9UA 1EG2A 1U0OC 3OAAD 5ALTA 2VHWA 3O9VA 1BCSB 2PMWB 3FTDA 1FXSA 4OQXA 4U8GA 4BMDA 5HIKA 2MMCA 3KQPA 3A28A 2AI1A 3AFHA 2A9KA 3AG5A 4F96A 3QXSA 2FEOA 4O0MA 3H4MA 5CT6A 3SS7X 2NUPB 3DKVA 5MGNA 3WGIA 2RHGB 2ZAGA 3LX5A 5BN3A 3EN0A 3JAWA 4FYVA 4N0QA 3L02A 4MZXA 5M3BA 2WB2A 2C4WA 4FX2A 4KMSA 4RTRA 4HUJA 1P60A 2XOXA 4EJFA 2YZNA 2CYAA 2PT7A 1WNFA 1HFJA 3HLTA 4US1R 3UBTA 2HMWA 1QFXA 3CH4B 4TL9A 3B3JA 1RRVA 4URFA 1SG0A 3F97A 1EQUA 4TWZA 4A6DA 3PR3A 3NVKI 3E4DA 3C16C 3NBKA 4QGAA 1YD7A 2J5KA 2P11A 1WCXA 3MHTA 1P29A 3PSAA 3V1UA 1T8RA 2F3PA 5EI5A 2FETA 3OZXA 1H05A 2PRKA 2IC5A 2AUMA 3BAFA 1AUPA 3D3EA 5CHYA 2ZE6A 5CGZA 2O3RA 1PTKA 3EQ2A 1WNTA 3ORFA 4A82A 4EO4A 2AS0A 2JIQA 1DU4A 1SN7A 3LL4A 3QXXA 4CQMB 3VKGA 3VJKA 1YQ9A 2Q45A 2ZTMA 1Q21A 1RE0A 2QJTA 3IUQA 4LY3A 4PG5A 1OIXA 1TGYA 2MMGA 1BVRA 4PLCA 4UAVA 1TMGE 1OBHA 5JAPA 1SUAA 3BBPA 4GECA 4YGYA 3HEMA 1DAMA 2QD5A 2R7AA 2NW6A 2I7DA 4HVTA 1EFDN 2DUMA 4DE5A 4XGKA 3VPCA 2ORED 4P80A 4IDAA 3U4MA 4WNIA 1HORA 3DYVA 2DVMA 3C6XA 3MS2A 4QXPA 3R40A 1OR8A 1NW7A 3FLAA 5FHQA 5B4TA 1JR3D 3SZMA 4DWJA 5F33A 1LDGA 2YYSA 4AYTA 1DJQA 3N0TA 1LCIA 2HJHA 3K5HA 2WDPA 5EHNA 1FSSA 3NYQA 1ZOLA 1HG0A 2DOKA 4W9NC 8LDHA 4Z0TA 4OMUA 3CNOA 4OQMA 1IOZA 3UJNA 4LN1A 1H5QA 1WV1A 1KIAA 3RVDA 3W78A 1MAAA 1K63A 4AQ7A 3QEKA 2DY1A 4NKRA 4QDKA 1V8ZA 4L5IA 3V3TA 4UFPA 4PRKA 3QSYA 2WU8A 1JGTA 3BZWA 3DT6A 1G5RA 3GROA 4OG2A 4US0R 4UUBA 4C4SA 2BAGA 4YCCA 5DGDA 3LXRA 1MT0A 5H59A 5LLSA 1WPQA 1JWBB 3PNQA 1ZUWA 3ZC3A 2UUCB 1OLSB 2IQIA 3PPXA 4KACA 4HLUA 1IDOA 2BGJA 1W36C 1T2FA 2BI4A 1C29B 1M75A 4LJ4A 1TTQB 3LLCA 3AR2A 2H29A 3AEKB 1IZ9A 3F3MA 4RYLA 4UU8A 2ODWA 3R8CA 5HQJA 1WV0A 4MUIA 3HB7A 2AFHA 2OCIA 4I8DA 4NL4H 3T7AA 2WC1A 2DWQA 1JB1A 4DYHA 4NV1A 2ADFA 3AEZA 4O08A 1Q11A 5AJVB 2LTAA 3KZXA 4RFLA 2NV6A 1BX1A 2QP9X 1ECBA 4OHVA 3Q0IA 3MGBA 4X85A 2X3UA 1BDBA 1C14A 3RFXA 4BN5A 4N3GA 4C0LA 1B14A 1ZW1A 2GKGA 4KN8A 1TTTA 3EMBA 5DTMA 2ZDGA 2OQ2A 4D0GA 3MINB 1Z08A 3QFTA 3IEXA 1N6HA 2PJUA 3JRWA 5C81A 2J08A 1SOAA 2PYIA 1NW9B 1FX0B 2YWJA 4OGWA 3VJMA 3HCWA 2J59A 5D51S 1O97C 4IHJB 4TT3D 1WPXA 4DLZA 1HSOA 1F4VA 2W0MA 4B8ZA 3QVWA 4JQZA 3A3KA 1E4VA 2VRCD 4IOKA 4RENA 1VIMA 3G68A 1SBQA 3W6PA 1EGVB 1ZM2A 3K8OE 1Y3CE 2VNIA 3AINA 3HLKA 3JASA 4I36A 4RO0A 4U3JB 4WCFC 4R83A 4BKMA 3DFMA 1QQBA 1PFGA 1HE2A 3CUWA 2C61A 2ZVJA 2XB6A 4DLRA 3ICEA 4G89A 2J5BA 2GCOA 3FPGA 2CYCA 1CT9A 1CZUA 1FYFA 1MPTA 4G0NA 4OXNA 5J2TB 1XEXB 2YN4A 3KWLA 3R4CA 3H97A 4ZVQA 1GTL1 1L7DA 1Y9AA 3BJRA 2CZGA 5KJEA 1V3TA 5HGJA 3CO5A 5JD3A 3O4IA 2AB0A 2FP3A 3AU9A 4N0EA 1Z2OX 2OHGA 5EPUA 2ZI5A 2C3MA 4KJXA 4TL7A 5DV9A 2LNDA 6LDHA 5GJVC 2VF7A 2B92A 5ELLA 2FKNA 4XZ3A 1A9TA 1U8FO 4TM7A 1V39A 3TDMA 2VJOA 3CZ4A 1ECLA 1SFRA 3SDSA 2H1RA 5LZ5A 3PHLA 3OQNA 3BZBA 2KX7A 1IQPA 3WZ2A 2EDAA 1R0YA 4FMCB 1KXZA 3PYXA 4LRTB 5TF4A 5HQ3A 1Y1KE 3Q87B 4N9WA 4OM8A 1C9YA 2IW3A 2QTVA 4IWXA 4WXYB 3WLEA 3UOGA 4HK4A 3ZDQA 1HWYA 1LPMA 2CMHA 3QHPA 4FOTA 3JQ8A 3TJRA 1W0JD 3GLUA 4GPZA 1RAIA 3TG8A 1HY3A 3R7DA 3A2KA 1L5HB 3FW1A 5IC5A 5CDFE 1BMQA 3WP0A 2SNIE 1E3EA 1E89A 5CXXA 4IEEA 5AM1A 1UBFA 4BMXA 3P0RA 1QLWA 2ZJ5A 2ORYA 4LF9B 4ISBA 2HWKA 4DJEC 5ETJA 3K35A 1CK4A 1C3OA 3GGDA 1ZSVA 2AT1A 3U3RA 1SXJE 4GYYA 3V4FA 4CNBA 5A4IS 3DFZA 4P54A 4Q02A 5KYVA 2HNBA 1DIAA 5EOVA 2QLBA 1SMKA 5EIBC 5ALWA 5BSUA 4RAQA 2G7MC 3WLJA 1YK1A 1K7YA 3PL5A 4M55A 4MWEA 2IE0A 3RUDA 2IHJA 3QI7A 5FA6A 1OHHD 4CMEA 2KS6A 1XAIA 2XHZA 1SJ9A 2ZATA 1NI4A 4NESA 4NH4A 2P41A 2AMFA 4TZTA 5EWJA 3E27A 2QZ9A 3VBCA 3VUFA 4DZTA 1SOWA 1J33A 3A0RB 2J45A 1JFLA 3DR5A 2HRCA 4IFBA 1EVYA 3K1JA 1VJ1A 4K9NA 2D3WA 3JWPA 2BDEA 3WMRA 4B5KA 1WF6A 5AW2A 3ONWA 3O8OB 5DLQC 2I8CA 2BFBA 2JAWA 3UMRA 5F7OA 5IVIA 1JHRA 3OQOA 1P2BA 2F90A 3B2QA 2VATA 1ORRA 3FUTA 4RBNA 1QIFA 2C8VA 1XA4A 1Q3HA 3AERA 2C96A 3GEGA 1E3DA 1Z2PX 3QU7A 3EWSA 4GP6A 3Q11A 4POOA 2JJ8A 4JB8A 4LRUA 3EXAA 2A59A 1I7PA 4BV8A 1TD9A 3F90A 1XYGA 4PAOA 4O4HB 4YVFA 3SDZA 3LKZA 1UH5A 2J8ZA 2QGFA 1C1XA 2WLSA 5I9BA 7REQB 2SCUB 3A26A 4KX3A 4M1EA 4V0QA 2XCOA 2Z5VA 5DCYA 5B1YA 4CG1A 3AEUB 4JLWA 1DEAA 5G0UA 5DXFA 4Y6SA 2WF6A 2PUHA 1G64A 1ONSA 3BG5A 1FU4A 3PNVA 3RYHB 3JQBA 4HVLA 7YASA 1UK6A 4AKSA 4TT8A 4QDTA 2XMCA 2RMKA 4R51A 2HC9A 4CCYB 1TKBA 2WPDD 3CTMA 3IQFA 2QSZA 4D0NA 1HL7A 3FUCA 3AIKA 1RYHA 1NOIA 3LLSA 3TSCA 3ANTA 4PX3A 3KRTA 1I0LA 3PFKA 2Z3ZA 4P4GA 3PFBA 2ZIFA 3GLHA 3U4GA 4NCBA 2Q5QA 1GYRA 2PXCA 4U9UA