4GP8B

Structure of recombinant cytochrome ba3 oxidase mutant y133w+t231f from thermus thermophilus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
source organism Thermus thermophilus
publication title Ligand Access to the Active Site in Thermus thermophilusba(3) and Bovine Heart aa(3) Cytochrome Oxidases.
pubmed doi rcsb
total genus 50
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4gp8B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4gp8B02
3TASA 1BRDA 4N4YB 3OD3A 1KBVA 4GP8B 4G7QB 1V10A 1E0PA 2ZONA 2DYRB 1AZNA 1PNCA 2IWKA 1E67A 4RH4A 1WS8A 1C3WA 5DHHA 1JXGA 1X0K1 2LNLA 1UAZA 1JVLA 4MBSA 4DP0X 1PXRA 4JQ6A 3IEAA 3TA4D 2ZWNA 1QKPA 2PPAA 2H5UA 1ET5A 4G72B 1CURA 2YAHA 2YAMA 1UATA 4MFHA 3CVBA 3ABMB 3H56A 5AHZA 1A8ZA 3QPKA 3TBBA 4QKTA 4UF7C 1NTDA 3FSWA 2J5WA 3NY9A 1TN0A 4XXJA 1WS7A 1PLCA 4NAJA 3QJRB 2I21A 1E5YA 3DKHA 3FT0A 3OMAB 4DJHA 2A3TA 5DYSA 3FU7A 1ETJA 2PEDA 2TSBA 3QBIA 3AG3B 1Q5JA 4QRYA 2UX6A 2IDSA 3SQRA 5JJEA 3ZPRA 1SNRA 4A2GA 4FA7B 4W1TA 3UAAA 2FTAA 1P8IA 1MZZA 3NJMA 1QKOA 3C9LA 4GPOA 1JVOA 1WAEA 1S53A 4G71B 4L6RA 1AZBA 3NJLA 4YSQA 1IW9A 5I5MA 1DYZA 2UXVA 3PAVA 4E9YA 2XLLA 4EIYA 3ZEVA 2BW5A 4AKQA 2P80A 1BQRA 1PLBA 2W88A 1ASQA 4J4QA 3HANA 3UZCA 3HAQA 5H2PA 2XX0A 3NSYA 4HALA 7PAZA 3REYA 3FPXA 4E9SA 3X3BA 1BXAA 3AG4B 2ZZLA 4PXKA 3CZUB 3ABKB 2AZAA 4BWWA 1PY6A 1TU2A 1N68A 3GXUB 1R2NA 3QAKA 5J7AA 1HFUA 2NTUA 1I53A 3NSDA 3GDCA 4E9XA 5ANHA 4MD2A 1MZYA 2YAPA 3ABGA 5B1BB 4GBRA 5B6XA 3NY8A 5B2NA 2J55A 3NP3A 1ASPA 1XIOA 1GS6X 5H2HA 1IBZA 4ENZA 3JT2A 4HCFA 1V55B 4DP9X 4N6HA 2W8CA 5G54A 2GC4C 2ZFEA 3OE0A 5ITEA 4FAAB 5BR2A 2CCWA 3CDZB 1AR1B 4YSRA 2J56A 3P0GA 1JERA 1RZQA 2BWDA 3U25A 4BV0A 2IAAC 3PCYA 3IE9A 5KKHA 2OV0A 4JKVA 4LDOA 3FYIB 1GSKA 4Q89A 1PNDA 1JZEA 1OCOB 3NJIA 4HHWA 5G2DA 3TBCA 1F50A 2IWFA 1XB6A 2XU9A 5D4HA 5I6OA 3CODA 2QPEB 5AWZA 1S54A 4MD1A 2PPEA 1JZJA 4N8UA 2AZUA 6PCYA 1R1CA 3DDLA 3X1NA 3QBGA 3ASOB 5FJGA 1JV6A 4OV0A 5AFAA 1NIBA 6PAZA 1RZPA 1BM1A 2VM4A 1RCYA 3ASNB 1AIZA 4BDVB 4EJ4A 4FPDA 2XV0A 5F7BA 5A7EA 4IB4A 1NIDA 1BEXA 3EH5B 1PZBA 3UABA 1NDTA 4TXVB 2YCWA 3ZX1A 4BK5C 2AFNA 2GHZA 2XXFA 4KO7A 1IUZA 3H4FA 3PLYA 1X9UA 2DYSB 3G5WA 4K9JA 4UANA 1JXDA 4YSCA 3TU6A 2XXGA 3ZDWA 2CAKA 4DPCX 1NWPA 2I7OA 2X87A 4DP1X 5FC9A 1JOIA 2I20A 3AG1B 2X72A 5I28A 4A4MA 3DIVA 3X3CA 2PCYA 4X32A 3OM3B 2IDFA 4WKXA 2KS9A 2QDWA 4JHVA 5TK4A 1IC0A 5E9NA 1CYWA 3AY2A 4F7KA 2KSAA 5BR5A 5A45A 2HZHA 1AACA 2IDQA 1QNIA 3FQ1A 2PPCA 5EN0A 3WG7B 4BVNA 4KO6A 4DP6X 2ZIYA 2XVBA 5B7EA 3NYKA 1Q5IA 2XV2A 1QHJA 1GR7A 3D12B 3NT0A 3JTBA 4XTNA 4YVNA 4YSEA 2Y00A 4QI1A 2GB2A 2YAQA 3UGEA 5B6YA 5H2MA 4NC3A 2XYBA 4KO5A 5PAZA 3PAZA 1FA4A 2BWIA 3AG2B 3T71A 2BZCA 4FBZA 3FSVA 4Y9HA 1KBWA 2JKWA 3RYMA 5G28A 1IKOP 1F56A 3V2YA 5AX0A 2P80D 1PZAA 2XX1A 1PAZA 3NP4A 4BUOA 2N0MA 5ITCA 1ILUA 5LWEA 2BHFA 2WSDA 3FSAA 3WNJA 3OE9A 3T6ZA 5B34A 4MQSA 1OOWA 4X31A 3QAPA 1NIFA 4DKLA 1NZRA 4BWTA 2B3IA 5I6MA 1ID2A 4E9RA 4N4WA 3X1EA 3C9MA 2YQBA 1S8JA 3S8FB 3T6XA 2GIMA 2CBPA 3N55A 1M9WA 2YDVA 3X2QB 4BXSV 1GYCA 1W6LA 4E9TA 3WNIA 3NJKA 2VW7A 4KLYA 1J5DA 4PAZA 3CVCA 5H2KA 4KOCA 5AX1A 3UTVA 2DWSA 2VN3A 3KJ6A 1A3ZA 1WA1X 4A2DA 2Y02A 1BQKA 4CSZA 3COCA 3EH4B 4YSOA 2VM3A 2PLTA 3MBVA 3MBWB 1KCBA 1WA2X 2EILB 3WIAA 3CVDA 4GP5B 1B3IA 2Y03A 1KGBA 3UACA 1ET7A 1KCWA 1GS8A 1KV7A 4AZUA 1ILSA 4HWLA 3IN0A 4BEYA 1ZIAA 3AW5A 4HHGA 3S3DB 1VGOA 3VVKA 1SJMA 3PDSA 1EZLA 2EINB 4BWUA 1JV7A 4E9WA 5I5IA 5H2JA 3OAXA 5A44A 2JAFA 1X0I1 2UXFA 1CYXA 3EH3B 3FS9A 4BDVA 3X1GA 2IH8A 5AKRA 3EMLA 1L0MA 4KNUA 4KNFA 1OE3A 5I26A 4HAKA 1TEGA 5F7AA 1XB3A 1BRRA 4DP5X 4A67A 4AMIA 2FQEA 5D4IA 2IH9A 2JFCA 2R4SA 1MG3C 2DV6A 2UXTA 4G70B 7PCYA 2JAGA 1KGYE 2VSKB 2GI0A 2HRHA 1SF3A 1FWXA 3OMIB 5I6KA 4G7RB 5IY5B 1MDAA 3V9CA 2BW4A 5JJNA 1W6WA 4XT1A 5AHYA 1L9HA 3ODUA 3ABLB 1HAWA 3IBOA 4W9ZA 2XUWA 4DAJA 2FNWA 2HXAA 5D4JA 1AS6A 2I7SA 5G36A 4GY4A 4QIDA 2PP7A 2H47C 1QM8A 3FQ2A 2Z73A 3UAEA 1GY1A 1QHQA 2XWZA 2HPYA 1JZFA 1RKRA 2FT6A 1KMEA 4JR8A 5G53A 5AZDA 1BAWA 1IW6A 1CWQA 1M0KA 1LN6A 1S52A 2Z55A 1AG6A 1E5ZA 1PLAA 1FFTB 1SDDA 3PPSA 1ZIBA 5A8EA 2JXMA 4WAVA 4NB7A 4YSUA 1ZPUA 4HCGA 2XV3A 3NJGA 3VG9A 1ZDSA 1FBKA 2OCCB 1AOZA 3FPYA 2CUAA 9PCYA 1OCRB 1U19A 5B3SB 5B1JC 1AP9A 5B7MA 2HX7A 1PZCA 4M3HA 4GYCA 1PY0A 2Q5BA 3T45A 5B6WA 2MRYA 4AKPA 3NS0A 4UAHA 1NPNA 2J4YA 2L6XA 2EI4A 2ZXWB 1BXVA 2VT4A 3S3CB 1NIEA 1J9RA 3AZUA 3HB3B 3WQJA 4A2HA 1ET8A 2IWEA 2AVFA 4DP8X 1PXSA 4X1HA 2QDVA 3PXLA 1OCCB 2G87A 1A4AA 1A65A 2NRDA 4QLWA 3FU7B 5TK2A 4BXVA 1OV8A 2KSBA 3VI0A 1VJMA 4YSPA 2YXVA 1C8SA 2WJLA 3QJQB 1TEFA 4HZ1A 4A66A 1SF5A 4PCYA 1O0AA 3C75A 2YAOA 1X9RA 2FQFA 3VHZA 1M0LA 2IDUA 3NJNA 3UZAA 2HRGA 5H2NA 1T5KA 1PF3A 2PP8A 4A2FA 5H2LA 2PPDA 4WW3A 1AZCA 1XB8A 2OJ1A 4M4RB 3VGAA 4A68A 1W8EA 2FT7A 3HAOA 2FT8A 3QQXA 4IAQA 1OE2A 3NSCA 4XTOA 1AT9A 1XMEB 3QJVB 2VSMB 1AANA 1ZDQA 3HAPA 1L9OA 1NINA 3WI9A 3OE8A 1GZMA 3QJSB 1DZEA 4PXFA 1L9PA 2FWLB 1GS7A 3V2WA 3L45A 5B7FA 2Y1AA 1TN5A 3FU9A 2AT9A 3UTWA 1SHWA 3N2JA 3NJFA 4DPBX 3OMNB 4YL4A 4DP7X 2GBAA 4EF3A 2PCFA 1BYPA 2UX7A 4TL3A 3MX0B 4KNSA 3QJTB 5I6PA 1PCSA 3CAPA 4NERA 3IN2A 3PWHA 5EHFA 2HLEB 2VMJA 3QJUB 4E9QA 1MGYA 1AS8A 3CDZA 3FU8A 2Y69B 4HIPA 1XJIA 1J9QA 3ZPQA 2YCYA 2YDOA 3OE6A 4UG2A 5G2AA 1VLXA 1AG0A 3FSZA 4ZK8A 3ABWA 3T6VA 3X1FA 4YSAA 3AYNA 3SBRA 2GSMB 1E30A 4L0PB 3WKQA 2RACA 4F2FA 2YCXA 4P5SA 2F95A 3HASA 5H2IA 3VW7A 1AZRA 5B0WA 1CUOA 3S8GB 1JZIA 3UONA 4HYXA 5PCYA 3QDCA 2YCZA 4MQTA 2J57A 2I1XA 2Y04A 1KG8A 1X0SA 5B35A 1ZV2A 3NJHA 1F88A 4XTLA 5JJJA 1OE1A 4GP4B 2BP0B 4CSPA 3PQRA 1J5CA 5C1MA 1JZGA 2I85A 3AM6A 2BRDA 1KYAA 4BEZA 1OCZB 1GY2A 2I35A 3H4HA 1UCQA 4HYJA 1KDIA 1L9TA 2TSAA 1AZUA 1GU8A 2KSYA 4L35A 1SDDB 1URIA 4A2EA 1JZHA 1WA0X 4LDEA 4YVUA 1MG2C 3KW7A 1M0MA 1QLEB 1TKWA 2CALA 2R4RA 1V54B 3EF4A 1AQ8A 8PAZA 1CC3A 1E12A 4YSTA 3HARA 3RFMA 4AKOA 5I6NA 3NYAA 2E86A 3ERXA 3FYEB 4F2EA 3A7KA 2QT6A 3KW8A 5I5JA 1L9SA 2YAFA 1SFHA 2DY2A 3RZEA 2YARA 2BP0A 4LDLA 1BYOA 3UADA 1M57B 1ADWA 1S51A 4Q8BA 1J9SA 5ETZA 2HX8A 5F8UA 2X88A 3OQRA 2FQGA 3QBKA 3BVDB 1A4CA 3T9WA 4GRVA 1BXUA 1PMYA 3NJJA 4KO9A 3UTYA 5H2OA 3CG8A 1OF0A 5TGZA 2FJSA 2AANA 3QBLA 3FQYA 4XT3A 5B1KA 3ZIYA 1F4ZA 2B08A 3S3BB 2FQDA 1AS7A 2NTWA 2VW4A 4AX3A 2WJKA 3HEIB 2Q9OA 4JHUA 3PAUA 5B1AB 1L9RA 2Y01A 3X1BA 1R84A 1H2SA 2PPFA 3DTUB 4DP4X 1JXFA 1EHKB 2BP8A 1GW0A 2EIJB 2ZOOA 5G2CA 5B6VA 2VW6A 5DHGA 3WKPA 1FBBA 2EIKB 5LDUA 4GYBA 2F93A 1S8LA 1L9QA 4JKNA 5AZUA 3SBQA 2YAEA 2LLNA 4YSSA 1H68A 4K5YA 2UXGA 2R7EB 1C8RA 1AAJA 2M3GA 4KNTA 1A4BA 2GC7C 1JGJA 3AYMA 2BO0A 2RH1A 4DPAX 5B6ZA 1JFPA 3SN6R 3BQVA 3V9EA 4E9VA 2HX9A 1DZ0A 1BRXA 1J9TA 1E65A 2H3XC 2MTAA 4P5RA 1ASOA 1NWOA 1IXFA 3GYRA 4G7SB 3UTXA 1HAUA 2BP8B 3PXOA 1NIAA 4AMJA 2WO3B 1YLBB 4UHRA 2EIMB 2YXWA 2IDTA 3NSFA 4WTQA 5B1JA 1KG9A 1NICA 4KOBA 4HCIA 1GUEA 2PP9A 3ZBMA 2WO2B 1KDJA 4BWBA 3DQBA 2R7EA 4X4KA 3NSBA 4EA3A 1N70A 1SFDA 5I6LA 1HZXA 3PBLA 1SHXA 4DP2X 2QPDB 1P8HA 1P8UA 3UG9A 3SBPA 1BQ5A 3EHBB 2CJ3A 3T6WA 4IARA 1NPJA 1M56B 2DWTA 2BZ7A 4GXFA 1IBYA 4AI7A 4YSDA 3D4SA
chains in the Genus database with same CATH superfamily
5AOLA 2J88H 4FFZH 3E2HB 3TN0B 1OT2A 5CR8A 4A6YL 3DUSB 1A7OL 4MNQD 1W15A 3T3PF 5KOMC 4U3SA 2NOYA 4HJEA 1JXGA 4QGYA 2AV7A 4WVRA 3PXJA 4PGBB 3VFSA 4F37F 5B39B 2GTQA 5MEQB 5T3XH 1PXRA 5DMKB 1CXFA 4JRXD 2PPAA 3UG3A 3V0WH 3IVKA 4U1MB 2WBJA 3CN4A 2X12A 2YAMA 4XNQA 5JHDB 3LKSB 4I8DA 1E6JH 4HWUA 3SBWA 2PMZA 2E47A 1JV5A 4TVPE 4P0DA 3DVGA 4K5NA 2X42A 2Y6SC 3BVNA 1T5WB 2JCCB 3BGAA 4HJUA 4M7JL 4DWHA 4JRWA 4YDIH 5DD3H 3EH2A 1NUDA 4HLZG 2C7UA 5D6CA 4HFUH 5E08H 3CU7A 3WIFA 4XPAH 5KSBA 1P8IA 1N67A 4KJYA 4H8VA 4QRFA 1AGCB 4I1NB 1EJOL 4J3BA 4DIXA 3ARFD 1DVTA 4I9WE 3I6KA 4YSQA 1UACL 2VDQB 2ZUQC 4IRSC 3DX9B 3ROOB 5JHLL 1CGUA 1LNUB 1ASQA 4QO1A 5ISZE 5DQ9B 3CLFL 2XX0A 3VXSB 4Z77B 1LP9E 4IBSA 1DO6A 4JQXA 4AK2A 1PIFA 5IVXE 3QQDA 4ZW7A 2LR4A 4Z0BL 2QVFB 3F00A 1N68A 5DJXA 2CKNA 5BO1H 1QLFB 5DZNA 4PJ6A 4ZMWA 4K8RH 5EEUA 1QPXA 2BOCA 3MUJA 4ADGA 4HOMA 5C2UB 2DIEA 4FJ6A 3ZTJG 1MRDH 4D0CB 5HYIA 5BRPA 4WNQB 5IV2B 3LKNB 4DKFH 1U42A 3J8F7 4FZEL 1DSFL 2WXJA 3OE0A 2V8MA 3N1PC 5DD5H 2N1TE 2V9QA 5DD6B 2PTTB 3E6FA 1X5ZA 4YE4H 4HULB 3RFRA 1NFIA 2XWTA 2G0KA 3MNZB 3BH8A 5JIDA 2BWDA 3QARA 2DBLL 2OR8A 1XQ4A 3G9AB 2BNQE 5C08A 2AXHA 4JKVA 3GRWH 4JAMA 2R69H 1JF1A 3REVA 3T04D 3GSQA 3ILQC 1XB6A 4M1DH 3AY4A 5AWZA 1E5BA 1YY9D 3V6ZB 3VYPA 5I5RA 2F53D 2FEDD 3DDLA 1NGWB 1TENA 2YRLA 4DVRH 2AAVA 3S2CA 4QJ4B 1FZJB 2P5WB 3P77A 1BF5A 4FQLH 4WFGE 2VLRB 3WE1A 3R1GL 2B15A 2E4FA 1NBZB 2BH0A 4I85A 3HA0A 1EUUA 2OXGA 2WTRB 5EFIA 4RBPK 4NWTL 4KI5F 3BVTA 1MWAL 5A2FA 1V8HA 4HBQA 4HWEH 3O3DA 5LGYA 1PL3A 4M8QA 5FFLA 5IB5B 5FUZH 3K8MA 2OI9C 4IEFB 5F3BA 3MU3A 2AV7B 5FC9A 1JOIA 1M2VB 4M6MH 1GAFH 2R2BB 4L3CB 5FO8B 3B2VH 5C97A 3DIVA 2DD8L 4KZ0A 1ZLVK 2FB4L 2J2ZA 2OMUB 1D9KC 4MAUH 4GKZA 3IVKB 1MHEA 3VWJA 1WZLA 4ZO8A 5ES4B 1F1GA 1XGUB 1THAA 3DVGB 4LHUA 1A25A 2AKRB 2NZ9D 1ZA6A 3BAXA 2OMWA 2X10A 3IU4H 2Q7YA 3DXAD 4FQ2H 3O4OB 1FBIH 1J86A 3WIFB 2I5YL 3SKJL 4F8TA 1AXSA 1VGKA 5HHVL 1EO5A 2EIEA 1JGUL 1DBKH 3D2UB 2FO4B 3F84A 3GBML 4FQIL 2AXWA 3FCUB 2AQNA 3U1SL 3TIEB 4MJID 4ANVA 3E6HB 2CWRA 3DO7B 3QJXA 3WSQH 4XCFH 1BM7A 4XTRD 3T08A 3ZRCC 5G28A 4FTVB 1IKOP 2L7UA 5FOBA 3NZUA 2K3HA 4L2YA 5D2LF 5FOJA 1A9BA 4PJ7B 2AJSH 4ODTH 1IAMA 2ZIDA 5L2JA 2VR7A 1KCLA 4LP8A 5I8KH 2VMCA 4FYRA 4P59H 5E8OA 2Z91B 3EYVB 1UXWB 3VGBA 1NZRA 4U1IA 3F05A 4GRMA 2VDOL 4F7EB 1IBGH 2XTSA 4LU5L 3C9MA 5DFWH 4LEOA 3S8FB 2XBDA 4OLVH 1R5WA 5FECB 4L3EE 3FONA 1ML0A 3PJLA 4BXSV 3OL2A 2MQ0A 4E9TA 1JI1A 3NJKA 4KKQA 4Z7VF 3WNIA 4AL8L 5IMMA 5J12B 1JSYA 4PJ8C 3CVCA 2WOYA 2WWNA 5DMGC 3GSNL 4WTWA 3ULUF 3BN9D 4H88H 3I74A 4Y4KD 3COCA 4LSUL 1HL5A 1AD9B 1JF1B 3QORA 4N86A 2ZCKL 1DJIA 3TV8A 4EN3D 3V6ZA 2PO6D 4AZUA 3DJZA 1T6VN 1V3KA 2FBOJ 4XPTL 3WY3A 4WUUB 1BSIA 3IM1A 4GFXA 4QRUB 4ADIA 1SXNA 1E40A 2ZPKH 3HFMH 2DM3A 3LV3B 4Z7VA 1KTRL 1AC6A 5H4YA 2P45B 2EE3A 5EBMA 1QSVA 1RUQH 4MLIA 3VG9C 3DHMA 4N2LA 5AKRA 4RGOL 5CCKL 4GPVA 4G2AA 4FG4A 1CGSL 3RX8A 5EU6E 4BCZA 2B4CL 3KAAA 3QUKB 4QF1A 2X2IA 3NACH 3QULB 3QYNA 4AV0A 2XTJB 1KCVH 3FUIA 4XC1L 4NIYE 4Y16C 2W9DH 4ZPTB 1CU4L 5EF1A 4MB3A 5FYJE 2YZ1A 3EGDA 4FEIA 2IWGA 4M8QB 1AIFB 1FL5A 2WQSA 3OMIB 4PWEA 4XGZA 4A63A 4KRPC 3OBAA 3L54A 4QKXB 1GGCH 1W6WA 1T2XA 5FKAA 3WY2A 3ZZ1A 3NCEB 2H0PA 4I3RH 3VFNA 2IMNA 1UURA 5JHDD 1K8IB 2H47C 4B95C 2Z73A 1F4YH 4NWUH 4DF9A 4K5OA 3U0WL 4PW3A 3NJXA 3TO4D 5DJDB 5G53A 1AHWC 4R7NA 1M0KA 2GUOA 3TWCH 5ERWA 4J8RB 1SXAA 4DZBB 4KKBC 5J57B 2VLMD 2FR4A 4QRRB 2G0LA 3FO2A 3SQBA 2DI8A 9PCYA 1U19A 1HQRB 1JMZA 3IJ7A 1MFAH 3SPVA 1BG1A 3MRBA 1ZSHA 2WLHA 3PV7A 1SRDA 4JZOA 5SX4I 3TEZA 1E4KC 3DUUA 3TIEA 4UQ3A 5JXAL 3Q1SL 4JY4A 1NPNA 4ZXBB 3RDTD 2WXQA 1IKFH 3HB3B 1ODAA 3DHUA 4IKKA 3K72B 3TT1H 4JFHD 3VDAA 1V7MH 3IETB 3H3PL 4B96A 5IOPA 1A9BB 4HBCL 3LZQA 4XZUB 3VRJB 3K8KA 2K6YA 4DGUA 4GO9A 4PJBE 4NQVB 2OAAA 1Q8MA 4XB3A 4MX7A 4ZFOL 3NZHL 4PCYA 2P8MB 4PJXB 2OI9B 2E7MA 3U46A 4LKXA 1T83A 3RGBA 2V8LA 3V8CA 2IDUA 3HUJB 3UEZA 1VEOA 1A0QL 1HWGB 2J20A 4UU9B 3QZBA 5CBAA 1AZCA 4WHTB 4A68A 2X6VA 1YMHA 1NCIA 3EZJB 4QYAA 1OE2A 3MRMA 1ZPLA 2R4SH 3OLGA 1XXDC 4I89A 3TFBA 1ZDQA 1G7HA 1OIOA 3GMPA 4DT2A 2PCXA 1L9OA 2KLSA 2V5SA 4IOSA 5G4NA 2FWLB 4I18B 3V2WA 5E6IA 5CSZB 4XMVA 4POYA 5JYMA 2AT9A 3FCGA 3PNRB 3QORB 4XP4H 4F1SA 4LHQB 4TL3A 2PYED 4YHOH 5DVOA 2EDKA 1TTRA 4MJ2A 4LOVA 4ZDHA 1U92A 3OJDA 4NKQB 4N0YL 3VG0L 5K69A 2WHVA 1E8XA 4G82A 1I1AA 4P4KA 3TH2T 2GIYA 4QOKD 1J9QA 1SOSA 2F2HA 3ZPQA 4EIBA 1J8HE 3FQXB 3Q3GB 1EZVX 4ODUB 4TSBH 3WKQA 3QUKA 3WXVL 1GIGL 2PXYA 2C9UA 2IBGA 4KTDH 5BUGA 4EO5A 4LEEA 1S7XA 1RZ8B 2YPLB 3RA7H 5KVFE 4DNLA 1BWMA 1HHHA 4K7PY 1QFHA 5D2LB 4FA8A 5INDB 1AIFA 4XGZB 3SOTA 4XN2A 2FJUB 4HHAA 4ZPVB 1HSAA 1NC2D 3S3PA 4L1DA 2Y04A 3BKJH 3LPWA 1KG8A 4KH2A 1F00I 4DSYA 5F9OL 3NJHA 1A4JA 2CD0A 2EDJA 3VMNA 1QWUA 3X3FL 1HS6A 3T8VA 4G6MH 1FLRL 3KPSD 4OFYD 3V4UH 1OVZA 2O5ZL 1BLIA 3HRPA 4WTZG 2ENPA 3RWJA 1URIA 2PW1A 2B0SH 5E4IA 3S36X 3KW7A 1KBPA 1OK0A 4P9MH 1B90A 3QUML 3IJ9A 5CGBA 1UEMA 3VD9A 3BWZA 2D3NA 4YFLF 1NEUA 1F3DH 3MRBB 5BZDB 5D8JH 3CVHB 4QRPA 3BJ91 3W0WE 3BT2L 3RWFB 1RZIA 4UQ3B 4NRXB 2DDQL 5AVRB 2YD6A 5I1GL 2VXSL 4LLYB 4YHMH 2QR0A 3B7SA 3UCRA 5MEPA 6FABL 3KPRA 5F8UA 2AJYH 2CRMA 1DVXA 3VNZA 1MFCH 3KL5A 2W91A 4JKKA 3RIFK 5CM1A 1QR1A 1FNSH 5HPMB 1P1VA 1EEQA 4J3XA 4KZCA 4PHZA 5I1KH 2BOBB 1BFOB 3EYFA 1D7BA 2X4TA 1EDHA 5F72S 4XT3A 2QSQA 1KCSH 1RPQA 3QDJB 5B1AB 2Q9OA 3U9PL 3BAEL 3ZDZB 3Q2NA 3GKWH 3MO1A 3EW3B 1QBML 1X5XA 4RX4A 4PJ8A 4OCSL 1QG3A 3I9GH 3WKPA 1FBBA 2EIKB 4ERSL 4KK5D 4PJEF 1TJGL 2NY6B 4HFWA 2FVNA 3FUKA 4CC0A 2JCCF 2ATKA 1S4IA 5KSAB 1YPZB 4GSXA 1ECZA 2M3GA 2X6MA 1LO3H 4HWNA 4NUJA 2B5IC 3NIFB 1JGJA 2BJML 1RL1A 2WKOF 3ARGB 2NY5H 3SGDH 1SJHB 3AXLB 3O3EA 2HX9A 2GBUA 2KUTA 2QV2A 3C6LC 4R8WH 1T1YA 1ZS8A 1VKXA 5C07A 1YY8B 2DQHL 1IXFA 1O75A 2M83A 3K6IA 1AO7E 4F2MB 4F7CB 2VQ4A 2WZ5A 3UTXA 4NNXB 2FGZA 2BP8B 2RTTA 4W9GC 3HBQA 4HJ1A 1SEQL 4FLSA 4ZS7H 2Q87A 1T1WA 1YECL 5GGRB 3GKZA 4FADA 3T0DA 2OZ4L 3V7MA 1E9OB 4Z7WA 5I18L 1IVTA 4N2MA 4MWFB 2A6KB 5DQJB 5FX3A 2JB6A 3P9MA 4ZNCD 1N70A 2A9ML 4QTIH 3PQYA 3LTVA 4U3XA 1I3GH 1BJ1H 4YPGA 4YGAB 2OCJA 1F2XK 4X9GA 3T0VA 3T6WA 1N0XL 1IC4L 5DUML 5B38G 3OQ3B 5FYJH 4GXFA 1CT8A 1UWYA 2M8XA 3R18A 4YZFE 4KK8D 1QNZL 4F57L 4Z7VE 4FFYA 4PP1D 1MFEH 3BMWA 1WS8A 3QZNA 3LEYL 4BSWA 3FQTA 3CVIH 4NZRL 4KKLC 2IV9A 4P3CH 1FNGB 5CJXA 1IAOA 5FYKH 2ODHA 2VSDA 1JV2A 4DP0X 2OPCA 2CPUA 1F42A 4GJTB 1EGJL 3RWJB 2ZXBA 2GAZB 4S1QL 1LWHA 4QIRA 3QUZA 2KDYA 1CFSA 3NCWA 4JFFA 4JANB 2VXUH 1LD9B 4BK5A 5HHPB 3SJVE 5A6LA 1WZMA 4XMPH 3ZKQD 1PLGH 1WK0A 4OR1A 4YDZA 1L9MA 5BZDA 1MVUB 1R3LA 4G8GE 4Q2ZA 2XZQL 5GSVB 2XRAH 3VDBA 1EUTA 1L0YA 2VB5A 4UIKL 1KIPA 2YA2A 4HIEA 1S53A 2GUYA 4TVPL 5IBUG 1C1EL 1KGIA 3IB4A 4NGHH 3BUPA 4XPBL 5HXMA 1F90H 3O45B 1WHOA 1OT1A 4FI6A 5KYNA 1PTZA 3F01A 1TJIH 4PJGA 5D7SL 5K9JH 1SLVA 3PGDA 5D5MB 5DFAA 1B0RA 2X4TB 2ODIA 2WQAA 1JGVL 4NZDA 1I53A 4R2GD 3BI9X 1QLEH 4JPKL 1G4RA 3O9WA 2WIMA 4F91B 1VERA 3ZKND 3DV4B 1VZHA 5F6HI 1ZTXE 5F7DB 3KYAA 4WGVB 1DJGA 4JFEA 3KR3H 3IGFA 4YE0A 1NQBA 3U7AA 2R56L 5TF1L 4ZOCA 2C34A 2BVPA 3RGVA 3MLVL 2AK4A 2W0KA 3A24A 4NUJB 2APSA 1OSZB 2BC4B 5C09D 3LSOA 1BZ9A 3CVHL 3BPLB 3U2SA 3IS1X 1SJHA 3B3BA 4N5ED 3E0GA 2PO6A 2ARWA 4LCWA 2AJUL 2D9QB 3LEVH 2IWFA 4LARL 1KJ2L 4UV4H 2QV4A 3UTQA 3DGGB 3SE8L 2WLYA 3QJOA 1F2QA 1E6JL 1MF2L 3K6OA 4BSVB 3P3YA 1CYGA 3T2OA 5EIVA 4JM2F 1E7UA 1HKFA 4LLDA 4N2HA 2IBBA 4R2GB 5EZLB 1S3KL 4NQED 1RHHB 4JKWA 5CUSL 3QCTH 2HT4C 3WUWG 3QS2A 5LBVA 4TV3A 1EVUA 3DETC 4BCXA 1AP2A 1DUYA 3RHWK 4B9GA 1MOEA 3OXRA 1I7ZB 3AXIA 1THCA 4WGWB 2F61A 1NLDL 4IBUA 1RZGB 4I0KA 3PJNA 5TF0A 4BK8A 3LRSA 4S0SD 5E2JA 1FSKB 4P2RE 5CJ5A 1OGTB 5J13B 4HZAA 1QQDB 1MKFA 3LOWA 3L5HA 3ZLQC 1Q9KA 2JLPA 3T5WA 2NLJA 5EBWA 4M6NL 3TO4A 3H2WA 3I9IA 5JUEL 1UWGL 4FQQB 3ATEA 1IFHL 4J1UA 3ESPA 5E2WH 4CN6A 4YFLI 3IYLW 4G7VL 5HYJD 1WWAX 4Q7DA 4WHDA 3GJEB 1X4XA 3AROA 5F3HA 3QFDB 2JQAA 1DSFH 1OXYA 4RAUA 2XVBA 3DX8B 4WO4C 4P49A 4U6YB 4K07A 1I1AC 4Q2ZB 3LZLA 1G7PB 2Y00A 2K1MA 3EJZC 4P05A 5DSCB 3OPUA 4P23A 4KZEH 2HSIA 4JZJA 1WBXA 4MDIA 3VAEA 4ZYKA 2C9PA 5CAYB 3B3IA 3VTTA 1OGPA 2ZX5A 1OAZH 2XX1A 4HFUL 1J9CT 3VFWA 3QI9A 3ZZQA 1U9KA 2BIOA 1UYWH 1ZLUK 2HWZH 4LNVA 3TBYB 3Q9PA 4X31A 2WXOA 3ME0B 5AOKA 1NIFA 3HB3C 4DH2A 4NO2A 1WICA 4FQHB 2G2RB 3CFUA 3KHQA 3CXFA 2OM5A 1KJ2B 3GMLB 1QRND 3DI3B 1IGTA 3N55A 3ZL1A 2OZ4A 2QQLL 4FQXB 2DMHA 1CK0L 1B4JL 3OKKA 3BT0A 3RPBA 2C9QA 2VMDA 2XTJC 1DL7L 2ALAA 3TOPA 1UB6A 2FX8L 3WOVA 4Z0BH 4QI3A 2E8YA 4LPVA 2AEPL 3MV9B 2QQNH 4XWGL 1DCLA 2NXZD 3MXVH 4IIQB 4NQDB 4EXPX 1Z3RA 3PIQA 1DQJA 1P7QD 4JQVA 2W0FA 1MFBL 2NY4B 4RSVA 1GGIH 4WO0A 2D3JA 4LHUG 3VWKD 4DKFL 3D87B 3KZ8A 4HWLA 1I1FB 3LH9A 5C0AD 3QEUA 1SYVA 2VZ3A 4HX1B 4B9FA 4E0RA 4LCWE 1YEIH 4M62H 1X0I1 1G9NH 5LCVA 2H41A 3N42B 1C7SA 3OF6D 2WN2A 4FQ2L 5KN5B 1NKOA 2AK4E 1J0YA 5F96H 4WWKA 3GRWL 3VQMA 3ECBB 5I26A 5D7LA 4PJCA 2ENSA 4PJ9C 4FQ1L 1X6NA 1MCQA 5GQBA 3NAAL 1U93B 5GRWA 4ETQA 1EPFA 3VRIA 2R4SA 2DJ4A 2DV6A 3FJTA 4EDXA 2WXKA 1VACA 3MRLA 1H5BC 2A9AA 1KYFA 2LV4A 4KGJA 3NJVA 3NIFF 4E5XG 1ZANL 3OX8A 2Q3ZA 3WAKA 4NQDE 5AHYA 3WEXB 3FMGL 4X8GA 2ILLA 3IBEA 1U95B 3G6JE 2IPKB 1K3ZA 2V5YA 2OL3A 4U0RB 4ONFL 2YRBA 1N7ML 1C08B 3KPMA 1GY1A 2YLKA 4NWTH 3RWIA 5KW9H 2O26U 1RKRA 5I24A 2FT6A 5HHQB 4HPYH 4LDOB 5K1JA 3QXDB 1UASA 2ZX7A 5HHNA 1PAMA 1S9YA 2D7TL 4M4PA 1CFQB 4OJYA 2AQTA 5IEHA 1EHXA 4WAVA 2HFGL 1A6UL 2AI0L 4IMKC 1FBKA 4K94H 4FDWA 4PD4K 3QA3A 3OJMB 43CAA 3AAZA 4HKJA 1AP9A 2JK5B 3DRTB 4WV1C 3VSVA 1OCWL 4TUOB 3ZPDA 3QZOA 3T45A 4RFEB 4AKPA 2YWZA 3QIBA 3RVXC 2P8PB 4LRIC 2NNAB 3DBSA 2X44D 3C5ZA 4PP2B 2GSIB 3QYCA 2KLTA 2IWEA 2NYYC 3D2TA 5IESL 4ZOEA 3QWOB 3VXQA 4FTVE 4CVXB 1UKQA 4G43B 1BBJA 4XPTH 1XSKA 2VLKD 3NGBC 3RE0A 3VFWB 5KVFH 4LAQL 1FH2A 1I9EA 5E5MA 5DGQA 1TETH 3VXRA 1OF2B 1NCGA 1ZVSA 5F9DC 5C9JA 3TBSB 5DRZB 1JG9A 2B3RA 3GS7A 3S97C 5DA4A 1D5XA 2HT3C 1RZFL 2W0PA 3O41A 3OLEA 4MMZB 1U8PA 5A7BA 1M4KA 2UY7A 1LVEA 4IRSB 4ZW5A 4BFIA 5LXGH 1TSHA 4YDLC 1MAJA 3QR2A 4GO8A 3QW9A 3TVMD 2WXRA 4QRSB 3U6RA 4DQOH 1ACCA 4PXFA 1NMCC 2QKIB 3L1GA 4JHZA 4XP1L 4HV8B 3G7TA 2HTKC 3ULUE 1CFNB 3EYUL 4L05A 3KVPA 5AKTA 4X5PA 1QEWB 3RP1A 4P23C 4PB9L 4RGNB 4PJIE 3GSNB 3AFLA 1U8JB 4M9OA 2HAZA 1X9QA 2VLKB 4JO1L 1TTFA 4QNPE 1CLYL 4WI0B 3DWTA 3VXNA 5L4MA 3ULVE 1JUFB 2VE6A 5ICZA 3RUGA 5AVUB 4KQ4H 2LW3A 4GKSA 4UG2A 3PQYD 1R24A 3X1FA 4WJ5A 3P4LA 5JIPA 3L9BA 3JV6B 4KK6D 2ZG3A 3UBXI 2NYZA 1G0XA 1Q9LB 3HASA 1AZRA 4XO3A 3Q8BA 3WN5B 2PABA 3BIAX 3L4VA 4A7SA 3GJFK 3PL6D 4V1DD 1M53A 1M1SA 4R83A 1QFWH 2DKUA 3MV7B 4N3UA 3S96A 4HUCA 5L8JB 4ZQKA 4R5TA 5B4MD 25C8H 5TE4H 3ZMNA 3FTWA 3DIFB 5FKPA 5B35A 4XTLA 3GEFA 2Z34A 3E7JA 4W9HC 4LDLB 5AOJA 1RI8A 1I4FA 3U7WH 8FABA 1MFVA 1N18A 3B7TA 4OJCA 4EE2A 3KPRE 4L29A 3T0AA 5DI8B 3SDXF 3L3OB 3ETSA 3NA9H 4Q0XL 1DP0A 2KT6A 3S6CA 1G6RA 3WJMB 4BGDA 5KYYB 4C47A 3VXOA 4NCC1 2CO6A 4MXVE 3U9UB 5TTRA 1AGEA 3O8XC 2JCWA 1J8HB 3C6EA 3DOSA 1S7QA 4HGWA 4XXWC 5E8EA 1IC5H 4Z7OB 3LIZL 4JRYD 5EN2A 1TSRA 3ARWA 3STLB 3QIBB 2A6IB 1AE6H 3L95B 1C9SA 3P2TA 2BP0A 4Q8BA 3G5YB 4TUUA 1AI1L 5HDQH 3OQRA 3MROA 3MUY1 4IHBA 3X12A 3OZLA 4GAGL 4U1JB 4R5XA 3S35H 3R4DA 1BMWA 1FH5L 3PWPE 4YHPB 4ZBJA 3A4AA 5F7WC 4XMKL 3O9WD 3SPGA 4W70A 2WYIA 2FQDA 2VRAA 3HLAA 1KPVA 2P7TB 3HEIB 1I8MA 5I15L 5E2UH 1FF5A 2HVKA 5DHEA 2PPFA 1JXFA 2EIZA 1U8HB 3V4LA 3WXVH 3JV4A 3B6SB 1U8PB 4GT0A 2QMKA 5G2CA 2W60B 4HKXA 1XR9A 3DLQR 2EKSA 2Y6TE 1Z3GH 4C8XA 3IU3A 2FATL 3MV9D 3NIDB 1HSBA 3MRIB 4PJDF 2J72A 2VXVL 3GK8L 3FT4A 3F64A 3MLRH 4PGDB 4Y5VB 4KKZA 4L37A 4JG0L 1DVSA 4N8VA 1PJWA 4ANUA 5IROD 4Y2DB 4S1RH 1WZKA 2DQGH 1QSEA 1LP9F 1CDGA 2BSDA 1AO7D 3GSNA 5DD1L 3BAYA 4DN4H 1UEYA 1F11A 4MJ5A 5AD0A 2YOAA 4XXDA 1HL8A 5KJ7E 2FUQA 1MUJA 2Y36L 2WCPA 1GUEA 4GKSB 1B0IA 2B39A 3ZE2F 1KDJA 3NH7H 4PY7A 4RQQA 3IKKA 3LZOA 4K3JL 1HI6B 4ODWA 1S7RA 4OSUL 5IJKA 2YJLA 2HVJB 2BY1A 5FA3B 1SVBA 3T0EE 4YHOL 3TLRA 1F3JA 1V5JA 4R3SB 5KUMA 2WYTA 4Q56A 3TVMC 3H56A 3MOBH 3WN5A 5IBLD 3JWOH 4GQQA 2YGNA 2VKXA 3B9VA 1TDQA 1II4E 4JFWA 1CS6A 1D3CA 3S5LA 3L4TA 2DYRB 2ADYA 4OLZH 4MD5A 4RH4A 1MJJB 5LNEA 3ZQ9A 4PU2A 4F7PA 4TSBL 4WW2B 3IK2A 4M1CD 4JQ6A 2H5UA 5HYJA 2GFBB 1IGIL 3B2UC 3DX7B 3OKNB 1TEYA 1HXKA 2IH1A 3GKWL 3HOGA 2IFFL 3L3OA 3MRNA 4HK3J 4JFPB 4I3GA 4NC2B 2ED8A 2PYFB 4Y88A 5ENWB 5AW0B 4RRPG 4CN4A 4XP9L 1QKZH 3LKQB 1FNHA 3SQRA 2R8SL 3D0VA 4HKZA 4HGWB 2GJZB 2VR5A 5KVGE 3C60D 2A73A 2DB8A 2B1HH 5EC1B 3X3FH 1NEZG 4PJGF 2A6IA 5EWIH 1ZT1A 4NKOB 4MBOA 3WUZA 4QLRA 1GCFA 3CZFB 1AZBA 1CQKA 2ERJC 4QTFA 4E9YA 3A6OA 4TSCL 1R47A 1ZOXA 3HZVA 2Y5TA 3PG2A 3ESMA 3M45A 3QO0B 4HDIB 4PUBH 3X3BA 1M7IB 3H3KA 2KZKA 2LU5A 5HY9A 1D5ZA 3CWGA 5I18H 2H1PL 4KKAD 5IG7A 2P47B 3N44B 3N9GL 1ORQA 1OSEA 5ANHA 4LO9A 5DJZA 1MZYA 1AGBA 1A8JH 1R3IL 2G9KA 2XA8H 3B5HA 3F7YB 5B2NA 1TVBA 2BX5A 3PWVA 2VZTA 4Q9BA 4DJMA 1AGCA 3UG5A 5EZIH 1DUZB 4ECNA 1QW9A 3Q43A 2EJ1A 2JI1A 1QA9A 4OV6F 1NC4B 1GTFA 2H6UA 3COOA 3Q6FA 1CTOA 4JFDD 4QRTA 1BQUA 1NAKH 4H8UA 5E1HB 2F9BT 2K4WA 3G5VA 5FYLL 4U1GB 1QI3A 3VD0A 3GBDA 5DK0B 3BRDA 2WM0A 4PYGA 3ATAA 4P3CL 1NFDE 3NJIA 2XY1A 3EFOB 1FZOA 3DRQA 4BIKA 5I6OA 1VFBA 3QDGD 2ZF8A 5D70H 1MVFA 1L7TL 1R1CA 3MV8D 5CEZE 2IC2A 3B9DA 1MUJB 2R1YB 4K5MA 5E2TL 3VWKC 4EZLA 5CLWA 1KGUA 3QIBC 3TEUA 3K6NA 2H4EA 3AT9A 2VABB 3SCMD 2J8HA 5J9PA 5J6SA 4FMKA 3IFLH 2FSDA 2RFXB 4KWUA 5FW6A 4R8WL 2NNXA 1F3JB 4FQPA 4PB0L 5DEZA 5FS5A 2XACC 3WIHH 2AJVL 2NNRA 4N8CH 4M6OL 1LEKA 4L3EA 2AFNA 4DK6A 1T2QL 4H8HA 1YECH 3MXWL 4BE6A 3PYCA 4K9JA 1S7WA 4OQTA 3C12A 4PS3A 3UO1L 2VR9A 1CDYA 4S10A 1LDPL 5KG9A 3F7VA 5KSUB 1MSPA 1TJIL 3ALPA 2WZPA 4PJ9B 3CBJB 5E1GA 3QHZH 1FZJA 1BJMA 4M5SA 4YHNB 5GJTL 1NFDB 2VLRA 3N1GC 2NY6D 3ORJA 4U1SB 1YQVL 3OM3B 1HZHH 2GFBA 5DC2A 4JHVA 4H8WC 2R39A 1PKQE 2W65A 5C9KA 2BSSA 3CC5B 4ZMPA 4G8EA 3T0WA 2BRRL 4JDZA 3L9YA 1QNZH 4F57H 3K2KA 1HNYA 3D0AA 2OMYB 2MWCA 4DS7E 3AQDA 2WGNB 2J7LA 2FHCA 3P9LB 4JN2B 1LEGB 4NZRH 4OF3A 2GJZA 3BYTA 1FZKA 1BX2A 2X70B 3ROLA 3NT0A 4NKDB 4C59B 5CINH 4HJ0D 1A5FH 1BD2A 2DJMA 2GB2A 3HMXH 2D03H 3PAZA 2BVOA 1L0QA 2GBVA 1JCVA 3SY0A 1A7RL 1GH7A 1DLFL 4NAQA 2R4RH 2XBTA 4FXKA 5DU7A 5DYOA 1U8OB 3LEVL 5IT2H 1Y6NR 5KYWB 1B6UA 4CW1A 2JKWA 5E03A 2Y5TB 1SN2A 3AS0A 5E8NA 1B88A 4PGZA 4XWOD 4XVSL 5AVWB 1E4XL 4R7LA 1G9HA 4EXKA 4IOFD 1XCWA 1P84J 1XGQB 5BJTA 3RWDB 1R0AH 3HI1A 4HH9B 3T1FB 1GMIA 3DSNA 2ADJA 4M3KB 2DQTL 4G1EA 1PD1A 1QATA 2LAAA 2N3JA 4AEFA 2EAEA 1N4XL 2CMRH 2K70A 5DRXA 3N1QC 3E6HA 4DPRA 1O7VA 3QDAA 4ZMAT 4IGBB 1X7QA 2X41A 2WLMA 3MRQA 3HG1A 1J5DA 3D1MC 4UT9A 2VO8A 3NFSL 4XAKD 1MJUL 2Z7UA 5GRVK 4JRFA 3UTVA 2DWSA 4CMMA 5IVZA 3DPBA 1A3ZA 4EI6B 5EEXA 1KG0B 1N0LA 5DHDA 5G5DA 1FV1A 3F5WB 4Q58C 2Z6FA 1OO2A 1KCBA 1WA2X 2EILB 3AM8C 3EFOA 4MDRA 2LABA 5E8OB 1B3IA 2GPZA 3VU2A 3VXMB 3WO4B 2MFNA 3ZMRA 4U1IB 4LSPH 3N85L 2JH2A 4ZTOH 3KLKA 2WZ0A 1KLGA 1JPGA 4HHGA 3S3DB 3PDSA 3BLKA 3B7YA 5I5IA 5KVEE 4OLUH 1EFXA 1ZHKA 3DMMB 2ADIA 3GXDA 4UZUA 4OM0L 5C08E 4AYSA 4ETYA 2BNQA 3W2DL 4N8PA 2D7QA 3BZ4B 3EOBB 4Y89A 3QE5A 4IS6B 1U91A 4O58H 4Z7UF 3EO0B 5F7AA 2FYVA 3UC0H 4XN1A 4DP5X 3RL1A 3D0LB 4NFDA 2E6JA 2CHNA 5D4IA 3VTMA 3GZOA 5DHVH 4BHUA 1BVZA 3KLQA 1FGVH 3CUPB 3ZR6A 5E8PB 2X9YA 4V1DA 2H9GA 4JGMA 3GJFH 4GG6A 5FGCB 5ESAA 2MH4A 4N6RB 3MFFA 3G5ZB 4MNQB 2XCMC 3VXTB 1L9HA 4Y5XA 4NUGL 3ABLB 1KYDA 5DJCB 5AAWA 1D6VH 3LXCA 1HOEA 5MEOB 3C2AH 2JKJA 5AQ0A 4LQFH 5HVHB 4JRXB 2R9HD 2E7LC 3QEGH 2ZYIA 2X9ZA 3HBZA 1NCWL 1SDDA 2WIIB 1SMDA 4KUCF 4KXCA 2F53A 1IL1B 2BZDA 1P4IL 4QXUH 3NJGA 3RNKA 3BO8B 4Y16B 4MA1B 4N2EA 1DL7H 2WCSA 2J5LC 2AJXL 3EGDB 4BQ6A 2BIHA 3HBGA 3OKDA 4Q9RH 3KYMA 1FO0H 3O4LB 3LHPH 1TLMA 3S98A 1WT5C 2HTLC 2MRYA 3MRCB 2CPCA 4MCNA 4RMBA 3S3CB 4MCZB 4OIFA 5BV7B 1A2YB 4V1DE 5HGHA 1GGIL 1BPLB 1F4XL 3MLYH 4DP8X 1RIHL 5CJOH 4OGYL 3RPKA 4OIIH 1A4AA 2FO1A 3VXSD 4FOMA 3O0RH 2EP6A 4ZSOE 1G7MA 1H8NA 2IXQA 3RWDA 4UOW1 1VJMA 2EADA 1A1MA 1AR1C 3HI1B 4HH9A 1WPCA 1H3PL 4ZMQA 1TEFA 1UH3A 1U8LA 3M6DA 2CIIB 5AB9A 1NMAL 1WISA 4JZOB 35C8H 4LVHC 4FLRA 4XMUA 4BZ1H 2P26A 4OB5L 3S5YA 4PP1C 4JW3A 2PPDA 2CBTA 3DX9A 3WCYA 2VH5L 2X9XA 3VXRD 1KY7A 1PVHA 2Y1ZA 2CJTA 3BVXA 3C5JB 2X4SA 4NO3B 3O2WH 4X0KB 3UYRH 3WIIH 4F7MB 5AW6B 4QYOA 3HAPA 4BE5A 1N5AA 4TNFA 1DVZA 3VNYA 2EACA 4LNRA 1SHWA 1KTJA 4DP7X 3MX0B 5HVFB 4YXKL 4QXVA 2QQLH 2XTLA 2YK1L 3U7YL 4MQXC 3ZT5A 4AEHL 3VFMA 3MV8B 4J39A 4NO0D 5JOPD 2BLFA 4WNQA 2VMEA 5AW4B 3QUYD 4HPYL 1EMTL 3GS4A 2Q8AH 3EJPA 2F1BA 3FU8A 2VZOA 4WHTA 2I60H 4P57B 2WXPA 5HDBE 1U91B 3FN0H 4N0UE 2OS7A 4AV5A 4MAYC 1E2VA 1NCHA 1ZHNB 3UZQB 4KKRA 1N5YL 1ZLVH 5IR1A 1OCWH 1MPAH 1ZKAA 3DNKA 4UTCA 4MJIB 4KRLB 1N3NA 4GW4B 1CUOA 3S8GB 3LB6C 3RU8H 4U49A 3QUZC 3ZTNL 1HHKA 1N8OE 3U0TB 2C3VB 3CX5J 4ZODA 2N1KA 1BF8A 4GRLC 3D25A 1NJ9B 1N2RB 4J3VA 1TZIB 5IBLC 5SWQB 2MNUA 4ABVA 1C16A 1ND0A 1AYOA 3LN4B 1TETL 3R06A 4PR5A 1FVDA 1MLCB 3ZDYE 1QACA 2MEJB 4K8RC 1H8SA 3AM6A 5EPMB 3FU3A 1NBZA 4HPOL 2I35A 4ZO9A 5FW8A 1X4YA 3H7LA 1CN4A 4HAFA 1OSYA 4DGYH 3L3IA 2WIIA 1SDDB 3DOIA 4WI5A 3BPNB 4LDEA 1D6EA 4HAGA 1KEMH 4IJTA 4IRJD 2CALA 4NQQA 3GO1L 5AUMB 3CHRA 1B6DA 1WGVA 1JGEA 2VLRE 3SB3A 3SJVB 4Z5RB 2Y7NA 4F2EA 3FYEB 3KYMB 3O4LA 4KUCD 4DQOL 1CXHA 3LS5H 2Z8VC 1KGWA 3MRCA 1M6UA 4HIIA 5F93C 4N2BA 1A47A 2VDKL 3MOQA 3U4AA 4Z78B 2AQSA 3IMRA 5F2FA 1ADWA 1J9SA 2HX8A 4NCDA 4UB0L 1VAHA 4OLXL 1P4BH 3EFDH 4JCLA 5GJSL 4KUZL 1CL7L 3TA3A 1NFDF 1G1KA 4PV8A 1CLYH 4KO9A 4D8PB 5EU5A 4GMTL 3CHXA 1U2HA 3C6LA 2QHRH 4OJFH 1TU2B 3QJHA 5D1ZD 3P30H 1UVQA 2ZUVA 3LNHA 3LQAL 4BUQA 1G87A 3QDJE 4R84A 3RBGA 1H2SA 3MLWH 2ICEB 4ZO7A 4H1LG 1FL6A 3RTQD 1UZ6F 2Z8RA 4DKTA 2O72A 1RJLB 3D48R 2EZ0C 4NBXB 2X1WL 2ZP9A 3EOTH 5I17B 1XCQA 2WNKA 5D93B 3SDCC 3ECUA 4AM0A 3K3QA 4BH8B 1JNNH 5BXFA 5IQOA 4ODHH 3VXMD 3CN3A 1UACH 2GABA 2HJFA 2BCKA 3HNSL 1OAUL 4P5RA 1YC8A 1OTUC 4P9HC 4KKAC 2HN7B 3H9HA 3MO1B 4JKPH 3KBFA 3GSVA 5AZ2H 1CTMA 1F1AA 1EXGA 4I77H 1CF1A 5KVDE 1H15A 4Y8AA 3NPSC 1YLBB 5BV7C 3SDAA 5CIPA 3L9EA 1KG9A 4Q9QL 1A6TB 4QNPF 2F7PA 3ESVF 5DWPA 2YEQA 5KVMC 3DQBA 3FB5A 4X4KA 3BD4A 1SFDA 5IR1B 1MRDL 2ZXEB 2X4QA 3MRDA 1XGTB 1ZTXL 1KPRA 1NPJA 3UL4A 5JR1H 1D9KB 2DWTA 3A6BH 3HJEA 3O0LA 2WUCH 1BW8A 2YUWA 1YY8A 3N6YA 3GRWA 1YEKL 5B3JF 3PPEA 4Z7VB 2H2PC 4B53A 3S88H 2R51A 1HCFX 1KIUB 1MIMH 1C16B 1ND0B 1NGPL 3LN4A 4DGIH 1KGXA 4WAFA 3TYFA 5DQJA 3BJLA 5T1LD 3U48A 3G04B 3KPSE 3EJYC 1ET5A 3FO0L 5L88L 1EQWA 4YUEL 5E2UL 5AHZA 3L3IB 4P48A 3GSRA 3H6AA 4XB8A 4PTUB 3V4VL 2MOVA 1XH3A 4QHKJ 4RFNB 7TAAA 2VERN 2A3TA 4PS4L 4NSKA 4JY5L 5AUMA 1Z3GL 1A14H 2E9BA 4IIZA 4W9LC 4RGND 5FLVA 3FB6A 3K6SB 4GS7B 1MW0A 4BK4A 1BVNT 4X6FB 4GPOA 2EDEA 2ETWA 5MENE 3MJ7A 5FWRA 1R34A 1MWAH 5DEFA 3NJLA 2R23B 2JKNA 4MRBA 2NX5A 3VGAB 3ZEVA 3IRCA 4HSCX 2RQEA 5JW4N 2BHYA 5GRUL 1YNLL 2VXQL 5JLZB 4PV8B 6TAAA 4FHJA 3AY4C 3CSYB 4C4UA 4M7ZC 3A23A 4JFED 1TU2A 4OD1L 1HFUA 4HC1H 2NTUA 2FB4H 2AQRA 2LTQC 4MAUL 5IB2A 4MD2A 3BSHA 5EO1A 4X98A 5EUOE 5B6XA 2AK4D 3RGVC 5EU4B 2IH3B 4ZW8A 3VRLF 1RJCA 2VT0A 3ARUA 1RJZB 4U1KA 1E9QB 1WBYA 3JT2A 3K72A 2O4EA 3QUXA 4FTDA 1MDTA 2ZFEA 1RJLA 1PX3A 4TKWA 1IC7L 3WTWA 1QSEE 5T1DH 1UM4L 3ZU8A 5EMYA 1JD7A 3RZCB 4YFEA 1NC2B 2PR4H 1HIML 1DBKL 1RZ7L 4P2OC 4EBQL 1JDCA 3I6LD 1B0RB 4QRPD 4J12A 1J87A 5CS7A 2HJFB 2XICA 3Q5OA 1OCOB 3FOLB 1K9TA 2K8MA 4HVBA 3GLZA 4XCFL 4NO0B 3MJ8B 4FE9A 3DHJA 3KE0A 3PF2A 4EIGB 1JZJA 3QZWG 1IBBA 3AS2A 3DV4A 5CBAB 2N7AA 3QPXH 2VXVH 1JGDB 4WY7L 4XN5A 4PQXA 1PD0A 4XP9H 1MY5A 3II1A 2RR3A 5FO9B 4JFHE 1E2WA 2EO9A 3K4DA 5GS3A 1CCZA 4UTBA 5C1MB 5DF0A 1R3HA 5GGQL 1TCRB 3ARGC 3IMUA 3BZEB 1E8YA 1X5HA 4EI5D 2GT9B 4FABH 1Q1JH 2FRGP 3UABA 5C0EA 2ZYHA 2XXFA 1CICB 4RX4D 5IQ7L 4NM4L 1QLRA 1BZ7A 3TU6A 1IAIH 4AYMC 1QBBA 2DTSA 2PTUA 5FFGA 3TTYA 5IMOB 1FAIH 2X4PB 4QHPA 4AITA 4DUWA 4A4MA 2PCYA 3RG1C 4AZ8A 1UUNA 1EANA 1OSPL 1R5IA 3MSPA 3BH9B 5EZLA 1KGCE 1YEJH 2Y25A 1RHHA 3PHSA 1HL9A 1FORH 3B4NA 3GB7A 1TJHL 1YN6A 3WEAA 1J8KA 1QWNA 1OWRM 4CC1A 2YBRA 3SJVD 5INDA 4ORGA 5F44A 3MBXH 5KSAD 2ZIYA 1ONQB 3NYKA 3QRBA 1U58B 4GUPB 5D72H 5EO9A 5FYJD 3RKPA 5I23A 1EIBA 3MRHB 4U1NB 1J0ZA 2FJGB 4AIZA 5B6YA 4K73A 3QIUD 2Y7MA 2W9DL 3T71A 1ROWA 2VN6A 3G3LA 2YKKA 5B22A 4RRPA 5K39B 5BUPA 4HJ0C 4XVJH 5AX0A 1WAPA 4U1HB 4QUOA 3ZKXC 4NM8L 3DBXA 2ITCB 4PRHA 1M6OA 5CKGA 5D1ZB 5TE6L 3DX8A 5HI3C 1MREL 4NQEE 4R4BB 2Y0SA 1I9JH 3TZVD 5A40E 4ZG1A 2XWBB 3IFLL 1E27A 4P2OD 1E9QA 3DK0A 2AQ2A 3LRMA 3OZ9L 3X2QB 1GYCA 1HCZA 3O6FD 5T1JA 5JOFB 4NC1C 2FSEB 3ZN6A 3IGKA 3FU6A 4G6AD 4KOCA 4LCCB 1EDQA 3B56A 5F1NA 2VLLB 2AMUA 5L7XL 4OGXL 4AQEA 3EYFB 3LXBA 2LOEA 1WD9A 1SY6H 2ZXGA 1F6FB 3IMTA 4AJYV 4P46B 1NDMB 2MOGA 1RURH 3S37H 4KX9A 3BE1H 1HHIA 2OK0L 3WUWB 3BAWA 4QEGA 2NY3C 2DEXX 3BQUC 4WO4D 1NAKL 5FCUL 1GYWA 2Q86A 2GITB 3FAWA 4J7RA 1CXEA 2KL6A 1JK8B 2RMNA 5A2KH 3BWAA 4UM8B 2IMMA 3PP3H 4Y5VC 5CEZL 3RZWA 4FFWD 4Z7QE 3VD4A 1MI5E 3BIKB 2IF7A 4JFXB 2C3XA 4ZNEE 1AQHA 1GSMA 4JJOA 1DQJB 4YS4A 3KLLA 4TTDD 5TDNB 3ULVL 4KROB 1L7IH 3KBHE 4OCRL 5DWUL 1DLFH 5L4JA 4LIQH 1YNTF 1KEGL 1ZVYA 4GRLD 3VXPB 1T89A 3UTZA 5K9OB 4WKZA 2JKTM 4PJ7E 4XP6H 2MQGA 2DLTA 2MTPA 2JELH 1CDCA 3ULUL 1J18A 5CZXD 2B20A 5D7EA 3E3QE 5D4JA 2H0EA 1R5IB 3KWWB 1XF5A 1QSFD 1AR1D 4F9PC 1UTDA 4PJCB 4N0CD 1E4JA 3HFFA 4ODVH 4EAEA 5FEBA 1IW6A 2P46B 4WQOA 3VRIB 2J4WL 1AG6A 4WZ9A 4QCIB 3D39D 3V5DB 3NABL 1FFNA 3GF8A 2FYYA 3WEBA 2CUAA 3G6JA 2ED7A 3ZKMD 5DC0A 4U1NA 3SDAC 1VCAA 3OHXA 1MI5B 1DEDA 2Q5BA 4OY9A 4G59C 2JKIS 1IM3A 1U8NB 4NJ9L 4I1PA 2ED6A 1K6QH 4OH2A 3VD1A 4NUMA 4BZ2H 2WBXA 5CP7A 5LNDA 4U6VH 4MD0A 4CVZA 1I8IB 1BECA 1S9YB 4HISA 4FERA 1OV8A 4G9FB 5D1ZA 5F9OH 5JMOC 1BEYL 3A22A 2EIDA 5C2BL 3QJQB 3QT2A 4A66A 4NQEB 1MCHA 3C5XA 1J8HD 2XWBA 1FC2D 3PWNB 3IE4A 3GMQA 3EOAA 1A6ZB 3DUSA 2MNJB 3S34L 3Q2WA 5IJDC 1PF3A 4W4NA 5DHMC 2X4UB 4FGMA 3QRFM 2GSIA 4OFQA 4YO0B 5GGTA 1J11A 2N0KA 4GW5B 1NCNA 2WWOA 5AVYB 4KRNA 5B38B 4PJGB 3ALWA 2CGRH 1YJDL 3HMWL 1MEXH 1N59A 2B2XL 2QLVB 1BQHG 2QMJA 3L45A 2O5NA 1XDTT 4NHUB 4YL4A 3TN0D 3TONA 2GBAA 5GZOC 3BVNB 3O9WB 2CMRL 2K9UA 4PVNA 4HWZA 3HRZC 2WZ6A 3WUWA 1IQWH 3CAPA 3QDMA 3H9SD 5ILTH 3QEGL 4YDJB 3QH3B 3V6FB 2Z31C 3CDZA 4TL4A 4XE0A 1LQSR 3HW7A 4RFOH 1XJIA 1CLVA 4UBDC 4QXUL 2YCYA 2CR0A 4BV1A 3OE6A 4N85A 4LLMB 2F54A 1B4LA 1EVTC 4YSAA 3TCTA 1TT6A 1YYMH 2GSMB 5JZ7C 2YCXA 4QO1B 2WTOA 1A3RL 3KXFB 3MCLL 4JN1H 4MNGA 4EVNA 5TDNA 4M43H 4N90D 3VI4E 3CSFA 2A74C 1TJGH 5KSAC 3ZT6A 1E90A 4OUUA 3UTZB 5K9OA 1NMCB 4XNUL 2ATAA 2BOCB 2J57A 3LKRA 1JVKA 4O58L 1FBIL 4TLUA 4PGEA 2F5AH 4YXLL 5L0QB 4LSTH 4FQIH 1BAGA 4JRXE 5HJ3B 3CCHA 1CIUA 3U1SH 4ZS7L 2TSAA 1SEQH 1K2DB 2DKMA 1WA0X 3V5DA 3GM0A 2NY2D 2HLFC 3LXUX 3AUWB 1UZGA 2Z7ZA 1QUPA 1XSJA 5DRWA 2KC0A 2A83A 3OAWA 3VFGH 2QT6A 4YHLH 3W9EA 4EI5C 3NTCH 3S96B 3C9NB 3MLUH 4PJDB 5MENB 5E5LA 1G7JB 2NX5D 4M8VA 4Y2OA 2NY4D 5EBWB 4JG5A 4LDLA 1TQVA 2CCLA 2UWEB 4JHAH 2MHAA 3F85A 3FT2A 4JY6B 3SDCD 4MD0B 1HXMA 5IJVA 1S7SA 2YHGA 1JDAA 1PG7X 1Z0MA 4MS6A 1G6RB 1UA3A 5KYYA 5CEXB 2PWDA 1E9PA 4ZFFB 3EBHA 1AGDA 1T5XB 2OXGB 2JF1A 2YD1A 3SGJA 1OY3B 4UCFA 3IDXL 4FMFA 3KDPB 1WBXB 2ZOOA 3SQOL 3BRGC 4OGYH 1VFAA 5CMAA 4MA7H 4X7TB 3T0ED 1CD1A 5AVQB 1GYVA 3DV6B 3ZK0A 4HJTA 5IFHH 3K2UL 4HCRH 4PRBA 2WJ5A 1C8RA 2YD8A 1AAJA 4OCWL 1Z5LA 2BY3A 3ZKNC 5ANMA 2RH1A 3PV6A 4NHUA 3STZB 4PRPA 3ES6A 4I4WB 1TIUA 1SOXA 4FQHA 1K8DA 1KPVB 5IW1B 2VH5H 1KJ2A 3GD1C 3GMLA 3O4LD 4G7SB 4N2CA 1U8HA 4FQXA 3JV4B 1JRHH 3HAEH 1WEJL 3NA4A 3WIIL 4IGBC 2ESVA 1DDTA 3IDMB 5FGSA 1XR9B 5BCAA 5E2VL 4X99B 3Q13A 2FO4A 4Y4FB 3ZSSA 2WCGA 2CNYA 2G3XA 1KY6A 4F15B 4P23D 5HBBA 1F4HA 2G4GA 2JI2A 5FO7A 4GS7C 4FXGA 1BQ5A 1HINH 1KXQE 1WFUA 5CWSA 1XTLA 3KR3L 3LQZA 2VDKH 2EE6A 2GQHA 3WO3B 5AG9A 2DH2A 4X6EA 1FVEB 1KBVA 4RLDA 1KELH 4PLOB 5E1AA 4ZAKC 1BZQK 5EC2A 4M9PA 2HFTA 3D2UD 2JKSA 3GMNA 1UXWA 4D2NA 1E67A 3JQOB 1B2WH 5GRZA 1UAZA 3MBEC 4MBSA 3JTTA 1AOHA 4W9FC 4OZ4B 1S7RB 5DJAB 4DN3H 2WQVA 4UF7C 1ZLUH 2CUIA 1VACB 2C4FT 2MQ3A 2KYIA 3TL5A 3QJRB 3EYOB 1V7ML 3DKHA 4HUWB 3AMLA 3VGEA 5IREA 3BSZH 3B8SA 2GG1A 4Z7AA 4FCHA 2G3ZA 4Y2NA 2HKFH 4OZFB 1K4DA 2Z31B 1MZZA 4LOEA 1QEXA 4EUPB 3EBGA 4M8RA 5AB0A 3MCYA 1YYCA 1WAEA 5T5NF 1Z9SB 2WC7A 1ES0A 1R17A 1UOLA 3CDCA 4R97C 4WW2A 4HD9A 4N24A 5I5MA 5C7XL 2EUXA 3PAVA 5HHQA 1IGJB 2VL5A 4WDIA 2W88A 4KDWA 4F92B 3UZCA 3IDJB 3FAXA 4JKPL 2ZKWA 5IEHB 1Q0XH 4G9FD 4E9SA 1J1PL 2ZZLA 4PXKA 1BFVH 3ABKB 4YQXL 4M1GH 1ZY9A 1H9VA 2YPKA 3N50A 5I8OL 3GXUB 3GC3A 4TQ8A 4M6NH 1BWWA 1I9IH 3DMMC 2PWFA 2E9GA 4CADB 1QO3B 2PCFB 4ICXA 1OARH 2A73B 2WUBH 1L5GA 1XZ0B 3MN8A 3BW9A 4WNJA 3LKPB 4OLXH 1P4BL 3EFDL 3QFJB 4NP4L 2F8OA 1UOVA 4KUZH 1O7DC 1HNGA 3GI9L 1V55B 3A6BL 4N6HA 4HCFA 5FKAB 2OMTA 3O3BA 2XC8A 5HGGS 1LLAA 5B39G 1CG9B 4JO3L 1HX0A 1Z5LB 1JZ4A 2IOOA 5DFVC 3QG7L 2ZAIA 4MD4B 4IBTA 4HU2A 4HT1H 4Q89A 4IRZA 1PNDA 4E41B 2EEXA 1AGBB 3QYMA 3E3QC 3WFEH 5KS9A 2MQCA 1TUPA 3O41B 5IHUH 1DUZA 4JE4B 1IM9B 3LN5A 4XRCA 5LQBH 3IDMA 5SWSE 4MKTA 2XN9D 3OAYH 3SE6A 1JV6A 4LLVB 2ZX6A 3GUTA 2V7NA 4PS4H 1GVIA 4OQ1A 2VR8A 1XH0A 3MRJA 3V6BR 1E7VA 4JDEA 4BDVB 2ICWI 4TUJB 3OHXC 1G9EA 4FPDA 3AQYA 5FO7B 2P5EB 3P0VL 4JM4L 5IZ7A 4ZQTA 4EZMA 1BEXA 1NDTA 3SDYH 1HOCA 3V4UL 1U33A 4XZUA 5ADOH 1IUZA 1VSCA 4NLAA 3JWDH 3G5WA 3MRFA 3GMNB 2H0FA 3CZGA 4WI0A 1KB5H 4X6DE 5HJGA 4XN9A 2KZWA 3NQKA 1EZUA 4JPIB 3SPJA 1JUFA 2VE6B 2R29H 3X3GL 5ICZB 3W0WA 3F83A 4QRPE 1BREA 3RIKA 1KJ3L 5J7CC 5ETUA 1FG9C 3WFZA 2NY5C 4UU9A 4EKJA 1MFBH 4XBPB 5DVKA 4K8RD 5AAPA 1WJ3A 2YPVL 1QSED 5BRZE 3VCLA 4WKXA 3HE6D 4R4FL 4UQ9A 5I1GH 5J89A 4LKCB 3D4GA 4PWJA 1YEIL 4ZW3A 5A45A 15C8L 3CLWA 1FJ1A 1G9NL 2ENYA 4NQUA 1IE4A 2JXMB 4HUKB 5E6IB 1X3DA 4KO6A 1O6VA 1S7WB 2I24N 3C5SB 4N0FA 4X8XA 4N5UA 2Z31A 1GC1H 5KG9B 4XTNA 2PR4L 4WI6A 1YA5A 1ES0B 4M7KH 4QRBA 2C1PA 3U9PH 5H2BB 1I4FB 4LLQB 4PSPA 1JF6A 4J4PA 4XX1E 4O02A 1E3FA 1W72A 4GFTB 4UDTA 4XH2A 4ERSH 1LP9B 4M56A 1WTGT 3E8UL 4AGPA 1T0OA 2CNZA 3MJWA 2YPKB 1S8DA 3FSAA 3EO9H 2XJLA 1J8HA 2SEBB 2VQTA 3GLDA 4MQSA 2COVD 4JMNA 3QAPA 3WJLA 2BJMH 4YHIB 3X1EA 3STLA 5D7IA 2Q20A 2XWXA 2ZOKB 1SOQA 3EXLA 4Z95L 4CU6A 4MHHI 3FQUB 3OSVA 5EUOF 1HSAB 4FXKB 2WBJB 4O9HL 3WE6A 4A38A 4U1JA 1E5UI 5BW7C 1JV5B 5HI5C 1I7RB 4FJYA 4CSZA 2IANB 4G83A 3SGKA 1F86A 4MD4A 4P2RB 5BS0D 3POHA 4XCYA 4DERA 5HGDA 4MDJB 4LP4A 3X13B 2F15A 2J8OA 3BUIA 5F9WB 4ALAC 1OPGH 1QFUL 4Y2DD 2EDXA 1KB9J 4P5TA 4K3EL 3UACA 5JHLA 1ET7A 3KD4A 3ENEA 3CXHK 1MCOL 3NGBB 2W60A 2NY1C 2EKSB 3QDGA 2WB7A 3T1WA 3BP5B 3CQPA 1X7QB 4QXGH 3D51A 3MBXL 3FS9A 3TT3L 1G7IB 3MKGA 3LEYH 2QR0B 5LGJB 3DPBB 4HAKA 1FRGL 4KITB 2P42B 2ATPA 1DVFD 1FIGL 2IH9A 2JFCA 4YXHL 1YSOA 2UXTA 2QGCA 5TE7H 5LCVH 3WLBB 3VI4A 2BOBA 2BNUB 3FOMB 1YNKH 1T80A 3QG6A 3W5MA 4A7VA 2BW4A 1J0IA 2V2TA 1CVSC 2NDFA 5G4OA 4W9ZA 4LSSL 4DEPB 2ZKHL 4GY4A 5DURB 4A6YA 4TRPL 3VCLB 4TVPH 5JZ7D 2JTYA 3QDME 4JO1H 4NM4H 1JXKA 4ZFGL 5JPNC 5SWZA 4TVUA 1CE1L 4CMHC 1ZIBA 3E80A 2JXMA 1YAIA 2D9CA 1NGZB 1FLTX 2XV3A 5L9DL 1NCBL 3U6XA 1ZDSA 3IFNL 3X14B 5CHNB 3UBHA 4MD5B 4FS0A 2YC1A 1VKXB 1HH6A 3P2DA 3BGFB 1U6AH 3OKOB 5GGSA 4TLSA 4WENB 4UT6A 2J4YA 4IDLA 5GGRA 3U4KA 1UZ8B 4OZIB 3VO0A 2PKDA 5C7ZA 4JFPA 1KXTB 2LFGA 2WTRA 1EWHA 5EFIB 5TH2A 2QSCL 4EUPG 1XMWA 2OMNA 5A43C 4EI5B 1VENA 1MIEH 2H2SD 2KSBA 1U41A 3ZZLA 3NIGB 1NANH 2D0GA 2WTPA 2YXVA 4XPFL 1C8SA 2P5WD 5HVHC 3FZUC 2DH3A 1FPTL 5D2NA 4APXA 3GIZH 3RI5K 3TBVA 1PEZA 3FQUA 4BUGA 3ULVH 5I75B 3VGAC 2Y22A 1SYSB 4WHYG 1JPEA 5FYKU 1MF2H 4F9LA 3A4DA 4XTOA 3HZVB 1XMEB 1JV2B 2VSMB 3MTRA 3QWRA 2AKRA 3Q6GH 4XCYB 3O6KL 5IG7B 1SVZA 2IO5A 2IXQB 2Y1AA 1FFPA 1JE6A 2NY0C 4JFUA 2XT1B 1U8LB 1VGKB 4QWWD 1DN0B 3SKMB 5I6PA 5A2LH 5BRZD 2R69A 5E1IA 3KLAA 1KOAA 4IM8A 2XG4A 4LP5A 4MXWL 5T3ZH 1IQDB 1WAAA 4RISL 5E4OA 5EUKB 3JVFC 3WNOA 1WV7T 4L9LC 2YDOA 1G7LA 2ZXCA 4RWHA 2YBGA 4QYOB 4PJ7A 2DQIL 4L8CB 2V2XB 4FP8L 4HIXL 3QJFA 1F4AA 1JNLL 3MGTB 1UWGH 4KK9C 3VI4B 5GGUA 5D5MA 4XMTA 4BFRA 4F7EA 3L3JA 2N7SA 2Y24A 5FECA 3C8HA 4NZFA 4Y19A 1U8IA 3A4EA 2EDNA 4WGKA 5PCYA 3RVVD 2KMWA 2I1XA 3OAYK 5CU9A 1OAQH 2JB5H 3F12B 4W9CC 1IZJA 4PJ7F 1NMBL 4U6HA 4UM9B 5DHYA 4OI9A 3V6OC 3SOBL 1I8AA 2X3AA 3VD5A 5BRZB 4APQB 2F6AA 5AYQA 5JORA 4J6RL 2AV1B 4N1HB 1AZUA 3M7OA 1CLOL 4WUUE 4LIQL 5I76A 4G6JH 4L3EB 1W8OA 1JZHA 1N6VA 4XCCH 3CNKA 4JHWL 4TPRH 4ZAKA 5GPRA 3RGVB 1KEGH 2DQEL 1QLEB 3CMOH 3HR6A 3RWHA 3AITA 3ML9A 2MNWA 1OAZL 3OAZK 1XV8A 2ZSWA 3MGOA 2VLJA 2OJEB 4IW4C 4X7FC 3T8XB 4TQEL 1A9VA 3GMRA 5HHXL 3K5RA 5SWQA 2PN5A 2ZXAA 5LDSA 2K7QA 4U1SA 4H44C 3B2PA 4LASH 3SE3A 2Q3AA 5B3JE 4OT1H 5CBEA 2E0PA 4AUUA 5BRQA 4LLDB 2X0UA 3O2VL 4LSQH 1KLUA 3OV6A 1IQWL 3MV7D 4OLZL 5FGBA 1OAYH 1TMCB 3P4MA 4Q6YA 1XO8A 5FXCH 4UV7H 1IJNA 1WYJA 3NSXA 2R2HA 3ZIYA 3QBLA 4RVBA 4RFOL 5DT1H 1UM5H 2UVEA 2B08A 1HXYA 4APXB 4AG4L 3TPKA 1A7NL 1CDIA 1W0YT 4X9IA 3ESOA 3SY0B 4N20A 4ATWA 5B6VA 1RIVL 5LDUA 4BZ2L 5DYOB 3WYRA 2F93A 1OGTA 1QKZL 1S8LA 3UYOD 1QRKA 3ET9F 4JKNA 3WKYA 3FCSB 4WHYH 2XPGB 2DTMH 1WIOA 4M62L 1OGSA 1MCSA 1JTOA 4J8RA 4I0PC 1JJUA 4YOKA 1GGBL 5EU5B 3VI3A 3A6CH 4WU7A 2Y7QA 4PRIB 5E5UB 4HXBL 5JNYB 1LQBC 4G3YH 5FDWB 2FIKB 5J11C 4CDGC 4R26H 1BOGA 2MTAA 4WEEA 5FYLE 3MNWB 1ASOA 3KPPB 2FL5A 1GPOH 3C8DA 1CFTB 1ZT4A 4X50A 3CDYA 4U6YA 4PUBL 3B8YA 4KVNH 2J8UE 3HHMA 2ICEC 4DKDC 5I19H 1G94A 1PY4A 1OP9A 1Y07A 1DJYA 3MUZ1 4Z0XA 3NESA 4U31A 4EI6A 1BQHB 3UZVA 5C71A 3VRJA 2XKUA 5DS8A 3W11C 4JRYE 3ZVVA 1TF4A 3SKNA 1O6SA 3V4PH 1AFVH 1NCAH 4PM1A 3OD3A 2KPNA 4M6AA 3KHOA 1U8IB 2D7TH 4MMXC 4BZ1A 2M2DA 4CNIA 5I1IH 2LNLA 1A6TA 5F88A 4IBZA 1MFDL 1DSWA 1TOXA 2BSCA 2FWOA 3CFJB 5A2AA 2QTVA 3N5AA 2CO7B 3R7QA 3TURA 3QQ3A 3F2LA 2HH0L 4LF3B 5CZXC 4I18A 1SXCA 4OTXH 2YZ8A 3IAPA 1JXJA 5T1MB 1CO1A 3FSWA 3FZUD 5IJKC 1TN0A 3DTXB 4JG9A 4NAJA 4PBDA 1BXXA 3FU7A 3L5WA 3BAJA 2Y7SA 2VDMH 2X4OB 4KNQA 4ZDHB 3DJRA 1AXIB 4WK0B 3UAJA 4GXVH 4FA7B 2FJFB 3RPIB 1FO0A 4FQXD 2EEFA 1F6LL 1G7QB 2YPLE 3MRKA 1MLBA 1YZZA 4P4KC 2HUEA 1VCBC 1IGYB 2NXZB 2RJMA 3WAJA 5ALBH 3KGTA 3P4MB 4WFED 4WLCA 4Z7NE 3CZUB 4LFHG 5E2VH 2WVUA 2G5UA 4JMXA 1FZMB 2CDEB 4X6CE 4HHAB 5B1BB 5FB8B 3PE9A 3NY8A 1NBVH 3WFDH 3WLWC 2O93L 2R2CA 3PUCA 4LLAA 3QUGA 4XMLH 2P24B 4OCYH 2NX5E 5FFOA 2WLLA 4FCAA 3DSFL 1EK3A 2ICWA 2W8CA 1H3WM 1QYGL 5DEGA 4KQ3L 2IPKA 1NUNB 4YL9A 4BINA 3V2AR 2VXTH 2WP3T 3DJSA 3U25A 4WJKB 4B0MM 5JW5B 4LOFA 5L2KE 2G5RA 5ACLA 2YRPA 1F41A 1I1CA 2R4RL 1BOGB 1JZEA 2CIIA 4W9JC 5C0GA 4AQ1A 4PJ5A 4IHOA 5DZOA 4MD1A 1Q72L 1ZT4B 5CEYA 1CGVA 4ZX4A 4PTTB 3QA3B 1KZQA 1OT4A 3VXUE 4DN3L 1VB9A 3QBGA 4R90H 4QTHB 4W6WB 1GKEA 1KYOK 1DBBH 3LH2H 1BVKB 1RZPA 2VDPL 4R9HA 1BM1A 4MZIA 3BSZL 2B59A 1IGCH 3NRQA 4N9OB 2LU3A 4LVOC 5J8OA 4P3DA 4GBXC 5A7EA 1BBJB 1SQ2N 1TQBB 3GTVA 3V4VB 2OSXA 3TH3T 2XA3A 3NFSH 1J12A 3MJ8A 3NA9L 4Q0XH 4AYID 3L3OC 4RZKA 3K71B 2WXIA 4PJEE 1DJHA 2BS71 3WS6A 3MNVB 2DIBA 1WBZA 3RY5A 1JGDA 4BZ2A 1ACXA 4M1GL 5I8OH 4AH2A 5KSAA 1FDLL 2TRYA 4H25B 1QI4A 1C5CH 4RMTA 1BP3B 4W9IC 3FULA 4X6BB 4QRSA 1A7OH 2VIRA 5FHAH 5D7JD 3PL6C 4XBGB 2PPCA 2X4OA 1ZJAA 5B7EA 4ILDA 1HYSD 2B14A 5FHBH 4LAJH 2F7RA 1WCBB 4JO3H 4YVNA 4Z7OE 4XNMA 4XOAA 2GJ6D 3V0WL 3FH7A 4NQSB 2K45A 5AKVA 3KPNA 3H8NA 1U2CA 1KFGA 4O02H 3P3UA 2JB6B 3P9MB 3FTYA 5T1KD 4WFFD 1P7KA 2E7BA 1U2YA 4O5LH 1WE5A 2V9TA 4TNEA 5IHUL 3APFA 2P80D 5JA9A 5DJ2B 3K2MC 3ZL4L 3JV6A 1R3JA 1D6VL 3BC9A 4XPAL 3EADA 2DWDB 3GBNH 3IRPX 5B34A 3AREB 1U58A 5EO9B 3POCA 4L2LA 4S1RL 5I6MA 2B3IA 3ZE0F 1T20A 4YBQD 4NHCH 2WLIB 5C3IA 3F04A 2D8KA 3UEQA 1D9KD 1XD1A 1X44A 2R0ZH 3N40F 4JM4H 4PG9B 1H3VA 3K5SA 4X7EC 3VFVA 4Y1TA 3FFOA 1W6LA 4POZD 1E0OB 5ADOL 4HXAH 5EDSA 1BFVL 4YQXH 5AX1A 1SJEB 4ISVB 3SDDA 3O4LE 4WW2F 3VFRA 2R29L 4GXUN 2OSYA 3RFZB 2HT3D 2WSKA 1M6OB 1EAOA 4ELDA 5HHPA 1T6BX 2LTQB 3BUYA 1UVQB 1E50A 4PJ5B 4L8BB 1KGBA 1P6FA 5MP6L 5GSVA 2Q3XA 3A67H 1O0VA 2NUPA 2C4XA 3IN0A 5EOTA 4OIIL 4R4FH 5LB1A 1P2CB 1E27B 2VLKE 3ZJAA 5DLMH 1SJMA 2EEAA 4IDJL 5DVMA 2AHIA 1QTPA 5EEYA 3OAXA 3HIZA 5JHBA 2JAFA 1YMMA 3EG9B 1LHZA 1T22A 5B39A 3ULUC 5EA0H 4FYQA 5AVTB 2FEDC 3ARTA 4F8NA 2RCSH 35C8L 4K3DH 1XL6A 5J5EA 2P5EE 4FF9A 5GS0D 5I2IB 1DDHA 3PDOA 4XHJD 1DQML 1PY9A 2HN7A 3H9HB 4LPTA 1V7NH 3UJIH 2CXGA 3BEVB 4CA4A 5LWYH 2L7EA 3MOAH 2BDNL 3K71A 4EZJA 5BO0D 4BZYA 3HZ3A 4JFEB 2R8SH 2D73A 4O2FA 3RWCB 3WY4A 2KBGA 2ZCHH 2OR7A 3QS3A 5C08D 4MVBC 4QIDA 4OZHE 4N1EA 2X05A 3FQ2A 4JX0A 3SDYL 4AGMA 5LG6A 4O2CB 1BZ9B 4UILL 2XWJA 1P1ZA 3I2CL 2KERA 1BAWA 3O6ML 1MCPL 1L3WA 3PPSA 4LCWB 3WIAA 3DMMD 5FPIA 4Y5VA 3H0TB 4YSUA 1TKWB 4E41D 4BD4A 2F1EA 3D6GA 2YD0A 4BQCA 1SZNA 1ETA1 1H19A 4M6ML 1R46A 1JAEA 1VEMA 5B7MA 3IKCB 4KV5F 1LWJA 4OD2A 2P1YA 1KUMA 2K4AA 2XA8L 4D0CA 3TBTA 1RSFA 2ED9A 3NSDA 2VT4A 2VN5A 4YDKL 1ET8A 2YR3A 3CHQA 2PTTA 3JZYA 4FI8A 3PXLA 5C0CB 2G87A 4GRWF 2A77L 5IB4A 1M7DB 1HI6A 2G3NA 3PFUA 3SKJH 5JDSA 3VI0A 5DMYA 3AREA 4TOYL 1P69B 3FB6B 3K6SA 3OR6A 2ZUYA 2P4AB 4XO5A 2YAOA 3LRSB 1T20B 1X9RA 2UUDH 2VO5A 3GSQB 4RWYH 1RUKL 3MJ7B 2E9WA 2PP8A 4URTB 1G9MH 2QHLA 3EGXA 1FN4A 2NX5B 2A0LC 5INCA 1MJJA 2VL4A 5LCVL 2OL3H 4J1UB 4AT6B 1A6WH 2P5WA 3P77B 2ZP8A 4PS8A 3KWVA 1AT9A 1CI3M 4HWBL 2DI9A 4F33A 3WI9A 2ZNWA 3HKFA 4PMEA 3RZCD 3SD2A 1T03L 2XOTA 2VDOH 4XHJC 1M71A 4DPBX 2NNCA 4B9YA 3BGMA 2UX7A 3IDGB 1G7PA 4ZFZB 3GT6A 1VF5C 2NUPB 1CD9B 3FO9B 1CL7H 4JRYA 4K7PX 3EJTA 3HE7C 4JZJB 3QAZC 4UI2A 3GSNH 2AW2A 2ENQA 2AABH 2CRZA 3SYPA 5FW7A 1XSIA 4LRIA 4WO4A 1TVHB 2WBWB 5G2AA 3IMVA 5T3ZE 3FSZA 2L4OA 3CFNA 4NUQA 1AXTH 5I9QB 1OPGL 4OV5A 1NL0H 2ZAHA 2OMUA 1MHEB 2ZCKH 1OGAD 2M1KA 1YQVH 5FM8A 1DDHB 2DEWX 3CIAA 2QGBA 1KXHA 4BH7A 4PLJD 3EKCA 1M7IA 5KAQG 5HY9B 4YWGH 2ZPKL 2Z64C 5KOVC 3FB8B 3O6FA 3V8OA 1DHKA 1MJ8H 4D9LL 2WXHA 2MPVA 3T2PA 4MQTA 3OKKB 2QBWA 5F9AC 2WXFA 5B1CA 1X0SA 4L3FA 1FRGH 3ZGIA 5I71C 3HRZB 4Y4FD 3NACL 3D06A 4FNLL 5C1MA 1KSRA 4YXHH 5ISZD 2KS0A 1WFIA 1KCVL 1TCRA 1OCZB 3A47A 2B9AA 2E6QA 2XQBL 4GSDH 4JG1L 4YK4C 4L35A 1OHZA 3FQ4A 3IXTB 2E27H 3OVUB 5TJWK 1TKWA 3HZYB 1MCNA 1MHHA 3MYJB 5DK0A 3HARA 2XFXB