4GPAA

High resolution structure of the glua4 n-terminal domain (ntd)
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
FPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 4
publication title Comparative Dynamics of NMDA- and AMPA-Glutamate Receptor N-Terminal Domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 132
structure length 379
sequence length 379
ec nomenclature
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gpaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gpaA01
1JFVA 2NT4A 3LUAA 3MA0A 3Q9SA 1MIHA 4RU1A 4W5RA 1DC7A 1GUBA 1Z26A 4DQDA 5IBQA 2IPAB 4F8JA 3MQ4A 4Z9AA 4YO7A 3HJFA 2HPHA 5PNTA 2YHBA 5KC9A 3K4HA 3T8YA 1BAPA 5FWXA 3O2QB 4DADA 2J48A 2PUAA 5DKFA 1JH9A 5TQ0A 1ZHHA 1SXIA 2JRLA 5B3JA 4EYKA 4KPYA 3EODA 1Z16A 4CBVA 5FWYB 5C5EA 3O1IC 4YGXB 5CNJA 1DRJA 4Z4CA 4W5OA 4EYGA 4XASA 1B00A 2KYRA 4IILA 2PL1A 4RXUA 5FWXB 2FMKA 3H5IA 5KWSA 2H3HA 4FE7A 4N47A 2MYTA 4EVSA 1JL3A 1P6QA 4Z4FA 4G97A 2HQRA 2O20A 4LE1A 1JDPA 1XHEA 1SRRA 2R48A 3FGZA 1U2QA 2VYCA 4G0XA 3O21A 4MR9B 1QP0A 4YWHA 1NATA 1URPA 1ZESA 2QVGA 3MM4A 1W9HA 4QYMA 4RDCA 5D2CA 3RVRA 4ZYLA 3A10A 2F8TA 2HSGA 3HEBA 4YR7A 3RQIA 1QNLA 2IPNA 4KQ9A 5IUNC 1LJUA 2AYXA 1XHFA 4N0QA 4RY8A 1JDNA 1PEYA 1YS7A 3CS3A 2W42A 2LPMA 1ZVVA 4Z4IA 4MAAA 3SG0A 3QELB 1M5UA 3OQNA 4Z99A 5CHYA 3ILHA 3NNSA 1DBPA 3I42A 1USGA 2AYZA 4JP1A 3QLVA 3EULA 3URMA 2VK2A 2TMYA 1S8NA 4WXMA 4OLBA 6CHYA 5JNWA 1M2EA 3OM1A 4KMRA 5IEJA 1EFAA 1TJYA 4MRMB 1FSPA 2QXYA 3H5LA 4EYOA 5TQ2B 4KQCA 4MYRA 3Q7TA 4H3HB 3H1FA 5EWLA 3MF4A 2HQOA 2VUIB 4O1HA 3UK0A 1BDHA 1TM2A 2RJOA 1SD5A 3FFTA 4RZSA 4Q7EA 4L4UA 5FBHA 1D1QA 4OBBA 1F51E 2IOYA 3G1WA 3HUUA 1NXTA 3VNAA 1D5WA 3DGFC 1YIOA 2IYNA 3KJXA 3OQOA 1DJMA 1Z17A 1A2OA 1BVHA 3EJWA 4MQEA 4Z4GA 2FMHA 4DN6A 4FB4A 2XDYA 2MYNA 1H9CA 3TB6A 2B4AA 1YVUA 5CNKA 1EWKA 2ZWMA 3EQZA 5HQJA 3D02A 2E4ZA 3KLNA 4G0OA 2QSJA 3H1EA 1ZAYA 2FQWA 1FFGA 3BRSA 4MR8A 3H5VA 3JVDA 4YP9A 1NY5A 3RVJA 1KRXA 4KNYA 3LKVA 2HJ9A 3GBVA 4GPAA 1EAYA 3NNNA 3RVQA 2FW0A 3H5WA 4FE4A 3I5AA 3JY6A 1JYEA 1SXHA 1FFWA 2E4VA 4Z0NA 3LTEA 3O1JC 5KQPA 4RK4A 5DTEA 1T34A 2A9OA 1JF8A 3QK7A 2E4YA 1IIBA 4UHJA 3OLXA 1M5TA 2WMYA 5FBKA 1R8JA 4PYRA 1C0EA 1JX6A 1Z15A 1ZITA 2ID9A 3CFYA 1NXXA 2MSKA 1I3CA 5JS2A 1P6UA 2PL9A 3C97A 2WY2D 1CYEA 1BA2A 4S05A 2R47A 1JYFA 2WJAA 3M9WA 4N03A 1K66A 3GL9A 1Z18A 4ZPJA 2PUCA 5FWYA 1E6LA 4LE0A 8ABPA 4HYEA 4QICA 1NXVA 3H6GA 4RY0A 4Z4EA 1JFTA 3S99A 4F06A 2JBAB 3OO0A 4O5AA 4EYQA 3CG4A 3ROTA 3RVPA 4XLTA 3F73A 1RZRD 5KQMA 3OM0A 3HO1A 2GKGA 1JHZA 4OG2A 5DCLA 3RVKA 3IP7A 4MR9A 3E61A 4IMJB 3FFWA 1VPWA 1GCAA 1NXPA 3OLWA 1QPZA 4B09A 1D1PA 3CTPA 4W5QA 2GBPA 5IULC 3DLHA 3QLUC 1KRWA 3C3WA 2OQRA 3DGEC 3HV2A 2WB4A 1DG9A 3JTEA 1TLFA 3K9CA 3NHZA 3NNDA 3HCWA 3KYJB 4GNRA 1QQAA 1U8TA 2FKAA 3Q7SA 4MQFB 4O1IA 5F64A 4ETNA 3OMXA 2FLKA 2E4UA 6ABPA 3QELA 4P1ZA 5TPWA 1D2AA 2P4UA 1CEYA 5DGCA 5JS1A 3SM9A 1UDRA 1OXKB 5T7BA 3JPWA 2NT3A 1C4WA 3UUGA 2BGGA 4JA2A 1Z25A 1KGSA 4JAVC 1VRVA 1U2PA 3C6QA 1JBEA 4MRMA 5TPWB 3TMYA 5TQ2A 2L2QA 1K68A 4TMYA 4RKQA 3O74A 4G86A 1ZH2A 4RV5A 2FEKA 2QZJA 2QR3A 5JNUA 4S04A 2PKXA 4TLLB 1Z13A 3GT7A 2JK1A 4KRFA 1LK0A 1DRKA 3H5TA 3KG2A 5EWMA 4RXMA 5TPZD 4WWHA 4G0YA 3LFTA 1EHCA 2H0AA 4L85A 5BRJA 2FSPA 2IPLA 3O75A 5JNSA 3QLUA 1YTUA 3TD9A 4WXEA 3OLYA 4ML3A 4MS4A 5I4CA 1FQWA 4IF4A 3RH0A 3IP9A 2FXIA 1AB6A 4EVQA 7ABPA 4N41A 4NCBA 2FN9A 2E4XA 5EWMB 3Q7RA 1DCKA 4E7PA 1MB3A 1RPJA 3RVMA 2NUBA 5KQLA 5JNRA 4WT7A 2YHAA 2GX6A 3OO1A 3MIZA 3ROFA 4EVRA 4PZ0A 1YS6A 1ABEA 4MS4B 1USKA 3EQ2A 5IEBA 4LE2A 3HDVA 4MLDA 4MR7B 4RK7A 2VUHB 2PUEA 2WRZA 3CZCA 5JNVA 3HDGA 3UKJA 3HSYA 3KTOA 4D74A 1DBWA 4KK3A 2JVIA 1E2BA 1LBIA 2QU7A 2FQXA 4W5NA 1DZ3A 2R4QA 3GWGA 2FTKE 5CNIA 3T38A 3JS5A 2FMIA 3H1GA 2NZVG 3NHMA 5IC5A 4ZMSA 4Z4HA 3LUCA 2F8SA 2PMCA 4JB0A 3FDFA 1D4ZA 1VKRA 3HK2A 1NXSA 1PEAA 3KSMA 4XAQA 3N75A 3TO5A 1NTRA 3QLTA 3A3KA 3L6UA 2A9RA 3C3KA 3GBPA 4EY3A 1RZRA 4YV7A 4NV3A 2PUBA 1DP4A 2CD7A 2L17A 1QO0D 3W9SA 2A9QA 3JVIA 3OQMA 4ZMRA 3HUTA 2E4WA 3DBIA 1GCGA 2FQYA 5GQSA 5BQ3A 2R25B 4RK1A 4G0MA 5KC8A 3GYBA 4KVFA 1DBQA 3O2SB 2M98A 3KYIB 3LOPA 4MS1B 1YK0A 1APBA 5BRAA 1PHRA 2FVYA 3LUHA 5B3JC 3VNBA 3LMKA 2JBAA 1DCMA 4RK6A 3BREA 3CU5A 3GV0A 3N0WA 2V0NA 3BBLA 3CZ5A 3IDOA 4W5TA 2Q5CA 4Z9BA 2GI4A 3SAJA 3I45A 1YK1A 3DLBA 2RJNA 1PNRA 4IMIB 1SXGA 2RGYA 4MS3A 5HM6A 3HXMA 1JFSA 1JLKA 1MB0A 2LUOA 2IDMA 3CKMA 4WZZA 2PUFA 4KREA 1U0SY 4LDAA 1ABFA 4PEVA 1QQBA 3QX9A 3FMVA 4MGEA 3LUKA 4XFKA 4RK0A 2MSWA 4MQFA 1L5YA 2PUGA 1ZDMA 2M1ZA 2MYPA 1BDIA 4LRQA 2CHFA 1DC8A 2WJWA 4MS3B 3T6KA 1F4VA 1AB5A 3SY8A 3M6MD 3LUJA 1YMUA 4OTZA 4E7OA 5KQGA 1QKKA 5TPZA 1MAVA 2I6FA 2HQBA 3GA5A 2PJUA 3Q41A 2L18A 2FMFA 1ZN2A 3QEMB 4UHKA 3F7NA 3MYYA 4M88A 2OENG 3OMWA 4H3KB 1P2FA 3OLZA 3P9YA 3QLVC 4PE5B 5E3JA 4JOQA 3HS3A 3KHTA 3FFXA 4RWEA 4G0QA 2QVCA 1PUXA 2MYUA 2CHEA 2DRIA 3M9XA 4EGSA 1VLZA 1YMVA 4RK5A 3QX8A 1KMIY 2GWRA 2B1JA 3KLOA 1EWTA 5TQ0B 5ED4A 3IP5A 4D6XA 1W25A 3O2JA 4KFCA 3TX6A 2LP4Y 1TMYA 4NQRA 5GOTA 2IPMA 4LZLA 4YCSA 1QP4A 4HNSA 5HKOA 9ABPA 1E6MA 1NXOA 1RNLA 3DZDA 3N53A 3KS9A 2ZAYA 3LUDA 3LKBA 4KV7A 4G0PA 1GUDA 1CHNA 1EWVA 1LBHA 3RVNA 4Q6BA 2LIVA 2P9HA 1USIA 3KCNA 1ZH4A 3H6HA 1RXEA 4TN5A 4F11A 5JNTA 5T3YA 3BILA 4TLMB 1QP7A 3OLVA 4QYWA 3IPCA 3RVOA 5C5CA 1A04A 4F3TA 2IKSA 1WETA 4JB2A 2PE5A 3N6VA 3Q15C 3A0RB 4MR7A 3L49A 1ISRA 4LDZA 1TVMA 1QO0A 4H60A 4PICA 4YRZA 2ID7A 2JCGA 1U04A 3LUGA 4XXHA 4HNQA 4OLAA 2MSLA 1M2FA 3E3MA 2PLNA 2RDMA 4JASB 1J56A 5TE9A 4ZJPA 3RVLA 1Z2DA 3KKEA 2JVJA 4WUTA 1BDJA 3I09A 1Z2EA 1LJLA 1ZGGA 4RKRA 4KK4A 4RS3A 1XWWA 4F12A 5HSGA 4RY9A 2L19A 2A9PA 3T95A 4YLEA 3HM9A 4Q6WA 4IGAA 5DLEA 2QV0A 4RSMA 5TQJA 2CWDA 3ILYA 3LUFA 1A0OA 2JVKA 4QPJC 3CHYA 4KZKA 3C3MA 4MS1A 4ETMA 3H75A 4XARA 2FLWA 5EWLB 3D8UA 2JB9A 1ISSA 4IRXA 4N0PA 1JWLA 3EAFA 4Y9TA 1PNTA 3BRQA 3HVRA 5ABPA 4HNRA 2FEWB 1QMPA 1RXIA 3JPYA 4RXTA 3RVSA 2QW1A 4D6YA 3QEKA 2PUDA 2LBPA 3F6CA 4LX8A 1ZGZA 1OXBB 1P8AA 4MQEB 4MLCA 3O1HB 1FFSA 5KI6A 3H5OA 2PAFA 1HEYA 5IUJC 1L5ZA 1DCFA 2FN8A 1MVOA 5BR1A 3A0UA 3N0RA 3CRNA 3CNBA 3NBMA 2N9UA 1Z12A 5IUKC 4P98A 4YS6A 1Y1LA 1ZY2A 3R0JA 4EUKA 4MR8B 5IX8A 3EDCA 5EWJA 3B2NA 3SNKA 4N76A 2FEPA 4MPTA 3EGCA 3HZHA 3IP6A 4NICA 4ETIA 1GLGA 3N0XA 4OATA 4G0ZA 3IPAA 2X7XA 3CG0A 3CLKA 1NXWA 3GRCA 3MMNA 2NZUG 3QEMA 2WWVD 1E6KA 3F6PA 3SQNA 3G85A 5CNMA 4NCAA 5EWJB 3N8IA
chains in the Genus database with same CATH superfamily
3J7AC 3GLQA 4W7IA 3T5BA 2ZSHA 5KYGA 3G5TA 4M0KA 1FMFA 2J0QA 1TOAA 2WIBA 4KGZA 4RADA 3AR6A 2W98A 3D7LA 4U2KA 1YE3A 3ZIDA 5JXHA 2AKYA 1KIFA 2BC9A 3QXXA 3OCXA 4Q7KA 3K94A 5LKRA 1MQAA 1F38A 3BCUA 2AK3A 2JDIA 3O2QB 2J48A 2Q8NA 3AVPA 3K0CC 3MB5A 4XIYA 3EJ6A 4GUAA 4J3NA 2H4XA 3UA4A 3X44A 1Z16A 3L7MA 5BVHA 3EGXB 3O1IC 1U1EA 2QZZA 2WLSA 5CNJA 3E18A 2Z1NA 3HCPA 2QJWA 2H9IA 4LDQA 3W5JA 3TL6A 3WADA 1OXUA 5JAMA 4DLAA 1G21A 3HCBA 4YONB 3OQ1A 2PBLA 2PUHA 4OKIA 3N3BC 5D01A 1W1WA 2H3HA 4N47A 3K0AB 1EFUA 4IG4A 1SXPA 3PUIA 1DHTA 4LYEA 1R64A 5G1OA 5BWCA 4K03A 4ZVQA 1M2NA 2WUDA 5DF1A 4WY5A 2NP7A 4CEHB 1NMYA 4G0XA 4AZVA 1SKYB 4DAEA 2C57A 2X5JO 3I1IA 4C5BA 1EG7A 2XJ9A 2QVGA 5ALJA 5LZ2A 1KDPA 1ONBA 1JHQA 4BXOA 1PQ4A 1MOPA 4AUKA 2DBYA 4OHYA 4XYGA 5HIJA 2AN4A 3U81A 1N34B 2IEAA 4XUDA 2Z57A 1LH0A 3L93A 5BSRA 4JENA 2JHGA 2MMGA 1K8RA 2JFXA 3PWTA 2PX0A 5CB4A 3QU2A 2PX6A 5CT9A 3BOSA 2IUSA 2ZVJA 3QELB 5EMJA 2FN3A 2CJYA 4FD2A 4AO7A 1IZYA 4RHTA 4GPBA 2W6OA 3N2NA 3E03A 4EJSA 2JI6A 1K7CA 1KQ3A 1LQTA 1UUFA 5MHTA 3GRRA 2OGZA 3Q3GE 2PRZA 3AIMA 3GPLA 2NOAA 4OI4A 2R97A 1PL6A 3KVRA 1E5DA 4ZN6A 4H35A 3B70A 4LIPD 4YT8A 2OYSA 5AHWA 1AXRA 1M3SA 1VL8A 3H5LA 3I6MA 1YQXA 2JAPA 4KQCA 4MRNA 2IK8A 4OP3A 3ADCA 4BVHA 1NPYA 3SI7A 3R0IA 3LCUA 4AICA 3BEDA 1YA6A 3KL2A 4JL5A 3G9UA 3WLQA 1KIMA 5H3CA 3WWEA 5EJ8A 1WRBA 2GPYA 1JG6A 3BKXA 1X1RA 2NO9A 2YCBA 4O3FA 4XGRA 1KWKA 4H3HB 1G5PA 2G8NA 1JLHA 1CQIB 2VEOA 1UXKA 4I46A 2QX7A 3WQSB 3VKVA 1TM2A 3ASUA 4P9NA 3O4RA 3GPCA 4YI3A 4YCJA 1QXSA 3ZQUA 4ZOBA 5FBHA 3LSTA 3ND7A 3LA8A 2IHKA 4MWZA 2PZEA 2XUDA 4M38A 1DTWA 1LWOA 4QQFA 4TMWA 3RADC 1H8HD 1KIAA 2J9ZB 4JVMA 3ESYA 2V1UA 3T3OA 5A5GA 4MGHA 1GAXA 1KZ1A 4J7UA 1JSZA 1EGHA 3V3KA 4MQEA 4UD6A 2PA3A 4YVFA 5IZ4A 4EPWA 4Q37A 1C2TA 1YQTA 2FMHA 3P4YA 4I1OA 1H9CA 1A5ZA 5AKGA 2OBLA 3CMMA 2IWHA 1GPLA 1HQKA 3HJBA 2BGNA 1NKSA 4FX2A 1VLQA 1MGOA 2WM8A 1KJWA 3GAMA 4K9RA 1O95A 1JVSA 2ODBA 3I39X 3UF0A 3JD1A 4JU9A 2GHTA 4BNUA 2I1QA 4EI8A 2CMGA 1GL6A 1XB2A 2R6DA 3ND6A 1KFBB 4L27A 1L8QA 5JHHB 4B3XA 3HR8A 3W6OA 3X2SA 5DTQA 2WWIA 3DZJA 3ZLBA 5EYPA 1UANA 3LTEA 1U3TA 4DMLA 4GS5A 3O84A 4AZSA 1S2MA 2J8ZA 2O14A 3KXIA 4JD5A 3W04A 1U2RA 4TZKA 4ENRA 5J4LA 1XZEA 4OBEA 2A0UA 2RC6A 3FRHA 3I0MA 2CL7X 3A6DA 4PYRA 3U31A 1ND5A 2GAJA 4B3DA 4M1EA 1N5MA 1R3UA 2CDRA 4CDNA 1IM8A 5CTAA 1PGJA 2WMDA 3EVCA 3LT1A 3PDIB 1SFRA 2A9FA 2CXXA 2RG7A 4E94A 4HWKA 2BKXA 2C92A 3L82B 2AFVA 3AOEC 4I6JA 4EB6A 3M70A 4DV4B 5EG5A 2OP0A 4QVGA 3F0TA 1RXUA 3H4IA 4ATNA 4QM7A 1OA0A 1XCMA 4E21A 1E2EA 2VPZA 2QL5A 2PXXA 3UJHA 5KVAA 2W2LD 1ZK4A 5CDFE 3B9QA 2OAQ1 2EJCA 1KOLA 3ZE8A 1B8OA 4RFVA 4JJ4A 1OBCA 3LQKA 4J91A 3AINA 2JLWA 3ZEAA 3HO1A 1C41A 4OJYA 5AK5A 4K87A 4Z1MA 2Z6VA 3R75A 3VPCA 5FPKA 2Q9UA 4EELA 3G7NA 4EJ2A 5JECA 2XTMA 1Q21A 4AJ2A 5JSHA 3AUTA 3K0FB 3A7EA 4L9AA 3RUHA 4KXUA 4BQPA 2QLNA 3QWAA 3W1WA 1W5EA 1BNCA 3RR2A 3PVSA 1Z0SA 3AEXA 3E4DA 1MNQA 3OX2A 2D2IA 2G6TA 1CJKC 1OFHA 4FT2A 3SEZA 3D54D 3N6XA 3QE9Y 2YZNA 3B60A 4LFBB 4P3YA 3KYJB 4PIMA 5CVCA 5DJ5A 5CK4A 2OYCA 2GPTA 4GPD1 3RS9A 4EY4A 5CFOA 3OPXA 4D7AA 1E62A 3QZUA 1UBSB 1Q0UA 1SQ6A 2RGAA 2R6FA 2OHOA 4NBWA 2A3NA 1JG7A 3EEOA 1VMDA 3QE4A 5GV8A 3IQDB 3S1LA 1PU2A 1FEZA 5FWDA 3BCRA 5A4DA 3BDVA 4R4JA 2JLRA 3EZ7A 4R31A 2DFLA 2OHGA 4EITA 1C4WA 1NPTO 1VIVA 4AY5A 1O03A 2EU8A 3IX7A 1GG2A 1QFYA 1TTQB 2JAHA 4JAVC 2FAXA 3AF3A 3QFSA 1BWPA 3UMRA 4A03A 4ESVA 5IJXA 1OBVA 2X40A 3WGOA 3M6FA 5IWCA 5CW1A 1USVA 1Y8ZA 1XNJA 5AVZA 1ZHOA 2VT3A 4QT0A 2A14A 3K1AA 2PNFA 4H2DA 1LK0A 3PR1A 1L5KA 3KC2A 3IT3A 3VI3B 4BNJA 4D5EA 2RKOA 3U7QB 2DJ5A 3GDOA 1RCTE 3ZE1B 3WGYA 1EBBA 3LFTA 1UT5A 3QIAA 3O73A 3ZGLA 1L3CA 3KQOA 2XXAB 1N2SA 1U1DA 3IVXA 3QXGA 1GADO 1AZSC 1V26A 1K0UA 5KHLB 2H7CA 3PZBA 5MN6A 4QDTA 5EJ2A 3QF4B 4P83A 5TARA 1OWMA 1M8KA 3SYLA 1DEOA 2DETA 3EHEA 1B23P 3OD1A 4PNHA 3HB7A 3CF0A 3AW8A 2JI7A 3PUZA 5AM4A 4MMYB 4WCFA 4EJ0A 1TM5E 2C5LA 1UZAA 3ZGXA 3DHVA 1TRHA 3QVVA 2PXCA 2BBTA 5BW8A 5ITWA 1MUUA 1QYDA 3STHA 1KKLA 1USKA 2P9JA 3MWEB 5FULA 4LE2A 3WWOA 4BAUA 4RK7A 1XEWX 2W2KA 5FL7D 3KQUA 3KJQA 1WY7A 2I4IA 5CGZA 5G3ZA 2C0CA 5DFAA 1EEXB 4I5DA 2GWHA 2X5OA 3MQ2A 3WB1A 1JN0A 3O4FA 3LWNA 5K3CA 1QTRA 5T57A 1I3KA 1SIBE 3GLHA 4GLJA 5GGYA 3V33A 1D2NA 2HRCA 3M4JA 5EXDA 5F23A 1E1CA 3QVXA 2BR4A 2W4MA 1DVRA 3O6VA 4ZMSA 5LJLA 4G81A 4GNKA 4EFNA 4QXAA 4R2WA 1GGVA 4IGIA 1OROA 1VKRA 2X8AA 3TFOA 3ZY4A 3Q0TA 3BE8A 5DEOA 2VCEA 2D7DA 4C06A 2QSZA 3C3KA 2O8FB 1G7SA 5IABA 2PRKA 2P90A 4IZHA 4M1KA 1ENZA 1QYRA 1J8VA 1X7HA 2EGUA 1F8XA 2VH5R 5EZYB 4BNXA 4YMUA 2FWIA 2BKAA 2RHCA 3AL2A 1DPFA 4CKWB 2PZAA 3AFIA 4QARA 3DBIA 2BHLA 4FKMA 3H2JA 3UWSA 2N46A 1RFGE 4AZ3A 1Y63A 1V7PC 2EZ8A 3AQIA 1RJDA 2P0EA 4NF2A 3BMOB 3WJ1A 1F7UA 4GIBA 2ZT5A 2Z2KA 3GG2A 1Y1RA 3ZDQA 1YKFA 1TU0A 2O52A 3HO8A 4MUJA 3FWKA 2A9JA 1H8ED 2CNOA 2YDYA 2DMRA 3LXRA 3B13B 3L8EA 2I4TA 2DJIA 4FYIA 3EUAA 4X64B 4W5TA 1XTTA 1XZKA 3C8DA 1FDSA 1OFIA 1P2UA 1W46A 4C4ZA 4DA6A 3VUEA 3AH8A 4BO3A 4EJFA 4GLFA 3ZVNA 3W8EA 3PNLA 1DV2A 5DULA 3FYUB 2F3PA 3EOBI 4HH4A 4R6XA 3EWAA 4HVAA 4PSDA 1AH2A 4GR4A 1Q7GA 1SGWA 3V32A 3RLIA 4HGRA 1LJ8A 1Z5GA 4RJLA 3KKKA 2V3VA 2NXNA 4ND6A 4LDAA 4PEVA 4ZCSA 1YCFA 3FMVA 3KJGA 4PV7A 4QO8A 4UM7A 1YB6A 2QBYA 2HT1A 4TQ9A 5K6AC 2WI8A 2F62A 2WAXA 2OHIA 4JKOA 4XD7D 4XH9B 4B45A 1B0ZA 4CN9A 4Q4AB 1Y6RA 4KQXA 4US0R 4QDOA 2EG9A 3U80A 4DG8A 2QZ9A 4P7JA 4XX0B 4RF5A 1P9RA 2ZUVA 1YL6A 4KQ6A 5CTJA 1A9PA 4YASA 2IHVA 2JFHA 3IUBA 4JVOA 5EJMA 1JEEA 4AURA 1ZGAA 1TF2A 2Q07A 4DVGA 1JYSA 3L0SA 3PFKA 1YSCA 5L6LB 1W2GA 4D8YA 2DLNA 3BHJA 1M2WA 1ULBA 1G8JA 2A3RA 4RQAA 1M76A 4FUQA 4EABA 1K4YA 4OAOA 5TVKA 4CMBA 3W2HA 4IMRA 4ZQBA 2ZSAA 4Q7JB 2XMCA 3X0DA 2CHEA 2V6FA 2VQDA 1QGDA 2Q0HA 2YXPX 4QNRA 4RK5A 5DRYA 4PHFA 1QGED 2G06A 3RK0A 1KMIY 2AC7A 4BTEA 1FNCA 2FSVC 4YJHA 1IHDA 4XSGA 1UADA 3FCUB 2C7GA 3HXLA 3MS4A 1QG6A 2XB9A 3CCBA 1WXGA 4KQWA 3TX6A 3ZR4B 3GEIA 1XRNA 2OV2A 1QHSA 1Q20A 3T7KA 2IW1A 3JD0A 1I7LA 5JIBA 1Q1BA 2D62A 1JEAA 2PX8A 1L5FA 1XVUA 2WINI 2AWNA 3K1JA 3IDAA 5DBFA 4AYTA 1K2VN 3N58A 3MMSA 2CYAA 4RVUA 4BVJA 1GR1A 5HBGA 1NLYA 3JD2A 3TW8B 3UB4A 3WLLA 3WZLA 4NYIQ 1AXGA 2PFGA 3D7RA 1NQWA 3MK31 2HIHA 1PJBA 3FPGA 5T3YA 3QVSA 3L07A 5IFLA 4DBLE 4F3TA 4EH1A 3QBDA 2QTZA 5EIFA 2XUGA 1EP9A 4YGYA 3QPVA 1G8FA 3OIVA 4MVWA 2J33A 1VI6A 3RM3A 2C2WA 3CLTC 3GJ5A 2OEPA 3UC9A 5HUHA 2R6CA 1IEQA 3KB8A 1FA9A 2N1BA 1QH9A 3SVLA 4OLAA 4K86A 4F9GA 1I32A 1U3UA 2A59A 1CZUA 3ZHOA 1Z83A 5TE9A 1REQB 1I6KA 4Y7CA 2O23A 1L7DA 1Z75A 3D4PA 3QMMA 4TL6A 4P2GA 4QREA 1M2OA 2A0WA 4CG2A 1YDEA 1ZGGA 4L5AA 5B64A 2ZAMA 1HLGA 1NE7A 2DLDA 2QRMA 2BF7A 4MWGA 4NV1A 1UMKA 3RC3A 1DQYA 2ZANA 4TTAA 4FLFA 4MSUA 3ZJYA 1JDZA 1AZLA 1WXDA 4KZKA 3JQFC 1P0CA 1NZDA 1NBWB 3H75A 2P2CA 4CI9A 3AO0B 4IHJB 5L45A 1G8KA 5D3QA 2Q6IA 2C9DA 2EVWX 5GJWC 1PNTA 3BIXA 1NOKA 4EB8A 1VTKA 4LK2A 1WR8A 3UHAA 3OX4A 3WNZA 2OB2A 2YY5A 4XEUA 4V0MA 4YRJA 2R7NA 2YV3A 4DRYA 2Y27A 1S01A 1Y8RB 3FKSA 4ZEWA 4ZT5A 1C9DB 1JDBC 2Q49A 1M6WA 1H0SA 3ZD6A 4MLCA 2B83A 1C1DA 4BFLA 4LYHA 2QT9A 2XOKD 3ER8A 1RBQA 3P0IA 3KYCA 2YFKA 1AY0A 1ECCA 2PT7A 1EKXA 2V6BA 4QPZA 3T94A 4AG5A 5LMNB 5MFZA 3N86A 1QYXA 1P91A 5FJIA 1C7RA 4GQAA 2D7JA 5DBGA 3VAYA 4RMIA 3ROPA 4QZVA 1JPUA 2ODQA 3NEJA 1N5KA 4OB7A 1RC1A 3D7NA 4E4RA 2ZR9A 1AQLA 4PPQA 4HAIA 3B7WA 5TDHA 2X0JA 4EW1A 3R5FA 5CT4A 1IRXA 1A8IA 3D3JA 4G0ZA 4YXWD 5JC1A 2F43B 3FKQA 5FH9A 4RPGA 3EXIA 3WMRA 4GX5A 4XR9A 3BXEA 1DAMA 3NHLA 2GBIA 4II2A 2NXEA 1PBNA 2XB8A 2WWVD 3NC0C 2BFOA 2F1RA 3QV1A 2W70A 1RP7A 3G85A 4NBTA 5HKKD 5KOJB 2ECPA 2JI8A 3Q9SA 3L02A 3VBCA 1DC7A 1PK8A 2P11A 2H2DA 3IUJA 4MVCA 3ROZA 1JI3A 3T1QA 5H8WA 4EJSC 4G0NA 2DCUA 3WLEA 1B93A 4G4IA 3TGLA 4KPGA 2JKZA 2EJTA 5F4BA 2NVOA 5G4LA 4FB5A 5EN4A 4GZ5A 1N2CB 3LC1O 3S55A 3SBEA 3NJRA 1ZHHA 2OFXA 3NOXA 4HFMA 1E8NA 5DE3A 4ZCRA 5JZSA 3U3OA 3QEBZ 4KPYA 1BHQ1 3CT4A 3K09A 2C4TA 4II3A 2ZVQX 3R3UA 5FD8A 4Q4LA 3TF5A 3D3KA 4AUNA 4EYGA 1OLXB 4JL8A 3E2MA 2OFWA 4OP1A 2QE6A 4X63A 2CNWD 3BB3A 3NZEA 1FSSA 4OL9A 4OQMA 1FFDA 1GZVA 1XK7A 2VWGA 4ISBA 1N8NA 1E5LA 3NUQA 3PHCA 3CURA 1NVMB 4LE1A 4BWVA 4LYJA 1BQ4A 1HQYE 1ODKA 3D8HA 4RZHA 4TVKA 1UBFA 4B0OA 3GGDA 2JH3A 2JLXA 2HUPA 4JLDA 3RRBA 4MPRA 1NATA 3VJRA 1RZ3A 2V7UA 1ZGBA 3KCQA 3L9WA 1JTVA 2WHQA 3B51X 3FCSB 4YMLA 3PDCA 3EDQA 1N33B 5EJEA 1WU7A 1FS5A 4L57A 4MUGA 1QKIA 3WDKA 1JQLB 2OFOA 2X23A 2ZBRA 2ANBA 2VJLA 1WEKA 3DS8A 3ZLTA 4LCBA 3OQNA 3ILHA 1R37A 1DBPA 3KSDO 4I9NA 1CZKA 1WXXA 1RQNA 2H00A 1P0FA 2SKEA 4YECA 4JS0A 4BMVA 4IQFA 1H5QA 4NPHA 1H2HA 3MTGA 2IGTA 4KOEC 3VPFA 4D92A 2QT1A 3QRWA 1A9XA 4BO4A 1HFWA 2HSWA 1MJ5A 2OHJA 3CEJA 1KOFA 4GWGA 2VQSA 2WJZB 3COSA 3RUIA 1XDGA 2VJPA 3MC1A 4G09A 1Z4IA 3PR3A 4UU0A 5JAZA 4PVDA 1NJFA 2C95A 3ICOA 4JDPA 3CTMA 4OJTA 4ZV7A 2ORIA 1JEQB 1D4AA 4K6OA 4KQHA 4LHXA 3UW3A 2AOXA 2O2GA 4V0QA 3N2GA 3TWOA 1VYUA 2VUIB 5AW8A 4O1HA 1BDHA 5LYJA 4M21A 1TGVA 3BICA 1QH1B 4L2IA 4PXYA 3GT4A 3I8SA 1JECA 1L5HA 3ZHQA 4RZSA 3GF4A 3NKFA 1O89A 3B82A 4H7JA 4HN2A 2CFOA 3QTTA 3ROFA 4ALIA 2X8JA 1N0HA 1HYHA 1QIMA 2D8MA 1PE0A 5ECYA 4F4CA 3WTCA 3TZBA 1FC0A 1I33A 2CXHA 1AGRA 1Y3FE 5I5GA 4EBBA 2P40A 1R18A 4KYUA 4X60A 2IV3A 4CUKA 4E88A 1BVHA 5E9WA 1YZ3A 2XQFA 4WV3A 3ROXA 3ZE9A 5B4TA 5M7EA 3LTNC 4J0DA 5BOVA 4W6ZA 2HFKA 1YVDA 2GPNA 5KUTA 4JGBA 4TSKA 4YXFA 1KTIA 4UE6A 2XEXA 5JYDA 1D4FA 2HA4A 5CXXA 5JOQA 3T7CA 4FFOA 3EQ7A 3TS1A 1FUYB 2FP3A 4ZT4A 3IAS1 1Q5PA 3QUCA 2ISCA 1Y5LA 5T4HA 1EVLA 3SS8A 2VNHA 1EH5A 3DVQX 3I2JA 4L5YA 4HEA1 1Y3DE 1KERA 4GPAA 1CJTC 3NNNA 1IJEA 1DEKA 2FEMA 2C04A 3C6ZA 3EEQA 1XEWY 2C0QA 4ARUA 2AE1A 2HA2A 1FNSA 3QYFA 5HGJA 2QG9A 2JJ2A 2OYRA 1TF7A 4DNOA 2DXIA 1XEXA 3PXEA 2AJLI 4EECA 1ZG3A 2DWCA 3DMFA 4W4TA 4TQAA 1JQJC 4F93B 2ZUUA 3AM5A 4IW3B 3IT2A 5F1KA 4AC9A 4BIMA 4MVJG 1QFSA 4N0EA 3CE9A 3NH6A 1AF4A 1G4HA 1JZTA 1FP2A 5SYMA 3TXYA 2F1HA 4HZIA 2X86A 4LV6A 5JS2A 5HZKA 4BL5A 2BTEA 2M9MA 3FVWA 2WB2A 3SZGA 4MUFA 3CUVA 1FW8A 4S05A 3EQ8A 3IH5A 5T41A 2PX4A 4CCSA 5EKXA 1Q1GA 3ZWYA 5K4GA 2SCUB 1BDMA 2HT6A 1OFGA 2ZYUX 5DLYA 3SBOA 5LD2C 1D7OA 2ECQA 2VVTA 4LJ4A 4WXHA 1AQYA 2DBVO 3AOGA 3LRPA 4ZVOA 4DW8A 1MH1A 5BP7A 3N87A 2ILTA 5ESXA 4RY0A 1V0JA 1NR1A 4AVYA 1Z4QA 1ZBDA 1RD4A 3FB1A 3PKZA 3B3QA 4OGFA 4OIMA 4CNQA 1YFJA 4KR6A 4EYQA 5ALGA 2Y6VA 2YMPA 2DUUA 3H0KA 3RVPA 3MFYA 2ZI7A 4YAFA 5KQMA 2VUUA 4AY6A 2O2ZA 3BIJA 4PLTA 3PD1A 4IDAA 1BXGB 3RW9A 3SFZA 1YB5A 2IEDA 1U1CA 2DQYA 3ESCA 2BW0A 3IP7A 1OT3A 5ELLA 4E22A 4E5YA 3PX2A 4IUYA 3ABSB 2TYSB 2VBIA 3F6YA 4F86A 2VT2A 3D4BA 2FA9A 4HK4A 1BHJA 5DLDA 1Q7RA 1FX0B 3EPPA 1VKOA 3SSMA 2QZPA 4WESA 4RAOA 3V8QA 4M0FA 4C22A 1MW9X 2TSYB 4R2KA 5JFTA 1PV4A 3T5PA 3K35A 3O4HA 4QYIB 2ZXUA 4DDMA 1ZXBA 2NUAB 3BQMB 1FYDA 3OMXA 1C50A 1C3EA 2JBWA 4TTVA 5DNEA 1SCDA 4LVCA 5DLQC 3QI2A 5FI0B 1T3HA 4KJZA 4RGQA 5G41A 6ABPA 2HDHA 5ALOA 1Z4MA 2VI5A 3CUYA 4U2CA 1GZHB 3L46A 3KWFA 3ZDFA 5U9CA 3VYRB 1WEHA 1HFEL 4KN9S 4BYGA 3CV3A 5JRJA 1OXKB 1W52X 2IW3A 3B36A 4KN6A 2Q5JA 4JP3A 2OV8A 4F2HA 2X6TA 4V39A 3INGA 4OCZA 3L7NA 4AUMA 1RXWA 1P1FA 4XIJA 3FHCB 1EXVA 4G5YA 2ODTX 1J1ZA 4LV5B 3SDZA 5TT1A 1SXJA 2C0PA 1IBMB 5TIIA 3DCYA 1R4ZA 4C2UA 2NO7A 2PX5A 1U4NA 2D59A 2C88A 2R7LA 3EF0A 2R4UA 4TWRA 4ZWNA 4JI5B 2AUNA 2VHZA 1U11A 4N82A 1G5HA 4PQFA 1A4XA 4IJUA 2R6R1 1G6Q1 1TYAE 4FGJA 5KOHB 5BN5B 4JITA 4TYWA 3ZPXA 1YQEA 2OCBA 3O3NB 4NYMQ 4UVGA 2VOJA 1M5RA 3NS7A 4L72A 4L85A 2P78A 3GRZA 4IJ6A 1EUZA 1RACA 2Y0PA 4IXMA 4DXAA 3RSCA 4QU0A 3CH4B 1Y8AA 4ILEA 1PNQA 4Q9LA 1XQ9A 3KOZA 1D07A 3R7FA 1MQ8B 4X65B 1ZN9A 3COZA 2PYZA 4Q3LA 2HMUA 4MQMA 1C0LA 3REFA 2CUZA 4X85A 2JAQA 3MJCA 3LQ2A 2JAUA 2WJ6A 2WNSA 1RMQA 5CLJA 1KDRA 3B1XA 3EK2A 4PZ0A 4WECA 2JBHA 1L7PA 3O0DA 1YS6A 1UXOA 4GZ6A 4RFSB 3KAKA 4UM5A 3I4LA 2GJAA 1G2OA 1C9EA 1M9NA 2ZQ5A 3ZYZA 5H83A 2R11A 5DNUA 2NAFA 3OZBA 1S3IA 3PNSA 4WIAA 2H54A 2QPOA 1EYZA 4OH1A 1QE3A 4PN7A 1NNEA 1NW3A 3AR7A 3HADA 1KZ4A 2XD4A 1R88A 1VJ5A 1YZUA 3HNRA 1D2GA 1V1MB 3X1ZA 1C8BA 1DBWA 3RUFA 4BHTA 4D74A 5FTWA 1KBOA 2VT7A 1LBIA 2GTPA 3T12A 4J94A 1P1BA 1WLSA 5B7PA 4BVFA 1XMXA 5BVGB 5KTNA 1LWNA 1OOEA 2I2BA 2X41A 3VO8A 1W85A 2XUHA 2OBFA 3WRWA 2O3UA 4JYBA 4AO8A 4IIYA 3LL4A 1VRCA 5JJCA 1U4OA 3L43A 1UT8A 4LKRA 4MQ4A 3FW1A 2EBHX 1LZKA 3B3AA 4NVRA 1T2NA 4KWCA 1Y81A 1B8PA 1J6UA 2AFIB 1UM9A 1WZNA 2WDPA 4F5DA 1DWUA 1BGWA 1HMPA 2CD7A 2WWGA 4D8TA 3EVNA 1XVLA 2FLVA 1ES9A 4J2HA 3AJ9A 2FKNA 3CINA 1CJUC 1MT3A 2QW8A 2DWPA 4HWOA 1FFAA 1P18A 2BKEA 3GYBA 3VPGA 3ZTWA 5JZ9A 3REQB 4I19A 2ATVA 2R7MA 4HJRA 3AW9A 4FKZA 1FQKA 1NRXA 2HL6A 4IDFA 3UAYA 3ZUGA 2AI1A 1M8JA 3PQ3A 4M6WB 5TV2A 3QU7A 4H6PA 2PQ6A 2V0NA 2EIXA 4CF6A 3LY5A 4KRGA 1SHTX 4NEGA 1ANKA 4X94A 2B37A 3OM8A 1J0BA 1ZUNA 2GI4A 4Y0VA 3G1TA 3DLBA 1N6HA 2OMKA 4PLPA 4B8YA 5ECGC 4P0TA 4E4YA 5KSOA 4BLUA 4EG8A 4JR0A 3PDUA 1ZCJA 1AO0A 1ABBA 5IG2A 2FQ1A 4GE0A 4FQ5A 4ZZIA 1GNSA 4CKBB 1ABFA 2WQZA 4HGYA 1QQBA 1UJ2A 2HWWA 3B6IA 3LUKA 4G67A 2P7HA 4KIJA 2OBXA 1DKRA 1YI0A 1U0BB 3FB4A 4F45A 1ZDMA 2V58A 3M34A 1MIOA 5FX2A 2FG6C 3TLAA 2ONJA 2C3OA 1DAIA 1R6UA 3FTNA 1NAHA 3DHNA 3SHTA 2VDQB 1W93A 4FSHA 1XSEA 5MGBA 4ARIA 4LCJA 3O3OB 3GA5A 2UDPA 3CNOA 4R2JA 4TV9B 4GBED 4A73A 2L18A 4RTJA 1DAFA 3CEAA 3RBVA 1XKLA 3OFNA 2QZ4A 4NARA 3CJRA 3GMDA 3ILXA 2ZDGA 1YHZA 4G41A 4NENA 4EHIA 2ODEA 2OG1A 5FPQA 5ALEA 3EXG1 2QD5A 3K53A 5JPCA 4RAQA 3FFXA 1G9SA 2G67A 4QJBA 5FAXA 3ML1A 3EGVA 5HRCA 4LNUB 3OIDA 2ZZMA 3ZQ6A 5KDDA 2QMEA 3GI1A 5F1OA 3O4GA 4EGSA 3KXPA 2LE0A 3MJVA 1NOIA 1A2KC 2H1CA 5KYYB 2WIAA 1C0PA 3LQYA 1OGIA 5TQ0B 1VKZA 1N2ZA 4ZRMA 2ET6A 3UOAB 1XVVA 5CLQA 2EFGA 5HKOA 1JKIA 2OB1A 3G2MA 3P4XA 3QPWA 4BCBA 3DEAA 8LDHA 3FR7A 4WBNB 1M0SA 4HDKA 3II6X 4G0PA 2JC3A 1GUDA 5K4HA 1XR3A 3NTOA 5HNKA 1PZNA 3VR5A 4HP8A 3EN0A 4Z7JA 4G0UA 2HY7A 3WR5A 1WHSB 4C78A 4H27A 1BWRA 1M34B 1SQGA 4P4SA 2QE7D 1ML3A 4QAQA 2OCLA 4TLMB 4JLPA 4YROA 3TEFA 5E6RA 1SCBA 2HCBA 3SBDA 3WLOA 4ZCPA 2J32A 2KB0A 2PGIA 5L51A 4CTJA 2VQ3A 3AU8A 5J47A 3B1KA 4LYDA 2VSYA 4TVOA 1VI5A 2A57A 1KY3A 2I2CA 3ZGNA 4HNTA 1KGDA 4QELA 4KAAA 5LA6F 2J9YB 4J4HA 3U56A 1DWPA 3IELA 2ID7A 5A4KA 2OO5A 4H0CA 3EZXA 5D5QA 1K3UB 4HNQA 2OQVA 2I22A 4HDRB 1L9XA 2OZKA 4C0JA 1DAOA 2A2ZA 4UPDA 4ZQIA 4Q3AA 3IAHA 4UTOA 4X61A 1Z8FA 3V1KA 3WTBA 2I99A 2ZATA 3HJRA 3PFWO 2XRMA 1U2GA 5DBEX 1NAIA 1XDUA 2M6LA 4EGFA 4GU5A 2JVJA 3MT9A 1Q0QA 2HLHA 3CH7A 4WUTA 1GEEA 2CLHB 2F9LA 3I09A 2XKBA 1BKDR 2TMKA 4TLDA 3UTDA 4QFMA 3JQ8A 2CLSA 1NRIA 1N1DA 2P8SA 1B1AA 2HSDA 2AR7A 3AC0A 2IZ7A 1PP4A 2FPMA 1U31A 1M6EX 1JB9A 3D8NA 2GD2A 3OWXA 1K7YA 2WFLB 3MT8A 2ASEA 4ISCA 4KFTA 2X1LA 4XWTA 3FOWA 4FXPA 1K9VF 3BGVA 2BFBB 1DLJA 2CSXA 4RE6A 3NC4A 4INJA 5C8YA 3VZSA 5ICCA 1O9HA 1EDDA 4ETMA 1NQOA 5F2EA 3C1TA 4Q47A 3T4PA 2OUIA 1K6XA 1RXSA 4AWBA 6NULA 3SQLA 1JHUA 3FLMA 1ZXLA 1WHTA 2IUYA 1WPQA 3HVRA 1AKMA 1O3YA 4OMFG 4O29A 2C8JA 4Q1VA 4DZTA 3OEEA 3GPDG 4DEYA 3SS9X 2MJLA 1DEAA 3DMHA 1R5OA 3F6CA 4LA4A 4DJTA 1GG9A 3GA7A 2CVPA 4M7PA 3JQCA 4BB0A 4NXMB 2FG7C 1XJQA 1KK3A 3KZVA 1NVVR 1JA1A 1EBUA 4PYKA 1LNSA 5IUJC 4M0CA 1GDHA 4U8HA 1JLLA 5EIOA 4YCLA 2BE9A 5BY2A 2PJRA 3AL0C 1XV5A 3EHDA 2CHUA 3IAUA 3K0KA 5LXTF 3NBMA 1U4SA 2KBFA 2ZS9A 2WQ7A 4ZI7F 1H6BA 1D03A 2NSHA 4JEIA 4KXMA 2VDNB 3VSDA 3T34A 1C8LA 5IWAB 2QLJA 1KI9A 4PXAA 4OX9B 1EWQA 3ZV7A 2GFQA 2YJZA 1C80A 1U8AA 2IU4A 2ZRNA 3UHOA 3WNBA 4YCNA 5BNIA 2G7ZA 2ZEJA 1IQ0A 1X19A 3GUHA 3VR5H 3EA5A 4B5KA 1GFZA 2G40A 1IBLB 2O2EA 1E6KA 1BS1A 1HE4A 2FUG6 2FPPB 1ENYA 3P0HA 1RBZA 2EEPA 5IBQA 1JHDA 5AXBA 3RFCA 4N12A 1NM5C 3RJTA 3LVBA 3E23A 2AVDA 3F9RA 1XFDA 2W22A 3FGNA 4KXFB 1JU3A 1JVBA 2Y1KA 3CSDA 4PO1A 5JVDA 3MMZA 1BAPA 3K0HA 4IICA 1IN7A 2WJIA 2H2WA 1BMFD 1T6XA 1ZH8A 2W2PA 2X6RA 3ITNA 3N7UA 1YRWA 3R23A 2JZNA 4JIMA 4MP6A 2E2WA 1IY1A 3FMOB 4XSVA 3KJEA 2QTCA 3M6LA 3V7WA 3NP7A 2HRRA 3CRQA 1NLZA 1TADA 3IBTA 1WLYA 3ILSA 4JI1B 3NFYA 1UBNA 2WD9A 1EESA 1M83A 2IHJA 1XRQA 2REOA 1G8HA 2V0CA 2FEXA 3KDAA 3M83A 3Q72A 4P92A 3AUAA 5ALWA 4B2PA 5KWSA 3RU2A 5I9LA 4RLFA 1XHEA 4UEKA 5FTMA 1Z39A 3TSOA 4JL6A 5C8DA 2D3TA 1CUIA 3FIJA 5KQSA 4UQLA 1Q92A 4BLWA 1TEZA 5AR1A 1C3OB 1R6AA 1DIOB 1URPA 1W6RA 5A4IS 2W6QA 8ADHA 2OESA 2DPMA 2JGDB 3PWSA 4F2WA 4R05A 4PSUA 3W7BA 1E2JA 1GNRA 2PK3A 3VUFA 4HCJA 2QN1A 3BXPA 4XM0A 2D5IA 4D0LB 4LF9B 1GN9A 1SCIA 1QGUB 2AMJA 3NFRA 2VJDA 1C7IA 5F5XA 2RGGA 3SQDA 3ZZMA 3QSYA 2QTVA 1PQWA 2O57A 3NVDA 3GFSA 2R5NA 1B74A 4CTMA 2Q4BA 4Z99A 5LLDA 1I4LD 3I42A 1SBNE 1I4TD 2ZYGA 3OCUA 2YS7A 5JDIC 3O82A 2A5LA 3T9AA 2Q3MA 3QMPA 5CJ2A 3G17A 1A7UA 4JFAA 1W9MA 3SHVA 1A8SA 1Q7CA 2PQMA 2OO7A 2NXCA 1JLSA 2RJ3A 1XCPA 5JNWA 2RHJA 5AJTA 3WFJA 4RTRA 4Y9RA 4DIDA 1L6IA 4YRLA 1PX0A 1W36D 1JZQA 2DR0A 3CT6A 1IOWA 1N75A 2JATA 1QG2A 5B55A 5JCOC 4LF4B 3UANA 2WYIA 5CFMA 1S6YA 3LHKA 4M9RA 1YJ8A 3B1JA 2ZJ5A 2GGSA 3TUJC 1OU0A 4QOEA 5CFLA 1UAAA 1KDTA 4HUQB 4ZI2A 2FJPA 4HNGA 1G3QA 3OC0A 2ACVA 4CG0A 4HXEB 2QUAA 4GH5A 2H9YA 3A3OA 3LW8A 3QUBA 1MJGM 4MI1A 2CMDA 1OXSC 3U4AA 1AV7A 3Q3JB 1OLUA 4CG1A 3BWBA 3RTAA 3TDKA 4DV0B 1T9KA 5HK9A 1NC1A 2HU5A 3ZLJA 3I6BA 3MUEA 4S1VA 1K7XB 3MUOA 1V5EA 5ETJA 2EFJA 1QMGA 3VR2A 1YIOA 2D4HA 3M4XA 1UWKA 2ZQZA 1B41A 3ECAA 1G1MA 2WF7A 4G4SP 4LZOA 4P5EA 3T1HB 1ISGA 3I2IA 1M74A 3ONFA 3L01A 4Z7NB 1HWYA 3KB2A 4HRVA 1UMCB 3JYLA 2CFSA 1OI2A 4E32A 2YWCA 4RKWA 5C80A 3IE1A 3A6KA 2AOTB 3KL4A 1MR3F 1QFXA 3DC7A 3H1EA 4RF3A 2C1XA 2P3SA 4YP9A 4ALNA 4C4XA 5I45A 1TGYA 3PUHA 1TVKA 3A70A 3BK2A 1W0JD 2CL0X 4GRDA 4ERNA 1JAZA 5A62A 4BNDA 2VHTA 1RQ2A 1TE2A 3DAGA 3B7PA 4AF8A 1W88B 1BWSA 3H17A 3OAAD 1V4NA 3JQ7B 5KQPA 1I2DA 4L02A 2E4YA 4YUAA 3QOFA 1H5UA 4E07A 4DDWA 3WMWA 5DM2A 2C8LA 3VVCA 4XPIB 2H1WA 4AN1A 1Z15A 1MU0A 1GD1O 1N5IA 1VLHA 3OZ7A 2F9MA 4L0DA 3KSAC 4B7ZA 3GCXA 1OHHD 3VU1A 1GNTA 2B5VA 4V0OA 3VZCA 2FW1A 4QASA 5JXIA 3TAUA 5LQUA 2YXEA 4GZLA 5KYVA 2VJMB 1NL3A 4Q9KA 4MV3A 1YQ9A 3AEKB 2ZVDA 3DF7A 4CI0B 2RH9B 3TKAA 1E7MA 3O31A 3TLKA 1NSTA 5B57C 3WNDA 3H6GA 1GAJA 1P3DA 4ARSA 2Y1OA 2XE7A 4LDNA 4YT5A 4FOTA 4ARZB 5AJWA 3W6UA 5JALA 3M1YA 3MGGA 4MMZB 2X76A 1G6HA 5L4NA 4JLBA 4K2HA 1RJ9A 2VPYA 2O8DB 3B2QA 4JCCA 4KYVA 3K9BA 5CVEA 3VBEA 3FTQA 1N8TA 4DLYA 3CW9A 1UXJA 5J59A 1Y0BA 2DWUA 1DI0A 1E58A 2OZLA 2NSYA 3PCXA 4FYVA 3GLGE 1MF7A 1KMQA 3WK6A 2Q6KA 2ZFUA 1XLWA 1KYWA 1E4EB 1V11B 4HDAA 4JYCA 4D0SA 5I8PA 4CEJB 2BEUA 4J0JA 3K3PA 2Z09A 3IIIA 1VJDA 1BE8A 1FRFS 1QQ6A 3WJ2A 3D2LA 3VR3D 2GN2A 3THWB 1I1QB 1M8GA 5I3CA 3KR1A 1R6BX 2IH2A 1G3MA 1K06A 2I3AA 1TIBA 3ULKA 1AMUA 3VDQA 1GL7A 3M7IA 2B99A 3C3YA 4NU5A 1O96B 2AN3A 2AJCA 3AF2A 3HBNA 2RI0A 1T9DA 5LYYA 2NZXA 4UUBA 5DHPA 1FFCA 3IV9A 1ZD9A 1T0HB 2RGNC 3GLIB 4IQ0A 1YDHA 1MX1A 3DR5A 4LC1A 1PVDA 4ZCMA 2C4VA 2W6NA 4FI3F 2EP8A 4YRRA 3SD7A 4AS1A 2OLJA 4Q03A 1MOQA 1E6UA 1OZGA 1XALA 2O2XA 3DXFA 3K0CA 3VYUB 1BXRB 1H2ZA 1IAQA 2OO3A 5CM9C 3ZNQA 3GFGA 4UQOA 1L3IA 4GZMA 1TD9A 4W1QA 3OQ6A 4R7TA 3WK7A 2CV1A 1QHGA 1G17A 2WP8J 5TPZD 2XZDA 3P2IA 4Q4JB 1A2QA 4O0LA 1UK7A 1OC2A 1KSJA 3M1AA 5ICSA 4MA5A 4IM7A 2XQIA 3DDWA 3OJXA 1DKNA 4IDOA 5BYAA 2R79A 1AV6A 3BTOA 2JKYA 2YIMA 1U98A 4ML3A 2ZWIA 1XQWA 3W9UA 3ENQA 2ZDHA 3V1YA 2IUTA 2O8BA 3L41A 2FN9A 4OM7A 4KR3A 2Q50A 1UFKA 3LHIA 2FB9A 4A36A 5LQNA 3P9RA 1LV8A 1RQXA 3VHQA 3ZKWB 2YHAA 4IHQA 2YWXA 3IP3A 4IVQA 2YKGA 5JQWA 1DNPA 2PUWA 3UPUA 1BXKA 4F4UA 4NC9A 1E61A 4E5KA 1XZFA 3K9NA 4B6SA 2R68A 2A6PA 3L7LA 2SKCA 3L6CA 4FD3A 3EOZA 3PFGA 1QNFA 3ZE7A 3TZQA 1P2TA 3RYHA 3EDMA 2VKQA 4Y2HA 5CD1A 1J0DA 1YIDA 3WMGA 2HU8A 4XI9A 4ABYA 3TTXA 4KW7A 4D41A 3VYSB 3RV4A 1G0OA 3DOJA 4ETWA 5LZ9A 4W9NC 1MB2A 1IXZA 1CTQA 2VTEA 1HO3A 4JMPA 2IU0A 1MO5A 3N2ZB 1UIRA 4IS3A 2YY7A 1TO1E 1KR2A 2I1LA 4TSFA 4ECAA 2FZKA 1X1TA 2WR8A 1SUBA 4JLNA 3V7YA 3ANXA 4ZVVA 4B1FA 1FTGA 3OEHD 5CFZA 1CR1A 4CT4B 1T8UA 3ZCVA 3M6VA 2HB6A 2VDWB 3IYLW 3JVIA 4ZAGA 4U7JA 1LPAB 4LMAA 1Z2AA 3NATA 5GQSA 2FYTA 3KRTA 3A9CA 1Z29A 1BGXT 1Z0ZA 3PX7A 4G0MA 2YZ7A 4FN5A 3RVBA 3O2SB 1VPDA 1M6NA 3IL2A 2VATA 1IVNA 5K6RA 3HY4A 1APBA 5IDXA 3IAM1 2F4NA 3REGA 1T9GR 3FETA 1JJ7A 1U2DC 1YBVA 2YVAA 3CU5A 4Y18A 3N0WA 3CNLA 3OI7A 5CEEA 2XMZA 2J7PD 1X42A 1J8DA 3GNTA 4GM0A 5IJAA 4NH0A 4BLPA 1A5BB 3UJ8A 3HSKA 1NW8A 4G4SO 3LX8A 1B6GA 1BX3A 2COUA 2WT4A 3G2QA 1C3XA 4HN4B 5HM6A 1JLKA 4D96A 4MW7A 4N5IX 2JFWA 2BTQB 2ZU0C 3IO5A 1SPBS 1U0SY 3HXPA 5AVXA 4B7UA 2O1SA 4ZCQA 4PIVA 3JX9A 4EPXA 2X7HA 4B76A 1T36B 4LX0A 4XWKA 1H0KA 1AVTA 1LC0A 2WWWA 3VSBA 7MDHA 4H6XA 5A9SA 2PA0A 5EJGA 4DSNA 1U1FA 3AL3A 4D9BA 1OT5A 1CKEA 4HFJA 3C74A 4DCTA 3LUJA 3WL7A 2UUCB 4OTZA 5JAPA 4QTXA 3D0KA 3VX3A 1YV9A 4HWGA 2XA2A 4MPPA 5JZBA 5JFGA 3H84A 4N54A 5CCXA 1CS0B 1I4DD 3T7EA 4BO8A 2VBGA 2IOQA 4B17A 1NBME 1J49A 3A1NA 3TZLA 4XZ3A 2JLBA 3DPUA 4IS2A 4JOQA 2I66A 1CP2A 3EXEA 3KHTA 4GL4A 3K70C 3V4SA 4CF4A 5K3FB 1EFPA 4E30A 5ALLA 1E2LA 4EA8A 1IN6A 1BX1A 4CWAA 5I6DA 5FLXA 5D6NA 1VMIA 3FTDA 1CY6A 3ZG6A 4MV4A 4D6XA 5I7SA 2FSSA 1CJBA 1FP4A 5JI2E 2B2CA 3SSNA 5K0CA 5HF9A 5TB5A 2E5LB 3PI7A 3R0ZA 1A5TA 1RWKA 2F4VB 3I23A 5AH0A 9ATCA 4P3XA 4JBHA 4QWMA 5JH7B 2ZSKA 5ITVA 2GZ3A 3C3AA 2OPBA 5KVVA 3HKDB 3Q1KA 1GFSA 3C7DB 5F7XA 1LVHA 1XRLA 4YREA 1KS2A 3KCNA 3BIOA 2JS7A 3DO5A 4K6GA 4I55A 4LMRA 5JLAA 3ZGVA 4Z51A 5GJBA 2IBSA 3OCYA 5JNTA 2P5TB 3LPMA 3HV0A 2IX9A 5K8TA 2JG3A 3AK4A 2WWFA 1WETA 1T9CA 2W6PA 3T0GA 1VKHA 5BMVB 4MR7A 2CK3A 1QHHA 2XB6A 4J90A 2JLVA 3I9KA 4ACBA 3HBAA 1EX6A 3PQ8A 2YOHA 4ZP1A 1R5BA 1F0NA 3UPDA 2VPWA 1DQSA 3ANNA 1WKCA 5AKLA 3PENA 4NDNE 2PBZA 4PZEA 1NN1A 1CBUA 3D7KA 1JAXA 4ZJPA 5C5IA 1GAEO 1HETA 2NSLA 4ZJUA 3PEYA 3Q6MA 2X0FA 1UP6A 3DFUA 4IZ6A 3NM6B 4V2UA 1T4CB 4BC0A 4R7GA 4QNMA 2ZI3A 3EVTA 4RKRA 3I61A 1US8B 3IHTA 1ZW1A 3GZ4A 5L3RA 4FCVA 1QVVA 2A9PA 5MF6A 1RHKA 3PSAA 2G1PA 4REMA 5KZMB 4NFYA 2IYFA 2IY8A 1Z34A 1AK2A 2GYVA 3SDBA 1B8UA 1JRLA 5HJ5A 2QI9C 2XX3A 3LUFA 1A0OA 4Q24A 5KX5B 4RSHA 4ZIRB 1VCHA 5I48A 3VOBA 4EHJA 5FRDA 1J2JA 2NGRA 1MDFA 5BNZA 2CNLA 2GOYA 4B73A 3E5RA 1BOFA 1FQOA 1HI9A 1TA4A 2PKCA 2ZTLA 5A7GA 2A30A 4NE9A 3R6DA 4X8LA 2SECE 3UEOA 5ED0A 2REQB 1NDHA 1EXMA 3BAZA 3M6UA 4RXTA 1P61B 2ZYRA 3JQAD 3RVSA 1RADA 3HP7A 3IRVA 5IBPA 4H4EA 4WN3A 3HO6A 1SKYE 1OXBB 3ZC3A 1IQUA 2VNAA 4ZFNA 4QBTA 2XVYA 3C15C 3HBFA 1FFSA 1NI5A 1XAHA 1I0IA 5DGHA 5BYBA 4D9JA 3WIEA 3B9BA 3C5VA 1GGMA 4GSKA 2GFIA 2AG6A 5KS2A 5BR1A 3H2HA 2ORYA 3A37A 2OXCA 4JOSA 4H08A 3A0UA 1EX1A 3D0OA 5ECWA 1XLTA 4RIEA 5KYNA 5HYVA 1Y1LA 2W6ID 3K1ZA 4KO2S 4ZHSA 1P5FA 1U7XA 4ENWA 4S1WA 2LV8A 2IDJA 3EVEA 1W5AA 3AJAA 3NPMA 4QGAA 3SHWA 1QJCA 1F5SA 3GU3A 1W36C 4C29A 5CLLA 3IXMA 5BO5A 1I94B 4F56A 1NIJA 2HMTA 3IIMA 2JGMA 2ZRLA 4KH1A 4LXTA 4QD3A 2XODA 2QRHA 3NP9A 1LI5A 3WSTA 1R0KA 2XH8A 2Z2XA 3BGWA 1U02A 1X6VA 1GOTA 3LUAA 4Q4HA 1IM5A 2JGAA 3E05A 3I6YA 3WNVA 4TUYF 3LPDA 5DSZA 3OQJA 2P35A 3IXQA 2HPHA 4FW9A 4NIMA 1FLVA 1CEEA 2J9FB 5DTMA 4UTNA 4DB2A 1X86B 3SX0A 2ZRJA 2J5XA 4Y1EA 2IS6A 3SKYA 4XKJA 1HT3A 3K0AA 4Q93A 4FC7A 2DQ4A 1CLEA 1L4EA 4EYKA 4LI3X 4PNZA 3U9SA 1UOPA 4FI3C 4E3WA 3EC7A 3WO0A 1VCIA 1CIVA 5LC1A 2QN3A 4IF6A 1KDOA 4ZGWA 2CXOA 1I2ZA 4EKIA 1DDOA 3F1KA 4RXUA 1Q91A 1GWNA 1X74A 1TVCA 5K0NA 1Z6XA 1ADGA 1W581 3M6WA 4FDUA 4PONA 3EPJA 3OF2A 3FSJX 1JDPA 2YHIA 4CKYA 3R09A 1DMRA 2AQ8A 3HJCA 1G42A 3ET4A 4NOJA 1QK4A 4HSGA 5I7EA 1J9EA 1QJ4A 3O21A 4MR9B 1V3UA 1XROA 1EPUA 2H18A 2CC2A 2GR9A 1N5OX 2CXUA 2NSJA 5FR2A 4P3NA 1E9RA 3EIHA 3W34A 4DMMA 1M7BA 3L04A 5SYAA 3FDJA 1J42A 4NBRA 2UXDB 3RQIA 1QNLA 1X94A 1E1DA 2YVLA 2PIAA 3FF4A 4TT3A 5K3DA 4PO3X 1TRKA 3EAQA 4J1NA 2NIPA 5DHTA 3ZTYA 4RANA 4XGQA 4MAAA 1ZIXA 1HPLA 2F64A 5AI4A 4O4JB 1X8LA 2J09A 4YRGA 1E92A 3TUZC 1ZD3A 1PJ2A 1OYWA 1PF7E 1H6AA 2DBQA 3AETB 2PLAA 4K05A 3BEOA 3D7SA 2R0QC 2Z5FA 5IM5A 2FSFA 5AQ1A 1K3FA 1O6CA 3JASB 4K9SA 5KOIA 3CUTA 3JQEA 3PDJA 3PRYA 1GKLA 1WB4A 2GXUA 4WXMA 1FFBA 2WZDA 2G6BA 3MT0A 4KDFA 5LZ5A 3U3MA 4E1BA 6CHYA 3OM1A 4KQGA 1GHTA 4QTYA 2A88A 3UXYA 3KLPX 4WSOA 2FSVA 5F7ZA 2YWHA 3DKKA 1V71A 3L4SO 2OHXA 4RELA 1R4MA 2ZLBA 5HPYB 1X70A 3MF4A 1NJ6A 3JQAB 2LWIA 1HLDA 4OB8A 1UL1X 1GQRA 1IRIA 4WNIA 3F7TA 4L4YA 4S3MA 3DDOA 3F71A 4WY8A 5A4MS 4J07A 4MYUA 1A69A 2YQ4A 4Z7OB 1EUDA 4JT2A 2AG8A 1D5WA 4RDXA 4D56A 2FX3A 4HUTA 1MZVA 1EWRA 2J5BA 1BJTA 1PX2A 1H94A 1J07A 2H57A 1YULA 3E3AA 4QNNA 2NVWA 3ZH9B 4G5RA 3QYJA 4GSYA 4LJLA 1YCDA 5L3QA 1GJRA 4HQKA 3U4QB 1SBYA 1XD2B 4M53A 5E9AA 3O8BA 2XQJA 3TTSA 3EVGA 3O9ZA 5DHRA 2APJA 1E6EA 4C0AC 1IXRC 2JCVA 3QA3E 4KWIA 4EJ6A 3R8FA 4IDHA 3RROA 4X41A 3OX1A 3ZWOA 3V4FA 3ABIA 3SX4A 1IB0A 3DEYX 3H1PA 2NQTA 1HNZB 1Z6AA 4TWZA 1AN9A 4RM2A 1FRZA 2Q46A 1TJPB 1T2CA 3QX7A 3ADKA 3KOXA 4MGZR 4YJ2B 3E4CA 1V8FA 2DB3A 4NONA 3LG2A 4RK4A 1OASA 4K1XA 2AXNA 3GJ8A 1NW6A 4P82A 4H17A 1IIBA 2QVXX 5FBKA 1G64A 5JQGA 4IRMA 2QY9A 2ID9A 4V0NA 2FZVA 2MTBA 3EF1A 2WV9A 1KFKB 3LKZA 3JQFA 1JFFB 1KEZA 3DWGA 2NTNA 2WFZA 4N03A 1JNXX 2XHZA 4GOLD 3R8XA 1M2VB 2AIRA 3FYSA 3LL7A 4RENA 2P30A 5I7RA 5B53A 4JLAA 3PIDA 4OXRA 2ENWA 1AUXA 5LPNA 3Q2KA 1UPFA 3E7DA 1QRDA 3K15A 3U44B 4JUDX 1H2AS 3I2HA 3DKPA 4PM4A 1FFHA 1P1IA 1YR9A 4Y2TA 3IUSA 3EW9A 4DAOA 5JAHA 3ROTA 3EE6A 4QSMA 4DIKA 1N8SA 1R0BA 3MTDA 2H08A 2QM0A 2BJVA 2COEA 4QTTB 4G1FA 2D74A 2R7KA 1KQNA 2DZDA 2GKGA 4IAOA 3VMMA 2AI3A 3BH0A 3AYZB 1KOGA 2B1GA 2PR7A 2WA2A 4BC1A 2ZUCA 4UQPA 1EX7A 1J5EB 4N5HX 4LNHA 4R2LA 1D1PA 1NI3A 1ZPDA 3C87A 3LOQA 4WTOA 4TTSA 5IULC 5CYFA 8OHMA 4J1TA 1Y3HA 3HKEA 3NHZA 1TLFA 4HC4A 3BL8A 4RH1A 2PX3A 4JEUA 4RA9B 3Q7SA 1K88A 3ME5A 4X6YA 4IP0A 3ZCXA 4XVCA 1XTSA 3DE6X 4ON9A 1X9HA 4H15A 3T9CA 2QX9A 5EIHA 5IYZA 4GOMD 1CEYA 2GEBA 3S2ZA 4MOWA 5EQFA 1MO4A 4BYMA 3QWBA 1YMQA 1XF9A 2XYRA 4TT8A 1ZW6A 4X7PA 1GQQA 2F00A 3BRWA 3KPWA 3UJCA 1N3IA 1Z25A 4MRVA 1XQXA 2WVGA 4QDZA 3OWHA 1IHPA 2IYOA 5KYWA 2IC5A 1H8HA 4DR3B 1C7JA 3A6ZA 5JMPA 1MFZA 5FLKA 4JUFA 1B26A 3F6BX 2FX2A 1QBKC 2RIPA 2Y0BA 3KZCA 2XXAA 1FLAA 2W48A 2Z5LA 3KTFA 5JNUA 2JD1A 2H9AA 1SRQA 1IULA 2X5NA 4RL4A 1QWSA 2FRDC 4DA4A 1DB3A 4IIBA 3DV9A 3G2PA 2QA5A 1CUJA 5LWQA 3OJOA 1LNZA 4JEMA 3SZMA 2H0AA 4C0BA 1YIAA 1CE8A 3DCIA 3P27A 4LRXA 3ABOB 4EVQA 1AB6A 3MWEA 4DRXA 4NCBA 2JHPA 3PJFA 3NWBA 2D5LA 2XUIA 3KPVA 4KFRA 1KPIA 4L6IA 2I3ZA 4MQLA 4TMKA 3PXUA 3Q7RA 4QT4A 2QTTA 3A7DA 2B5OA 5DISB 4E4TA 1RVV1 2A0KA 4ZJZA 5I7VA 3A4NA 3ZY2A 1GGHA 1Q0TA 4WNCA 1LSJA 3OO1A 2DHEA 4MXDA 3H2SA 1ZMOA 4C07A 4OEHA 3WWPA 4DNQA 1CRZA 1IJFA 2I2DA 5JSQA 4FYXA 4LWOA 2VP0A 2OLKA 2IITA 3EQ2A 3ABQB 1XRSB 5CH8A 3V2HA 5MN4A 3R3ZA 4P4NA 2F3SA 5DX0A 3CLVA 3IMCA 1LLCA 2YR0A 5F3WB 4M1YA 4UW9A 3EDOA 2PH3A 3L8CA 1AGNA 3B48A 4GE3A 1Y48E 5I8WA 1NVWQ 5K2OA 4MKIA 4DM4A 4P7GA 2PUTA 4WOCA 1ZIOA 2BMWA 3HZZA 2INGX 4RZQA 2C54A 3DA8A 5LQJA 3BB1A 4H9GA 1T5OA 4BU0A 2EWVA 2PMCA 3ZHUA 1NQXA 4IOLA 5C1IA 3UAVA 1CEXA 1OFTA 2W2LA 3LQ1A 4X24A 1JQEA 4J43A 3I52A 4DYVA 1N6IA 1SCUB 2NVUB 3JYNA 3WP1B 1ZM9A 3UMJA 2QHXA 2VP3A 1YRYE 3A3KA 1C5KA 3VC2A 4BZZA 3ZWAA 5IVHA 4R8VA 4XGNA 4E2ZA 3B52X 2WJYA 1UPUA 3TLZA 1CQPA 3WDSA 1GLNA 2QAGB 2A4MA 4N3BA 1KYTA 4BCDA 4KQKA 1JU9A 5BQ3A 2TECE 3ZDDA 3HFGA 2Y0DA 3O8NA 3V2IA 3FWNA 1E2KA 3RKRA 1F8YA 4P7BA 5BWLA 4A0SA 2GNAA 1GUFA 5EE3A 1XUOA 4S0XA 3ZDCA 3JALA 3IPLA 3PQ2A 4TTRA 1G5IA 2Z2ZA 2AEEA 3E58A 3P2OA 5BYJA 4OOFA 5KWEA 1GTRA 1KI7A 1RSZA 3BWEA 1KFJB 2XVXA 3LVQE 4P38A 5DXFA 2J5QA 3IDOA 4U9IS 5C8ZA 2BEWB 5DTJA 3PYLA 4QUBA 4YAOA 1ISJA 2HD4A 4JNKA 3ZXUB 2WJJA 4Q4AA 2RK3A 3O8OA 3C6XA 2B1IA 2PH5A 1VG0B 2DT8A 2XWJI 3I0ZA 3ONNA 2WVHA 5CVVA 2IYPA 5BUQA 1JHAA 2AB0A 3Q5GA 4Y0AA 3TZKA 2IDMA 3CKMA 3QI7A 4E13A 5HQ3B 4KREA 4H6WA 1ODIA 2ILVA 1OZFA 1KNQA 3JYPA 5EI5A 4MGEA 4IQ8A 3TIFA 3AV0B 3FSRA 1BTOA 4JQOA 3I04A 4FEYA 4UXJA 4AMBA 5GTDA 1CUVA 5KJCA 4V0RA 1HNXB 3DB2A 1K1EA 3S2IA 2M6RA 4GKVA 3SZRA 3VTZA 3KBBA 3CUEF 5BWNA 3HDQA 2HIAA 2ZRBA 4WNAB 1U9IC 2Q7DA 2BI8A 2I6FA 4KWTA 4R98A 3VHXB 1RI1A 4OFXA 4CKXA 5K3EA 2PJUA 5GINE 5C5DA 1NJGA 5B1SA 2GYUA 1EINA 3H9JA 1L4HA 1AQ6A 2FMFA 1UMBB 2OFPA 1JR2A 4CMCA 5C18A 4XRRA 1SCQA 5E0KB 4XEHA 1OZHA 1FB5A 1YASA 1Z8HA 3C6MA 3DE0X 1KP9A 3I9MA 3K92A 3K96A 4RH0A 1H42A 2IZ1A 3OMWA 5JY6A 2F9FA 2K2QB 5LB4A 4KZPA 3CVVA 1JHRA 5AKEA 1Z3IX 2HO5A 4DRZA 3IQGX 4WEOA 4FGLA 2P4QA 2Q5HA 3R2JA 4IG9A 1NF9A 2VDVE 4RCZA 1ZNQO 2WSYB 3ETEA 4C30A 2FV8A 2G9RA 3OH8A 3ZV6A 1DOHA 3OOHA 2XCUA 2O3SA 2RHHA 2ZAGA 2ZRGA 4L16A 1UINA 2B1JA 3RJZA 3WLAA 3TW8A 5DM60 5IKXA 2REBA 4GLBA 4LTNA 1HBJA 1JG4A 3CVJA 3GJ4A 5BVHB 3G2OA 4JX8A 5FL7A 2XUJA 4C4RA 3PFFA 1YL5A 1YO6A 2GT1A 4FYWA 1L7VC 2VHXA 3VM6A 1G21B 1MBZA 2VT6A 1NMXA 1XRRA 4PQRA 2C2HA 5EFOA 3AB7A 1RM4A 1YS9A 1EWVA 2DUNA 3DCNA 3MRVA 4K1LA 5C37A 1PWYE 2QQEA 4L8GA 3EAGA 5EERA 3OX3A 3HL0A 1ZH4A 2RGEA 4FGZA 5DM1A 3U1VA 2MIIA 2JW5A 3VV2A 2YIJA 1XXLA 2I2AA 4ENQA 5AIBA 5GIPE 1TK2A 4N6NA 1ZJ5A 1QP7A 3HZRA 4NFLA 3UK2A 3WI7A 1LRJA 4HX9A 4AJLA 4ZOLA 5F4ZA 3L0PA 4BXOB 4E5VA 5AVWA 4OKNA 2DHCA 2EWWA 3DOUA 4L1KA 3NAMA 3EVAA 5LIPA 3UGJA 3K1YA 3P32A 3U4GA 1FYXA 4OUDA 2EJUA 2PMKA 4J49A 4G1BA 4PVCA 4QOHA 4WZAA 3WA6A 4FR0A 3ZTTA 4EFMA 1Q84A 5CB4B 2PZBA 2PWBA 1OLOA 3IEIA 4BNFA 3AVOA 5GZ6A 2HBQA 2HH9A 3S40A 1P9LA 1EB9A 1SUCA 2VAXA 1XD9A 3PTZA 2CJPA 3CM0A 4EJSB 4F72A 2QF7A 3T15A 4CKCA 1POWA 3AUJB 1G3UA 2R8BA 4NEHB 1GM5A 1H8EA 4R1MA 4XUGB 5TY0A 5T3UA 3VKHA 3A6GA 1XWWA 5HSGA 2CDAA 2G17A 4EI2A 5IXYA 3WFIA 3VVBA 1C30A 1CUYA 2AMVA 3ZQKA 1J0EA 4OKSA 3RC8A 4EM6A 1RZVA 2XD9A 2YUTA 2ZYWX 3G9ZA 4V03A 1OC4A 5COQA 4FIZA 5AM5A 1TU4A 3RANA 3TB4A 4BNMA 3J81A 2D06A 3BK1A 3TAXA 1N7JA 4DJ5X 3C3MA 3A58B 2E55A 2GBGA 3LZ6A 4F6LA 1F20A 1KI3A 2WUWE 2ZOSA 3Q7QA 4IDBA 4K3VA 4UHHA 3UPTA 1S2OA 1CUDA 1NKTA 3X1YA 4ZD6A 4XD7A 2AUTA 1MNAA 1ZMTA 2HM7A 4PTYA 1Q0PA 4I5FA 4EENA 4RABA 1XQVA 2I9PA 5ARCA 4ZK2A 1ARZA 3AVTA 1DTWB 2FEWB 3I2KA 1TKRA 5FTNA 1YA8A 2QGZA 2FJ0A 4D6YA 4M9UA 4DNPA 5EEHA 1D2MA 3N9IA 4NTZA 1UJBA 1MC8A 1P8AA 1DHRA 1DT5A 1KVQA 2IVFA 3DOCA 3KQQA 4MQEB 3G8CA 3EVDA 3DHYA 4N3GA 5TNXA 3RREA 2DEUA 3OJFA 4NK5A 1EM8A 1HOTA 2ZRFA 2F43A 2OZPA 3ZCRA 1EMDA 2VR1A 4U3JA 3N0RA 3COWA 3LXUX 4K9LA 4R3WA 1EFHA 4N39A 4GEKA 4UUPA 1UC5B 3HA5A 2QYTA 2Y0EA 5HJ7A 2GD1O 2IEYA 3NJ4A 5HRUA 1VLJA 2IHUA 1Z6TA 3JRNA 4L08A 3CVYA 2OE2A 4ZVKA 4QEZA 1QTIA 10MHA 1ZK0A 1T3TA 2YC2C 3OUTA 3Q3EA 2HCTA 4JR2A 4RHYA 1V9LA 1KRHA 4C04A 3QA9A 1N2CA 3I6ZA 5A0FA 3JARA 4I3FA 4NDAA 2XUKA 3BD9A 4K0RA 1Z5ZA 4RU1A 4W5RA 3LY9A 2ORVA 3ZN2A 5DX1A 4YUZA 1P1HA 4KDRA 5LBUA 2IPAB 3LDUA 4ZAFA 3PGJA 3GEPA 3HCAA 3A9WA 3UT5B 1LLUA 4Z9AA 4OXXA 4OHBA 1J9ZA 1R10A 2X5KO 3H16A 4MGYR 1F2UB 2BGKA 2PUVA 3E8MA 3ICWA 4P7FA 2AFRA 5CMLA 4UCQA 2PGDA 1F8FA 5FOWA 4B6JA 4DSAA 5KCZA 1CXZA 2O8CA 5F5NA 3PE3A 3CR8A 4L28A 1EQAA 3WKBA 4AO6A 5LSAA 1UJ4A 16PKA 4GLLA 2ZB3A 1QIHA 4BCCA 2IYVA 2BD0A 1LTKA 1G5FA 1UPAA 3OJLA 4BV8A 3K0SA 2NMVA 1SKAA 4QYSA 2QN6A 1XCGB 1LDMA 3AR4A 1F5NA 1OFVA 4PZUA 4YJFB 3DVLA 5BV0A 1S2NA 2GZAA 4FPXA 2PWYA 1G3RA 4D0NA 1ORRA 3H9CA 3BULA 1AGXA 2ACKA 3JXEA 4FWBA 1RWMA 1NYLA 4UARA 4X8HA 4BEBA 1ZRNA 3H2GA 1WD7A 1OUMA 5KYKA 1CF4A 5TLSA 4B87A 4TKUA 4I0WB 1MKYA 2C1ZA 1GPWB 2WJ4A 3ZS9A 5FPPA 4WNYA 3LDHA 4BZWA 4KQEA 1J4AA 1KH3A 1ZSYA 3ZYCA 2ZRIA 2ZYTX 1PWXA 1SULA 2VH2A 4MTLA 2BBOA 5DX8A 1EK0A 3AXTA 1QX4A 3FZQA 3T3EA 4M0LA 3MRXA 5K8VA 4KX3A 2X2FA 4TLAA 4URFA 4RVCA 5EJ9A 3HXQA 1NJ2A 1PV1A 1QRAA 4RKEA 4N6GA 4UUAA 3FN4A 4H0FA 3GCZA 1VGRA 2WD8A 4F9FA 3ED1A 2WTAA 2B7LA 4Z49A 4ROTA 1SAYA 1E6WA 1ZNWA 5AXAA 1E2DA 1VC2A 1L1FA 1ADBA 1BMTA 1HDGO 2JJ8A 4IHAA 4JP1A 5D6OA 3VC1A 1NX6A 4B83A 1RLUA 3S8MA 3QTLA 4NQZA 2TMYA 4IJVA 1C9KA 3MCZA 1JEQA 3NDBB 2VWQA 4O59O 3T4EA 3VSEA 3BXOA 3R40A 2XZPA 2R96A 5HX7A 3F7MA 4EIWA 2J59A 4GX1A 4NZZA 3QF7A 3N8KA 1BHSA 3JD3A 3NTRA 4RQBA 4B8ZA 2W4IA 3R5XA 2XOKA 3NAGA 3OTIA 4MZDA 2VDLB 3MTJA 3LRTA 4XB6B 5E0OA 3K1AB 3FPFA 5CA1B 1QVRA 4ZHQA 1E99A 4IDEA 3LBHA 3IJ5A 2A0YA 4OQEA 1T9ZA 3AF0A 3P9PA 5CM8B 2C84A 1EP1B 5K4AA 1QQTA 2VF7A 3D8TA 4L4UA 5G0VA 5C1OA 2ACEA 1RT9A 2VZ9A 3NALA 1SVUA 1GUZA 3ZWNA 3KJZA 5JZOA 3U61B 5FI3A 4YXWA 1T29A 1AKNA 4CMKA 4AJ1A 1QH0A 5ES4B 2IF2A 2VP9A 5EP2A 1G6KA 2IV7A 4WK2B 4B6FA 1JV2B 4W5HA 2P9GA 4UNIA 1KYYA 2XDYA 4DLKA 4OLJA 4WCFB 3TB6A 2ZM6B 5FTKA 1V9CA 3LFHA 1N7HA 2GZHA 2ZT8A 3NRBA 1TQDA 4WFJA 3SC2A 4KE6A 4W5JA 3KLNA 4GRAA 2P6OA 4HGOA 2MU1A 4IJ5A 2X14A 2PGNA 4IUBS 5J2TF 3UIEA 4DCCA 4XWOA 3GLKA 3TQSA 1XU7A 2W2KB 4Z2AA 4BGDA 3KWMA 4YP7A 2PEYA 2DG2A 1CVIA 4A2WA 3VDNB 1ONPA 5CB0A 1P2BA 3L8ZA 3GLHB 1DC5A 1GZ4A 3LO5A 3RSFA 3UM9A 1E3WA 4DTCA 1CUEA 4FYKA 1C9MA 1E1CB 2B35A 4XJSA 4YRNA 1R0LA 4F91B 2BVNA 2IYRA 2OORC 1GPNA 4PYNA 3EF3A 4AK9A 1U2ZA 2CNWA 1R6XA 5DN6A 4WVFA 4HDOB 3NGLA 1RXCA 3GAAA 1UKCA 1ZMBA 5EKDA 5FYDA 3D2AA 3AWDA 1G2PA 4CLOB 2NM0A 2XT0A 1U81A 1EE2A 2Q9CA 3EQ6A 3HABA 3HYTA 2GAIA 3T35A 1N0WA 4AJ4A 3IDFA 4PG4A 1P7YA 1SBHA 2PDAA 3GRUA 2IOHA 3FUUA 3RS0A 1AD2A 3LPCA 3OTQA 3H1AA 1T43A 3MAJA 4EA9A 2JLUA 3E9YA 1SD1A 3P9QA 4W8HA 3B12A 4IXNA 3RGGA 3T9DA 3ANMA 3IVRA 5KWVA 4AI6A 3EQ9A 1RLTA 4Z4EA 1FLNA 1RQRA 2FZ5A 2ZGVA 3MAGA 3S99A 2EQAA 3O8CA 2CXPA 5EXSA 4KIUA 5C81A 4HEHA 2ZTVA 1JILA 5FFMA 4GL2A 3TIVA 3ZU3A 3IAS6 4FMCB 2REXB 4B6RA 4WBNF 4C7XA 2X2PA 5KC9A 3KBOA 1MRZA 1KVSA 2C7RA 1WUJS 3O8LA 1LK7A 1SBTA 4IGKA 4O1MA 3PQDA 4MUXA 3KEGA 2I7DA 3JTMA 2GXQA 1VYTA 5EPUA 1RI5A 4AYXA 4U7PB 1D0SA 1UJMA 2CUTA 5A3JA 4O8ZA 2HV9A 2O7NA 4MWBA 1P7PA 5HILA 2GBPA 5AICA 3U60B 3KKLA 3EPKA 3FKSD 1KRWA 3C3WA 3DGEC 2RAPA 3JTEA 3WLHA 3K9CA 2HF7A 2ZS7A 3LYAA 2XY4A 3TG8A 1I6MA 1ZWKA 4CM7A 2VRWA 1AGYA 4O1IA 4DIFA 5CPBA 3FCCA 3A1CA 2ZJZA 5FPTA 1N25A 2C2XA 4BP3A 5ERXA 2GBFA 1MN6A 1R8QA 4CIWA 4X1YB 2JKVA 1Z7EA 2P4UA 3EG9A 4KUHA 4POAA 3BZWA 2Q1UA 4AP6A 4DWJA 4JLOA 2VDKB 1SBCA 3GFFA 3V34A 4HUJA 3GFOA 4WOKA 1NM5A 3SLKA 4DCNA 5TEVA 3TLXA 1ML4A 5I7FA 2AFIE 5DV9A 5DCYA 4HI0E 2JIQA 4MRMA 3X1JA 1Z0AA 4Y6GB 4LRYA 4B2YA 2ZJYA 1K68A 1LPOA 1GZ7A 4GOOD 4S04A 1UDAA 4OHUA 4DA9A 2J85A 1S8FA 1FYWA 4JSRA 4RVSA 5KJ6A 5E4YA 5JROA 3AY0A 3KG2A 2IHZA 4YJHB 3E81A 1JJIA 3M0EA 4G0WA 1Q83A 4QGSA 1RHUA 5IJWA 4PHHA 4X66B 3O75A 5JNSA 3K6SA 1RLMA 2HXSA 4M86A 5THKA 1PFYA 3ZW8A 1VL1A 1DIBA 4S12A 3VDRA 2MR5A 3ZHXA 3HY3A 2BKVA 5AXCA 4DV2B 1GPAA 4G26A 1EK1A 4KMMA 1KAOA 2WIFA 2QROA 1P2DA 3BF8A 3MHTA 4OXYA 1V4BA 3VU8A 1P0IA 3KEOA 3N05A 1ZC4A 5F3RA 1WCYA 5EHNA 4P93A 1DJQA 1V1MA 1ACLA 4P4UA 2AEJA 2GX6A 2X1VA 2VAVA 3C43A 3G8BA 1ZFNA 3L1VA 3LX4A 3NHRA 4HAOA 4Q05A 4S1OA 5ENDA 5A7HA 4QATA 4MV7A 4XJVA 1EFRD 4EUFA 1R00A 1H23A 2Z9BA 4ZICA 3LWBA 1TW3A 3KT0A 5TSDA 2VUHB 3PG5A 4L7VA 2O8EB 3A6PC 3HDGA 3LQ4A 1IK4A 2X3FA 4NBKA 5EVCA 1I13A 1SCJA 4YQEA 5CAEB 3VU0A 3VYTB 4GI1A 1GA6A 3CZMA 1QFZA 1A97A 2IS1A 4NXNB 2ZRPA 2BKUA 3K16A 4UBMA 5LCXA 1N57A 4PLFA 2ZTSA 3HI4A 1TCUA 3C3PA 5E6SA 2RD2A 2CNDA 4DJEC 3FDFA 1RFLA 3ZDRA 3CZRA 2HU2A 4LY9A 3IKTA 4M83A 4QLBA 3DEKA 4TS4A 3GG9A 4QXMA 3ZK9A 1M2OB 3BERA 1JA0A 3EWIA 5ARDA 5JCOA