4GPAA

High resolution structure of the glua4 n-terminal domain (ntd)
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
379
structure length
379
Chain Sequence
FPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Dynamics of NMDA- and AMPA-Glutamate Receptor N-Terminal Domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords Glutamate receptor 4
total genus 132
structure length 379
sequence length 379
ec nomenclature
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gpaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gpaA01
2AYZA 2KYRA 2RDMA 5PNTA 1QMPA 4PICA 3MA0A 1QO0D 4W5RA 4G0OA 1CHNA 1ZGGA 2IOYA 1Z12A 4WXEA 3HDGA 2F8SA 4RY9A 2LPMA 3R0JA 3TMYA 3EULA 4MQEB 2CHEA 5TQ0A 1XHFA 4N76A 2XDYA 1DRKA 3H6GA 3H5WA 3Q7RA 4PYRA 3KHTA 4RK5A 4RS3A 4Z99A 3RVLA 3LKVA 2R47A 3TO5A 3O1IC 5FWYA 1ZHHA 5DLEA 1ZESA 5TPWA 1Z15A 3EDCA 2AYXA 3OQMA 1JBEA 2L17A 4KMRA 2HSGA 1ZVVA 1F4VA 4O5AA 3VNBA 3GRCA 1LBIA 1A04A 1L5ZA 2FW0A 4LE1A 5HM6A 4RXTA 2LBPA 3LUFA 3MYYA 2E4VA 2JBAB 5DGCA 3UUGA 3RVQA 2FMIA 3BBLA 1TMYA 5JNWA 4RKQA 4Z4IA 3IDOA 1QPZA 2A9QA 3H6HA 3HJFA 5CNIA 5EWJB 4RV5A 1DP4A 1PEAA 4RKRA 4EYOA 4ZMRA 4Z4CA 3QLTA 1PUXA 4LRQA 4DQDA 3TB6A 2YHBA 3N75A 2CD7A 3KKEA 5CNMA 5CNJA 1YK1A 2X7XA 3RVMA 3OO0A 3HVRA 1ZAYA 2IKSA 4G0XA 1DCKA 3D02A 3Q15C 1DBWA 4MR8B 6CHYA 1NXOA 2LIVA 4FE4A 3QEKA 2J48A 4GPAA 3NNNA 2GX6A 2VK2A 3MMNA 3URMA 5IX8A 4F11A 1CYEA 2PUAA 4RXUA 2N9UA 2VYCA 3QX9A 4OBBA 2L18A 1DC7A 3OMWA 3QLVA 1A2OA 3JPWA 3QX8A 4UHKA 4EVSA 4MYRA 3T38A 1C4WA 3HSYA 3HUUA 3Q7SA 3CTPA 3C3KA 1Z18A 2PMCA 3SNKA 2L2QA 2DRIA 5B3JA 2FEKA 1E6LA 1Z2EA 1FFWA 2QSJA 3MF4A 4KFCA 3OLYA 3RVNA 3ILHA 2IPAB 3O74A 2A9RA 3F6PA 4MLCA 3N0RA 4N47A 3JPYA 1NTRA 4IF4A 3HDVA 2PUFA 2PL9A 1Z25A 4G0YA 2RGYA 2OQRA 1JFVA 1HEYA 2Q5CA 3T95A 1NATA 5EWJA 1LJLA 1JLKA 1ZH4A 1ZDMA 4YO7A 3SG0A 3E3MA 4MS3A 3JY6A 1JHZA 2JVJA 1K68A 4HYEA 4RK4A 1USKA 4QYMA 5I4CA 3ILYA 4KQ9A 2PKXA 4ZPJA 1ZN2A 4RU1A 3H1FA 4QPJC 3H5IA 3Q41A 3SQNA 4YLEA 4QYWA 5BQ3A 3KYJB 3H5VA 2WY2D 1RXIA 5GOTA 3HM9A 1USIA 4KPYA 1WETA 1C0EA 2F8TA 2WB4A 4JOQA 1DG9A 3MM4A 4LDZA 1KRWA 4JA2A 5IUKC 4F3TA 1Z17A 1FSPA 2LUOA 3S99A 3HXMA 1K66A 1LK0A 5KI6A 3T8YA 2GWRA 3T6KA 4W5TA 4KQCA 4EYGA 4YWHA 2JCGA 5C5CA 4IMIB 1XHEA 1ABEA 4QICA 2QV0A 3OM0A 3N0XA 2PAFA 5TPWB 2FN9A 4XAQA 2WJWA 2FTKE 2P4UA 4XLTA 4L85A 4ETMA 3IP5A 1JH9A 1T34A 2ZAYA 1VLZA 5KC9A 3OQNA 1ISRA 1GCAA 3CHYA 4Z0NA 4IRXA 5T7BA 1JDNA 4MRMB 5KQPA 3P9YA 3GV0A 1NXVA 2WMYA 3EGCA 3M9XA 3QELA 4YCSA 5KC8A 2OENG 3IP7A 2R4QA 2HQRA 4Q6WA 2GKGA 2R48A 4O1HA 3NHZA 4JB2A 3DBIA 2WJAA 5B3JC 4PE5B 1Z13A 2WWVD 4MS1B 4TLMB 4MR8A 2PE5A 4MLDA 4RXMA 4F12A 3TD9A 2QR3A 3OQOA 3HS3A 2E4XA 4RK6A 1MB3A 4Y9TA 1D1PA 1NXTA 2JBAA 3LUAA 3GBVA 3H5TA 4RK0A 2NT3A 1QKKA 3QEMB 3D8UA 3KJXA 5FWXA 2NUBA 4CBVA 1ISSA 1U2PA 2H3HA 3N0WA 5IEJA 1SXIA 4MQFA 3O1HB 2QU7A 3FDFA 3GA5A 2HQOA 4XASA 4ETIA 2MYTA 1EFAA 3OLZA 1TVMA 4OATA 2L19A 3IPAA 3NHMA 3Q7TA 3EODA 4NICA 1EWVA 3TX6A 2BGGA 3KCNA 2LP4Y 4B09A 3DLHA 1OXKB 5BR1A 4MS3B 4D6XA 3QELB 5CNKA 1AB5A 1MVOA 1JDPA 1EWKA 5JNSA 1R8JA 2VUIB 1Y1LA 4P98A 2FMFA 5TQJA 5TPZD 4MPTA 4WWHA 4H60A 3ROFA 5JS2A 1JWLA 2HPHA 4S04A 4EYQA 4MQEA 1M2FA 2W42A 1JL3A 4YV7A 1BDHA 1NY5A 4WT7A 5FWYB 1VRVA 3CU5A 1D4ZA 1FFSA 1W9HA 3H1EA 3LUKA 4G0QA 1AB6A 3RVPA 2HQBA 3A0RB 5ED4A 1RZRD 3JVDA 2FLKA 4JAVC 1XWWA 3OMXA 2FQXA 3G1WA 4F06A 1D5WA 4Z9AA 4LE2A 4KK3A 3GWGA 1PNRA 4YP9A 4Z9BA 5IULC 3LUHA 4Q7EA 4W5QA 5DKFA 4YS6A 1IIBA 4MS4B 3RVJA 4IILA 4DADA 2O20A 3OLWA 4KVFA 2QVGA 1YTUA 3ROTA 4G97A 5TPZA 4Z4GA 5DCLA 1RXEA 2FVYA 4E7OA 3LFTA 5DTEA 4L4UA 5D2CA 1M5TA 3DGFC 4LDAA 3QLUA 3CFYA 3MQ4A 1FQWA 1MIHA 2JB9A 3EQZA 3OM1A 1GUBA 3A3KA 3F6CA 4G0ZA 5F64A 1A0OA 2B4AA 1PHRA 1E6KA 4N0PA 5KWSA 5E3JA 4RY8A 3F7NA 1YS7A 3LUGA 1SXGA 2B1JA 1PNTA 1YIOA 1U2QA 4KZKA 5TQ0B 1E6MA 3GL9A 3E61A 3GYBA 3KS9A 4LX8A 4MAAA 4XFKA 5TQ2B 1ZH2A 1M2EA 5JNVA 1YS6A 2FEPA 2NT4A 2WRZA 5IEBA 1JYEA 3O21A 5EWMB 1BDIA 1H9CA 3I45A 1LBHA 2RJOA 4XARA 4MR7A 3LUCA 5FBHA 1SD5A 4OTZA 9ABPA 5JS1A 5ABPA 1ZY2A 3HEBA 4W5OA 4Z4EA 1RNLA 3H5OA 2FMKA 3C3WA 2JRLA 1U8TA 3LTEA 4ZJPA 1EAYA 2PLNA 2GI4A 5JNTA 3QLUC 2MSWA 4ETNA 1DCFA 3N6VA 4Z4FA 1Z26A 3DGEC 2M1ZA 1QP7A 1GCGA 3CKMA 2M98A 1DC8A 4NV3A 4DN6A 1DBQA 3W9SA 3KTOA 1JFTA 1USGA 1GUDA 4TN5A 4NQRA 2PUDA 2E4ZA 3HK2A 1SRRA 3SAJA 2FMHA 3QEMA 5T3YA 3RVKA 2FN8A 3MIZA 2H0AA 3CG4A 1QQBA 4OLBA 3O75A 4M88A 1URPA 1DZ3A 1JF8A 4N03A 4MQFB 1TLFA 2MYPA 5JNUA 5CHYA 1YMUA 4RK1A 3SY8A 1LJUA 3DZDA 3FGZA 3GBPA 1Z16A 3RVRA 2V0NA 2E4YA 3F73A 5JNRA 2PUBA 3CRNA 4HNRA 1DJMA 3HUTA 3IP9A 5C5EA 4S05A 2NZUG 5GQSA 3KG2A 3LOPA 1FFGA 1P8AA 1JYFA 4F8JA 2ID9A 2NZVG 2FQYA 3OO1A 4D6YA 4OG2A 4IGAA 1J56A 3RH0A 4G0PA 1PEYA 2QXYA 4EVRA 5KQMA 4MS1A 1BAPA 2YHAA 2JVKA 2HJ9A 2JVIA 3RQIA 4EYKA 4JB0A 4EY3A 3K4HA 3O2QB 1W25A 2IPMA 4TMYA 3BREA 5EWLA 2FLWA 1VKRA 1BDJA 3IP6A 3CZCA 4RDCA 1KRXA 2FQWA 1E2BA 1QQAA 4Z4HA 3GT7A 2FXIA 4E7PA 1DRJA 1EHCA 1NXWA 2QVCA 2ZWMA 2I6FA 2ID7A 3NNDA 4XXHA 2IPNA 1VPWA 5EWMA 7ABPA 1F51E 2FEWB 4JASB 3FFWA 4Q6BA 3SM9A 4LZLA 3A10A 3I5AA 3KLNA 4WUTA 3HO1A 2JK1A 3KLOA 1NXSA 1KMIY 3LUDA 4YGXB 4UHJA 5HKOA 2IYNA 4KK4A 2FSPA 3O2JA 1TM2A 3N8IA 2FKAA 2GBPA 4LE0A 2E4WA 4HNSA 1ZGZA 4WXMA 1D2AA 3KSMA 1BA2A 1NXPA 4YR7A 3VNAA 1EWTA 1NXXA 1MB0A 5IUNC 3JVIA 3RVOA 3HCWA 4MR9B 1L5YA 1YMVA 1YK0A 3IPCA 1QO0A 3O2SB 3M9WA 3NNSA 2P9HA 2TMYA 1RZRA 1P2FA 1P6QA 3EAFA 3CG0A 2PUGA 1QP0A 5TE9A 4RZSA 1YVUA 2E4UA 3N53A 1QNLA 1DBPA 5EWLB 3BRQA 3UK0A 4N0QA 1B00A 4EGSA 4YRZA 3H1GA 4MR7B 5FWXB 2QZJA 4ZMSA 3I42A 2CWDA 4MS4A 4EUKA 5IBQA 4TLLB 2MSKA 4OLAA 1ABFA 3OLVA 5IUJC 5KQGA 4HNQA 4MGEA 4PZ0A 4G0MA 4H3HB 3BILA 1I3CA 3B2NA 2IDMA 3HZHA 4PEVA 4FE7A 1UDRA 2RJNA 3CZ5A 4N41A 4ML3A 5HSGA 3CS3A 5IC5A 2PUEA 3RVSA 4EVQA 4KRFA 3FFXA 1M5UA 2IPLA 3EQ2A 1D1QA 4MRMA 1KGSA 3FFTA 2PUCA 1DCMA 3I09A 4H3KB 5BRAA 3C97A 2PJUA 1S8NA 3H5LA 3H75A 5BRJA 3LKBA 3L49A 4NCBA 4O1IA 2QW1A 3G85A 3L6UA 4KV7A 4P1ZA 1QP4A 4IMJB 1BVHA 4KNYA 3QLVC 5FBKA 2MYNA 3C6QA 3EJWA 3KYIB 1TJYA 6ABPA 5TQ2A 3M6MD 4MR9A 5HQJA 2A9PA 1MAVA 1P6UA 2MSLA 1ZITA 3A0UA 3LUJA 3UKJA 8ABPA 1Z2DA 2PL1A 4G86A 1CEYA 1GLGA 3OLXA 4JP1A 4FB4A 2VUHB 3QK7A 3CNBA 4D74A 5KQLA 3FMVA 3Q9SA 4WZZA 1RPJA 3DLBA 4W5NA 1OXBB 3C3MA 2A9OA 1JX6A 3K9CA 4GNRA 4ZYLA 4NCAA 3JS5A 3BRSA 3NBMA 1U04A 3JTEA 3O1JC 1SXHA 1U0SY 2MYUA 2R25B 3CLKA 1APBA 1JFSA 4RK7A 4RWEA 4RSMA 2CHFA 3LMKA 4KREA 4RY0A 3HV2A
chains in the Genus database with same CATH superfamily
5ES4B 4MW6A 3DNFA 1JECA 1IVSA 1GN8A 5JCOA 1H0HA 2YVAA 3FLAA 1RDFA 2BFBB 2EF1A 2ZSBA 4RPGA 4A27A 4W5RA 1LNZA 3AFOA 4AP5A 4PS0A 3UKOA 3S81A 2X3UA 4PANA 2ZYHA 3R5XA 4RIHA 3RHTA 4DGQA 1K9SA 3OTGA 1HK7A 3K8ZA 4LXYA 1E1MA 2XDYA 4KQJA 821PA 4Z99A 2O4CA 4FKZA 4PZ9A 2JA1A 1H3NA 4P3NA 3HUFA 3IUMA 2IE0A 2IKQA 4NR0A 4DA9A 4BGUA 2K4MA 4ZDJA 3F7TA 1Z0AA 4M99A 1ZVVA 2OFWA 2ZYWX 4GLFA 1NLUA 1BXRB 1AQ6A 3CLSC 2OC4A 4J4BA 5AOAA 3U62A 4KR7A 1NTOA 4NH0A 4LF6B 4IFTA 1O08A 4X91A 3JR7A 4L5CA 3V8VA 1N36B 3HFJA 4EWLA 3QVGB 1ECPA 2PBZA 1XRLA 1XEWY 4TLAA 1U6KA 2NZXA 1MAAA 3V8EA 5D1HA 4BWGA 2PKCA 5FPKA 2OBMA 2AUMA 2BPOA 2GCOA 4BCCA 1JHPA 1IY0A 4UMFA 5G02A 2FXVA 2Z2JA 4NHEA 5FADA 3ZTTA 1XTZA 5I7SA 2XSZD 1XKXA 4LXTA 5BR4A 2FK7A 3FHTA 2G8NA 3IP8A 5HRUA 2ZXEA 4TVOA 4HATA 4L16A 1WXQA 2P11A 3ZHSA 1NXOA 1QF9A 5HRAA 4KSBA 5KNBA 5FLXA 4LDRA 3MTEA 3PDJA 2CVHA 1Q1EA 1C81A 1PJ8A 3K0FA 1SC3A 4ER6A 2FZKA 4AJKA 1RJGA 4JP5A 3DHVA 4EKEA 2N9UA 4B3MB 2O3RA 3HGQA 4ZCQA 3QX8A 2XHEA 2BUAA 5BN5A 3GP5A 5HIKA 4BP1A 3KBOA 4KXMA 3CUUA 3HUUA 1PTKA 3Q7SA 4N1AA 4NCHA 3RLFA 4ZVLA 1BE1A 2IBSA 4AC9A 2IYZA 1WHSA 4OGFA 2QT1A 2NU9A 3RVNA 3NTRA 2IIPA 4A10A 1DTWA 4C43A 1RPTA 4FZVA 3AY7A 1KOLA 1H85A 1NVEA 4TUYA 2IWRA 3LLCA 3PC8A 3VI4B 4LGVA 1ODJA 2Y05A 4KBYA 4CM9D 3QRWA 4F6RB 5LNK1 1U3UA 2HWUA 3NONA 4OQZA 4S1TA 3V4RA 4OXKA 1QC5A 3G88A 3L1IA 3CH7A 3UOWA 1V41E 3CNEA 2BBSA 3D0RA 3O4GA 5K09A 1NQOA 2XMGA 2DEUA 2EIHA 3QVSA 3ONVA 5HJ2A 1I3KA 4DJTA 3EEOA 4DA4A 2O2HA 2R8PA 1ZNQO 1L3CA 3PC4A 3U4CA 3DZKA 4JLOA 1TZCA 2J5BA 3NHKA 4BFVA 1K89A 1OLSB 4IS3A 5FL3A 3QOWA 2J67A 2HLDD 3NV7A 5ISMA 3S2GA 1PEKE 2DFPA 4HB4A 5E9JA 1USIA 1VMIA 2F9MA 4W7SA 4DT1B 4G8JA 3ZPXA 5CB4A 5DHUA 3ADCA 4UUNA 1G21E 1JVNA 1LC3A 3OA0A 4R2KA 2D5AA 2LUOA 2X9VA 3I9OA 2IYVA 3ZDDA 2XBMA 3N59A 3OJLA 1F4LA 4QDXA 3SYNA 2WDZA 3G8AA 4MRVA 2VNAA 5HCIA 4UUQA 1PIWA 1E59A 2FY8A 4CEIA 2VT3A 4X7PA 1Q0LA 3D2CA 1M2OB 1YWGO 1T2VA 3K6RA 3LO8A 4PLTA 3AW9A 4WVLA 3W5JA 4W5NA 4HEHA 3FUUA 4L85A 1XVLA 3HJGA 1LEHA 3OKFA 3I5XA 3BFJA 3MJDA 3GMSA 4FUTA 3ZWOA 4OXNA 1O95C 1F8FA 4G84A 3ZGNA 2V7QA 5K6AC 4HQKA 1D2NA 1XDWA 3NW9A 3P9YA 3SSAA 5AW0A 4PIMA 3D5QA 1JR3E 1VM6A 5JC1A 2VZLA 2ZBVA 4MVYA 4EYEA 2Q2VA 2R4QA 3AFIA 5HILA 3TW8B 2NOAA 2GERA 3L92A 4K9DA 3BEOA 4AG3A 1OZ0A 2Q3HA 4B43A 1GGJA 4GYJA 3WKAA 4BEVA 4BNHA 1SHUX 2PJRA 3CX6A 4KE7A 4Q66C 4Q9JA 4A73A 4Y1FA 2TMDA 4V1CB 4YQFA 4J1TC 5LMUB 3F98A 1AV7A 1KDPA 1KYWA 1TQ8A 3R5JA 4MRRA 4Q82A 3LAWA 4KSYA 2E4XA 1YHYA 3EMVA 1Y1PA 1MB3A 4WNAB 2GCNA 5AQ1A 2OAGA 1QCZA 2YZKA 3ZQ4A 1RPZA 2W2QA 2XAUA 2ANBA 1YB4A 1XKQA 2B0JA 1XRMA 3UH1A 3JQQA 2BCGY 2HSJA 2GCPA 5FNVB 3RSOA 4OX9B 5DVZA 4DV0B 4WOKA 4KQ1A 3WADA 4BKMA 5FWXA 4K81B 4LVCA 2QI9C 5FQNA 4CBVA 4QFDA 3L7OA 3NVAA 5BO5A 1MEOA 4CLOB 3GA5A 2P77A 1Y82A 5KVAA 4NF2A 3GH1A 2ZSKA 1JQDA 5AWFC 4EPYA 3GPCA 4PW0A 2WEKA 3WDLA 3BZWA 3ZY3A 1NQ5A 3PITA 3WLOA 1BOFA 2O2CA 3F3KA 1EUZA 3KCNA 3N9IA 5SY9A 2X1LA 1UBEA 2WV9A 3D3NA 1TQHA 3QELB 1DAKA 3NPMA 3H5RA 1AB5A 5J5CA 3TINA 1BX0A 3TEFA 1EWKA 2BEKA 2DBVO 3QZUA 4D26A 1ODFA 1M6YA 1ZN8A 4DJ5X 1PV1A 2OCDA 2X58A 1NXQA 1EZ1A 3B9QA 2W48A 3O9ZA 1FC0A 3ZIAD 2VATA 1QJ4A 1U99A 3MTAA 2V7PA 3GHHA 3HDHA 2A3NA 1SXQA 5DNEA 2O8EA 4BY9E 2PLFA 1TVKA 1E9SA 4UD6A 1ILWA 1N5IA 2G4VA 2GEKA 3DV9A 4WAUA 1D07A 5LYYA 2VOJA 1FFSA 2F3UA 3DVLA 3P27A 3PJGA 5JXIA 2AXPA 3NALA 3RVPA 2YW2A 4JQSA 1LVHA 1DWUA 3IXLA 2JANA 1WXHA 4JDPA 1S2DA 4ZI3A 4H16A 1Y8ZA 5LP6F 5M29A 4UXHA 4EA6A 3V1KA 4PSDA 4P84A 1AJEA 5CEEA 3PRKE 3UXHA 3ML1A 3ZV6A 3NHJA 4Z9AA 1E4EB 2AD1A 2WIJA 1CQIA 2HMWA 1GD1O 3AHIA 3AF2A 3F4LA 2H8KA 3Q0IA 3RTGA 5IULC 5JDIA 3AVUA 3PC3A 5AVRA 5KJ6A 2VLBA 3QE0A 1O9BA 2OCGA 3T35A 1RQLA 2CL7X 3NHAA 5DTJA 1CJSA 3EIFA 5D7NA 2YJGA 1Z7BA 4HQ6A 4JJIA 2EEZA 3FFAA 3DOOA 1PS9A 4FHEA 4GEGA 4MUHA 3FCEA 3DE3X 1RXEA 3MSCA 4J6EA 1CVRA 4ND2A 4ZQEA 1KK3A 3U4GA 2QUJA 1TZBA 1NOIA 3TG8A 1Z6QA 4M9UA 3TQOA 4LDAA 1V5IA 2LRHA 3RYIA 3VDNB 1VPVA 2YYZA 3HVIA 4J7XA 4ZO4A 3HV0A 3VR6H 4Q7QA 2OZLA 3K6KA 2Q1YA 3O03A 5FI1B 2CJXA 3AESA 2IU0A 3RU9A 3WIVA 2XWQA 3NCHA 4JITA 4OM8A 4V0KA 5FBWB 2IX9A 2VHQA 3TR6A 4BVKA 3LECA 4X3PA 2DETA 1AKNA 1KAQA 2JGMA 4RQBA 4XYGA 4DLRA 2AN5A 4JU9A 3SCZA 1C41A 1AS0A 5JDCC 1TE2A 4HQFA 1KS9A 5DYGA 2V6MA 1X0VA 4TMWA 2YZGA 1EE2A 5EWMB 1KFCB 3E9EA 5BN3A 1BDIA 5A71A 5H8WA 3FTFA 1LBHA 2V55B 4JLDA 5JMPA 1PL7A 2ECPA 3S44A 3VBEA 5KKCA 1K7FB 4V3BA 2ORED 4WMLA 4DOMA 2BGNA 2C8JA 4JCOA 3UHFA 3GAMA 2WB2A 4E46A 5DNUA 4JC0A 3OE1A 1QIDA 1UWCA 2ZPTX 2QN7A 3EEQA 2HFJA 1UBKS 1XJ5A 3ROZA 3LT5A 2J3KA 2YWRA 2ZBFA 1TJ5A 5JJKA 1XV5A 1FSGA 3L43A 5AW6A 1KTVA 4PFQA 1W4ZA 2ERYA 2Z2XA 5AI5A 5AJVB 3O73A 4LOHA 3W5VA 3W78A 1Y5LA 3EY9A 2VQ3A 4ALMA 4ETNA 3EA5A 1OH8A 3L7KA 3OZGA 4KN8A 5LZ8A 3QMWA 3SHVA 3T5BA 2NADA 3GZNB 1U2SA 3AH8A 4MWDA 1DC8A 4NV3A 2GVDC 1GG2A 1QE0A 3RC7A 4KITB 5CXXA 2V7GA 2ZR0A 4BB9A 5CB4B 1YRHA 2VCYA 4IF6A 4ILKA 1PJZA 3VJKA 5U9CA 2Y0CA 4QJIA 3H2SA 2PXAA 4WD3A 2AFVA 1NLFA 1GU7A 1YZ3A 3RS7A 3CRMA 1JILA 5EFOA 4AKTA 5JMTA 3O8CA 4IIJB 3RV4A 4Z1OA 2BMAA 2HHCA 5B7PA 4LWPA 1H94A 1RQ2A 4BDSA 1XTTA 4WJKB 2PX0A 1Q74A 4YIKA 2GPSA 1QHGA 3H5NA 4YXWA 4XQCA 1DJQA 5CVVA 5AKKA 1K27A 2IZ7A 2V98A 1I33A 2ZAOA 3NH9A 1XEXB 1JKXA 4M1SA 4ASUD 1EJBA 2VH5R 5CVEA 2VPIA 1ZIOA 2F1HA 4FJ1A 4FYJA 5TX7A 3HCEA 3I3OA 5CDSA 2W2VA 3PFKA 5JO9A 2KMLA 3K9LA 3M9LA 4QYXA 4W6QA 3LPNA 3THYB 1FTWA 3DDOA 3FHJA 2OCLA 4DWWA 2ECOA 3CRNA 2J1LA 4IOKA 3I0ZA 4GLBA 3V5NA 2HUNA 3DC7A 4LA4A 2NZUG 2QL7A 2J09A 3CLUC 3LLMA 5FAKA 2QS9A 4GOXA 2ID9A 4PNPA 5H82A 2V3CC 4NTZA 1S8OA 1KSGA 4TOIA 1G3MA 2G82A 4LG1A 4IGAA 1YJ5A 4WACA 1EQUA 5LZ5A 3O9VA 1ZJ5A 2IELA 2A0FA 1DAIA 2GLXA 5BOVA 1FJXA 1GUYA 2Z43A 2B8EA 5ITVA 1K08A 3BGOS 3FJYA 3I6IA 4IR7A 2JVKA 2ZAIA 4EEKA 5BR7A 5H5JA 4BMNA 4YUAA 4M0PA 2ZUFA 2LD4A 1US8B 2EYUA 3B9BA 2LKDA 4RMJA 4YJDA 4EA8A 4Q12A 1X7WB 5HBGA 5L6MB 4Y98A 1LRKA 3B48A 1Q6YA 4Z4HA 1XEAA 3T1HB 1YR9A 1JEYB 3KPWA 1W96A 1ZL0A 4IIVA 2I1WA 1MJHA 1Q7RA 1NN0A 1SIBE 3M6WA 4OBEA 4DW8A 3ZJVA 3QYAA 1RYZA 1R16A 4HX2A 3UUFA 1O4WA 2VP6A 2A35A 3ROPA 4WJZA 1XF1A 4E2WA 3EUWA 3A10A 2G1UA 2IXTA 2JK1A 1MAUA 4DMRA 1NXSA 3A26A 1Z29A 1P2TA 3BFVA 5DGDA 4WKNA 1OHHD 3MERA 5EZYA 4AT1A 4B87A 4C4SA 2DFLA 4D8UA 1I2AA 1LLUA 3F6SA 2ZS7A 3RRMA 1XNGA 3NKLA 5BMOA 1RRVA 1FLDA 4BIIA 4FBLA 4GM4A 3RVOA 1C3JA 2GLUA 5KREA 2G09A 2HDOA 3O0DA 4LI0A 4XSHA 1GNRA 1E58A 2F7SA 4Q9LA 5EE0A 3P2MA 4QOFA 1S7CA 4C88A 4UNIA 5BSWA 3ZX5A 2YN2A 2H51A 1VJ1A 3CRW1 2HJVA 2PO7A 2Z1NA 4NOMA 4YJ3B 4CDNA 3PJDA 3PFNA 3KQMA 1EP1B 1QK5A 4BB5A 5CDUA 2P7HA 4ISBA 3QPBA 4N6NA 1QQ6A 3PJFA 4WCDA 4XB2A 1XD2B 1TZMA 2XUFA 4GI3A 3VAYA 5JALA 2VDLB 5IBQA 4ZMBA 3VDQA 1TECE 1CJTC 1QYIA 4EW6A 2IZ6A 2H92A 3QU7A 1A4XA 3ODPA 1W85A 4CL3A 2BDUA 2J87A 3RIGA 2XLCA 4RH3A 3AR4A 4Z5XA 5K0EA 2ZYRA 4ZD6A 4G0MA 1RSZA 3VFDA 4DRXB 1HE8B 2J9ZB 1BA3A 1BNCA 4TYNA 1DADA 1UJCA 4IIHA 4PZUA 1YVRA 4BKRA 3K5PA 3IA2A 2WSIA 1D9XA 5AKGA 3DUFA 2OB2A 1SU7A 3E5RA 3IQWA 3H18A 4AYTA 1TYAE 4OIMA 2QTGA 1E79A 5ALNA 3EIXA 2J9YB 1MDBA 3I09A 2YHUA 1YL7A 3H75A 2AJBA 1NWCA 4EJMA 1C1HA 1D5CA 3H2HA 2EJWA 4K6OA 4OJYA 3SXPA 1R4ZA 1P75A 5THKA 4JI7B 1S4QA 1SUIA 1JJBA 2QVLA 3LDGA 5LU9A 3QLVC 2VXOA 1ENYA 1MJNA 1NRWA 3TYXA 3DFZA 2EOAA 4MR9A 2H31A 4BWYA 4H7KA 1P6UA 1LS1A 4AUMA 5AUOB 3MCUA 4BMVA 4UTRA 3EOBI 3ESBA 1BE0A 5KTTA 4LV8B 4ZGWA 2VPYA 3IT1A 4R84A 1TM7E 1D1SA 1I7DA 1P1IA 1IRIA 5DULA 4N39A 2GXSA 2YMPA 1RMTA 1ZXXA 4JSRA 1YACA 4LHXA 4EARA 1JU9A 5EMKA 3SQXA 4X44A 5KX5F 1ESMA 3AX6A 4HP8A 1L9XA 3PNSA 4X61A 4G0WA 1GNSA 3BRSA 4CM6A 4LF7B 1N1GA 1W30A 3CX7A 2QX7A 2ZU6A 4QM7A 3OCUA 2XYRA 3C7DB 1X15A 1UP4A 1U7XA 4Y6GB 2AL7A 4G8BA 5EP1A 4MQLA 1L5KA 1NLMA 4CVNA 3D8SA 4LXXA 4RSMA 5COQA 2G28A 4Y1GA 2GN6A 1YQ9A 2YWFA 1UEJA 4X92A 4DQXA 2OCYC 5JJCA 4JBGA 4U7TB 1IONA 2C9BA 2XQIA 3OQIA 1RM0A 4KG7A 1IM8A 1WB5A 2VT2A 2V9ZA 2BW0A 3FG9A 3K5IA 2JHGA 3NX4A 2QN1A 2IOYA 2EAUA 1JPUA 3MCVA 1H4TA 4RY9A 5F9MA 3WOHA 4E22A 5SZHB 4PTYA 3TQHA 3JATB 4HSGA 4UDNA 4WN9A 1HOTA 3H6GA 3I6MA 3L3BA 4NCKA 3LKVA 5DLEA 4B0OA 5HEKA 2J3IA 1XBTA 3V1MA 3H2GA 5A3RA 3PUZA 1FVHA 4PPQA 3BERA 3E7PA 3M82A 3WNZA 1KC3A 4TSKA 1DCTA 5JCJD 4HUQB 3CE6A 3BH6A 3MYYA 4XDYA 4HT3B 5K8VA 4ZVOA 4LOKA 2D2XA 2CVPA 3KZMA 1NRJB 2RBGA 3IDOA 1V8ZA 3KKPA 4L9SA 4Z4IA 4G4SO 1UADA 3THRA 1KQPA 2ADFA 2C61A 2XMRA 3T7IA 4EI2A 2OQVA 2WV7A 2BGMA 3E35A 3HWWA 2ILTA 1IEVA 4KO3S 3DE2X 3UN1A 1ZGAA 3N75A 4PX3A 3MJVA 3ZHRA 4DA6A 2G1KA 1R0ZA 1X7ZB 2Z4SA 1F3OA 2QYOA 3PX2A 5A0FA 1R9GA 2R62A 3EXG2 5L4LA 2C54A 3Q15C 5FKJA 4RJTA 4GL2A 1BFUA 2O3JA 3TLBA 3FPHA 1BGWA 1CS4C 3FUVA 5H9VA 4MW9A 2C98A 2JCXA 3NHUA 4KE8A 4A8JB 3ESDA 3NGMA 1YS2X 4F11A 4LJ5A 5LD2B 2Y6VA 1IJEA 2XYGA 4O2LA 4C6RA 5EUCA 4BS9A 2QRVB 3LHSA 3AKYA 1FFAA 1L4EA 3LC0A 2FUG6 3ABZA 2BGJA 4IG4A 3VAAA 5TEVA 2R87A 4TLEA 2Y1DA 3DCJA 4MOWA 1XMSA 2C77A 4GKVA 2HIHA 1L7EA 3A37A 3LX6A 3VV2A 1V0JA 3U7FB 2Q3DA 1EE1A 2JBHA 2CCGA 4U7DA 5CDHA 1UIRA 2OT3B 2W11A 3A9WA 3CRRA 3ILHA 2AA3A 3OZBA 1H2ZA 3PEFA 4OQDA 3RRZA 4CMEA 3KK0A 1GR1A 1IZ7A 1PJTA 1KWKA 1ZK1A 1LSUA 2ZG6A 2YNMC 3NG1A 5AOVA 5LMNB 4P34A 1S89A 4F5DA 2PU5A 1JHXA 3PWKA 3WYNA 4KUHA 1OBCA 3ZWWA 4ZV4A 4XPIA 3S5UA 3AJEA 3KVRA 3UGJA 5KNBD 1QLJA 2I6TA 5KTOA 4E2FA 2PK3A 2A9KA 3KQYA 1E9RA 3L8DA 4ZPJA 4CN9A 5H16A 3HY3A 4CTJA 5E2AA 1O0CA 1XU7A 5D6NA 4QPJC 2C0PA 4P3PA 2WIBA 2XSZA 1Z22A 5KSYA 3RJ9A 3ONNA 3P2JA 2VDRB 3G7SA 1KAGA 4IRUB 4DDTA 2PEZA 2GJ4A 1YQXA 1GPDG 4NEHB 1JWAB 4Q1DA 4UM5A 4H1TA 4KPYA 3R8XA 2BTQA 2WB4A 1FYEA 2GEJA 1YNOA 2ZIXB 3WDMA 1DG9A 2QX6A 4A16A 1SG0A 5DGTA 5G3ZA 3VPHA 1OCEA 3ZWKA 4F2GA 2R5WA 5HYVA 4L6AA 2VJYA 4U00A 1I1QB 3I4CA 4YV1A 4CL0A 4DXAA 5LQSA 1BROA 1HPLA 4ZDKA 1RHMA 2Y0PA 3VZBA 3G13A 4OA8A 4AY6A 1P4JA 1KIAA 2VF4X 4KIFA 3WWPA 2WA2A 3RAEC 1Z63A 3S2IA 1HA3A 1XNJA 4MRNA 4UQLA 4TTAA 1C7IA 4MUKA 3R24A 4YCDA 2RKWA 3HGTA 4M0UA 3G6WA 5KC9A 1P7PA 1NUSA 5ELXA 2PT6A 2WAYA 3HMQA 3R20A 4O02B 1P1BA 1KK1A 2P6NA 4Y30A 3R74A 3WS7A 3B1XA 4WZAE 5LIRA 1Z2CA 1S02A 4C03A 3JQAB 3VR6A 2BH2A 3H42B 4HWRA 5GZ6A 3TAXA 4EB6B 4PAGA 3PRJA 2CUKA 1NJGA 1E94E 3DBLA 4EPRA 2OGTA 5FBLB 5GINE 4J16C 4C6TA 3QUSA 1JLLA 5EMJA 2O19A 1FA9A 3DBIA 1IB6A 4TYMA 2X22A 4UBNA 1JDBB 1TT5B 2IEBA 4M38A 1J70A 3EDRA 1ECGA 4RCZA 5JISA 1S2GA 1ZOOA 1YB5A 2HA0A 2PX3A 4LRTB 3TNFA 3OI7A 3V2HA 4ATNA 3F3YA 4L0QA 1DNPA 5F2OA 1XZDA 1SCQA 3TX2A 3W9UA 2N1BA 3LP5A 2NT3A 5D51S 4AIRA 1DV2A 5HM6A 2V7WA 2FDXA 1ZZGA 2FPUA 3DO5A 4G4SP 4G89A 4FFPA 1YCHA 4C7BA 2DBQA 3UJ9A 4M86A 5IG2A 5EHQA 1MOSA 1NNSA 2GTIA 4RD2A 2XB4A 4RZ3A 1PWZA 4IKOA 1RBMA 3VR6D 4MQFA 2YWHA 1WZ2A 2XMBA 3AUSA 2ZSDA 1HT1E 2V6BA 4NLLA 4XASA 3UIEA 1GG5A 4OI2A 4DLPA 2E5LB 2MINB 7AT1A 1XJCA 1POXA 3B82A 4MWTA 1XG5A 3MC1A 1GVNB 3EQ9A 2E87A 4R8LA 2C97A 2AG5A 2PQ0A 3KQSA 2W4QA 2GK3A 4YAKA 3ZQKA 3C87A 4RJKA 1MN6A 3GGPA 3HNPA 2FSHA 3T7CA 2GEFA 1I2BA 4A6XA 3FPBA 3EMKA 4ALJA 1KNQA 2VYQA 4GWLA 1PFVA 5HS6A 3ZHXA 4RLHA 4D97A 2QF7A 4CKXA 3EAGA 5K6AA 3FETA 1HTWA 2YASA 3V7WA 2XNJA 1WSAA 4MWSA 3LVFO 4YRCA 1Z0ZA 4QUBA 7REQB 4JI4B 1RBZA 2GD6A 3AUFA 3HVKA 5FWYB 3RS3A 5K6TA 1BG6A 2GKOA 2OB1A 3F49S 3K30A 4K2HA 3DYVA 1PDVA 5ALJA 2Y9PB 3HHEA 3IULA 3TRJA 1XI2A 4CMEC 1RQ7A 4FXPA 4U2KA 1XA0A 5KTYA 1H8ED 4F56A 2DQYA 4OJMX 3HL4A 3KAKA 3ORQA 2ZT6A 3GVIA 4KQ6A 3IAFA 1QFSA 5AR1A 1BJTA 1ZNXA 3AKDA 3FWZA 3QEJA 4KK3A 1E92A 3OD5A 3AL2A 3V8MA 2B37A 2OVFA 1MVNA 2YYSA 1E7YA 1NUHA 1V16B 4NABA 1JEOA 2ABWA 4KDRA 1CQZA 1D2MA 1XTQA 2ZIGA 1ND5A 3L1KA 3P0RA 4FBGA 4JOSA 1J1UA 1J0BA 4IPTA 1T8TA 3VSCA 5L7TA 5FTJA 1IEXA 1QRSA 4BB6A 4ZHQA 4M9QA 1X8KA 3PXGA 1PFKA 2DHRA 3TRDA 2NVUB 4RTOA 1AKWA 1ISJA 1WEHA 4PSAA 9MHTA 3RAJA 1FVXA 4RNDB 4DEVA 2RC6A 2LKCA 1LVUA 1WPQA 2QAGB 4CQMD 1TCCA 3V7FA 1TXGA 3A3KA 1YDHA 4E94A 3U4QB 1MC1A 1PHRA 1GGKA 2F62A 2NN3C 2R6CA 2W6QA 3PGMA 5KTMA 1Y6GA 4FOSA 5BMVF 1GKIA 3B6IA 1S3SA 2PZGA 4QVIA 2L82A 5GTDA 1ZHOA 3GFFA 1NQXA 2G1PA 5ECYA 1K75A 4RSHA 1RI3A 4RY2A 1UKAA 5IEBA 4DIEA 1T36B 4NFLA 5IYZA 4K8OA 1CUZA 4H3VA 5KTKA 2XRFA 5A4AA 4UUAA 4B8WA 1MX9A 1NP6A 1TX4B 1UOOA 3OQ6A 3QBTA 3GEBA 3HN6A 3LXUX 3FYCA 1RAIA 5CJPA 3SZMA 5B7QA 1ABBA 1I5OA 4O2BF 4E4RA 1LSSA 3K0EA 5DI9A 4YXFA 4RVNA 3TNYA 1DGQA 3D3JA 1SVWA 4PZDA 3ZXIA 1I7NA 1M1YB 1Y7PA 2AKAB 1IZ0A 3V2GA 1E5TA 3WR5A 3ORFA 2H5LA 4GL4A 1N2CB 2NXNA 4M1WA 4U0JA 3PHGA 3K9FC 3Q8KA 3ZEAA 1C9KA 5AKEA 1QFXA 4CEJB 1Y7TA 2P0EA 3C3JA 1GL3A 1VA5A 1WMSA 2M98A 5DBIA 1U02A 3I61A 3WBFA 2C8LA 1GA4A 3MJHA 1NA5A 3QVVA 3IJ5A 3TH5A 3GRVA 3HSKA 4GZ5A 2PUDA 1QH0A 2WF7A 1FPMA 1UANA 1JEAA 5AVUA 1RACA 3NHWA 4RPJA 4E1BA 3G68A 5HQ3B 3VKGA 3CRVA 1OFTA 3U16A 5DBFA 3C8HA 3HCRA 4MVJE 4P93A 3WAJA 1L5NA 1II0A 1SIWA 2PS9A 4NFHA 1IY2A 1GG9A 3M4YA 3MWYW 3V48A 3L9WA 2I7TA 3KQOA 4RD1A 1FNNA 1O6CA 4KR6A 1AH2A 2RHWA 1QGUA 1GPMA 1WMDA 5K8UA 1UBHS 2EKBA 4DC0A 2QW0X 4R1UA 4O4IA 2JJ1D 4I6GA 4RMIA 3V6MA 3RSHA 3QNUA 1UQTA 4UC0A 4COOA 5IJ0B 2V0NA 1T1IA 1W2GA 2R9VA 3OX1A 3F73A 1UMBA 4V2UA 1WV0A 2QP3A 3GRKA 3HUTA 4EHNA 3EGVA 3NTVA 2I62A 3PSAA 4A91A 3FM9A 2ADMA 2DX7A 3DZFA 1PGNA 3NDRA 2XQGA 4EO7A 3A2NA 4PRKA 3KD3A 4RLFA 3RIYA 1SQGA 5SY6A 2K6GA 2J9RA 1L5MA 3LXRA 5JEDA 2ZAMA 5EJFA 3O90A 1TNDA 3CB4A 5DTMA 4XGIA 1DSSG 2HQ1A 2XCUA 4HXFB 4V02A 3MZ0A 1XZKA 2A1TS 3HGMA 2POCA 3R0VA 1M1NA 1U7WA 3TOCA 1MCZA 3TJRA 3VR0A 1V3VA 5JATA 1DELA 1SWWA 3WHIA 4WZBB 4IYRA 4RQUA 3KJGA 3FUXA 3IRVA 4HUJA 3VYWA 3ZOZA 3CZRA 2AFRA 1NQAO 5KTRA 1NXWA 2FHPA 1J23A 3QG5A 1NONA 4UBIA 5DYTA 1B3BA 2FPIA 2WAXA 2IUEA 2IYWA 4FC6A 4YDSA 2X42A 4TVBA 4JI8B 2YFKA 4JASB 1DQSA 3QFCA 3A1TA 4S0ZA 3GUVA 3ZV5A 1BCRB 1UJ4A 3CUWA 1XDBA 3K1TA 3P45A 5KDOA 3ZDAA 3AGPA 2J45A 1FQKA 4F8YA 4FGSA 1EESA 3WIEA 2J9FA 4M8IA 4TKZA 1GY8A 1OT3A 3SQLA 4UOQA 1Y33E 2COKA 3L0YA 4TXJA 1Z56C 2PX2A 3QWHA 1SU4A 3U0VA 6NULA 3B5JA 5DYWA 1X7XB 2X8AA 4ZT4A 1G16A 4V24A 5FA5A 5HIJA 5BUQA 1TPZA 1Z6TA 2O2XA 4YR7A 1F2TA 2AQKA 3TOVA 3E05A 3NJ4A 4W9RA 1JS1X 1XVVA 2EXXA 2PKYX 4MKHA 1MNAA 5DHAA 5LCXA 5J3JA 1C30A 2HR1A 4WKCA 4WBXC 3GLGA 2WJ6A 4KLAA 3NDJA 4RE6A 3FTDA 2X0EA 4F84A 4TTVA 4MI3A 2HMTA 1BVUA 1U9IA 3E18A 1V8BA 1V7PC 1YVUA 3O2NA 4KCGA 4KXUA 1IUPA 3W34A 3ZLTA 5C1BA 1DBPA 1O97D 1JQ3A 3C7KA 3R7WB 4NMMA 1N78A 5A06A 4JKYA 3WSWA 4WSOA 1WDKA 3I9FA 1AZSC 3NAGA 4ZT3A 3A28A 3TLZA 1PGOA 1E3IA 1ZJJA 2C5HA 2C2WA 4EB3A 4MW1A 4EUHA 5I7EA 5ITSA 2EV9A 1P81A 3OLVA 4Q3BA 1R74A 1E7RA 2ZSJA 1AQYA 3PL5A 4MGEA 4KMSA 5L4SA 2JGJA 3E8XA 1O3YA 4M0FA 2NAFA 4BNUA 2PLRA 4GFDA 2RJNA 2HMVA 3HKDA 3P94A 3QVXA 3AR5A 4G1BA 4JR0A 4NYJQ 1TIPA 4XUEA 1R4NB 1C0LA 3HKEA 3KJFA 2QRPA 2CLSA 4IGFA 4TL7A 1J21A 1N5MA 3A3PA 1RBQA 2VJNA 2FGKA 5AXBA 1I4DD 3NBFA 2CLIB 3R3ZA 3TZBA 3K0FB 1NSFA 3GUUA 2VHXA 4BFWA 3KT0A 5BRJA 4Q4AB 1DRWA 2VRWA 4UU0A 4PPNA 5AKXA 4A7PA 4AG5A 4FMDF 3TE7A 1W73A 2EBHX 1GA6A 3GEDA 4B33A 2JAXA 5K0NA 5EIEA 1HKHA 1E8DA 4EO9A 2VDVE 3HO6A 4LCBA 3C6QA 1K2VN 3P4UA 4E5SA 3BXPA 4BGIA 3L0IB 3LPLA 1CE8B 4NCIA 3LC7O 1WF3A 1UK9A 3VDMA 1RCUA 3A0UA 3HADA 3P9SA 4GH5A 1OWOA 5I4BA 5KHLB 1T2EA 3HI6A 5CITA 4V1CA 2Z2KA 1X9HA 4DR7B 1V37A 1BTOA 3E1SA 5BYKA 1TADA 3E9DA 3VO8A 4AZSA 4FQ5A 2BHLA 6ADHA 4EG8A 1FDRA 1K5DA 1U6JA 3L77A 3DB2A 2OGUA 4S24A 1SBQA 3TOXA 2BD0A 4UNQA 5B4UA 1CQJA 2IW1A 1IM5A 4NBVA 3C7TA 3QE2A 4XWKA 1P9OA 3I1IA 4ZIRA 5JS8A 2G9VA 4HDKA 4ZV7A 2QX4A 1FNMA 3RD5A 2MYUA 3HKDB 4WASA 4DRYA 2QRUA 3EOAI 5A1JA 1C4OA 1RKQA 4JEHA 4UUPA 3FE2A 3U19A 3TSWA 4R0MA 4RY0A 3CM0A 4PRYA 1U7UA 4EGQA 4YUZA 5TT1A 5IWCA 3QUCA 1JSXA 4LGCA 4RFVA 4MUIA 1T2NA 2DB3A 1VE3A 2ZSEA 4DLUA 3C6KA 1WQ3A 3ETEA 3RRFA 5JRJA 2FGJA 1EPUA 2DP4E 2PRJA 3NIBA 4GPTA 1BXGB 1ES9A 2EFEB 5FULA 5LWHA 2JFVA 1TTQB 2R00C 3VKUA 2V5UA 3WWOA 2XKJE 1M1XB 3LOUA 4L4SA 3D8RA 4IXMA 2IV3A 4GYYA 3BMXA 4TM8A 3TO5A 3FNQA 2XDQA 3ZIUA 1KAEA 3GRFA 4W63A 1KI6B 2C2KA 2VC2B 4ZOLB 1R5OA 4ZZ0A 4JL5A 3WLJA 1A04A 2GB4A 2H4FA 3PHCA 3FDJA 1HYBA 3QNMA 4JZYA 4WBNB 3LJKA 1FXWA 3I01A 5ULLA 5DLDA 1TYEB 4FZRA 5JNWA 3LVQE 4N0EA 4OUDB 1C3EA 2ZT5A 3LV8A 5CNIA 2W98A 2JLRA 4D9GA 2BMVA 2VUSA 3IDQA 4NYMR 2YIJA 2AC4A 3VVBA 4ZO7A 4CV0A 2QTHA 4FHGA 3KUDA 4Q37A 2Q0HA 4NAVA 1EFVB 2XRMA 3LS2A 4JK3A 4CPDA 1W5BA 3AF4A 4AKGA 1Q14A 3DZJA 3K9BA 3DMRA 3PLNA 2VWGA 1OF1A 4ZAXA 3F97A 1O0BA 1QGOA 4ADSG 5ARBA 1AQJA 3HR7A 5B6JA 3C6MA 3EIWA 2DY1A 2RI6A 4LJ6A 3HB7A 5LXTB 3PGJA 3UYKA 1ESNA 2GAIA 3FF4A 4MZDA 4GLJA 5IASA 4HRVA 5LQKA 4ZJUA 2JDID 4IIDA 4GPAA 3WLSA 5L3QA 2ZRNA 5CT8A 4OHYA 2CSXA 2CMFA 3DV2A 4OQQA 2RIPA 4LBVA 4D9IA 3TXYA 3JPWA 5KTSA 5B37A 4GP9A 3KT3A 4WK4B 1ULAA 4C4AA 4EHJA 3T94A 3DOCA 4BVEA 4BLOA 3USES 1FP7A 1BVYF 1E6LA 2XT6A 3CSDA 3R9XB 2J3QA 3HG7A 4L9WA 621PA 3T3IA 3B1YA 3TGLA 3H9EO 2R6R1 5IXSA 1LI7A 4FINA 1V6CA 3EXFB 5I8ZA 2ENWA 1M67A 3SQMA 4MV3A 1QLHA 3STUA 2V7QD 3I83A 1FQJA 2B99A 3A4MA 3FBTA 2B6NA 3QHQA 3W77A 4M7PA 4Y2HA 4BX2A 1OTHA 2VJOA 3CYFA 1FZTA 3DQZA 2CV1A 3WGOA 3LBIA 4ENPA 2EQAA 4BMXA 5ALMA 1C8BA 4MYUA 3UWMA 1M10A 4GO1A 3SOZA 3EXEB 2A86A 1RJEA 3BA6A 3BFKA 3DXYA 1Z06A 3H8SA 4IDHA 4P7KA 4LYFA 4MA0A 4XA8A 1F2UB 4FUQA 4P7FA 1P60A 1W1WA 5JSKA 1UR5A 2FNAA 2XTZA 2FWMX 3U0BA 1YGYA 5CFPA 2AN3A 1ZMXA 2JLWA 4B4UA 3DTNA 1SIUA 1IBMB 1NV8A 1ZC4A 1SVIA 2FPMA 3V32A 4BNXA 1GKYA 1Q17A 2QD1A 1II8B 3F6BX 3S99A 2PCJA 4BNYA 5KI6A 4JUFA 2PBLA 4BO4A 1WDTA 1NLZA 1N33B 5I01A 3AG5A 4UU8A 4YWHA 2GYWA 5DWQA 2OHVA 2B35A 3RC2A 5LDHA 2FYTA 5IS2A 5KYVA 2C7PA 4Q4JB 3TIXB 3VH3A 5BVGB 1A5TA 4OLJA 5D5HA 4H6VA 3I8OA 2JAUA 4H1HA 4OEHA 5C52B 4L75A 2QN8A 2FRVA 2PRSA 2BFOA 1Q0UA 3NWPA 1LTQA 1G1MA 4K6CA 4I4NA 1Y1KE 1A5SB 3CWZA 4X6UA 5DNYB 3TOZA 2QN2A 4GLOA 3HR8A 1KFJB 2EHJA 1Y1TA 4LWQA 4MICA 3ZWPA 5I51A 4HR7A 1NXVA 1VXOA 4YX9A 3QELA 3EZFA 4V0NA 3Q8LA 3HKCA 4O8ZA 4Q0MA 3V80A 1MTZA 2OSBA 2X4DA 2JLUA 1K98A 3KJHA 4UQOA 4IJMA 4IRMA 4LY3A 4F92B 2DULA 3QUBA 5MDHA 2CXNA 4EA9A 2UKDA 2GRAA 1B0PA 2NQTA 2I91A 2VEOA 1ULTA 2HA7A 4KWEA 4C6SA 4F9FA 5JQWA 2FX3A 3H04A 1JUDA 2YFQA 4QWWA 4ZAZA 4RK6A 3TLKA 2VH1A 3BXHA 3Q7IA 4WNIA 4EL5A 1HEIA 3LC1O 2PR7A 2FJPA 3G02A 3C74A 4B7ZA 5A3QA 3Q6NA 1OR8A 3WE7A 4BVGA 4IICA 4DJDC 3QEMB 3C5EA 2X76A 3MTDA 3D8UA 5TMEA 1I01A 1TD1A 4URFA 1J2RA 4DUGD 4EPXA 5DMHA 2QUBA 2HU7A 1UAGA 4DIKA 3QPDA 3NBAA 4BPBA 1R37A 4I50F 3BIWA 4KH0A 2CJWB 3IVGA 1QHEA 2C9OA 2QGNA 3LM8A 3G2KA 2AFIA 2PMKA 3A32A 2G3YA 3PZRA 4FFVA 1S2LA 1ZNYA 2PFKA 3Q7TA 1GEEA 4UVIA 4XJVA 3W4IA 1T9CA 1PR4A 4ENSA 1NP7A 4XDHA 3F5QA 2CMDA 3L0BA 1W46A 5HW0A 4CM8B 2BONA 1NQWA 4JJFA 5T8KA 5BR1A 4UAUA 1T2AA 1CY4A 4LW8A 1Z2AA 7MHTA 5CH5A 3B9RA 4UE6A 4NAHA 2YJ3A 4P98A 4H4CA 1DWOA 1ZG3A 1S2IA 2GSDA 4H60A 5TPZD 4DWVA 3DBRB 4TTJA 5JZOA 3ZHYA 4IMPA 1D6JA 4BZWA 2VNHA 3ZKWA 4Y0NA 3L8GA 4FDAA 3T52A 4O2AA 4UOEA 3KSAC 1RVDA 4DR5B 4ABTA 4FEEA 3NETA 1VRVA 4NBKA 5TMDA 2E5FA 3DE6X 5EIHA 3SM3A 2HF9A 2QTFA 5BSVA 3OP4A 1DAEA 5J4VA 1QDUA 1SU6A 3LCVB 2PIDA 1WCV1 4OU5A 5DI3A 5ENZA 4BJ6A 2IYEA 2RG1A 3NAZA 5C8YB 3G1WA 3AVVA 3HRHA 4OGWA 4ZVNA 2DPYA 5A5FA 3EXHB 1J9ZA 1MBZA 2VHVA 3IDAA 3GWGA 1M6EX 1ZVMA 2WR8A 3BE5A 1M8GA 2CFCA 2O7QA 2YWCA 3K32A 2FV8A 3LUHA 1DV1A 4Z9BA 4ZCPA 4JI3B 3SF0A 4OMDA 5B4TA 4KXXA 4LK2A 1X1BA 1YJ8A 2QMZA 3PX7A 1ZRMA 2X3YA 3EZXA 5H7XA 1P5ZB 3OLWA 4FIDA 2CFOA 3DTTA 2OO5C 3GB9A 1JJVA 3LL7A 1F2VA 2H7CA 3MWDA 3P9PA 2JIZD 2E18A 1BMFA 2VCHA 2ZB2A 5TPZA 4Z4GA 2ZETA 4DM3A 2VHTA 3NHYA 2HRZA 3P9ZA 1N2GA 3CVVA 2RJ3A 3LDUA 3QVJA 3GOQA 3I9LA 2J3MA 2OBFA 3F6CA 3NTUA 4G0ZA 3OJXA 4P7BA 2O59A 1R2QA 3JD1A 3LQ4A 1XB2A 2OECA 1M8FA 4FGZA 5E3JA 3WLKX 1RHKA 2NXEA 1LU9A 2YBEA 1U7HA 4KODA 1KMCA 4NYMQ 3HXKA 5HGXA 1U9ZA 4KZKA 4LNUB 3ICOA 1SA0B 1W9MA 4TSRA 2BZGA 3ZCUA 4LECA 2Q3EA 3A1SA 1GFSA 2P6UA 5KWEA 2B78A 5FR1A 4B80A 4M4SA 2WG2A 3GJ6A 3GNLA 3JD4A 5K4GA 3U3MA 1YDWA 3F5DA 3LBYA 3A05A 5AVJA 3ZIDA 2C20A 1DHRA 4DUGA 1XCJA 1WQ1R 2RHTA 5EZ5A 4BP8A 4ZJZA 5EJ9A 2CNNA 3ER9A 3TW6A 1SBNE 4IDGA 5A0TA 4AWBA 1ZOLA 2PGOA 2Y27A 2Q9CA 3O26A 3PUKA 1ZNWA 4WXPA 5IN4A 5TVKA 5KMGB 5EQDA 5K3OA 5DW0A 1YZYA 5ABPA 1YH3A 3HEBA 1J2UA 1VLMA 2GDZA 5KU1A 2DAPA 4V38A 1GAQA 3LTEA 4EY4A 3KJZA 1CWUA 1X3LA 1Z4PX 2OYCA 4TX1A 4RTLA 3CT6A 4DB2A 1G5HA 4V0ME 1LW6E 4KPEC 3KLPX 4X7RA 1MC4A 4DPKA 4R3UC 4QX6A 4RELA 1PJQA 1JJIA 1U3WA 3AHHA 4REQB 3HBAA 5T64A 5K3FA 1GQRA 3QPCA 3IAEA 4G9BA 1B0UA 3TOSA 4DWJA 3GLIB 3BTOA 5IU6A 4ZU3A 1RQGA 4O08A 3EZ9A 4JSYA 3SJBA 1C7QA 2Z3WA 2KM1A 3BE4A 2C92A 4I3HA 5KYNA 3UGTA 3F6YA 2FMHA 3I4FA 4H7IA 5B1HA 1WBJB 2KW5A 4DCSA 4N5IX 2H0AA 3JWPA 3BG5A 4OLBA 2WW8A 5AI8A 4QTYA 3WIOA 3RREA 4GMFA 3ENNA 5AJZA 5HPYB 3VNUA 2V54A 1EB9A 1PJBA 2Q3BA 2IHYA 4GQIA 3SGLA 1B8NA 3DG9A 3DULA 1Y3FE 3T0GA 3SY8A 3CB2A 3OKPA 1SM4A 4K9LA 4R0NA 5AI4A 4IJUA 3WGJA 5ERGB 5KX5A 3OFVA 2F1OA 5JAOA 1P1HA 3FGZA 1XZJA 4HUQA 2HA5A 3RVRA 1M0WA 3SLRA 3WBBA 3ZZTA 5AVWA 5KMGA 5I47A 5J63A 1E2EA 4KDCA 3HU5A 4YMGA 1U1IA 1DMRA 2UYYA 4RULA 4FW9A 4PTZA 3HKCB 5JASA 4IHAA 1VA4A 2N75A 1P8AA 1NDQA 3UMRA 5BWMA 4KOEC 1Q0QA 4KIUA 1UJ6A 4FZ3A 3FCCA 2Y93A 4FCTA 4J9UE 1N6KA 3GD5A 5KQMA 4WV3A 4YJGA 3GP3A 3GCXA 1L5HB 2ZTLA 3N1UA 4IZIA 2FDRA 2ZREA 2HJ9A 3P9RA 2WWIA 3S28A 1WOMA 1A8QA 2R4UA 2IPMA 3BWXA 3IQDB 3BREA 3R41A 4LJLA 4W1PA 3MTIA 5EEGA 3A6EA 3VKHA 1PT7A 4TTQA 3ME5A 3NP7A 5CA0A 4LJSA 4UEJA 3ZDFA 2I8CA 3B36A 2QRNA 5ELMA 1JLMA 1PZNA 2R4TA 3TFOA 1O8BA 1RKXA 2WFLA 4B9EA 4JYPA 4U63A 4YCBA 1NULA 2G5PA 1N8KA 2GN4A 2RONA 2XCQA 3O8NA 4FX5A 2JAPA 4FOTA 4P58A 3EQ6A 4AUEA 5I9IA 2BGWA 4S35A 2CKMA 3IBFA 3CRZA 1V8PA 3HO1A 4ZKEA 3IEMA 3I2HA 1M9NA 2IEIA 3ZLVA 1HX7A 2IYNA 4NNJA 4IHKA 1VFNA 3MT0A 1X7GA 4JBXA 4R6WA 4RX1A 2XUDA 3ETJA 4DIUA 5EMLA 1LFDB 3EZGA 4EG6A 5KOJB 1FJGB 1YI0A 3SJ7A 5IPFA 4FFSA 4O6VA 1B7GO 1JA0A 3GFRA 4MV4A 5HHTA 2W6NA 3TBKA 1Z5OA 3K1JA 3JX9A 3KM0A 1QO0A 7YASA 1U81A 3W9YA 3AC0A 2IBMA 1L4NA 1K86A 1RJ9A 2OUKA 3LH5A 2F43B 4MUNA 4WA7A 5EP2A 1OOEA 4LDJA 5DV9A 5A0VA 2XI4A 5H02A 5FNZA 3NZEA 3OQJA 2R5FA 3I53A 2CT8A 2IUSA 2ZB8A 3AO0B 3OWHA 5HMLA 2QTVB 2OESA 1Z5WA 3U44A 3GDFA 4Z86A 4IDDA 1TK3A 5IF9A 2L42A 5JECA 1XRNA 2V4UA 5JH7F 2VNKA 1JXAA 3AXSA 2WFLB 4LF5B 1WLYA 4JJEA 4QDUA 3CUVA 2CXRA 2H65A 1XZCA 4F2DA 1U0FA 3AJAA 4HNQA 5T41A 5M7EA 3AERA 4MEAA 3ZD6A 1KORA 1I3CA 1YNSA 2E89A 1Y81A 2IDMA 4L07A 5BSEA 2XE7A 4KIJA 3RRNA 2NYUA 3LHFA 3RTEA 1OX4A 3WGKA 3B2EA 3DMFA 4LNAA 2ZWAA 3M6FA 1ZO8A 5F7ZA 1NVMB 3KXIA 2XOKA 1IJKA 4GOOD 4TMXA 4UOZA 2R84A 2HJSA 2YKGA 3A1FA 1FNDA 3NHFA 1TTPB 1K3TA 4PAOA 1U7PA 1ULSA 2PJUA 3P9QA 5BRAA 3DCYA 5T8KC 3MW8A 3K2BA 3O8QB 4BO5A 4IGIA 5EIXA 3NM4A 2AVDA 2XKBA 4EB6A 1VSBA 3ZV4A 3DW3X 4IMJB 1KIMA 4IL5A 3OKCA 1VL0A 3W5SA 3OZEA 1VZ2A 1KEPA 4BCDA 1F12A 1L5LA 1H4SA 4AD8A 4N0DA 2ZRPA 1PAUA 4YJ2A 1HFKA 4JJ8A 3E6AA 1ZITA 3AW8A 3L9XA 4ND6A 5FLYA 1AC5A 5DHRA 5AW5A 2C1ZA 4G86A 4KTTE 1Q2UA 2V6JA 1O5IA 2YVLA 3LL4A 1AHIA 1RXVA 1E8NA 3QP9A 3BKXA 3P0IA 2GN1A 3LZCA 3TWOA 3EN0A 4J3FA 2HCFA 4ZYLA 5F2KA 4I5FA 4BZPA 4GE0A 2AC7A 1ZU5A 2ZJ1A 3LQKA 1E9CA 3L8YA 2FPPB 5LLSA 4OI4A 4QRIA 4EF5A 1U0SY 2GBLA 2JLAA 2IXFA 3ECSA 4EHIA 3GROA 3QQPA 5KCMA 4MIKA 5CAEB 1X92A 5BMVB 1QRTA 2P4SA 3EISA 2WSMA 5E6SB 3HV2A 4B46A 1H1LA 4F3YA 2OORA 2KYRA 1DJLA 2X40A 2JIDA 2VNJA 4OKSA 4PICA 4ZZIA 4J1NA 2IEYA 1ZCBA 1CHNA 2M1XA 1KJWA 3ZE0B 2HA3A 1Z12A 2FF7A 1YBVA 2EQ5A 2ONCA 3UCFA 3R7BA 5TQ0A 1GTSA 4G09A 3H4MA 3TQQA 4XE5A 4TM7A 3TRFA 5FWYA 3V34A 5TPWA 2GOYA 1K6MA 3Q5EA 1NN1A 1G291 3AINA 2HSGA 2WF8A 2D4HA 2Q4TA 2PSDA 1NY6A 3HYSA 2NUTA 1JXMA 1L5ZA 1YVEI 4P86A 3ZU4A 1U0LA 3LYHA 4RXTA 3WYCA 1DRUA 1ZUNA 4BFZA 1AMOA 2YS6A 2HW8A 1OA1A 1TKAA 1JAZA 4EHKA 3SXJA 2PUJA 1GKLA 2G70A 1XKTA 1JKMA 3T9EA 5MGBA 2IH5A 2E6UX 4JGIA 1QB7A 2YHBA 1HT0A 2GPBA 3OCYA 1BKYA 4MCJA 3IBTA 4N7RA 4HH3C 1U2GA 1FCJA 4C04A 1IMOA 4WN3A 4NATA 3U81A 3ZU5A 1E61A 2GR9A 1QR2A 2Q99A 4A5SA 3JYNA 4R9UC 3QEKA 3DKRA 3NNNA 1ONPA 3MMNA 4U8GA 1KYYA 1N6RA 1UDWA 4XZ3A 3URMA 3VPAA 1T6ZA 3ITKA 4YRLA 4KJXA 2DBZA 2FH5B 2PAAA 4J2TA 5ADHA 2CLHB 2H2GA 1G5FA 2L18A 4IV8A 3ZTYA 2PWZA 2QZZA 3ANSA 3UFBA 2JIQA 3T38A 5EOVA 3WL7A 1RLJA 1BU5A 2ZUEA 1U90A 2PRKA 2YNMA 1ZKDA 5AVQA 2G07A 4I4IA 3ZU6A 5DBHX 3L7MA 4EQ6A 3JPYA 1WHSB 3LRXA 2JA2A 1X1RA 2PL3A 1ZM4A 3IQGX 3JASA 4HADA 4PZLA 1S6YA 3ZW7A 4Y2GA 3NATA 4ZXPA 5D3MB 3VDRA 5BYAA 4WNYA 5EIBD 5FCDA 4YO7A 3SG0A 4CIBA 3VISA 3A6HA 3KOYA 5F7XA 3JSAA 5AVKA 1FP6A 1ZI8A 2XEXA 2XNSA 1VIYA 1K6XA 3GELA 3P9CA 3PF9A 4BP9A 3QV1A 3KP1A 4UVDA 1ELOA 2FPKA 4HTFB 3SDSA 1ZN2A 1XLWA 3QSGA 1SGWA 1IM2A 1HO3A 4A1OA 3O3NB 4Q05A 3WMWA 2A58A 4DPLA 2O50A 3NM6B 2YV4A 1ZZEA 1SKUA 2K2WA 3PVZA 4XDZA 5CA1F 4Y2PA 4NVRA 2Y1KA 1Y6ZA 4R1LA 1MENA 5AKHA 2G8LA 5EE3A 5EY5B 4AN4A 5JDCA 3GRAA 4G67A 4I5GA 3UWKA 1VBKA 2VQ6A 4LDPA 3V2IA 1PWYE 3ETHA 4NL4H 3VZRA 3EWAA 5AXAA 3AI3A 4CCWA 1HE4A 2Q41A 1CUEA 4DA8A 3MG9A 3DZCA 3NU1A 1Z17A 3VX4A 2AD5A 4DMMA 1N3YA 1L7VC 1V1RB 3VC7A 1KVTA 2BFDB 3F47A 3U4IA 1U3DA 4B0PA 2O7NA 2JLZA 1Z0UA 3DZGA 4A82A 5HVNA 3VNSA 4E5DA 4RTJA 2AFHA 2AG8A 4OMCA 1MH1A 3IKJA 2DSTA 2WOOA 1F5SA 1HBJA 3C15C 4M1QA 2WJGA 4QULA 4C78A 3TAUA 4QL3A 2DERA 2RHLA 3FTQA 3K96A 1W88B 2F8LA 2Q5JA 4ZARA 2QUAA 2WWFA 2ZYTX 2CNWD 3TVDA 2B3DA 4B85A 5JY1A 4G0UA 1IAVA 3M4JA 2PH3A 1R8XA 4FMDB 2VDMB 3EVCA 1G4UR 4C14A 2JFHA 3EEYA 1N4AA 3ICWA 4FFLA 4YGYA 4AJ2A 2OENG 4GWKA 3OHPA 4LRUA 3OWOA 5DZSA 3GWZA 3CVYA 2XVAA 1UMBB 1WKVA 5BN4A 1F2DA 3WGHA 2H1LA 4JJKA 5K3EA 2D00A 2PSHA 4MW2A 2JK0A 2R6GA 2V7VA 3LD9A 3JQ7B 3UOAB 7REQA 1CT9A 5JSQA 1EXDA 1MZPA 3AR6A 2GBFA 1QS0A 2YQZA 1RLUA 4PPGA 3HCDA 4U6SA 4YI5A 1U7OA 2ATXA 4HWOA 4P32A 1B15A 1EJ6A 5DM4A 1SQ6A 4HGQA 6GPBA 2HO5A 1Y8RA 1UXKA 2ZDGA 4PYQA 3VU8A 4H7PA 3ICEA 2COEA 4D9MA 4P81A 3HE3A 1ID1A 3LGAA 3E3NA 4CNQA 3E7DA 2AOVA 2AZMA 2VDKB 2A1UA 3H1BA 2J41A 3SXUB 1WXWA 4CIXA 5B2FA 5K8IA 3NOXA 4DY4A 3FKSD 2I67A 1RLOA 1DJNA 2CBGA 2PLWA 1UWVA 3SZOA 4Y18A 4JI0B 3GVXA 3M5PA 4NCAA 3FDFA 1KHHA 4ZU6X 5IT0A 1MB2A 1YL6A 3EZ6A 3ET4A 2JGIA 1VHDA 3FWNA 3OLZA 5AMXA 3DT6A 2XHZA 2JFBA 5GZ3A 3KKOA 3Q5DA 2FRDA 1DTSA 2CHGA 4D3YA 3TX6A 3UTCA 4NJMB 4RQAA 4ZALA 3U5TA 3OU2A 3NORA 4I36A 4EUEA 4UTNA 1KPGA 4I08A 5FO1A 4HB2A 3RJZA 2DFDA 4E3ZA 3NBKA 4ZVPA 4J8PA 2ATCA 4X90A 4XKJA 3TGWA 1M7HA 4EI9A 4M98A 2W90A 2OYRA 3HDYA 5CH3A 4YFVA 4UNRA 4LFCB 5KINB 5LP1A 3T4XA 1XTUA 1AG9A 1G7RA 3B5IA 1UT5A 1N7GA 3IV7A 3FIUA 3IR7A 3UW3A 3KELA 3F0TA 4AS3A 1VJCA 4K6KA 5FLKA 3L2OB 3CU5A 4C29A 4DXHA 4ZI7F 5KJFA 1V96A 2JH3A 3BK1A 4UQPA 3ZHZA 5K01A 2TS1A 1XJWA 1BC5A 2CNBA 3AV0B 2W2XA 2Z2ZA 5FHQA 4Z7NB 5JLJA 5KDDA 1JLHA 1GOTA 2AXEA 4KQXA 4RF2A 2AQIA 3OMXA 3T99A 4BKUA 2EFHB 3K1ZA 1VSQA 1D5WA 1TQ2A 2IGTA 3JQGB 4WGFA 1X7WA 4TXNA 3UA3A 2UZ4A 1CZNA 3RSSA 1TUIA 1RR6A 3L6DA 4J0KA 2R8YA 3QU9A 4J0EA 1RWWA 2QRQA 1DIAA 3MFYA 1G8FA 4MKFA 1COWA 2QEQA 4KVFA 3MRTA 3VRHA 4AFNA 4BFUA 5TJHA 3GAFA 2B5OA 3IEKA 5E1MA 2Z9CA 2WINI 4TRMA 4OYRA 4XCXA 5BSUA 1KRWA 1GGMA 3FW1A 2R8EA 2CJWA 3CEJA 4PPYA 4P7JA 5AI6A 2PZFA 1JXQA 1M5TA 1SXJD 2PMDA 1E2MA 3MQ4A 1AUXA 3PD7A 3R5HA 3MPOA 3EQZA 1OB2A 1RWNA 2E3JA 2GZ3A 5JT1A 2QJWA 4O2AF 5A9TA 5LM3A 5AJHA 1VPLA 1DJOA 3EFEA 1SCAA 1VIDA 2JKZA 3U7JA 3CEMA 4WZBA 2EERA 2O48X 2A5GA 3FCXA 1UQUA 4DIDA 4I1IA 3G2IA 1PK9A 1Q0ZA 3E61A 2GASA 4RHCA 2JASA 3IB6A 4N3GA 3K0AB 1ZH2A 1YQUA 2YJ6A 2G1AA 2XA9A 2FEPA 2FW6A 3AETB 3FRHA 4YRBA 5HBRA 1FU8A 5HK8A 2DY0A 4LEIA 2N3ZA 2XF8A 3ZKAA 1LTKA 1TDJA 1H8HD 4KHZA 4KGZA 4MR7A 5I7HA 2NSJA 1DT3A 1VLQA 3OZRA 3ZJYA 3RWBA 2CV2A 2I6SA 4PO9A 4Q3NA 4YDRA 5AD1A 3D8NA 4HNVA 5I8WA 2QQFA 4DEXA 2ZJ3A 3H8JA 2O57A 2ZSIA 3CLHA 1NFFA 1XMJA 1CDEA 1XP5A 3FPLA 1Y8CA 2BHTA 3K0SA 2H63A 2HLDA 3B85A 3QTTA 4QAQA 4RIFA 3PNLA 4B3XA 1G2IA 1NOJA 2VT6A 4BU1A 3GRZA 4JX8A 4JROA 3C4VA 4B3FX 4A8TA 4OP2A 1HZZC 2WHPA 1VHTA 1BRMA 1TJ3A 1DDGA 2P1DA 3T61A 1XDDA 1RXYA 4MXDA 4WNAA 4C7VA 3GP8A 2IEGA 4TV9A 4UNSA 4U2EA 2GJSA 2ZJOA 4K6GA 4R7TA 2XH8A 2IP2A 3HK2A 3LBNA 2J31A 3CURA 3LP8A 5EJ4A 4DV1B 2HWWA 2VPZA 1ECBA 3K05A 3QF4B 1DO2A 1ITZA 2PT7A 3WQSB 2R751 2WJPA 4JXKA 1GITA 1K5HA 2QD4A 3IVCA 3SOPA 2P2GA 4XIGS 5CIWA 1E2UA 4A0GA 1TLFA 4MHOA 4XOUA 2HK6A 3RS5A 1MX5A 2R7AA 2HYDA 3KZKA 5CFZA 1NVVR 2ZJ5A 4TRNA 3PEUA 4NX2A 1O8CA 1Q7CA 4YAGA 3MINB 1C3OA 2PV0A 1QU2A 4BX0A 5LMZA 5C9ZA 4O4LB 5LBTA 3RR2A 1NVKA 4ZVTA 1LDYA 3L1JA 3H9UA 2PFGA 3GZ4A 2YC4C 3ONWA 2R2GA 5U1PA 2C5AA 2QQ0A 1F1BA 2Z6VA 3PXUA 4RLQA 5CGZA 4YAFA 5FFNA 1OBVA 4RHEA 3SK0A 1P3DA 5IAJA 3F9IA 1T5TA 1QS0B 3OX3A 4QOIA 2NU6B 3PXEA 2B92A 3BXGA 4YP1A 2YTZA 4XTRA 3UEOA 4ZZ1A 4HYTA 1PFYA 3MLEA 2ASEA 3EVGA 4WK0B 2EGUA 2I71A 4ZVVA 1AKEA 1NGSA 3DT9A 5ED0A 1L4YA 2XOEA 3OEYA 1FLAA 5A7GA 1ONNA 5AI0A 2ISSD 1AGPA 5EWLA 1YI8A 3SHFA 1VXRA 2VF2A 3CZCA 2XMQA 1NBWB 1KRXA 3FVQA 2SKDA 1Z88A 3EA0A 5AM5A 1E4EA 3I2FA 4BQFA 1UBUS 2CHUA 4X85A 1PQYA 1NW6A 3DV0A 4ARZB 1ORDA 2ZPAA 2FXIA 4GR9A 4A1FA 4Y2VA 1DRJA 1DFGA 2X1MA 4Q4DA 2OQIA 4UPEA 4Q39A 1V45E 4XJXA 3UAZA 3F1KA 1PUIA 4LC9A 4BNKA 4FEAA 1P4HA 1U9JA 4EUFA 3LWDA 4J90A 1Q19A 3DYIA 5C34B 4UBJA 1HUQA 1OJLA 5AK0A 4RLSA 1RYDA 1XCMA 1Y7LA 1IHOA 4IKPA 1O87A 3MSXA 4OMFG 5F1YA 4F4DA 2RD2A 1VBMA 1SCIA 2NTJA 1R4AA 4TV8F 2JRCA 2CYBA 3DAPA 3EMDA 2EBWA 3PICA 4F1WA 4ESEA 1NXPA 1E1RA 5E9WA 1E18A 2Y1FA 4GKBA 5EHZA 2H0QA 1FUUA 4ZXFA 1EJ2A 1G5QA 2CJFA 2IYUA 3FAZA 4RHUA 2JLYA 4XIIA 3AR3A 1WB6A 4BBPA 4ZOLA 2DU8A 2FOIA 2NNWB 1TKRA 4I14A 4I1SA 4NS4A 4XYBA 3T41A 1IVYA 5G1NA 4KRYA 1T4CB 3ZV3A 4J75A 5L4NA 4QBFA 1UIMA 2IZOA 2IXBA 5F35A 1T5HX 3AKCA 3KVNA 1YIAA 2QRZA 4GKKB 2ZVQX 1QDEA 1MA0A 1AKMA 1KDVA 1MQSA 2RBKA 5FWXB 4ZMSA 4DJJA 2QU8A 4D82A 1Q1ZA 1HFWA 1XE3A 2HREA 3CN9A 5ALXA 5HIMA 1JZSA 4CKBA 1Z5GA 1G41A 1UZLA 1QRAA 3AVWA 4TZ6A 2H4XA 4N4AA 4RGVA 3OEHA 2DZDA 1AV6A 4JMLA 4OP1A 4NPCA 4XDGA 3W8FA 4Y2XA 4A2QA 1E2QA 3PX3A 2I87A 2XMSA 1YE5A 3ANMA 3CUEF 4PEVA 3LZDA 4Q1AA 4Y2JA 1MT0A 1S9HA 4QU8A 4BAUA 3G9TA 4KBGA 1Q7BA 3IP3A 1M5UA 4G4IA 3D2LA 4ZQFA 4AO8A 5K8CA 3DZIA 2BKEA 2GBCA 4IJQA 4UATA 3U4HA 1ORHA 5NLLA 3W90A 5A3JA 2VTBB 4UUMA 4NCBA 3GX1A 4O1IA 4BEJA 1SVOA 2AI2A 3QQ5A 4HD8A 4KVZA 1WDMA 4P1ZA 4B5LA 3BTSA 1BYIA 5FF9A 4H08A 4CV3A 4QT4A 4NOLA 1T1GA 1JLSA 1W19A 4M8KA 1E99A 2MYNA 1J7KA 2XMPA 3HKBA 4F9GA 1HETA 2BHSA 4IH9A 5AVXA 2G5CA 2PGXA 3PZBA 4LMBA 4HYYA 1K8XB 4MSUA 1XPUA 2J4CA 2ORWA 3DF9A 4HXYA 1U1DA 5AK5A 4RTRA 3JQFC 3UENA 1XQVA 1GQOA 1JV2B 3AJRA 4D9NA 1IH8A 3JARB 3VTAA 4DLVA 2KLBA 5AK4A 2VUHB 2ZSUA 4HY3A 4PG4A 1M34E 1OXBB 3SDZA 2A9OA 3SJAA 1N2OA 4E5VA 3FVRA 4B7CA 3WLRA 2BJWA 1SZJG 4YT8A 1PKXA 1RXCA 1SCUA 3DMHA 2NNLD 2YMLA 4MV5A 4Q03A 4CU2A 3EK2A 4AYXA 2M9MA 1TW3A 4KNWA 3OQIB 4RZIA 3IOEA 3KQWA 5I3ZA 3UK1A 2NO0A 2VAPA 3WKCA 2GHQA 3W9SA 3LDHA 4A03A 1C7EA 1QRRA 3CXUA 1DX4A 3ZHCA 4DLSA 3Q0TA 1KI2A 1NI4A 1JB1A 3W2HA 1LPPA 1IATA 1JAXA 3HDJA 3TD2A 1R0SA 1CR2A 3AUXA 3CCBA 4FCCA 2J0VA 5CUQA 5TLSA 5CIYA 1SBZA 2PYZA 4D80A 4QEKA 1WP4A 3Q7RA 4ETMA 2R6DA 2VEDA 3KHTA 3NT2A 4JUBA 5CA1B 1L1QA 1NUAA 1AXEA 1UXOA 2ET6A 2RHBA 2Y0EA 3ED1A 3OC0A 4I4TF 3STXA 1LV8A 4EY8A 5FJIA 1RYFA 5DYNA 1YZQA 4LOJA 1EFUA 1LWOA 1ZD9A 3SE0A 1TF5A 1W47A 3KPUA 1T91A 3OOWA 1U2TA 5GPBA 3KQNA 2B4KA 4WERA 1A7AA 3KWLA 2P2YA 4GXTA 3AVXA 2YVQA 1G6KA 5CIQA 2OCBA 2W6OA 3H6KA 2EX0A 3GD7A 3MIIA 3P5BA 3EEBA 5ALHA 4BZXA 4NIMA 4TKUB 2JLQA 1VLLA 1OSNA 5FPPA 5JWHA 3DZBA 1F6WA 1PBNA 1GRQA 2B3TA 1QTIA 4L5BA 2X0JA 2WUEA 1ZJYA 2CD7A 3CEHA 5LP6C 1T5OA 3VJRA 1XDSA 4JEMA 3ENKA 1QF6A 3AWIA 3GFGA 4D8TA 1W7AA 2CVOA 3BD6A 4NENA 2C7GA 1GNVA 3QKRA 5IH3A 1ZAYA 4NMLA 5KVQA 2Y67A 3RFUA 1PR0A 1VYTA 2IUTA 4FLEA 1VP9A 1Z4OA 1MHPA 3BGDA 3IVRA 2Q5EA 3OQBA 4TTSA 2EX4A 3RAPR 5DU2A 1KQFA 2GNPA 1CYEA 2INGX 3T9FA 3L6OO 3W3AD 2O5CA 1BJRE 4ZT5A 1ONSA 3GW8A 3OMWA 2C4TA 1A2OA 2Q9UA 2EJCA 2QRVA 3A9UA 3QVTA 3RG2A 1JDVA 3RSQA 3IQHX 1KU6A 1SOAA 2XDAA 3ETNA 1KPHA 3C3KA 2J5QA 2ZJAA 3SJCA 1PR5A 1UWLA 4HRYA 4DBLE 2VP3A 4PSUA 5BVGA 3K92A 1NNI1 2FWBA 1G2QA 1R8YA 2QE7D 2ZDQA 3GEPA 4BGVA 4C7MA 1GNPA 2XVXA 3O3OB 1Z25A 4GZ6A 3AVYA 3A14A 4J0GA 3TR0A 4QDTA 1QTNA 1TVCA 4Z7JA 2QP9X 1JFVA 3T95A 5B58T 1ZUD1 2G9NA 1E9VA 1BMDA 4EG7A 2W0SA 1KH1A 2DHEA 4ALKA 4HYEA 2W2MA 2YICA 4IDAA 4ENWA 1YC2A 1JQLB 3GJ0A 3NAMA 4DILA 5HJEA 1A9XB 2D0IA 4HFRA 3OZCA 1XZBA 3FFBA 3UH0A 5EAIA 3H5IA 3UJCA 4IXTA 3PUVA 3OIFA 3O7MA 4PYMA 3UXMA 1OFHA 4B4WA 3V4FA 3AQ4A 1RXIA 3HXTA 3I05A 2F90A 4J0QA 1RD4A 2VK1A 3OCZA 5F5XA 1TJPB 5KJ1A 5DGIA 3NR2A 4V0LA 4TTPA 2A0KA 2XDWA 3HXOA 1O58A 3EUFA 2QUHA 5I7RA 1VL8A 1WY5A 3UZUA 2QRJA 2QM7A 4I55F 4NBRA 4GMHA 1LQUA 4OLFA 3D0OA 1UK8A 5G53C 4MI6A 4AUKA 4BFTA 5E7IA 3V4VB 4OU4A 3WB2A 1KMNA 2V8OA 1T3HA 4Q7MB 5MN5A 2OM6A 4CEHA 1ABEA 5KNDA 3VR5H 2AH5A 2V7EA 1Y48E 1DBSA 1W29A 1MO5A 5DIFA 4O8CA 3AF6A 2CK3A 3AEZA 2HNBA 4GOMD 4LC0A 4QLAA 3SBXA 2JH9A 4BOYA 3ETDA 1A7UA 1ZUWA 4KO8A 1FFEA 1OU4A 1DZIA 4L4ZA 3RS8A 3VR2A 4E03A 1NJ5A 2D0DA 2Z8YA 4XVQA 4HK4A 3O7WA 1UM8A 4XRGA 1ISRA 2QNRA 1T5DX 3ZCTA 1I6LA 1NE2A 3RW9A 1RABA 2PU7A 3GRRA 2IEZA 2GHRA 1XCGB 4MGYR 2IQIA 4RSRA 3GLIE 5CFQA 2ZSFA 1OTXA 1BEZA 4CM8A 1DC3A 5D3MA 5FPQA 4GE3A 2CUZA 1ZJ4A 1KQGA 4TQ9A 3R5SA 2HLHA 2Z58A 3GIWA 1QHYA 4R8VA 1U63A 2YJ4A 4F5ZA 3R40A 2HK9A 4PHFA 1PJ2A 3JR3A 1A7JA 2E0IA 1I6KA 3MOGA 3NHZA 4Q3LA 5IDYA 2FW7A 2W0MA 1G9SA 4J43A 2Y1EA 4QFMA 3W3AA 5HA5A 5A3VA 3VMMA 5B5SA 2NP6A 2O6LA 1ZRSA 3KVYA 1T35A 4LHZA 2Q8PA 4P4SB 3VR3D 4BQOA 3AUTA 3CINA 4FYXA 4F5EA 1D0VA 4XR9A 1QHHB 1E3TA 1IHYA 2XZTA 1NXTA 1U8XX 2AEEA 3MYRA 4QRHA 4Y2UA 3H5TA 1T2FA 2Q6TA 1P1CA 3MNFA 3RUEA 2P4HX 2ZROA 4ZV9A 1E0AA 4R9RA 3HA5A 3HR4A 5KNLA 3KQUA 2PD6A 4HGNA 1RYHA 1VTKA 4HN4B 3ED5A 4U7PB 1G98A 2VXYA 3LK7A 4OQLA 5F77A 3TZEA 4O2BA 4EOGA 1V7ZA 4PONA 2AG0A 4RVGA 2QU7A 3W3ZB 4CYMA 2FRDC 2BVNA 4OHBA 1TVMA 1N9GB 4P0QB 4ZK6A 4NCXA 3EF3A 2L19A 1NUTA 1UJMA 2I1LA 2Q29A 2HNAA 4HB3A 1OH6A 1KOGA 3VU3A 3RYCA 1B2LA 1VI6A 2QE6A 4HVTA 4MYHA 3KSUA 1FFDA 2GFQA 3FNIA 2BZ0A 2V03A 4N8SA 2Z5GA 3FGNA 2YHSA 4XWAA 3D0KA 4ZEVA 3L7NA 5CBKA 1Y1LA 2GKSA 1TJ4A 2FMFA 3KLMX 3NRCA 4MPTA 4WWHA 1IOLA 4NYIR 2V7TA 2P27A 5LOVA 3SYKA 2ZQ5A 3VOTA 1M2FA 3PE4A 3X43A 3ZDZB 2GPNA 4FNGA 4N5HX 2HMUA 1V5GA 3A9SA 3AEQA 1RADA 3FCUB 3ON5A 5CA1A 3DNMA 4L9AA 3BD9A 1BSVA 2BFWA 3DVRX 3WDSA 1MV8A 3LUKA 2F4VB 4FOOA 3FPAA 1TT5A 3FCAA 2HQBA 1SBTA 2XA1A 2G36A 3U44B 4YPOA 3SX2A 4HFNA 1STOA 2YWDA 3GMIA 2FQXA 4L4XA 2QG6A 3CKLA 3N2GA 3OUZA 4IIXA 3N2YA 5JS6A 4HDSB 2AQHA 3BHNA 4J1TA 4Q1BA 2O2JA 1BH6A 1GYPA 4FU0A 3UMJA 3FPEA 4MLPA 3WA6A 1ZJWA 2Z6AA 1QOPB 1JMYA 3QU2A 1M2OA 3UJBA 4W5QA 4BNNA 5C31A 1Y3AA 4OX9Y 1KY3A 1ZFNA 1FRVA 3MMSA 2QRGA 3M4NA 4OHWA 4ESHA 1NW7A 1WNTA 3VO1A 2DVMA 1ADFA 4DM4A 3T1YB 2NVUA 3EPPA 4B3JA 1JGTA 4EJ0A 3EG5A 3FUWA 4LZOA 1NHWA 3ANNA 1CUWA 3VAZA 3FF1A 4BO8A 3TBHA 3L07A 1KSFX 4NV1A 5AVVA 1UWKA 1RIFA 5B1SA 1OILA 2FSGA 2HWKA 4XH9B 1KNXA 3PSHA 1HE2A 1LPOA 1VB5A 2ZOSA 5C53B 2ZJ6A 3IODA 1EIWA 3FPGA 4YQEA 3JALA 5ICEA 1SMKA