4GP8B

Structure of recombinant cytochrome ba3 oxidase mutant y133w+t231f from thermus thermophilus
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Ligand Access to the Active Site in Thermus thermophilusba(3) and Bovine Heart aa(3) Cytochrome Oxidases.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 50
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4gp8B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4gp8B02
3NY8A 5B35A 2XUWA 3PAUA 4L6RA 4G7SB 1W8EA 3V9EA 3HB3B 3NSBA 1JV6A 3EHBB 3TBBA 4K5YA 1ZPUA 3CG8A 2FT8A 1PNCA 2XU9A 3OMIB 2TSBA 4PXKA 2FJSA 2IWKA 4CSZA 4IB4A 3X3CA 4JHVA 2YCXA 3AG2B 3FU7A 1ETJA 3QJVB 2ZOOA 3UONA 1AS8A 1XIOA 3N55A 2AZUA 1UCQA 4KNFA 3UZAA 2J5WA 2DWTA 3HANA 3AYMA 3P0GA 3PBLA 1M57B 4F7KA 3V2YA 1DZEA 3CODA 4G7QB 3NJJA 4DP9X 2IWFA 1ET7A 1BRDA 4EA3A 1PXRA 3REYA 1FFTB 5A7EA 5H2OA 4BVNA 1HZXA 2MTAA 2OCCB 4BWTA 4L35A 1BXAA 1UATA 5B7FA 2FT6A 2FT7A 1NIFA 1YLBB 3H4FA 4Q89A 3QPKA 1MG3C 3QQXA 2A3TA 3NJFA 1CYWA 4BK5C 3QBKA 1J9SA 1SHXA 3PCYA 1NWOA 1KGBA 2WJLA 2QT6A 4YSTA 2IWEA 4IARA 2I21A 1A3ZA 1PLBA 5DYSA 1IUZA 1NIAA 2NTWA 1A4AA 1SFHA 3PDSA 1MZYA 3WNJA 4A2FA 5H2IA 3GDCA 4UANA 1ID2A 2HX7A 1PXSA 1AG6A 1QHQA 2IDUA 5A44A 1X0SA 4EJ4A 3HAPA 4JHUA 1NIBA 3RZEA 5I26A 4WAVA 1WAEA 1HAWA 2B3IA 4MFHA 5H2KA 3FYEB 1R2NA 4J4QA 2PPAA 2Y01A 1WA0X 1SF5A 2VN3A 4DJHA 1AZBA 4UAHA 3KW8A 2H3XC 2VM4A 3HAOA 1PMYA 3CDZA 2BHFA 2XX1A 4KO7A 3FSWA 3VW7A 1C3WA 3AM6A 1KBVA 2DWSA 5AKRA 2DYSB 9PCYA 2I1XA 3UACA 3C9MA 5B1BB 1ADWA 3EH5B 1GW0A 5I6MA 1BAWA 1CUOA 1NIDA 1KCWA 1S51A 2J4YA 3CDZB 3CVCA 3T6XA 3UABA 1SJMA 2GI0A 1F56A 3NP4A 3A7KA 3X1NA 5B0WA 2IH9A 1M0LA 4QI1A 2HZHA 2J57A 5PCYA 4YSQA 5I5IA 1IW9A 2BZCA 3FYIB 4WKXA 4E9SA 1QLEB 3MX0B 2YCZA 1B3IA 5DHHA 4L0PB 2R4RA 5LWEA 1QKOA 1S54A 4XTOA 2BP8B 1OE1A 1I53A 2PP8A 1T5KA 5F7AA 1CURA 4DPAX 4XXJA 1JXFA 3RFMA 3X3BA 2XX0A 2EILB 3AG1B 1AG0A 3OMNB 1XJIA 2E86A 4MQSA 2J55A 4E9QA 1JERA 4E9XA 2VW6A 1XB6A 2LLNA 1J5DA 3NJNA 4YSRA 2KSYA 5G2AA 5C1MA 4GYBA 2YAPA 3AZUA 5PAZA 2PCYA 2BO0A 3ODUA 2IDTA 2Z55A 1TN5A 2I7SA 4HAKA 1JVOA 2GC4C 5B3SB 1BQRA 1KCBA 3T9WA 4BDVA 1BM1A 4YSCA 4GY4A 4E9RA 1BQ5A 5B6VA 1J9TA 3WQJA 1HFUA 1FA4A 3OAXA 4E9VA 3SBRA 2ZXWB 3FS9A 4G7RB 1KG9A 3QAPA 1R1CA 2AANA 1EZLA 1ZIAA 2PPFA 1J5CA 2I7OA 1GUEA 2P80D 4PAZA 4BXVA 1IBZA 3FU8A 4BDVB 3S3CB 2HLEB 1QNIA 4N4WA 1JZJA 2R4SA 5AX0A 4PCYA 7PCYA 2JXMA 2XXFA 1AS7A 2OV0A 2UX6A 3EH4B 1BXVA 3H4HA 4NAJA 1AQ8A 2YDOA 1ASOA 1S53A 3NP3A 2YCWA 2GSMB 2PP9A 4KO6A 1OE2A 2YAEA 3T71A 3DQBA 4JKNA 1JFPA 4LDOA 2HXAA 3ZDWA 1GS6X 2Y1AA 4MQTA 1SNRA 1WA2X 5I6PA 4UG2A 4E9WA 2UXFA 1AOZA 5LDUA 2BZ7A 5FC9A 1MDAA 2UXGA 4YSAA 6PCYA 1SF3A 4Q8BA 5I6KA 4TL3A 1HAUA 2I35A 4HYXA 4AZUA 4DP8X 1TU2A 1CC3A 1NIEA 4A2HA 1OV8A 5BR5A 1Q5JA 1URIA 4DP2X 5H2PA 2ZWNA 5FJGA 2PCFA 4A67A 5I5MA 3OE8A 5TK2A 2IDSA 2OJ1A 1KYAA 1PZCA 3HEIB 4QIDA 1WS7A 1KMEA 1M0KA 1IXFA 1R84A 1RKRA 3MBWB 3NJMA 4QLWA 3T45A 2LNLA 8PAZA 3ABWA 1OCOB 3VG9A 1PZBA 1RCYA 3OE0A 1L9OA 4HWLA 2IDQA 5H2HA 1QM8A 1XMEB 1AZNA 3FU7B 1X0K1 3QJUB 4BUOA 4DP0X 2GC7C 3NS0A 3D4SA 4HHWA 1IBYA 5ETZA 5B6YA 1JOIA 2EIKB 2Q9OA 1MZZA 3NT0A 3HARA 1NTDA 2F93A 3FQ2A 2ZZLA 3X2QB 5B6ZA 1BRXA 1RZPA 2Y02A 4P5SA 4A68A 1SHWA 4DPCX 1ILSA 1V54B 2JKWA 4AKOA 5ITEA 1OCCB 2EIJB 2BP0A 1FBKA 4LDLA 1BXUA 2TSAA 1M56B 2PEDA 1AACA 1V10A 1W6WA 5KKHA 1KV7A 2FWLB 3ASNB 3NYKA 3T6VA 4AMJA 1X9UA 2DYRB 3IEAA 1ET8A 4WTQA 4X4KA 2QPEB 1AT9A 2B08A 1X0I1 3WNIA 2WJKA 4F2EA 5I28A 4NB7A 2Y03A 3IN2A 1AAJA 1KDJA 1PF3A 2HRGA 4RH4A 4BXSV 2BP0B 3UADA 3TA4D 5IY5B 3HASA 5G28A 2KS9A 4BV0A 1H68A 5F7BA 4M4RB 1FBBA 2JAFA 1NPJA 4NERA 3AYNA 3N2JA 4KNSA 2JFCA 3TU6A 1JXDA 1BYOA 2YXWA 3ABMB 3ZPRA 5H2JA 3T6WA 1C8SA 2DV6A 1F4ZA 2VW4A 5JJEA 2X87A 2H5UA 2YXVA 3NJKA 3X1EA 1JV7A 3RYMA 3X1FA 2AVFA 2CUAA 4P5RA 1L9TA 2XV2A 2YAMA 2Z73A 1TN0A 1PLAA 3DTUB 1TEFA 2YAOA 2UX7A 4N4YB 2YAQA 1OCRB 2BWDA 4YL4A 5J7AA 1JZHA 2I20A 5B7EA 4MBSA 3ERXA 1PZAA 3EMLA 1IC0A 3ZX1A 4DP1X 3HAQA 3SN6R 1MG2C 4YSEA 3CZUB 2HRHA 2WO3B 4YSOA 3QBGA 4NC3A 1C8RA 3CAPA 5JJNA 4G71B 2R7EA 2F95A 2ZIYA 4GP8B 4GPOA 2NRDA 2YDVA 5D4IA 4ZK8A 4IAQA 4BWUA 4HALA 5DHGA 1JZIA 1PLCA 3PPSA 2FNWA 1X9RA 3IBOA 5B1KA 1AS6A 1KG8A 4PXFA 4QKTA 5B6WA 5EN0A 4JKVA 3ZIYA 5AX1A 6PAZA 1E65A 2FQFA 1V55B 3TASA 3FPXA 1J9QA 1WA1X 3UTVA 1XB3A 1M0MA 2R7EB 2CBPA 1NINA 7PAZA 3PAVA 1ET5A 3QJRB 2MRYA 4KLYA 4AX3A 2XVBA 4XTNA 1KBWA 5E9NA 2FTAA 1AP9A 1OCZB 2PPDA 3CVDA 3FSVA 5I5JA 1U19A 1BYPA 3WG7B 4DP4X 3QJTB 4FAAB 1L9RA 3TBCA 4FBZA 4EIYA 1KGYE 3X1GA 3NSDA 4GP4B 4N6HA 3NJLA 5D4HA 1S52A 2KSAA 1RZQA 2Y69B 5EHFA 3KJ6A 4DP5X 1PCSA 1WS8A 3OQRA 1M9WA 4N8UA 3QJSB 2VT4A 1NZRA 3QAKA 3WIAA 4A66A 3ZPQA 3S8GB 2VSKB 4DP6X 1S8JA 3UTYA 5AHYA 1A4CA 3ZBMA 1GSKA 1NPNA 2H47C 3KW7A 2YARA 4DAJA 4GP5B 5BR2A 3PAZA 3X1BA 2RACA 2YAHA 4GYCA 5G36A 1DZ0A 1ZDQA 4BWWA 2VMJA 2W88A 2GIMA 3OE9A 3VGAA 3FPYA 1FWXA 1OF0A 3L45A 4X32A 3UAEA 2BW4A 4XT3A 5D4JA 3SBQA 5H2NA 1VLXA 5G2CA 3C9LA 4GBRA 2BRDA 2IH8A 1L0MA 3D12B 3PXOA 5G2DA 5G54A 1SFDA 1XB8A 3WI9A 2XYBA 5H2MA 4M3HA 1Q5IA 4GRVA 1ZDSA 4HYJA 1E12A 1E30A 3COCA 3VI0A 1PNDA 3UGEA 1JZGA 5AHZA 3NJGA 3G5WA 4JQ6A 1PAZA 1F88A 3AG4B 4HZ1A 4QRYA 1E5ZA 1QHJA 4YVUA 3BQVA 4WW3A 2BW5A 2XXGA 3WKPA 3FQ1A 5I6NA 2I85A 4XT1A 1VJMA 1N70A 2FQDA 3UG9A 4KO5A 4KOCA 5B1AB 3ABGA 4HCFA 1W6LA 3EF4A 2XWZA 4KNUA 2M3GA 1BQKA 1H2SA 2EIMB 4HHGA 1GU8A 1TEGA 3FU9A 4E9YA 2YQBA 4ENZA 3S3BB 3EH3B 3QBLA 3QJQB 2P80A 2GBAA 1EHKB 1A4BA 3AW5A 4AKPA 1L9SA 3NYAA 5B1JA 4E9TA 1GYCA 2JAGA 5ITCA 1E67A 2AZAA 3AY2A 2NTUA 5F8UA 1MGYA 4BEZA 1S8LA 1L9QA 1SDDA 2HX8A 3OMAB 3BVDB 3ZEVA 4TXVB 1UAZA 2WSDA 1N68A 2DY2A 3U25A 2XLLA 4KO9A 2EI4A 4A2GA 5G53A 5JJJA 1ILUA 3ABKB 3ABLB 1IKOP 3NSCA 4YSSA 2AT9A 2XV0A 1L9PA 4CSPA 3FQYA 1GY1A 1AR1B 5ANHA 3S3DB 2CJ3A 1SDDB 1CWQA 3MBVA 1JVLA 1ZV2A 2IAAC 2BWIA 2YAFA 1L9HA 5TGZA 4X1HA 2PPEA 5B6XA 3UAAA 5B7MA 3H56A 4LDEA 1OOWA 2RH1A 3FSZA 5I6LA 5A45A 4HCIA 2X88A 1AZRA 3PWHA 1GS8A 1E0PA 2J56A 3DIVA 4UF7C 4YSDA 3QDCA 2HX9A 4K9JA 3WKQA 2ZFEA 4W9ZA 3C75A 1NWPA 4OV0A 4KNTA 3S8FB 4FA7B 3JTBA 3ASOB 2BP8A 2VM3A 4W1TA 2N0MA 2W8CA 4UHRA 1A65A 3UZCA 1PY6A 3DKHA 1DYZA 4F2FA 5H2LA 3SQRA 4JR8A 3IE9A 2QPDB 3SBPA 3PQRA 1ASQA 5AFAA 4FPDA 5B1JC 1JXGA 1TKWA 2UXTA 4A4MA 1JZEA 3GYRA 4G70B 4KOBA 3NJIA 4YSPA 1AANA 2VW7A 3NSFA 1JZFA 2G87A 2Q5BA 3V9CA 1AZCA 3FT0A 2XV3A 5I6OA 1F50A 5B34A 4MD2A 2QDWA 3GXUB 1AIZA 3VVKA 2PP7A 1PY0A 2HPYA 2Y04A 1A8ZA 4AKQA 3IN0A 4HCGA 1ASPA 1E5YA 1GR7A 1CYXA 1GS7A 3NJHA 1GY2A 2AFNA 1QKPA 2FQGA 4AI7A 4DP7X 4A2EA 2EINB 1BRRA 2ZONA 3DDLA 4XTLA 4AMIA 1KDIA 1O0AA 4YSUA 1NICA 2PPCA 1VGOA 2L6XA 2UXVA 4Y9HA 5AZDA 4EF3A 4A2DA 1LN6A 3V2WA 5B2NA 2X72A 4BWBA 2GB2A 2WO2B 1P8IA 2FQEA 3CVBA 5A8EA 4HIPA 1BEXA 2CCWA 2CALA 2Y00A 4MD1A 1JGJA 2VSMB 1P8HA 1GZMA 1J9RA 1P8UA 3FSAA 2QDVA 3PLYA 3NSYA 2KSBA 1AZUA 3PXLA 5AZUA 5TK4A 3OE6A 3NY9A 2GHZA 3VHZA 4BEYA 2IDFA 3OD3A 2YCYA 3UTWA 4X31A 2PLTA 4G72B 4YVNA 3OM3B 1NDTA 5AWZA 2CAKA 4DKLA 4DPBX 1IW6A 1OE3A 1ZIBA 3UTXA 3AG3B 3QBIA 3JT2A 4GXFA 3T6ZA
chains in the Genus database with same CATH superfamily
3O2DA 1FZKA 3A6CH 3GM8A 2PW2B 4X5XB 4L9LA 1IAKA 4ZXBD 1IKNA 4NKMA 4OM1L 2V7HA 4D7BA 4Y5XC 3X3CA 5E8NA 1PG7X 1J5OH 3QJVB 3C5SB 1F6LL 1OW0A 1AQHA 4Y4HA 1A3QA 4WNJA 3BFOA 3IU4L 3MLXL 4XVSH 3L3OB 4MS8D 1HQ4A 5ESAA 2FJHB 1MAJA 2JVUA 2GSIB 3BAKA 1BRDA 1KXTA 1UM5L 2BRRH 1WK0A 4HJJL 1J1XH 2OCCB 4L4TD 4JJ5B 3CHOA 2R0KH 3U0WL 2FT6A 1I3UA 2VMEA 1OB0A 1YLBB 4WI0B 3KLKA 4PJBF 4XPBH 4P9HL 4DGVH 4XPAL 4F1SA 5IOKA 3S5ZA 2QT6A 2BNQA 2WCSA 4L18A 3POCA 2X4SA 4R9HA 3VXUE 2QZQA 1A47A 5CGBA 3VXQB 4YFLF 1XCTA 5D1ZB 3DYOA 5EZOH 3LZFH 1PZ5B 2E7DA 2FUTA 2VC2B 2BMKA 1E42A 2Y3AA 3RI5F 3CFCL 3M7OA 3VI3A 3WEXA 4ZOEA 1RULH 1W0YT 1EFXA 4L9LC 1IKNC 2O4EA 1MCLA 4QXTB 2VN3A 2NZ9C 1C1EL 4QTHB 5EOQL 4Q6IC 2ENYA 3P2TA 4GQ9H 3OHMB 4ONFH 2EAEA 4KO7A 2X1WL 3F7YA 1SBSL 3QXAB 1OW0C 5J12C 4AOFA 3B5TA 4KK8D 2VQ4A 2FYYB 3ARZA 4ZMXA 4M6ML 4EI5A 1GZPA 5CINL 3G6AB 5B1BB 3VG9C 4N1HB 3SHSA 2VDOL 1VZIA 2FIKB 3N06B 1RMFL 3V8CA 3UBXB 1MW0A 3A47A 1KELH 4UTBH 4WUUB 2C7UA 2HKHH 1EGJA 3HKZA 4LOEA 2OI9B 2BNRB 2GK2A 4L1HA 3RKDD 3H3KA 2KZWA 4L0PB 2WLHA 4TUJA 5E95B 1XSJA 2A4EA 3H9SB 3OWRA 1IRAY 4BZYA 1Y6NR 2QFPA 1JXFA 4YHNB 5IQ7L 2W9LA 3EJPA 3E2HB 4MA3A 3X13B 2IOOA 3ZO0A 4GAAA 3U6XA 4E9QA 4AV0A 4DFHA 1NFIA 1KXVC 1ONQA 2NY6D 3DRQA 1OTSC 3NJNA 3Q1SL 3KL3A 4JM4H 2CRMA 1KEMH 2FJUB 4NXSA 3TBWB 2AEPH 3FULA 5KAQF 2VISA 1AGFB 1MELA 4NQXB 1BX2A 5AZ2H 4KWUA 2BCKA 4LASL 2PKDA 4HX1B 4MB4A 2G0LA 4C56E 2ZKHL 4ZODA 1FG2B 1PD6A 1CFBA 5DQDL 3MRQA 3FBKA 3O2WH 4QJ5B 4F3FB 1A6AA 2IMNA 1IM3B 2EO9A 1JZJA 5AX0A 4XCCH 3UTZB 3GSNL 4BSJA 2ESVE 1A7NH 1KY6A 2IPKA 2XN0A 4KKBC 3AU1B 2ICWJ 2X4RA 2NX5B 2HWZL 2YMOA 2VQUA 5FYJE 2DIBA 4JKNA 5HYJB 3QHTC 4KTEH 1II4E 2A1WL 1SLWA 3FB8A 2K7QA 4EIZC 1G9NC 1J5IA 4AYGA 1E40A 4P2YA 3CH1A 1FFNA 3CV5A 3WL9A 1U3HA 2NW2A 1YAZA 4PRHD 1SJHB 2AJUH 4BD4A 5JW3H 1R3HB 2EDBA 5C09A 2KQNA 1KYAA 2Z9TA 4M1DH 1F4WH 1R17A 1ZANH 2C3WA 4YR6B 2L8AA 5EBWB 3QVAA 2BDNH 4MAZA 3ULSA 5K5YA 2ILLA 3MRHA 1FLTX 3CXDL 1BVLB 4S1SH 4AM0B 5I1HH 3MNDA 2DMHA 5ESQB 4KUZH 3VD2A 2NDFA 1BLNA 1W72H 4JY5H 2Z31D 4YL9A 4PG9B 1DE4B 2IDCA 1RFDL 4JFDE 1L4IA 2F93A 4NNXB 4AEHH 1CD1B 4L3FA 5ITFB 4M7LH 4ZFOB 4IBVA 1BRXA 2Y0SA 3HJEA 2AI0L 1B6DA 1EWHA 4JO8A 1SHWA 4ZSOB 2Y9RT 4K4KA 5ITEA 2LAAA 2J1ZA 2LW3A 4QHMA 1MFNA 1KIUA 5J89A 1E4WL 2ENSA 2YPLD 1U4FA 4NPYB 1AHWB 2CRZA 3PHOA 4UM9D 2DYRB 3J2PA 4NP4H 5LCVL 1S7VA 3RFRA 2X0VA 1CK0H 2FL5A 3WJLC 1FYTB 3QDJE 1FZJB 2EYTA 4ODSH 1R5IB 4E5XB 2ERJB 2AKRA 3GJFA 1OHQA 3MOAH 1Z5HA 3BLKA 4ONHA 4MVBD 2L3BA 1U3HC 3EOBA 3X3FH 2ATPA 1DHKA 1IZKA 3L3KB 1FV1B 1FBBA 4JZNB 4WENB 5JOEA 3ARBB 3CQPA 3PWPB 3QCTL 3MLZH 4FQQA 2YXWA 2VKWA 1RZJL 4XZ4A 1U8PA 1LE9A 1F4YH 4HLZH 3X1EA 1JV7A 4PGZA 3M1CA 4MDJB 2BHYA 5AKVA 4MJIB 2DLGA 2MCG1 4AE0A 1BZ9B 1S7XA 1SN5A 1W8NA 1ZLEA 3UZQA 1P9MA 4MNQB 4LLQA 5EULV 5FYLD 3CFNA 5DZOA 2DICA 3HPLA 2ADGA 1I7UA 3U9WA 3GS0A 4YK4C 5A2AA 2P8PB 3CMOL 4NC1E 3WJMA 5EDSA 5I16A 3QUZB 4Q6KA 2W92A 4Y4FB 4O58L 3KYAA 3LRSA 2VXSL 2NQ3A 1AXSA 5E03A 5L2KA 4ZNEE 1ACZA 3PWJA 2MCAA 1C8RA 3CAPA 2FO4B 4GPOA 5J6HA 4DKAA 4UOQA 4CU7A 4OZIA 1N64H 2EUWA 1UZ8B 2ZYRA 1D2PA 2GTQA 3ESPA 4JG5A 2KPNA 5E99L 1MJJB 1ZV5A 4U6HB 4OD3H 4XBPA 3I6GA 4EIUA 5A6LA 4Y4HD 1BJ8A 4YXKL 1T5WA 2YD4A 3P69A 3RWDB 1MCFA 3FFOA 4HCRL 1CXFA 4K8RH 4LSRL 2CUIA 1JBJA 2V5SA 3T8XB 3HG1A 1OF2B 1QX1A 2Q7NA 5CLXA 3C8HA 1QLRA 4KMTL 5E9NA 1QAWA 3JTSA 1QFHA 2PPDA 3CVDA 2MOVA 4FAAB 5C0RH 2WQSA 1MLCB 1LJMA 3BKJH 4R2GC 4ERSL 3WNLA 4J12A 5F0JB 5D4HA 4LRNH 4N8CL 2DWEB 2V9RA 1JHLL 3SQBB 5DJ2B 3AMLA 1NCNA 5F7DB 3QJSB 2DQEH 2YEZB 5BZDB 5A2JH 4K3EH 4LSSH 3VI4E 3H9HA 3I74A 4PRBA 3ZBMA 3MRGA 4PWJA 3ZE0B 3N40P 4OCLC 2H26A 4G9FD 3MYJA 1HJCA 4GP5B 1EFXD 3OSVA 2OK0L 5BOJA 2R4RH 3KEDA 1JV2A 4QGTA 1K8IA 4JRYB 1U8IA 2NY2C 1CFNA 3FTXA 3VFGH 1Z5YD 5A40E 1OF0A 1UKQA 1NSNH 1P7KB 2ADYA 2CO4A 3EO1B 4NZFA 4XX1G 1UH4A 3C9LA 4N2LA 3ZTEA 4EI5D 1Q9OA 1C8QA 4PJDA 3ECVA 3NSXA 2OMYA 2FX8H 3Q6FB 4G9DA 2H6PA 5DHMC 3C5XA 3COCA 1FLRH 4IOFC 1JK9A 2MOQA 5I30L 4NS0A 4KKAC 4Q0XL 1JAEA 2GSGA 3NCJH 4HUWB 1D5XA 2F74B 1KIQB 3VSQA 1XL6A 3OKLA 4IU2B 1SVCP 3QIBA 5ADOL 2VDKL 5FYKL 1JGDA 4M5YL 1UVQB 5GIRB 5D9SA 1TEGA 1WE5A 3DX8A 3FU9A 4UNUA 1SHMA 3S36X 4AWJC 5GS0C 2JI3A 1PU0A 2D7PA 3FONB 2MMXA 4LP5A 4JFFD 1QFUL 3KVPA 2CKBL 4AKPA 3NYAA 2FB4H 3IXAB 1LP9E 5IT2L 2FH6A 1NLDL 5F8UA 1L9QA 1F2QA 4GPVA 1MRDH 4LSVH 4RGMC 5EC1A 2Q6WA 1UT2A 2JIXB 2R0ZH 1XF2B 1CE6B 4J1UA 1RZGA 3ZE0F 4FP8H 3SKUD 4A2GA 3QT2A 1BZ7B 1TXKA 2FEEL 3ILQD 4ZUSB 1WO2A 2WBWB 4TOYL 3QNYA 4UIKL 2X6UA 3I6KA 5T33H 2GW5A 4Z3GA 2I07A 2B1HL 3FQTB 4PGEA 2CK0H 1S3RA 4K9EL 3I3DA 3BSZA 2ICCA 5T3XL 2CUHA 4X6BA 1DVYA 1MRFH 1TQWA 2AV7B 4X8XA 5EU4A 4GUOA 4N9GB 5I6LA 1I3GH 1TJGH 1UM4L 4K5PA 2FNBA 1IGIH 2BVTA 1NBYB 1E0PA 3STZB 2A77H 2JK5B 2CPUA 5AOZA 2ZFEA 1FFPA 4NZUL 1TSHA 1LEGB 4DZ8A 4RNRA 3MRCA 3EFFA 3D2UA 4ELDA 3VX0A 1CGUA 3D0VB 3FO1B 3SPGA 5IMKB 3EYVB 4TSCH 1PY6A 1LO5B 5BQ7A 3ETBF 2QZ5A 5EZLB 3DRTB 1YHPA 2H32A 3O6FA 4FQXB 5H2BB 2EVGA 1TKWA 3VXRA 4KAQH 1WAPA 3D5OF 1JZEA 2K9FB 1BFVH 3IDYB 2HVJA 4L37B 3RA7H 3TTYA 2ZOKB 2VLLB 4L8SA 4JZOB 2HSIA 4W6WB 1N12A 5I8OL 1FRGL 3SPVA 1B0IA 3WS3B 4Z78B 5I75C 1P1VA 5KJRL 4E0RA 4FLHA 2PCPB 5B34A 5F9WB 3AT9A 2PP7A 4NC2B 5GGSA 2OTPA 4CC4C 5FCUL 4HT1H 4ODXB 1Z9PA 4OBSA 4O9HL 4ACPA 3HAEH 3WY2A 2P8LB 4OLEA 1QTSA 1RL1A 2FQGA 2DIJA 2I27N 1YYLH 3SD5A 4JFYB 3O3AA 4UOW1 3VGEA 3HHSA 1JYVA 1F13A 3RHWK 1TQBC 2WIIA 5GS2H 5L9DH 1G7QB 3VXMB 1YUKB 5DMIH 3VO0A 1CG9A 3EGSB 4AGLA 3T0XA 2Y00A 3D18B 2F68X 4H1LH 3EH2A 4JZJB 3BAEL 2PW2A 4X5XA 5SV4A 3GRWH 15C8H 4R96B 1YNTF 3L2MA 3O6FC 3B3BA 4NRYB 3NCXA 2F19H 3C5SA 4IM8A 2BH0A 1Z3GH 2CBQA 4IRJA 5MI0C 3F58H 4L8SC 1FORH 1YECL 4R2GD 1D5IL 3TBBA 2FBJL 5BJTB 1ZPUA 3OMIB 4QY8B 4PXKA 1N26A 2FJHA 2FJSA 2GSIA 4NC0B 4RGNC 3QEQA 4DEWA 2HKFL 4MJ6B 4EUPH 5AW8B 3L3DB 1L0YA 5DD6B 4JJ5A 5IROD 1UCQA 4QDGA 2ZX8A 1H3GA 3E6FB 3TX4A 2EEAA 1MWOA 3CTTA 1UWGL 3L8QA 4FKHA 3JWDH 4CA4A 3VTTA 4Z5RA 2NQCA 5HDBE 4PJHE 5IMMB 4BWTA 2E59A 3BWAB 1AOHA 1X6LA 4WEBL 2HLFC 1TJHH 4L5FL 3VFSB 4WI7A 3VXQA 1HKLL 3P0GB 4CL7A 3GZPA 5D1ZA 3BIAX 5C0EB 1H9DA 1XTMA 3NN8B 3ULUH 2CHXA 5KVEL 1NC2A 5DFVC 3UYRH 3SDCA 4UOZA 2ID5A 4HETA 3K4ZA 1A3ZA 5DYSA 3E38A 4HD5A 4QXTA 2QHLA 1CPUA 3HBGA 4LLWB 3U1SL 2Y36L 4BA8A 1QZ1A 5DC4B 5DS8A 1KN2H 4MNHA 3TH2T 4CDGC 2D31A 2FECI 1Z9LA 2WWKT 4IRJC 4YDNA 1P1ZB 1NIBA 1WAEA 1KT2A 2B3IA 2FYYA 2R23B 4GQRA 4J4QA 4DKEL 3KPPB 5IJCC 4AG4H 5L88H 2VLKB 5E2VH 1N0XH 3EJSA 4MAYB 3OZ9L 3HAOA 2NT0A 4YUEH 5F0PB 2BHFA 3GXIA 5D5MB 3WUZA 3UBXA 5BO0D 5JA8B 4GW4B 4KK6C 4WUUA 1CWVA 1HEHC 4HMEA 4M4PA 5IVXF 2VAAB 4Y4KB 1HCFX 2BNRA 3DVNB 4Y5VB 2VDMB 4OM1H 3FCGA 2Q76B 3CVCA 3X1NA 4YHNA 3LV3B 4FLOA 2ZUXA 3IMUA 2QGCA 1WIOA 4JO2L 1IW9A 3QUYA 3GBML 1MCWW 2HPOA 5D1ZC 4E9SA 5BXFA 1QLEB 1WP6A 3JUYA 3MLXH 3IU4H 5DD1L 1OGSA 1HHIB 2BP8B 3SDCC 2F8IA 3TBWA 1JDAA 5I9QC 1UM5H 2H0PA 3X3BA 4HJJH 1G94A 4N22A 4NQXA 1AGFA 3O3DB 3U0WH 1CLOL 4HGKC 3T3MF 4HX1A 2YKLL 4N90D 2F5BL 2K6YA 2ICWB 3BZ4B 2KZKA 4OZFH 4P9HH 2BO0A 2HT2D 4XPAH 1ITCA 1N5AB 5E6UB 1GOHA 1HL8A 2DS4A 1NUNB 1WZMA 1IM3A 3QIBD 2ZSWB 2BXYA 4HZLB 4J6RL 4YHPB 4BINA 1G87A 3A67L 3L4UA 3UTZA 3W56A 5KBPA 3BUBA 4KXBA 3AU1A 3MUY1 5EBMB 4N2BA 3OAXA 2NX5A 1D7FA 1HILB 3DOIA 4NO5B 5DJZB 1KG9A 4C55A 2AANA 5DGRA 5HYJA 1RUPL 2VUKA 4UAOC 1SOKA 5D5MF 1CGYA 2GCYA 1H19A 3HHRB 1C1EH 3ATDA 5EOQH 3HR6A 4OV5A 3IDUA 4XI5D 5ID1B 1HL5A 3QUYC 1HH9B 1SBSH 5FUCC 2R2EA 3MZTA 4JPKL 4J3WA 4WW1A 3RIFK 4NQCA 1SJHA 3P2DA 4BYHA 2CXKA 4M6MH 3RIAK 5CINH 3LQAL 3BD5A 4XVTL 3MV11 4PRDB 4K3JL 2VDOH 1SZNA 2MEJB 3N43F 1RMFH 1A3RL 3QPQC 4YR6A 4DCQB 5EBWA 4NJAL 4EKXA 4RFOL 2I35A 5E5LA 4IGBB 1BVLA 3RVXC 4AM0A 4C8XA 4P4KD 2PTVA 4HH9B 1SY6A 2HJLB 1EHLL 5HHMB 3UBXG 5ESQA 5KSAB 2ED8A 2J6EA 1KTLB 1HYSD 5ICYB 1DE4A 1G9HA 2LT9A 4NNXA 3TJPA 1TZHB 2QBWA 5ITFA 4ZFOA 2O61B 1KOAA 4F37K 5IZ7A 1L9OA 2DWDB 3AB0B 5IQ7H 4ZSOA 3B5GA 2N59A 4NUQA 2AQSA 2TRYA 2XA8L 1YYML 3RDTA 2Q9OA 1JOIA 3DPDA 4NPYA 1AHWA 3Q1SH 2EXTA 3BHBB 2Y7OA 4HEMA 4PRID 1FYTA 1FZJA 4W4OC 1R5IA 4P5TB 3VXRD 4HWBL 5FOBB 1DEEB 1HNYA 4NXKA 4J5VA 1V54B 3LN4B 2WWMC 3FH8A 2BSTB 4LASH 3PGFL 2DIAA 4FTVE 2EUXA 1FBKA 3OKKB 4P07A 1BXUA 5HHPB 4B27A 1HYRC 1W6WA 2ZKHH 2Z93A 5D7JB 3VXSE 1F1DA 4JZNA 5FFOA 2QKSA 5ITBL 5DQDH 1B2WH 3ARBA 4UQ2B 3PWPA 2XN9D 1E9OB 3IN2A 3FFCE 2HRGA 3P4NB 1HS6A 2RAMA 5JORB 1JTPA 3GXTA 5C0FB 3UADA 3GSNH 3HASA 1E2ZA 3NIFB 1CI5A 1BZ9A 5AW1B 4J3XA 4M4RB 1NPJA 2HWZH 4FL4B 4MNQA 2BSBA 1R6VA 3Q2VA 3RJOA 3RUGE 3RL1B 1G7IB 5BVPL 3HI1B 3AY4C 2A1WH 2JI1A 2WBXA 1NLBL 2ZXAA 3TBTB 2CH8A 3D25B 4CU8A 2P8PA 3NIGB 3NRQA 1DDHB 1H3XA 4TNFA 4F9LA 3D09A 3A4AA 3A3YB 4Y4FA 1EERB 1S9YB 1M1XA 1N19A 1TEFA 3BSGA 4JHWL 4K5NA 3RDTC 1DDTA 2XVKA 2Z1PA 2OMNA 3FU3A 3ENEA 3M1BB 4Z3EA 3FK3A 3ECUA 4Y2OB 4PVLA 4B5ZA 2FO4A 2VL5B 4O2CA 2XSKA 2A6KA 1PZAA 3LPOA 1UZ8A 3U2JA 3WTWA 2ERJC 3EMLA 2OA9A 1MJJA 4U6HA 4OLXL 1BM7A 1INDL 1K6QL 3CXDH 1PGRB 1R47A 5BUGA 5JHLL 3KLLA 1K5NA 1SQMA 4G71B 1AMYA 2CDEB 3ARBC 1RFDH 1WHOA 3QEUB 2V7NA 4NCC1 3U2IA 5L8KB 2J4WL 4QKTA 4Z7OB 2AI0H 5H4YA 5K39B 3ZIYA 6PAZA 4TLUA 2FATL 2V2WB 2DDQL 3KPTA 1MLCA 3UTVA 1MQ8A 3SKOB 1EXHA 1E4WH 3IWVA 3WY4A 4KJPC 3DIFB 1NINA 5HJBA 4TQ8A 5IOPB 5LCVH 1CICA 2DWEA 3SQBA 5DJ2A 2ZJSH 4F15B 5G5DB 5GSRB 3NIFF 2BVQB 1MKFA 1BYPA 2JB6B 5D1ZD 4F9LC 4Z0XB 2W94A 2NNAB 3L4WA 4Y4FC 3OLIA 3DX0A 3D4CA 2XRAH 3O2DL 1C16B 2AXHA 2XBDA 5DA0B 3N5AA 3QCTH 4PY8I 1A9BB 5HTSA 5IKCB 5MEOA 2D7NA 3RX7A 1RZJH 3QO1B 4EQ3A 5MHSE 5AHYA 1P7KA 2EDLA 4X7TA 5J9PB 2QEJA 4EZMA 2WC7A 1HL9A 4LSQL 4J4PA 1EJ6A 4G43B 3CCHB 1NCGA 1V27A 3L9BA 3PJLA 4FFWD 2D7TL 1YEDB 4KJQD 1HWHB 4Z7UF 5AVVB 5LGYA 3V5KB 2JCCE 2WNXA 4WUUD 3LKNB 1LEIB 4XT3A 1DFBL 3SBQA 5H2NA 1KB3A 4KXAA 3QUHA 1MCBA 4HUWA 4O58H 2F74A 1KIQA 2BNRD 2VXSH 4WEMB 3ZTNL 3IJEA 1DQVA 3D51A 5JXEC 3FU5A 3H9SD 4ZUVA 1CICC 5E6IB 4Z7OF 1ZDSA 5KVGL 2FSDA 4JDZA 3RTQC 1U8HA 4B9CA 4JY4A 2WVVB 1CF8L 2DL9A 1FN4B 1XGYL 5GIRA 2H2SD 3B2VL 3F65A 4OCMC 5E99H 2VDPL 2L04A 3BGFC 4YVUA 3BQVA 4YXKH 3FONA 4OFDA 5AG9A 3GBDA 4HCRH 1O75A 2XKSA 3IXAA 4S2SB 4LSRH 5SWZE 4KNUA 2GIXA 4U1GB 4NZJA 2KMWA 2JIXA 1XF2A 5E94B 3ZLQC 4GG8B 4BUGA 2K3HA 1XAKA 2YQBA 4RBPH 3RVXD 3QBLA 3QJQB 4WKZA 1BZ7A 2HJFB 12E8L 4ERSH 4ZUSA 1WWWX 4GBXC 3PGDA 4J4PC 4QTFA 4N8CH 4ABQA 1I8KB 1JHLH 3NQIA 4HJSA 3U7YL 4HJ0C 1IM3D 2LU3A 2WXFA 1JRHI 4BFRA 1EZUA 3FB6B 3ZDXB 4HS8L 3ABLB 1BWMA 3NSCA 1BIIB 3FQWA 4YH6A 2NX5D 1L9PA 4NZTL 3UEZA 1EO7A 3FH5A 1NBYA 5DJ6B 3STZA 1EGJL 4JFTA 2JK5A 5HYJD 2B14A 3TF7C 4WI5A 1ZV2A 3PUUA 2OK0H 4LEEA 1PYWB 1ACYH 2YFNA 1LEGA 5GS3A 4MAUL 5DZAA 4I18B 4Q9RL 2BX5A 3HE7C 1QSFE 3D0VA 3FO1A 1F5WA 1G9NL 5DHVB 2ZF9A 5IMKA 1R4XA 4OUUB 3ULVC 3EYVA 2KT6A 3DIVA 4YSDA 3WKQA 2HX9A 2R51A 1K4CB 4CMHC 3U4BL 4NM4L 3DRTA 2CO2A 4FQXA 2V5RA 5FM5O 4R8WL 3ZGHA 1CMOA 4G42B 4F2ME 4L37A 2G0KA 2OTUB 2V33A 5I30H 2IH3B 2ZOKA 4Q0XH 1KNOB 2VZ1A 3WS3A 2WW8A 4Z78A 1WT5A 1AY1L 4HYTB 2PCPA 2RALA 4OGAC 5JIKA 2OM5A 4IBYA 4W4NA 1TIUA 4OCWL 2WUBL 1YRKA 2VDKH 1BFSA 1NQBA 3IS0X 3KXFB 4ODXA 4OGYL 5FYKH 2P24B 4M5YH 3RFZA 2P8LA 2I25N 1TLMA 4RESB 2WKOF 3MGOB 1YY8A 4HD9A 3WHXB 5KVFH 5DQ9B 1HSBB 1ZAGA 3LTVA 1PAMA 4JFYA 2JJUA 1QFUH 1PY0A 2CKBH 2QL1A 3AQXA 5IT2H 3V4PB 1DVFA 1CU4L 1FYTD 1NLDH 5CP3H 4G6KL 4PJIA 3VXMA 3ZDXF 4BH8B 3EH1A 5CLTA 5EOCJ 3EGSA 3ARDC 5IQNA 3BAXA 1JK8B 1M53A 3D18A 1DUYB 1XSIA 2C9PA 1SJXA 2YOAA 2MQGA 3HRPA 3LIZL 5J1AA 3OPUA 5L6YL 4TOYH 4UIKH 5AZDA 5DJ0B 4V33A 5FYKU 3ARBD 4PVMA 3PWPD 2CLZA 4CUCA 4U1JB 2B1HH 1JZ3A 3GZOA 3I6LD 4FQXC 4NRYA 3CVBA 4K9EH 2PTUA 1UENA 3IDYC 5FHBL 5K33A 5T3XH 3MRRB 4DN4H 3LNDA 4MJID 3NSYA 4OFIA 1UM4H 2EO1A 5AZUA 2FVNA 4KJPD 2IDFA 3O3EB 4MNQD 4X31A 3QPXL 2Q7YB 2XPGA 4MJ6A 2CAKA 2Q3ZA 3PHAA 1IW6A 3L3DA 4NZUH 5DD6A 4AGPA 5BRZB 1LL1A 2VXQL 4LHUA 4B95C 2A0LC 2F7QA 3E6FA 4IHOB 2BSEA 3EYUL 3HB3B 3RFZC 3QUZD 5F8QC 4PY7B 4Y4FD 1YG9A 4XMZA 4JGUA 5LBGA 5IMMA 3VA6A 1ETJA 3BWAA 3TEUA 3Q0HA 3CZSA 1PD0A 3VFSA 1DVFC 2KPWA 3P0GA 1INEL 5C0EA 1UFGA 5FDYA 4XBMA 4ZFQA 5HSFA 3GFUA 4M43L 2IWFA 3F8UB 5I8OH 1FRGH 2GUOB 1R3LA 1PXRA 5A7EA 5KJRH 1KLUB 5E0QA 2YRBA 4MJJA 1JVKA 1RXLA 4LLWA 1S9XB 4LL4A 3LN5B 4NRXB 2B2XL 3HG4A 5FCUH 1UJ3B 1J9SA 4O9HH 4RRPM 1KCSH 3DGDA 3S0PA 3L2NA 4HIXL 1P1ZA 3BSHA 5C92A 2CD0A 2R23A 2IBGA 4GRWB 1M7DA 3MFFB 3KPPA 1XL4A 3FTYA 1A9EB 2VLKA 3LDBC 1O7DE 1TTBA 3O2VH 1PS3A 3KPRE 5IVOA 5D5MA 4J2XA 1A64A 4GW4A 2A6JA 2JB5L 4YEEA 5JQ6L 1QFWM 2VAAA 4Y4KA 2DWYA 3CX5K 2KZBA 2WZAA 4AM0Q 1A21A 3DVNA 3V6FB 3BAEH 3C5ZB 4JQIA 4OLWL 4HS3A 3O0LA 2R8SL 4B9FA 1W15A 2Q76A 1F02I 1J0JA 1RUAL 4KGLA 3LV3A 1ETA1 1EDHA 2WKGA 4JRYD 4N0UB 2N1KA 2HG5B 3ULAB 1JI2A 3CUPA 1YECH 4X6DE 2HAZA 3IDNB 2FBJH 4IMLB 1BAWA 3QAZC 1HHIA 2J1KA 4UT6L 5F3HA 3HG3A 4J4PD 2XN1A 5GGTA 4AZ8B 1ECZA 2BIQA 2HKFH 2VR6A 2VDNB 4CKQA 5I5IA 4YSQA 3O3DA 1U93B 2YCZA 1UWFA 3BZFB 5DHHA 1YN7B 1UWGH 1WISA 4O02L 3BZ4A 1OSZB 3CFBB 1OE1A 1MFBL 4MQXD 4LHUG 5CZXC 1TZGL 7TAAA 4BEIA 4HQQL 1ZK9A 4WEBH 1GYUA 2Y06L 3VXTB 3ZR5A 4YHPA 4ANWA 2E8YA 1HKLH 3G6JE 1XZ0B 2N01B 2VW6A 4XNUL 4XNDA 3I6SA 3MVSA 4GRWF 3UP6A 5KVEH 5E5UB 3ULVD 2EADA 1HILA 4L29A 5DJZA 4AH2B 5E8PA 1GVIA 1TETL 5HI3C 1NBZA 2ARJB 4K23H 3WIIL 4D0BB 5GS0L 3LNHA 3U1SH 2Y36H 1J9TA 3EFDL 2LOEA 3WQJA 5ID1A 4QGYA 3IPEA 2JIXD 3ZK0A 3D3VD 5C1MB 4MQ7B 1HH9A 3FS9A 5D2LE 3SY0B 4DZBB 2XT1B 3BW9B 2DMGA 4J39A 3CN4A 4RBPK 2IO5A 1UG9A 3S3CB 1TT6A 4OGAD 4DKEH 1QNIA 1J05B 4PRDA 2W59A 2GT9A 5AB2A 3OZ9H 4KJWC 4DCQA 4PCTA 1BXVA 5E6ZA 4M62L 3VFMB 2H8PB 3S35L 4IGBA 1R24B 2FH8A 4HH9A 5D7IB 3QB7C 4W6XB 5KSAA 2G30A 4EZKA 5ICYA 3RKPA 1MNUL 3WO3B 1W9XA 4EEEA 4YSAA 1TZHA 4S1DD 1USZA 2YK1L 2O61A 1HAUA 5ANME 1ZKAA 4DP8X 1CFMA 2DWDA 3HNTL 4FQPA 1QFWL 4JO2H 1L6ZA 2ZUQB 3EJJX 3GBMH 4K07A 5CNHA 4UDUB 1QWUA 4WW2B 3SGEH 1Q5JA 1Q38A 2IFGA 4A67A 4PWKA 5DD1H 2O6CA 3ZRCC 3JWOL 3BHBA 5CLZA 1CXHA 5HGDB 3CFJB 5G55A 5I0DA 3QZWB 1J10A 2J8UF 4M7LT 5FOBA 1QM8A 1CLOH 4IDLA 3RNKA 3FUDA 2BSTA 5D1QE 4PW4A 3OKKA 3EYQC 2YKLH 1E43A 4Y19E 2F5BH 5D7JA 3B34A 4GT0A 2X3BA 1GA2A 4JRLA 1ICTA 4UQ2A 1MH5A 5DU7A 1QEXA 1MCDA 3H55A 1T2XA 3LB6D 4J6RH 1VEMA 5JORA 1IGMH 2H0FA 5C0FA 1RZIB 3A67H 1B9ZA 2XG4B 1F58L 4IGBC 1X9UA 3OR7B 1QSVA 1EHNA 3BSZL 4M4RA 2WV3A 4JQVA 3CE1A 4KKLC 3QDGB 1RUPH 1G7IA 3BN9C 5E4EC 3RL1A 5KSAC 2R1WB 3HI1A 4L3EB 2HTKD 2W0FB 4DW2L 2WLKA 3LH8A 3ULUE 3E6HB 5C08D 3TBTA 3VXMD 3V6OA 3D25A 5IY5B 2KS9A 3AB0C 3DXAB 1S9YA 5F71A 1NMAL 4JPKH 4HW6A 4JL2A 3EDFA 3FO0L 1X4ZA 2VW4A 3LQAH 4UTAA 4XVTH 4D0DB 4Y2DB 4Y2OA 1H8SA 1HCVA 2YXVA 5CN1A 4K3JH 4U2ZA 1HT6A 2AVFA 1A3RH 5IMOB 3QE5A 4WW2F 4NJAH 2R2BA 4RFOH 2V6HA 4ES9A 4F7EA 4YLCA 4ODWA 3GMLB 2ZXEB 3GHPA 1IEAB 1EHLH 5T1JA 1OCRB 5BS0E 3KWXA 1FVEB 3QEUA 1OGTB 2ZAHA 4TSBL 1RVFL 4JEGB 2XWTB 3DUUB 4GUPA 5E8OB 4AV4A 2P5WB 3K5RA 5K39A 4F9PA 2BIIA 2BSED 1EO8L 2V2WA 4ZUWB 3TYGL 4YSEA 4JPQA 2Y5EA 4LL1A 4A2LA 2XA8H 3SKOA 1YYMH 2ED6A 2CJTA 5I1CL 4JFZL 1T7XA 1BQUA 3DIFA 4FL4C 4OF3A 5AG8A 4LP4A 5IOPA 2GKIA 4W9HC 3PPSA 5G5DA 1UEMA 4OTXL 4LKCA 3EKCA 4HWBH 1JXKA 2BVQA 2K1MA 3V6OC 4MWFA 4OLZL 3PGFH 4Z0XA 1WA1X 3WSQL 1Y18A 5CP7A 2NNAA 1Y07A 4JFHD 3KJ4B 2DLFL 43CAB 5ITBH 1C16A 5HHOB 3DV6B 2R4SL 4QYAA 1A9BA 5IKCA 3KPMA 1FL6B 3QO1A 5I8KL 3WG7B 4P2QB 3AWEA 5GHWL 4X9FA 4XMVA 5ECGA 3UAJC 2UV3A 4WRLA 1TYEB 4QRFA 5J9PA 3BZDA 1PVHA 3NZ8B 4FMVA 3OQRA 4KBPA 4PJFB 1QBLL 4UQDA 3CCHA 2J73A 3G04B 5BVPH 1NZRA 2VLKD 3P54A 1YEDA 4YFLI 4MAYD 2APFA 4XN1A 1JZ2A 3LRMA 1NLBH 3V5KA 2EE6A 2WINB 3WMSA 4F80A 5HD8D 3R0MA 3LKNA 4PPTA 3P3TA 1LEIA 2DWXA 4F9PC 2FEDC 4Y4KD 3TIEB 2MQ3A 5L4JA 4JHWH 3P0VL 1OKEA 5HI3D 4DIXA 4WO4C 1W0VB 2EUZA 4PJCE 5E6IA 1KLFB 2ATKA 1DANT 2J8OA 3L45A 1F4XL 3MBEB 4QAMB 2WVVA 4LOFA 4TYUA 1FN4A 4H8QA 4XP4L 4FFVD 1Q72L 5GRUH 4OLXH 4LPWA 1INDH 1K6QH 2PWGA 1XB8A 5JHLH 3V7AG 2K0RA 5DRZB 4A7QA 2VC2L 5FW6A 3RY4A 1Q5IA 1IC5L 4HK3J 5LAPA 5E1AB 4QXWA 1UXMA 4KJWD 1DUZB 1OLLA 2BP5M 3V0GA 3VDCA 4BFGA 3D1MC 3OR6B 2J4WH 2DQMA 1NCCL 2Q7AA 3DTXB 4WW3A 3O8XA 4YN3A 2FATH 3FTWA 2DDQH 3HZKA 2QQKL 5D7EA 2DMKA 1IIKA 3DMMB 5DSCB 2HJFA 2DKSA 1HHJB 1YYCA 2MQCA 4FFZA 3ZT7A 1FF5A 1XD0A 5EUOB 3HPJA 2YD5A 4KVPA 4AGNA 4YJZL 4XMUA 1U33A 3IDXH 3ARGB 4YGVB 2EDTA 3FB6A 4HFWB 5CD5C 4H8VA 4PJFF 1D5RA 3PABB 2VQ1B 5KSUB 4QHLA 2VRKA 4OJEH 1E27B 3O2DH 3TC9A 2QKIB 3SPIA 1T6BX 1U30A 2AHIA 1UTDA 4OFPA 4JPSA 3FOLA 5DVNA 5E6IC 5F88B 2EI4A 4Q2ZA 5DEFB 2IAMB 4I18A 2YGOA 4LNVA 4Z7WE 4JQXA 1Z7JA 4OUUA 4HZAA 3ML9A 1EJ8A 3W11C 1P84K 1K4CA 4LSQH 4PJAF 5KOMC 4J8RB 2NY1C 2D7TH 1VGKB 2DKUA 5D6CB 4U1GC 4DO5A 3N0AA 4WWNA 4HCIA 1WUZA 2EDMA 4B53A 4DKFL 1DFBH 1KNOA 3NCCB 4IGBD 2MNUA 4UF7C 3O8XC 3QDCA 3DGGB 5HHMD 2FR4B 5M7QA 3BN9D 3V4UL 1GGBL 3ZTNH 4XNYL 4KNTA 4IBSA 4Y1AB 5KVGH 2N0MA 2YMTA 3KXFA 4HOXA 4ABVA 2ODIA 3D39B 1X9QA 1CF8H 1KYOJ 1T1WA 1UD4A 1XGYH 2P24A 4WFHE 4BZ1A 5GPRA 1GZHA 4KHTL 2VDPH 4HJGB 5DQ9A 1HSBA 4HWNA 3TGXA 5I73C 2OQJB 3CQFA 2XTLA 1JXGA 2DL2A 5EUOF 1WFTA 4JKKA 4FEMA 4D0CB 5LGKA 1R5WB 4OF6A 3NJIA 5D1XC 3KLHD 4L4VD 1QI5A 4XGZA 3V4PA 2ZOWA 4BH8A 5EFIA 1AGEB 1JZFA 1MI5B 3APDA 4P5TD 4V2BA 1JV5A 4I18C 1AGDB 4JM2B 5AW5B 4Z7NB 4JQXC 1WD8A 2OYMA 1QRNB 5D7JD 4Y9BA 3X3GL 3I3EA 12E8H 4NQEB 3D33A 5DJ0A 4I48B 5C6TL 4U1JA 4WQOA 3FF7A 1U4EA 3U7YH 5T1MB 5FWRA 3BKYL 3FB7B 2AJSL 3MRRA 4AIXA 2NMSA 4HS8H 5FHAL 3AC0A 4NZTH 2UXVA 4WGKA 3O3EA 4EF3A 1EGJH 2C1OB 3GMOA 1E8WA 5C0IB 4HAFA 5JLZB 5BRZA 3ILEA 1QO3A 4JFEE 4W9IC 2BK8A 2J6EL 4RLDA 4ATTA 2F58L 4IHOA 4MAUH 2Y7QB 1HU8A 4B3EA 4L8CB 1G9NH 3L7EB 3ZE2F 1GZHC 2X4TB 3QWOB 3UTWA 5T1KB 4RDBA 1BPLB 3ELQA 1WFJA 5KSVB 4GKZB 1N59B 4FCAA 3QBIA 3U4BH 3BVTA 4NM4H 1GCYA 1UGNA 2OZ4L 1P7HL 2E9GA 2E7CA 5EU7E 2J88L 1EZVX 4JKMA 4LLDB 4R8WH 4XWGL 3BXNB 3TV3L 1KWGA 4K5MA 2NY4C 3MLUL 1CL7I 1OT2A 3RWFB 2ZP8A 4CSZA 2GUOA 3KVDD 1KLUA 1AY1H 5EO9B 3DX9A 1S9XA 5CJXA 3LN5A 4NRXA 4U3XA 2WUBH 3Q8AA 3K5SA 4OGYH 4KRPB 1MCPL 1TMCB 4J6IA 1FFTB 2XQ0A 3OB0H 1T2QL 4RDQG 3MFFA 1SXAA 4FADA 4PJ7B 1A9EA 5C0DB 2EZ0C 1NBVL 3LZOA 4KXDA 1AVAA 4P05A 1JP5A 5C9JB 4G6KH 1ZLDA 1N6VA 4LT7A 2OXHA 3PCYA 3TJEL 3RVWC 1QR4A 1G5AA 3HB3C 2X3CA 1HNFA 4CAGA 1Q9LB 2F0CA 3V6FA 5IIEB 3C5ZA 1BCIA 1JGLL 3E8VA 3GDCA 3LIZH 4POUB 3D08A 5L6YH 1Y1UA 3ZKMD 1EFQA 2VIRB 4PJEB 5JHDA 4HJ1A 1KY7A 4FD0A 1LO0L 1YPZB 4N0UA 3QRLA 4MLIA 3RZEA 3UJIL 4O5LL 2HG5A 5FHBH 4LVHC 4U4BA 2NTFB 1AKJB 3F12A 2ITDA 5CBEB 4B9IA 3IDNA 3LPWA 2VMFA 4IEFA 4BSVB 3KGRA 1SM3L 3L5WB 3QPXH 3U9UB 2E0PA 1EBPA 1L9MA 3TTSA 5CJXC 3PL6A 1T83A 2VXQH 4JREC 3IDJA 1U93A 2VWEC 3HI6L 5EA0L 1U8OB 2ADJA 1YMMB 2DYSB 3BZFA 3ZKNC 3EYUH 3BVWA 1WGVA 3CFBA 3CDZB 3QUXB 5DMJB 3SPCA 3NP4A 1OALA 3IPFA 5T5NF 3MRLA 3NQKA 3FYIB 4CBPA 1JE6A 2DQDL 1DVTA 2CHNA 2OR7A 3DVIA 3GTVA 4NUMA 4P2RA 5EZPA 3VXTA 1CD9B 1D2OA 1INEH 4NOFA 3B7YA 5JW4R 5CCGE 4ZMPA 2IQAB 4XOEA 1VF5C 4M43H 5FK9B 4R84A 2XX0A 3C5ZC 2FLMA 1T7WA 4AJYV 4D0BA 1AG0A 4M48L 4XO5A 4D3CL 3WN6A 1VKXB 2B2XH 3MNMA 4HG4K 4YSRA 3KDMA 4B7IA 5C1MA 1Y6MR 2YAPA 4MQ7A 3SY0A 2ZYHA 2JKLA 3K6IA 4HIXH 5E0FA 1OGAE 3KGTA 1T7ZA 2BFGA 2NY0C 3HN8A 4OQ1A 4TPRL 4PJEF 5ALCL 3LMJL 5FYKE 2NYYD 2DQ6A 2FJGB 2H4EA 2ITEA 1FAIL 3H1ZA 4X5WB 3PL6C 3DNKA 1T83C 3VFMA 4GSRA 4MNGA 2YFOA 1EO5A 3CAFA 2JB5H 4G7RB 5HHNB 4HWZB 5JQ6H 4KKRA 1GUEA 1J48A 4KI5E 3SOBH 5D7IA 2V0AA 4OLWH 1AO7E 1AJ7L 1ZWIB 2R8SH 2L7JA 3NFSL 1RUAH 4FHBD 4H8WC 5AAMA 4BFIA 3CSYA 1BBDL 2AXFB 3T71A 3MV8B 5AVRB 3LVTA 1GGUA 1HZKA 2IPUG 1AOZA 1VCBC 2BZ7A 4UT6H 1QQDB 3ULVL 1Z32X 5T3XE 2FLBT 4Q8BA 4PJGB 3CFJA 5HGDA 3HMWL 2AEWA 4HYXA 4XMKL 2F08A 4F8LA 3J27A 2MTPA 3HUJE 1FQ9C 1AYRA 3SDXE 4MQTB 1I8UA 1T4KB 3OE8A 4O02H 4XVUC 1MFBH 1IXFA 5EF2A 4X5LA 2LNLA 3ABWA 1GOGA 1TZGH 5F1KC 3GIVA 4HUUB 4HQQH 1ZT7B 4GS7C 2Y06H 3SO3B 2AEOA 3A21A 4IKIA 3KXFD 3ZKXB 3B2PA 2XKUA 3EIFA 4O2EB 1CB4A 1BOGB 1BZQK 1CIUA 2ZQKA 3CDFA 3OR7A 3QDMA 4MJ4A 2OS7A 4GO8A 1F97A 1NCTA 3UROR 1TETH 2R1WA 3WIIH 8CGTA 3INUL 5GS0H 4L3EA 2JKWA 2W0FA 4Z6AT 5EEVA 3PNRB 2ROYA 3EFDH 2GJJA 4X6EB 4ANKA 4YHOL 3T6VA 1M7IA 1TLKA 1FDLL 4X4KA 3IVKB 3DXAA 3REWB 4GLRH 1BQHB 3C60B 2A99A 2X6AA 2B08A 3QH3A 5TE7H 4WI8A 1KDJA 2P28B 4HUMB 1TVBB 3BAWA 3U7WL 3WDHA 4D0DA 2D9CA 4KV5F 7FABL 2Y72A 5FGCE 3QS3A 4YX2L 3WTSA 3DC0A 4M1CC 4M00A 4WI9A 5MENB 3B56A 3UCQA 4M62H 4ELMB 3Q9QA 3V6BR 3U2SB 1KULA 3N0PB 1NKRA 3GMLA 3S35H 1YAIA 1M2OA 3ZPRA 1E7UA 1IEAA 1ZK5A 1IBDA 2GJ6B 5IVXE 4RFEB 1MNUH 1FVEA 2OXGB 3LKPB 5I2IA 4ZBJA 2QADC 2WCGA 2YK1H 2XWTA 3HNTH 1BJMA 1QFWH 1MXDA 1S7QB 4FG6C 3DIDA 4ZT1A 4ZUWA 3T65B 2FEEI 2F7OA 1ZA6B 1U6AL 1JZHA 1X5IA 5B7EA 5SWQB 5AOJA 5FXCH 1Q0EA 3D50A 1NGYA 3ARUA 3BLBA 1KLGB 2EACA 5J7CC 2QVFB 2NNXA 3FN3A 4HJEA 1BEYL 1TO5A 2WO3B 3EGDB 4E9WA 4Y7OC 1NMBL 1OZUA 5D4IA 2GY7B 3L9YA 4YPGA 3BYTA 43CAA 1J8HB 3T3ME 4WTXA 4BQ6A 2EICA 5HHOA 3ZHFA 4GG6A 2NXZC 1FL6A 1YUHA 4ETYA 3LEVL 5D7SH 4PREB 3FPXA 3ZSSA 4G8GA 5A2CA 3PY9A 1M0MA 2NDGA 3NZ8A 3BSZH 1UHVA 3FQUB 3OB0K 4QRPE 1KGCD 2FTAA 1AP9A 3G04A 3TJHC 3WO4B 2YKKA 5LB1A 3QW9A 4TNGA 4DW2H 5KVEE 4ZS6D 3IDMA 2WINA 1UT9A 2P26A 4JFPB 5H94B 3RWEB 3T3PF 3VE0B 1NCHA 1KJ3L 2DEWX 4DOHE 4PMEA 3ME0A 4JBSA 4D94A 3V4LA 1QPXA 1ZT4A 1NMAH 4PB9L 3C5ZD 4BK8A 3FO0H 1SLUA 5C3IA 3AWGA 4PP2B 3UG5A 4J3TA 2X70B 2CJUL 1W0VA 4NQDE 5E5RB 4XWOC 3MBEA 1I9EA 2WXMA 1GSKA 2WXRA 3ZL4L 1FSKC 3V10A 3W9EA 4CGTA 1IBFA 3JV0A 4IRSA 3HN3A 5DRZA 2FDBP 4U1NB 2BRQA 4NQVA 5E1AA 5I1AB 1VZHA 2YZ1A 1RZ7L 1V3LA 1NEZG 4OLVL 4QNPF 4TSBH 4B7LA 3BZ5A 1MDTA 4BE5A 5L7XL 3DTXA 1H5BB 2IANE 2QJDA 3TYGH 1EO8H 3DMMA 5DSCA 2E9IA 5I1CH 1HHJA 4JFZH 3GSRB 4HYJA 3VRLF 4KRMB 3SYCA 5EUOA 3FHAA 4YC2C 4M29A 4OTXH 1FNLA 3ARGA 1VEPA 3EBHA 4YGVA 4NDMB 1X5YA 4IIQB 4HFWA 4OLZH 1FO0B 3PABA 2VQ1A 3QJXA 4WDIB 3WSQH 4KOCA 4KX8A 1URLA 3KR3L 4MA7L 2DLFH 5IFJB 3WN5A 1TPXB 1E27A 2M3GA 2QKIA 3O81A 1YDPB 3QP3A 2R4SH 4Y9EA 3BVUA 4JQIL 1UOKA 1LEKB 2VLRD 3MBEC 2IAMA 3A4EA 4U6YA 2YA1A 5GHWH 5IGXL 2CK2A 5FUZL 3L16A 4XVUD 4HIJB 5ITCA 1L7TL 3OMAB 3QFJA 1TQSA 4IRSC 1CLCA 4OZGF 3II3A 3WNMA 5H37A 3UTPE 1QBLH 4J8RA 1I9IL 4LPXA 4AITA 3QSKB 1VGKA 1ILUA 1IBBA 3C6LB 5ABZA 4KTDL 4FJZA 5GGTL 1DFXA 4XCEB 1VDGA 3QRBA 1EV2E 5AW9B 3S34L 1GIGL 3DGGA 1JF5A 3HLAB 2OCFD 5FGSA 2F7IA 2FR4A 3P0VH 1WWCA 4FQ2L 5CGTA 3H6AA 3DURA 1H3WM 4OZHE 4C58B 2VABB 4V1DE 2MHAB 3D05A 1WZKA 1IE4A 2X88A 5JIIA 1F4XH 2BOLA 3ARGC 4N68A 3UO8B 4XP4H 1Q72H 1TOXA 3PG2A 1PLGL 3FUHA 2OQJA 3MV9E 5E6SB 1G7PA 3C75A 5ABAA 3MX0A 2ZXBA 3S8FB 2VC2H 3WN5C 1R5WA 1IC5H 5I74C 1UWEL 4B50A 2Y6SC 2QKIC 4A6YL 3QO0B 4XBGA 4LCYB 4JAMB 1AGEA 1MI5A 2GJZA 4N2FA 3FO2B 2IAMC 4JM2A 1AGDA 3SQRA 1NCCH 5ES4B 2PYEE 4NKQB 3P77B 1QRNA 4MDRA 2QQKH 4N2KA 3MYZA 2XZZA 3OHXB 3KPOB 4EO5A 1GKOA 3HW7A 3MRIA 2IV9A 4I48A 4IRZA 3Q06A 3UXFA 1AZCA 3AM8C 5T1MA 3ZXAC 2X09A 3FB7A 2IBBA 4MASA 3EJTA 3SGEI 4HOZA 4LP8A 2BSRB 4U7SA 4FG6D 1CGSL 2LR4A 5EN2B 5JUEL 1MAML 1RIUL 4G8IA 3Q13A 3A24A 3EJZC 4M93C 1X5HA 4Y5YB 2C1OA 3QDGD 5JLZA 3OPZL 2GBTA 4LAQL 4L3ED 4YIQA 2CM6A 4AK1A 5J8OA 2DD8L 2YR3A 5E2WL 3IKKA 2KS0A 4ZX5A 2Y7QA 4NKOA 4LXFA 1AHMA 1Y1DA 4L8CA 2E4TA 2Y2WA 3BUQA 3DXAD 2X4TA 3SD2A 5T1KA 3TFBA 4C54A 2GB2A 4GKZA 1N59A 4BK5A 1E4KA 1TR7A 4Y2DD 5DZNA 4FZEL 1N3NB 1ZGLM 3E0GA 2QDVA 3JTTB 4LLDA 4MX7B 3GMRA 5H37G 5TK4A 3VJ6B 3RWFA 4JM2C 4BRVA 2LU5A 4DKFH 3CWGA 2PLTA 1GGYA 4W9EC 5F0LB 1F86A 3K4AA 4HULB 3GBEA 3QEGL 3V4UH 5EO9A 1GGBH 5ADPL 1MCHA 4XNYH 4P23A 3NSBA 3OKDA 3K80A 2O6PA 1XVSA 4HKBB 3SE9L 5EU6B 2P5WD 3ZTDC 1WFOA 3S7GA 2AF2A 4N6RA 5SWSB 1RSYA 3DJRA 4FNUA 2DMCA 4KHTH 3UZEA 3SBRA 4NQUA 2AZUA 1G0DA 4FFYL 2DWTA 4PJ7A 3HANA 5C0DA 3N9GL 5HXMA 4XWOD 1IVLA 5C9JA 4PQXA 3GJEB 5E6YA 5EC2A 1RK7A 2CMRL 5LHDA 1BOYA 1C7TA 1Q9LA 1GMEA 5F1NB 3RG1C 5IIEA 5KSBB 3SOBL 3X3GH 3I3BA 1YMHB 5HHOD 2VIRA 1CYWA 5C6TH 3N85H 4PJEA 3I85A 3IJHB 4TUUA 1E4KC 4BK5C 4PVBA 1QLFA 1YPZA 1EHXA 5K9OA 1S78C 3BKYH 4P2QD 3VTAA 4RISL 4YHIB 2X2JA 4GMSL 2AJSH 1T89A 2K45A 5HDOA 1AKJA 4R97C 4BZ2A 4R4FL 5CBEA 4BSVA 1MEXL 4PGDB 3UGXA 3U9UA 1OO2A 3TCTA 4P23C 2HVKB 2GK0B 4UQCA 1JNLL 2J6EH 3RVUD 3SKNB 2F58H 1R2NA 1U8OA 4ZW6A 5AALA 5IQMA 1YMMA 4KRPC 1DN0B 5CCKL 3BIBX 1A22B 1T1XB 5DCCA 2VM4A 3NCYS 4ZX6A 3CDZA 2WY3B 2XIBA 3GZQA 3QUXA 4GO6B 4I13B 5BUAA 3CHSA 3A0OA 3FSWA 2F53B 3VW7A 2VE6B 2OZ4H 4HC1A 1KBVA 3HCVB 4AW4A 2J88H 3MBED 4XWGH 3IMWA 3TV3H 2I1XA 3MLUH 2IQAA 3MNWB 5IB5B 4JRXE 4NFBA 4L1TA 4XN8A 4ZOBA 5FK9A 1PL3A 1J8RA 4XNQA 4RX4A 4ZNCD 3L4YA 1XGUB 3OGCB 4DNLA 1RZKC 1ACXA 1H8NA 1VKXA 4YFEA 2QFRA 4OIIL 4PBVC 5F7AA 1MCPH 4PUBL 5KSBF 1T89C 3BESR 2O5ZL 3V9FA 2AGJL 5KVGE 3DMMD 1T2QH 4P3CL 2RD0A 3BMVA 2BNQE 2PR4L 3K72B 1LO3H 3NTCL 3TA3B 2YWYA 2BM3A 2FJGA 1NBVH 1NAML 5IJVA 3T4YB 3WFZA 1XCQB 2YPKB 3UERA 2WSPA 3AZUA 4NI6A 3TJEH 3KPSE 5HHNA 4HU2A 1IBGL 4HWZA 1VESA 1WQVT 2I7SA 1UA6L 3MRPB 4U1MB 1R19A 3WXVL 2EVJA 3VI3E 1I4FB 4W9DC 1JGLH 3ECBB 2DYPB 3DX2A 2D2OA 3OKEB 4PSPA 1KGXA 4XAKD 1AD9B 5DTFB 2OW7A 1HXYB 1LO0H 2JJTA 3TN0A 1Q4NX 2AXFA 3UCRA 1O6SA 3MV8A 5GGVY 4O5LH 2DQUL 3UJIH 3NBNA 4PAZA 3RX8A 1QR1B 4FNTA 4YDLB 2CR6A 2EQDA 1V05A 1QQDA 1IFGA 2Y07L 5F3BB 4HS6B 4N5ED 4PJGA 2YDOA 1JUFA 2YAEA 2WZPA 1R9FA 1A4JA 2KC0A 4ZDHA 4JS7A 3HI6H 5EA0H 3RBSA 4MQTA 1WA2X 2VDQB 3DX7B 4N3UA 3ZOAA 4R26L 4Y89A 4W9CC 2GTWB 1RIHH 3ZGIA 1RLWA 1U92B 1N6UA 2C9XA 3AQZA 1GH7A 4WVRA 3LEYL 1E5CA 4Y1AD 1JNHA 1XGZA 1ZT7A 2FUQA 1T3FB 2DQDH 4X9YA 4FFZL 2R0WL 3LOWA 3D39D 4DP2X 4DQAA 4XBEL 2WXLA 3K6SB 2ZG2A 1J1PL 4O2EA 1BOGA 1MN4A 4R5TA 2D3NA 3W39A 4G6JL 4I7ZC 2R69A 4Y9CA 3GMPB 5AYTA 3MRBA 3KWWB 5AVTB 1WTGT 2DKMA 3IMBA 3FU7B 4Q7DA 4D3CH 2GC7C 1GXEA 2UUDH 2K6ZA 1MI5D 3CXFA 3MV7E 3TN0C 2JJTC 5J5EA 1RERA 1L7IL 5K93A 1BQHA 1QRND 2Z0BA 3C60A 4XHJD 4LGPB 5ALCH 3BN3B 4ZW8A 4NQED 3ZL2A 1TVBA 3LMJH 3B37A 5FLVA 3EJRA 5IBLD 5I0VA 1M56B 1V10A 2EDKA 1FAIH 3OB8A 4FULA 3F7VB 1LO2L 1ET8A 4XCYB 4ELMA 5CEXA 1WUNT 2H1XA 5ERWA 4G2AA 2GJ6A 2BLFA 1KN4L 4OQTA 1V3MA 1WCQA 1AJ7H 3VFWB 2EC9T 2WXJA 3LKPA 2OXGA 3NFSH 2ZUVA 5FO8B 3QIUC 1A14L 1BVZA 1XF4B 2BPBA 1HOCA 1BBDH 2O6DA 3KYKL 3NZHH 4NERA 4CMMA 4NO0B 6CGTA 1DQML 3K2MC 1S7QA 4GUCA 3GXFA 4UIMB 3T65A 3WTTA 1U3YA 2UZXB 1ZA6A 5EZJB 5T1KD 4CILA 1G1KA 4BZ1L 3JVFC 3ECQA 3IS1X 3ULVH 5C09E 3U0PB 1IL1B 1CXKA 4PM1A 3V5HB 2YAMA 1KB5B 3GRBA 1TN0A 3HMWH 4XMKH 1KLGA 2APVA 2TAAA 3VA2C 1IFHL 1PX4A 1MY7A 3EGDA 3MU3A 4C47A 3NJVA 2E5EA 2ESVB 3NZSA 4B5EA 3C60C 4GI6A 3DBXA 1UADC 1J8HA 1W91A 3ERXA 2YN5A 2X53A 4P46B 1QP1A 4PYGA 3WLBB 4ONGL 5F2FA 3VQ1C 4NCC2 1IQWL 5EPMB 2CDFB 2EVHA 2EDRA 1H15B 3DI3B 2WN3A 4IW4C 1A6WL 2Y7SA 5AB9A 4ZMZA 5JJNA 4UT9A 5LN8A 3IU3A 3FQUA 5C3LD 4MLSA 3TPUA 1E7VA 3LY6A 1K4DB 4U1HB 3INUH 5F7EL 1WLHA 4GSQA 2FQFA 4JG0L 3TASA 4CSSA 4MQSB 2ICEB 1XB3A 3VAEA 3PWVB 4JFPA 5H94A 3HA0A 3VE0A 4YHOH 1FDLH 1BDYA 3SQOL 1C5CL 2I69A 4WU5B 2MRYA 2XA3A 5CSZB 3JYCA 1KBWA 2XCMC 1EJOL 4PP2A 2FHCA 3U7WH 3X1GA 4XX1E 2O72A 5F9JA 3CFKB 1BQHG 7FABH 4GP4B 4N6HA 4JFDB 5IW3A 3VMOA 4YX2H 5GRYA 4DO6A 3KJ6A 4HV8B 1PCSA 3PV6B 4APQB 3D2TA 4I1RA 1F3RB 2WGNB 1U8CB 4LB8A 3I50L 2B9AA 1N2RB 5D93C 5AL0A 2OPCA 1CT8B 3UTYA 4U1NA 5I1AA 4XMLL 3WD5H 1FI8C 2BS8A 3PIQB 5E5MB 4UZSA 3RY6A 3MOBL 2RACA 3QDJB 1JWMA 2B1AL 4X6CB 1YMMD 2BNUA 5I0YA 2WQWA 3FTGA 3SDYL 4NUGL 1RY7B 3QUXD 1LWHA 1U6AH 3GSRA 2AK1L 5L2KE 4HWEL 1IVTA 1AQDB 2MSPA 3ARTA 4OZIE 3RU8L 4LBAA 4EN3C 3NRFA 3VD9A 3DJ9A 1BEYH 5H2MA 1FO0A 4BQCA 1UZ6E 3K6DA 4HDIB 1QBAA 1NMBH 2J8UE 1E30A 1CE1L 5IFJA 3ESVF 4HH8A 4FABL 4WGWB 2J3SA 5KANI 4PY8J 1MCQA 1PAZA 5TDPB 1YDPA 4OI7A 2DQGL 3HG1E 1LEKA 3LEVH 5ESVA 4HBCL 3ZZQA 1LK2B 3GIZL 5CM1A 3ABGA 3CJJA 4KROB 1JCVA 1N9PA 3HBQA 1H2SA 3QNXB 3TZVA 5I19L 1JZDC 4EI0A 4Y88A 3ZDYE 4PV8A 5HGBB 3RY6C 3CVHL 1E67A 1KJ3H 3BWSA 3LXCA 5LXGL 1GC1C 1UAZA 1HQRB 1N68A 4PB9H 3CFEB 5IF0B 4B96A 3U36A 1LM8V 1MVFA 5G53A 2CJUH 4XTRD 2VABA 2EIEA 2MHAA 3P9MB 2D7QA 3G5VB 3RWHA 3ZL4H 1FBIL 3MV8D 3BE1L 4H8WL 5ANHA 5M95B 1SDDB 5JOFB 3VFPA 1K8DB 2NXYC 3GSOB 4FXGB 1NA8A 3QNZB 3MACL 4EI6B 3MODL 3MLPA 2NSQA 3QBTB 4I9XA 4PJDE 5FO9B 3QO0A 4JLRB 2VL4A 4LCYA 3W0WA 1RZ7H 3ZT5A 4OLVH 1U95A 2E6QA 2SODB 3UC2A 5L7XH 4FFTA 1MF2H 2NY7L 3QZOA 4JDVA 4U49A 1RP9A 3ASOB 3SJVB 3OHXA 3KPOA 3TZVC 4ZFFB 4XPTL 1B88A 4GI9A 1L6XA 4NBYB 4F2FA 4MCZA 1MHCA 5GS1B 2BSRA 2PWEA 4A2MA 2BVPB 3MO1B 2Z7ZA 3WKNA 4MA7H 3NEOA 4Y5YA 4JFOB 3CC5B 3FT0A 3FFDB 4JQIH 1CDGA 3ES6B 4Z3JA 4NKIL 4B9JA 1N7ML 2UUDK 3CBJB 3Q2LA 5IGXH 5DD3L 5FUZH 1XD1A 1ED3B 1DTUA 1L7TH 1TYJA 3C60D 5E4AA 4AKQA 2AXWA 2FHFA 2OR9H 2RIKA 3CC1A 3EF7A 1DVXA 1JS4A 3TIDA 2Q20A 4DP7X 4WV1C 1S6NA 4BE6A 1N3NA 2XQBL 5JQHC 4MX7A 4KTDH 1M71B 5GGTH 3L2LA 4IU3B 5MEND 1TZOA 5D7LB 3VJ6A 3IJ8A 2YLKA 3H54A 3S34H 1HH6A 2X10A 1IX2A 3BPCA 2LLLA 2Q8BL 1E9PB 1FHNA 1GIGH 1RIVL 2GJ6D 3OHXC 4FQ2H 4TVSa 2WVSA 2VJ8A 2ZUUA 3MQIA 5DZJA 2DBJA 4IKNA 3MAWA 1HHGB 1LP9B 5F1OB 1U0QA 3QJHA 4HKBA 2C9QA 4GLRI 5EU6A 3VI4F 1NDTA 5SWSA 1PLGH 4NZDA 3DA0A 1DQIA 1OWWA 4X4XB 3FUMA 5DUBA 3NY8A 3RWGB 1KFAH 2A2QT 3K71B 4FQLL 5I1JL 4Y5YC 3UH8A 2GBUA 4JG1L 1UWEH 3UAFA 4A6YH 3VXRE 2DIEA 3RJQB 2W60A 2B9BA 1CFSA 4TMPA 2ZD0A 2IWKA 3QFGA 2Q2LA 4PHZA 3AG2B 4AT6B 4BV1A 1KXQA 1KCVL 5F1NA 1DLFL 4GFTB 1GAFL 4ZTEA 3P2BA 4RGNE 3PBLA 1MUJA 3L6FB 1J8HD 1OSYA 4MCMA 5BCAA 3IAQA 5E9DA 1DZEA 4ZMYA 2F7PA 4ZUTB 5CZVL 1CGWA 3IJHA 1A9VA 4GXVL 3VVVA 1ET7A 5CLWA 1QFWI 3U46B 1DLHB 3T0EA 4YHIA 5DHXB 4L0ZA 1GJUA 1CGSH 2HFEB 3FT2B 4WWKC 5JUEH 1MAMH 1RIUH 3U4EB 4E41A 1A6TB 4PGDA 1OM9A 4XN9A 3OPZH 3KLAB 4CVZB 4LAQH 3KBPA 3LNFA 4QOKE 1CXIA 2D03L 2HVKA 2DD8H 3O4LE 5E2WH 3SKNA 2BY3A 2NTWA 1DN0A 1LQBC 1SFHA 2XBZA 5F44A 5DD0L 3FCTA 1ID2A 5F7UA 3CZGA 3N41B 4DGWC 2D8KA 2IDUA 4JHUA 1J11A 2F53A 3OX8A 1LP9F 5CGYC 1P4LB 2VE6A 3QIWB 1FVDB 1M6OB 3HCVA 4FZEH 5AW2B 2P7TB 1JPFB 1FFQA 2PYFA 2CO7B 2PF6A 2AW2A 5CJ8A 3MNWA 2CCVA 1XGRA 4X7SL 4QCIB 4DKDC 4LSUL 3R7QA 2AJVL 4MBRA 3ZE1F 5HYSB 3QEGH 3QEQE 5ADPH 3REVB 3F7LA 4GRLC 2BY1A 1HVXA 3S35X 1NGQL 2FO8A 3T0EC 3SE9H 4DK5A 3U4AA 3V0HA 3QZNA 3V0VB 3DOSB 2AQRA 3MUGB 2JE8A 1MOEA 1JFHA 3TA3A 3K72A 4FFYH 3O45B 5BMFL 3GUTB 1KIPB 1KJ2L 3N9GH 3SBWC 1TJMA 1AHKA 3T4YA 1OTTD 1S54A 2YPKA 1I53A 3QQDB 3Q3GB 4GSXA 3OL2A 1Z5LB 2CMRH 1WC7B 4XO4A 3V0EA 5B8CB 1LK3L 3MRPA 5DFTA 4U1MA 4JCWA 3BP6B 4KTGA 1I4FA 1NFAA 1D6EB 1K3ZA 2H3NB 2HTLC 2NNRA 2QQLL 4QIRA 4XXCA 3SDDB 2DYPA 3OKEA 2W0KA 5AUMB 3RZWA 1IC7H 5I8CB 5DTFA 1TTUA 1WIPA 2PCYA 4UQAA 1RP8A 4HKXB 5HY9B 4RISH 3P4OB 1O9ZA 1QR1A 4AC4A 4GY4A 5K59F 4UQ9A 1MEXH 3QQ4B 4HS6A 1A6UL 1T66C 5HDBB 1J0KA 4E9VA 4PJHB 2FX7L 1EXGA 4D8PB 5I1IL 3C6LD 5DJDB 1JNLH 1YNKL 1IBZA 3QI9B 3DX7A 4TVPL 1WBYB 5CCKH 2G5UA 4XMPL 3MUJA 3TFKC 3VW3L 2BNRE 1WZ1L 3DI2B 4FMFA 2GTWA 1G7LB 5AVWB 2VN5A 5CSBA 5D7KE 2DQIL 4I2XB 2JF1A 3F7PC 3DQBA 1I7RB 3K6FA 1T3FA 3GPEA 1GS6X 1F3DH 1MFEL 2DM4A 3K6SA 5FUCE 4AV5A 4YDKH 4WNQB 5IW6A 2D4DA 3ZT6A 1NMCC 3GMPA 6PCYA 1QHPA 5E8EB 2X89A 1JGUL 1UB6B 4PD4K 1C5BL 3LN9A 4J8QA 1CLVA 5I15L 3DHUA 5ALBL 3RGBA 4OIIH 3FZUC 4PUBH 3NFPA 2C3XA 3MBWB 1F6FB 5E7FA 2A9AA 2O5ZH 4BKLB 2AGJH 3OAZH 1KBKA 4P3CH 2PR4H 4YDVB 3NTCH 5GZOA 2LQRA 4YOKA 1NAMH 4FQCL 2DAVA 4MD4B 2YA2A 2Q86B 1TENA 2AMGA 5JIHA 2EXWD 1CFTA 1IBGH 3MKKA 3AU0A 1UA6H 1RZPA 3VG0L 5J6GB 3WXVH 1MCRA 3RWJB 5HYJE 5HDBF 3RL2B 4YBQD 3VFWA 1BSIA 1XO8A 1F8TL 3GSWB 5FO8A 5MERB 1IKFL 1XF4A 2NTSP 5DUJA 1J8SA 4ECNA 2XTJC 4NO0A 3U30C 2WQ8A 2DQUH 3PREA 3SGKA 4UIMA 3Q44A 2UZXA 4NQCE 5EH1A 1WSST 4WFGE 5EOCL 5EZJA 1OVZA 5DR5L 4HLEA 3CPUA 2LFGA 2Y07H 3HC4L 2KQMA 3U0PA 3V5HA 3MRFB 1KB5A 1F41A 1R3KB 2OMXB 2VLMD 2BVUA 2G2PA 3CFTA 4LLVA 2EH7L 4TTDC 3ZTJG 3CZJA 1WRFA 3PP4L 4X9IA 2OZNA 2GEQA 2ZAGA 1ZHBB 4R26H 1SOSA 1X5MA 3RYMA 9CGTA 3ZR6A 2ZXQA 5TQ2L 4P46A 4PRAB 2Z73A 5DK3A 3WLBA 2WXOA 3LEYH 5A16B 5EPMA 5GZOC 3TT3L 4P2OB 2E9JA 4GINA 5KWYC 4FFZH 5FA4A 1NFDA 3R0NA 1F45A 2YAQA 2Z8RA 4ZSOE 3VFVB 4XBEH 1J1PH 3PQYE 4QLRA 4K7FB 1OCWL 4G6JH 5SWSD 3BH8B 3CD4A 4R0LB 4XXDB 1T1ZB 4Q56A 5CHNB 4GUQA 4XT1C 3VFUB 1K4DA 4HEME 4U1HA 5CGYD 3O0RL 2YO3A 1MWAB 2XWEA 4L1BA 1LYQA 2ICEA 3T4AB 3PWVA 2CRIA 3VXPB 2CBTA 3QORA 1U8JB 4WU5A 3QRGH 3QXVA 3DDGA 3NIDE 1PLCA 3SGKC 5F1IB 2FNWA 5CSZA 3TURA 2KZ1B 3P3YA 5DK2A 4FI8A 3EJQA 1JTTA 5FCSH 3B5HA 1E65A 4NN5C 2EDXA 4WU7A 5AVXB 3VNZA 2CRYA 3CFKA 5DK0B 3RVTC 2UVEA 4HV8A 3QJRB 1LO2H 2FE0A 3U83A 1CTOA 4BGDA 1U8CA 3SZKC 1A7PH 1N2RA 3D69B 1EX0A 5E2JA 4CC0A 5IQ9B 1PKQB 1CT8A 1KN4H 1IAOB 4P46C 1ND0B 2E6PA 1DQJA 1A14H 3PIQA 3T0VA 2HT3D 3BPOB 5A6MA 3QDJA 2BP3A 3KYKH 4Z9KB 1M9WA 5ACZB 2F9BT 1DQMH 4X6CA 4LO9A 1TCMA 1IM9B 4FTVB 3ZPQA 1IBHA 4YZWA 4CVXA 4X7FC 3EYFB 4QUOA 3VXSB 2F1BA 2CO1A 4BZ1H 5KVDH 1EVTC 3D34A 5D96B 2N7BA 4DAJA 1EVUA 4W81A 3MMEB 3UDWC 3NVQA 3NRPA 5C2BL 3PJNA 2ICEC 1RULL 1U2HA 3GXDA 1XH1A 1IFHH 1ZDQA 2GIMA 3QORC 3UTSE 5IHUL 4HDIA 4NT6B 4GQ9L 3FUKA 3ZHKA 3VM5A 5TDPA 3U1QA 1JPEA 2VO5A 4ONGH 4EIGB 5IR1A 2IH8A 3WI9A 1B4TA 1A6WH 1RZKL 4X4YB 1P6FA 4TS6A 3AAZA 3IAPA 1LK2A 2HLAB 3TFKD 4GQQA 1E12A 4M02A 2R2HB 4Y7MA 5DUPL 4P5MA 3TH4T 3O4OB 1A7QL 3UYOD 2X2YA 4XH2B 3TA3D 5F7EH 4ZNEA 5F70A 4JG0H 5HGBA 1JGEB 4WCYL 2ZX5A 4NQSB 1D5ZB 2J44A 2QQQA 5DQJB 3WS6C 5FECB 1PDKA 4YDJA 3EF4A 5DXWA 1C5CH 3SQOH 4OI8A 4NENB 1MXGA 3HRZB 4AQ8A 1A4KA 1WFIA 3L3IA 3CFEA 5IF0A 1EJOH 1KC5L 2DYPD 2AJ3B 3P9MA 2PWHA 3CGTA 4HJIA 4B9GA 4C59B 5CEZL 1N6QL 1ZXKA 3G5VA 4YE0A 3CHXA 3FZUD 4YE4L 1SDDA 3N04A 5JOFA 3SEPA 3BCFA 1K8DA 4FXGA 3QNZA 3I50H 4W93A 5KN5B 4EI6A 4Y2NA 2DQHL 5FO9A 1IKOP 3BKML 3TXAA 4XMLH 2VGLM 4JLRA 5D55A 1GY1A 2ZCZA 3MOBH 3VXUD 4URKA 5F6IB 3CFMA 4BFKA 3SDYH 4LHQB 2NY3C 3SJVA 4NUGH 3RUGF 5A45A 2AK1H 2Y1YA 1CQYA 3IJYB 1GS8A 3WE1A 1F11A 3BWZA 3IRCA 5GS1A 3RU8H 4NUPA 2HYMA 4MD5A 4XN5A 4J2QA 2G5RA 5E9AA 3ULVE 1MFAL 2BVPA 3MO1A 3ARFB 5KYWB 1UFUA 1CE1H 2W8CA 1A65A 3T2PA 4FABH 5K1JA 2F18A 2X89D 3UZCA 2X0WA 3FFDA 4FYTA 4NNPL 4R4NC 2DQGH 4UMGA 4KRLB 2DI8A 4KZDL 5JDSB 1ZA3B 4HBCH 1C9SA 2JCCB 3GIZH 1J1OL 1FJ1B 4AIOA 4XMXA 4FXGC 1I8MA 2G87A 4UNVA 4BCYA 1IC4L <