The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
50
|
sequence length |
166
|
structure length |
166
|
Chain Sequence |
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
Cytochrome c oxidase subunit 1
|
| publication title |
Ligand Access to the Active Site in Thermus thermophilusba(3) and Bovine Heart aa(3) Cytochrome Oxidases.
pubmed doi rcsb |
| source organism |
Thermus thermophilus
|
| molecule tags |
Oxidoreductase
|
| total genus |
50
|
| structure length |
166
|
| sequence length |
166
|
| ec nomenclature |
ec
1.9.3.1: Cytochrome-c oxidase. |
| pdb deposition date | 2012-08-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF00116 | COX2 | Cytochrome C oxidase subunit II, periplasmic domain |
| B | PF09125 | COX2-transmemb | Cytochrome C oxidase subunit II, transmembrane |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Rhopdopsin 7-helix transmembrane proteins | Rhopdopsin 7-helix transmembrane proteins | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | Cupredoxins - blue copper proteins |
