4GPGA

X/n joint refinement of achromobacter lyticus protease i free form at pd8.0
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
263
Chain Sequence
b'GVSGSCNIDVVCPEGDGRRDIIRAVGAYSKSGTLACTGSLVNNTANDRKMYFLTAHHCGMGTASTAASIVVYWNYQNSTCRAPNTPASGANGDGSMSQTQSGSTVKATYATSDFTLLELNNAANPAFNLFWAGWDRRDQNYPGAIAIHHPNVAEKRISNSTSPTSFVAWGGGAGTTHLNVQWQPSGGVTEPGSSGSPIYSPEKRVLGQLHGGPSSCSATGTNRSDQYGRVFTSWTGGGAAASRLSDWLDPASTGAQFIDGLDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease 1
publication title Neutron and X-ray crystallographic analysis of Achromobacter protease I at pD 8.0: protonation states and hydration structure in the free-form.
pubmed doi rcsb
source organism Achromobacter lyticus
molecule tags Hydrolase
total genus 84
structure length 263
sequence length 263
ec nomenclature ec 3.4.21.50: Lysyl endopeptidase.
pdb deposition date 2012-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gpgA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gpgA02
5DP3A 1ELGA 1H8IH 1GHVH 3SQEE 3KIDU 3TH2H 4JCNA 2OINA 5EOKA 1EOLA 1F7ZA 1EOJA 1SGRE 1ZGIA 5F8ZA 2QXGA 2Q1JA 1BMMH 1SL3A 1ZRKA 2C8ZB 1HAGE 1ABIH 1ZPCA 4MLFB 5HXFA 3P95A 2JH0D 4KGAA 1GHWH 1LHCH 3QGJA 1TPSA 5GWZA 1OYQA 4FXGH 2GZ8A 3ZZ9A 4AGKA 3A7YA 2O8UA 2FTMA 3SNDA 1D3DB 3AVZA 3BSQA 1GCTC 3BV9B 4ZAEA 2ZFSA 4IC5A 1TBRH 3TU7H 4GHQA 4H42U 1GBHA 4WMDA 4WH6A 1XMNB 3BTTE 2PSYA 1W7XH 3I77A 1K9OE 3A7VA 3TVJB 3UQVA 1W11U 4FUGA 2H1UA 2WPMS 3FAOA 1GJCB 1ARCA 1AZ8A 3SGAE 4BAHB 2VWNA 4OS4A 1C2IA 1BTWA 4A5TS 3TNTA 4LOYH 1ZZZA 1DWEH 3A89A 3EQ0H 4MNWA 1V2OT 1OWJA 1XUKA 3ZYDA 3LKWA 4JZEH 2ALVA 1SR5C 1TIOA 1Y5AT 2ZI2H 3ATWA 2F9NA 4DCDA 1GI1A 3GCHB 3B23B 4DW2U 4OGYA 3A87A 3A8BA 1QA0A 1ZHMA 2F83A 3A82A 1O2UA 1MTNC 1W14U 1SHHB 3GCTG 1GBFA 1MUEB 1YBWA 3SORA 2QCYA 2QF0A 1TX8A 4I8HA 5FPYA 4ISOA 3SUEA 1DDJA 3TNSA 4FUDA 3OY5U 2ZEBA 1S85A 2NU4E 1EP6A 4AG2A 1GI6A 3F9HA 1EPTB 2A2QH 2ZDLA 1H9LB 2ZQ2A 1BITA 4I8GA 5GCHF 1P2JA 3E6PH 1XKAC 1TMUH 1W0ZU 1CA0C 1YPHC 2SFAA 1SOTA 1SVPA 3ODFA 2P95A 5H4IB 3ZVAA 2ANYA 3SO3A 1NZQH 4BXSA 4NA9H 3SNBA 4IMQA 1GMDF 3BTDE 3U98H 1KDQB 1AN1E 1O3JA 3A86A 3SZNA 1DVAH 1Y59T 1Q2WA 2O8TA 3FANA 5ESTE 3JZ1B 4K8YA 2FOHA 3U8RH 4CR5A 2R2WU 5GPIB 1CBWC 2C93B 4Y76A 1VCQA 4B2BA 2QYIA 1Z1IA 2AGIX 4U01A 1MCTA 1TALA 2VIDA 2HRVA 2BM2A 1K1JA 2QAAA 4J1YA 1CHGA 1SBWA 1O2WA 3TH3H 4VGCC 1W13U 2CXVA 1TQ7B 3TIUA 5EU8A 1EP5A 3FVFB 3UQOA 1WCZA 4K3JA 2G81E 1O31A 1EZQA 2ZDAH 4YLUA 1AFQB 3K2UA 1OXGA 2WPJS 2BYAX 3VFEA 2P8OC 1ZYOA 1SQAA 1ELDE 2ANWA 1JIMA 3OU0A 1C5QA 3OY6U 4I7YH 1QFKH 2GDEH 5DP8A 1HXFH 1VR1H 3R3GB 1C1UH 2BQ7B 2FESH 1P57B 5ABWA 1KLIH 3V7TA 1S6FA 3C1KA 1H8DH 1ZSLA 2FS9A 5LPRA 2BD2A 3ZV9A 1Z8IB 1E34B 2ODQA 1MAXA 1EJAA 1ESTA 3MU0A 1IQJA 1PFXC 2PGQB 1AKSB 1FY3A 2GDDA 2ZHWH 4ISNA 3RXCA 3U1JB 1V2PT 1ZRBA 4J2YB 4FU7A 2HLCA 1QB6A 2ZNKH 1FN8A 1MKXH 1QBOA 1Y3WA 2ZC9H 1T8MA 2OBQA 2VB0A 1GBLA 3VGCC 3M5MA 1GJ6A 1VCWA 2FIRH 5C1YA 1JMOH 3RXFA 1IHTH 4XBDA 2GZ9A 1A4WH 2HWLB 1NRPH 1V2MT 1YPGH 1ZSKA 1C2GA 1P2KA 1PPZA 2ZCKP 2V6NA 3GY5A 2IOTA 2BQ6B 2BX4A 1GJ5H 1GWAA 3PO1C 1ZPBA 1C1WH 4AN7A 4XBCA 2SNWA 3MH7A 3I78A 4MPXA 5C1XA 2QN5T 2PKAB 2ZZUH 1THSH 4NCYA 3GCHC 5SGAE 1BRBE 2SGDE 1TNHA 3IITA 2P94A 3ZVBA 1Y3UA 2D26C 2ULLA 2NU1E 1GBBA 1HPGA 5A8YA 3MU4A 1DWCH 4E7NA 5EXLA 1FJSA 1MTUA 4BTIB 4FUHA 2ZU2A 4O97A 1MZDA 1ZMJA 1EPTC 4INKA 3GY8A 2VGCB 3U1IB 1N6XA 1OOKB 4NIVA 1ELAA 4D9RA 5EQQA 1QA7A 2KAIB 3S7HB 1NU7B 2OUAA 3BG8A 3KF2A 2TGDA 9LPRA 4MNXA 2ZPRA 1TGSZ 3BTWE 1D3QB 3BTGE 2W3KA 1AVXA 4B74A 3RXEA 4DG4A 3BTEE 5CMXH 3P6ZB 1ETSH 4I33A 1HJ9A 4TPYA 5CHAB 3EDXB 1ESBA 2ZDKA 3RC6A 2J4IA 3NPSA 4UONA 5DP9A 1MMJN 4BAKB 1TOCB 1UTNA 3GCTF 1ORFA 4KTUA 3ZZ5A 1TGBA 4NA8A 2GD4B 2A5AA 1AB9C 3BEFB 1AUTC 1NU9A 4Z0KA 1C5SA 1AWHB 1C5TA 4XDEA 1BMLA 3RUOA 1NPMA 1YGCH 1GCDA 1GVLA 1QCPA 3P17H 1J16A 2BZ6H 1LHDH 1YPEH 4MVNA 1DICA 1NRRH 1BBRH 3UWIA 3ZZ3A 1RTKA 1FV9A 1ELBA 1HAZB 2PHBA 1EJNA 5EPNA 1EAWA 1MBMA 3BG4B 5C67A 3QTOH 3KQCA 4NWLA 1GJ7B 4BXWA 4WY3A 1HJAB 4MNVA 3RU4T 1M9UA 2BLVA 3KQBA 7LPRA 3G01A 1ZHPA 1MTWA 1Y5BT 2ZGCA 3K6YA 3E3TA 3LGWA 1DSTA 2BDAA 1V2NT 4WH8A 1YM0A 1QJ1B 1UTLM 2H6MA 3M5LA 2FOBA 1V6DA 1FN6A 2GMTB 5E2OA 3BF6H 1HJ8A 3VB7A 2H9HA 4CBNA 2VWOA 3T5FH 3E0NB 2A32A 1K1OA 2V0BA 2H5CA 3A83A 4UDWH 1SMFE 1PPHE 1ZJKA 2AGEX 1Z71A 4RKOB 5F8XA 2V3OH 1O2HA 4O3TA 3FP8E 3E0PB 4WMFA 2G55A 1SGFG 8LPRA 1CU1A 1KXFA 4KELA 3LU9B 1L1NA 1OWKA 2P3FH 3TGJE 2GVFA 4ABBA 1PQ8A 1YPKH 1HFDA 1SG8B 1PYTD 2WYJA 1D4PB 1P3CA 3SU4A 4YT7H 1HAPH 2PGBB 3TPIZ 1BTPA 3PMAB 4ZKNU 4X6NA 2ZECA 4JZ1A 1YCPM 3S9AA 3LGUA 1TBZH 5EODA 5C3NA 3SQHE 3BIUH 5T6FA 1G36A 2G5NA 5LPEA 1J8AA 3GCNA 1O37A 4K2YA 2TPIZ 3CP7A 2ZGBH 3E16B 4AFSA 4HFPB 3UOUA 2FX4A 1NS3A 3MU1A 1HDTH 4U2WA 3VB6A 4ABEA 6CHAB 2R3YA 1A7SA 4OS7A 1PPFE 4THNH 3PROA 4YTAA 3ZZ7A 4ZUHA 3ZZ8A 3MHWU 1GHBG 1BJVA 2VNTA 1CO7E 2BLOA 2JKHA 3UNQA 1RTLA 5AVDA 2FOFA 3TLOA 2Y5HA 2AEIH 5HGGA 1F5RA 1FNIA 2I6SA 3A85A 1O2OA 1T8OA 1W3CA 4AOQA 2A4QA 2W7UA 2W7SA 2WV4A 2J34A 4MPVA 5CHAC 1MH0A 1UK4A 1HAIH 1O2KA 1O5GH 5C20A 3MNSA 3Q00A 3ZZBA 1EAIA 4YT6H 5DGJA 2UWOA 2ZTXA 1KXEA 1SGQE 3MWIU 1UTQA 2A31A 4I31A 5I25A 2HNTF 2Z7FE 3LC3A 1IHSH 1G2MA 2XC5A 1UVOA 3AAVA 4Y71A 1V2TT 3SNEA 3QTVH 1TX7A 1QRXA 3P92A 1KY9A 3LIWA 1BTYA 1O2GH 4GAWA 5DP6A 5DPAA 3RXKA 4BNRA 1KXAA 2Z9GA 4FUEA 1O39A 4ZH8A 1LMWB 1XUJA 2TRMA 3BEUA 4AG1A 2BXTH 3BG4C 3SJIA 1GL0E 1C5OH 1S83A 2GCHG 4D7GA 4Z6AH 1GHZA 2CJIA 5BPEA 1UTPA 1K1IA 1O2PA 5FHTA 2B0FA 1ELCA 4NSVA 3V13A 2Y7XA 1W10U 4IC6A 4ABHA 1K21H 3ZZ6A 5FAHA 1QQ4A 2GCTB 5GIBA 4GSOA 1FY5A 2RA0A 1O32A 1G3DA 2GMTC 2NWNA 4X2VA 3SBKA 3QK1A 1GI9B 3PMJA 1CT4E 1PPCE 3VEQB 4B75A 1AI8H 1LQEA 5JBAS 2FTLE 3RMLH 5DO4H 3DD2H 1ZSJA 2XCFA 1IAUA 1FY1A 4D7FA 4X2WA 2WYGA 3EA8A 1K22H 4WJG2 1L1GA 5LPFA 1A0JA 1OS8A 3RXMA 2C4FH 2F9VA 2XW9A 4FU9A 1LHFH 3VPKA 4LK4A 4X2XA 1QNJA 3U9AH 1HAYB 1HXEH 1PQ7A 3ELAH 1D6RA 1HV7A 2CF9H 2W26A 3LONA 4B73A 2DE9A 1E37B 4NZQA 3UR9A 2ZP0H 1P11E 1T8NA 1EZXC 1T8LA 3B9FH 1Z8RA 3I29A 2G8TA 2CGAA 4TWWA 1LKAA 3PLPA 2B9LA 1BMNH 1DWBH 1UTKA 3A7TA 1BHXB 2FO9A 2FEQH 3RXVA 4B1TA 3NUMA 1O2QA 3LC5A 1SI5H 1CVWH 1O2SA 2XCNA 3DFLA 1OWDA 2JETB 1XVMA 3SNCA 4I8KA 1GI2A 1WOFA 1TNGA 1AVWA 2O8MA 2ANMH 1C9PA 4ABFA 1WAYB 2A1DB 1C5MD 2TBSA 1O2JA 1G3BA 1KSNA 2V3HH 1O30A 1CA8B 2CHAB 1BHXF 4Y11E 2VWMA 2GV7A 1RXPA 2FI5E 2TGAA 1QL8A 3A84A 3GOVB 4CHAB 1XUFA 1YC0A 2V35A 4LZ4B 1JIRA 2QXHA 4FUJA 1FDPA 2ZU5A 2ZFQH 5JBBS 5C5OA 3UY9A 2HNTC 2WUBA 3RXSA 1O3PB 4WMEA 1E38B 1HAVA 4DY7B 1GJDB 4O03A 2B8OH 2H9EH 3MFJA 1SSXA 2ZFFH 2ZPQA 1FONA 3SUGA 1GGDC 3FP6E 3SN8A 3SI3H 2Z9IA 3SV7A 2PW8H 1SGPE 5L2YH 2Y81A 1C1OA 2BY6X 1IQNA 4X1PU 5K0HA 1D9IA 1DY9A 1SLWB 1C5LH 4A92A 2BVSH 1GHBF 3A81A 1ZPZA 1B5GH 5A2MH 1HLTH 1V3XA 4BOHA 2ZHEH 1TNKA 3STJA 1WU1A 2BVXH 2Q6DA 1DX5M 2ZIQH 1O5BB 2ZWLH 1DPOA 1C5PA 4FUFA 4INLA 4CH2B 1C5WB 1P0SH 1A46H 2ZQ1A 2Z6BD 1UVPA 1S0RA 1W2KH 3JZ2B 3M5OA 5J4QA 2VH6A 3N7OA 2ZFPH 3K6ZA 4A1VA 3RXJA 1CGIE 1QIXB 1NFYA 1V2JT 1AE8H 1E0FD 4Y8XA 1RIWB 4OS6A 1V2KT 2WPKS 1BCUH 1KXCA 4NSYA 1EAXA 1P10A 1ZTJA 4UFEH 1YPLH 4TY7A 5JYIA 1KTTB 4HZHA 1DS2E 3V12A 1LDTT 4YESB 2Z3CA 1BUIA 1N8OC 2ZDVH 1IQFA 4X1NU 1VITH 2Y5GA 3S9BA 5DK1A 1JOUB 1LVOA 2H2ZA 1MZAA 2BDBA 1J15A 2YOLA 1NTPA 3SOSA 4YM9A 5ESBA 3GCOA 1GHAG 2NU2E 2GCHF 1JXPA 1SQTA 1XM1A 1YLDA 1CT0E 2J92A 4MQAA 2P3TB 1O5DH 1SC8U 4GVUA 1V2LT 1AY6H 4MG3A 2A2XH 3PB1E 2HNTE 3M5NA 3OTJE 2J38A 2VIWA 3RM2H 2ILNA 1TQ0B 1TNLA 2QV1A 3D23A 3MH6A 2LNCA 4XSKU 1THPB 1B0EA 2VVVA 3MO9A 2G4TA 1RD3B 4Y6DA 4RSPA 1O5AB 3MH4A 3URDA 1KXDA 4JMYA 4I8LA 2CMYA 4X1RU 2ZO3H 1C2DA 2FWWA 2YNBA 1QRZA 2BD9A 3BTKE 4E06H 1AIXH 3B8JA 3CS7A 1HCGA 2JETC 2Z3DA 1WUNH 4KKDA 5IYTA 5A8ZA 3M3SA 1GBCA 2ODYB 3T26A 1YP9A 5EGMA 1GJBB 1GI0A 2FODA 4NGAH 1A3EH 2RDLA 2O8WA 4NIXA 4ZHLU 1XXDA 3ZVDA 2D1JA 5C5NA 4CBOA 2O9QA 2TIOA 3SJ9A 1BJUA 1SB1H 2BY8X 3ODDA 1Y5UT 2FS8A 3RMNH 1S82A 6GCHG 4XE4A 3MTYA 1JRSA 2P3UB 1BRAA 1ZTKA 1ZMNA 4ISIH 1V2VT 1KLJH 1C2LA 3TGIE 3SU1A 2ZU4A 1DY8A 1ELTA 2AYWA 4IMZA 1FUJA 1XX9A 1FQ3A 1THRH 1LCYA 1SQOA 3CS0A 4JYVH 1SOZA 4D76A 1EB2A 3ITIA 1NY22 1GI4A 1W12U 2PTNA 1O2IA 1TFXA 5LGOA 1C5RA 4K5ZA 1NFXA 4IBLH 4XBBA 1FZZA 5AFYH 5IDKA 3K65B 2PKSB 1T32A 2F9BH 4IN2A 1FXYA 2FLRH 3AASA 3RMOH 3FZDA 3C27B 1EB1H 1UHBB 2BD5A 2ZF0H 4FVDA 1DLEA 1QL7A 4NIYA 2SGEE 1C2HA 3QZRA 4IN1A 1L2EA 1S6HA 8GCHG 1G2LA 1O2MA 1O3EA 1F0SA 4K69A 3F9GA 1AMHA 1MKXK 2CN0H 1X7AC 3LGTA 1GVZA 1BQYA 1MU8B 2LPRA 5LH8A 3ESTA 2HOBA 3SJOA 2FOGA 2BTCE 2W5EA 3Q3XA 1Z8GA 2ZGJA 4F49A 3PM3A 1G30B 1EKBB 1GBMA 1QB1A 1WSSH 3GYLB 3MU5A 1OWHA 1TRMA 4NA7A 4YO9A 2GZ7A 3T25A 2SGFE 5K7RA 1MKWH 2BLWA 1C5XB 1O3AA 2ZTZA 3ZV8A 1K28D 2R0KA 2DE8A 2SGQE 3PMHB 4BTTB 2HPQH 3IG6B 1QJ6B 2XWBI 1EAUA 1P2OA 1ETTH 2VH0A 1GHXH 1O3FA 4CRBA 1BDAA 4ISLA 3SU5A 4YOGA 1MTVA 3AW0A 3GY2A 3KL6A 4AGJA 1TYNA 4DOQA 4Y8YA 4F4OC 1AFQC 1Y3VA 2GT7A 3MNXA 3NKKA 3AAUA 1LTOA 1SGNE 3QWCH 3A88A 1OWEA 3SU0A 1ZJDA 2VU8E 3PLKA 1ELEE 4FVBA 2Z9LA 1UCYE 3EA7A 3DHKH 1UVUH 1V2QT 3SGQE 4BAQB 1IQGA 2PLXA 1QQUA 1DUEA 1AE5A 1GDNA 1DOJA 1O3DA 3HKIB 4E7RG 2A4GA 1LO6A 1HNEE 1LVMA 2VIOA 3BTME 4GLYA 1FY4A 1LVYA 2PUXB 4DVAU 2ZHDA 1C2KA 2H5DA 1DWDH 1SGDE 4K1SA 4ZKOU 3TH4H 2OXSA 3R0FA 1F5KU 3GY6A 1GMCG 3H7OA 1NRSH 2PFEA 3HK3B 3LJOA 1E35B 3RXPA 1SPJA 2G5VA 1BOQA 4ZHMU 1L0ZA 5EXMA 4D9QA 2A45B 3PWCA 4AB8A 1EZSC 1V2ST 1YPMH 2HPPH 3W95A 2BDCA 3UOPA 1VJAU 2P93A 3LH3A 2XBYA 1TGCA 2HALA 3KQEA 6LPRA 2ZFRH 5C1UA 1HIAA 1GHAF 5JBCS 1CQQA 2FP7B 1SLXB 3RMMH 1Y8TA 5EW1H 1GG6B 3FFGA 2AIQA 4AFZA 5T6GA 3RXOA 2UWPA 2R0LA 1BBRK 1C1VH 4ASHA 5FBEA 3Q3KA 1GJ4H 1DFPA 3KHVA 4ABJA 1OWIA 1TNIA 1OSSA 2BOKA 4R0IA 2ZKSA 1A5GH 3L3TA 1YCPH 2ZGXH 1HAVB 1O3GA 5FCRA 1A3BH 1AHTH 1IQEA 5EG4A 2OC8A 3TITA 1C1QA 1H4WA 1AKSA 5JBTA 1SHYA 3A8AA 5E0GA 3VXEH 1AZZA 2TGPZ 1P03A 1C1TA 4ABAA 1UK3A 2FOCA 2ZCHP 3PWBA 2I6QA 4M7GA 2BHGA 2VGCC 4B2CA 4DURA 1T4VH 8ESTE 2GX4A 5GXPA 1OPHB 4MNYA 3O8CA 1P2QA 2WPHS 2FLBH 1GMHG 1NFWA 1ANBA 1O35A 4H6SB 3UFAA 1Q3XA 1L4ZA 1BB0B 3TK5A 1C5NH 1AU8A 1P2NA 3MO3A 2OD3B 2XNIA 6GCHF 3ATKA 3MMGA 1FPHH 3GY3A 2EEKA 4LXBH 1LHGH 1N1LA 2IPHA 4X8VH 1TWXB 4JK5A 3QDZB 5HMAA 1S0QA 1TB6H 4AB9A 4AFUA 3OSYA 1BTZA 4TYDA 3LT3A 1NN6A 1MQ6A 1AFEH 6ESTA 1MAYA 2ZTYA 3URCA 1S5SA 2ESTE 5T6DA 5A09A 1BRUP 2J9NA 3GICB 1MTNB 3SV8A 2BDHA 1ZGVA 1C5ZB 2HVXA 1P05A 1O0DH 1WBGB 1MBQA 1GBTA 1ANCA 4DGJA 2BOHB 2XYAA 3E1XB 8GCHF 3M7TA 2RCEA 1W8BH 4UD9H 1EQ9A 3CENA 1FI8A 3OX7U 1DXWA 1O2XA 1ELVA 1XKBC 3RXQA 1ELFA 2F9OA 2UUJB 4X0WU 4DIHH 1O2NA 1HJAC 3U8TH 2PR3A 3ATIA 1O33A 5I46H 1UTOA 3EE0B 1O2LA 2XBXA 1G37A 2R3UA 3E91A 2EI6A 2A7HA 1KIGH 2ZDMA 1YPJH 3GY4A 2D2DA 1FMGA 2M5TA 2ODPA 4OS1A 1P9UA 2BMGB 3RXUA 7GCHG 2J95A 2Z9JA 3T29A 1DM4B 3O8RA 1DLKB 1UTJA 2WINI 3EAJA 4K8BA 1C5YB 1A0HB 4CRAA 3ZZCA 1V2WT 2FM2A 4X8TH 1JRTA 1NROH 3IWMA 3F68H 1SGCA 3Q77A 5JDUB 1O2VA 3LH1A 1HAXB 3S9CA 2VVCA 1ETRH 3S7KB 1F2SE 5TCAA 1IQKA 2OTVA 4B76A 3KNXA 1O5CB 1QY6A 5GJ4B 1GI3A 3UR6A 4YOJA 2P16A 1HAHH 1IQIA 4NIWA 1DT2A 1QR3E 4VGCB 4NWKA 1O3LA 3UIRA 3QX5H 2FOAA 5DKMA 1O3MA 1WQSA 2FOMB 1UVTH 2ZHFH 1QJ7B 1IOEA 4Y10E 2P8OB 4SGAE 1NRQH 1Y3YA 3NWUA 3MH5A 4UFFH 1P8VC 1UVSH 1GG6C 3H5CB 1C1MA 1P9SA 1O2ZA 2AMQA 2UWLA 3O8BA 1KXBA 1VGCB 3RP2A 5AF9H 1IQHA 1W0YH 3GY7A 5BRRE 3OYPA 1O3NA 7KMEH 1YKTA 3S69A 1V2RT 3LGVA 3P8FA 4IGDA 1BIOA 1J14A 3MOCA 1F5LA 4BTUB 2ZDNA 2QXIA 5EW2H 1LVBA 1GBKA 1GMCF 4IS5A 1K1PA 2G51A 4KTCA 3D65E 3F6UH 2NU3E 1NO9H 1O3HA 2VWLA 3O8DA 1HAOH 2WUCA 4AFQA 4XFQA 4TY6A 5FBIA 2ZU3A 3KGPA 4K1EA 3NXPA 4UFDH 1A61H 1C9TA 5EXNA 1FPCH 2A5IA 2FPZA 3AW1A 4A1XA 6CHAC 4IW4E 2FYQA 4JZDH 3LDXH 2PSXA 3QO6A 1QBVH 3RU4E 1GBDA 3VGCB 3STIA 4HI3A 2Y5FA 3NZIA 1O2TA 3D49H 4KP0A 1Z8JB 3L6PA 4BANB 3F9FA 1A0LA 3SUDA 1CE5A 2BD4A 1HYLA 1TRNA 2RA3A 1CSOE 2CV3A 3ATLA 4FUCA 1G3EA 1BMAA 3RC5A 3M3TA 1CT2E 3U69H 1P09A 1GJ8B 1BA8B 5JPMH 4DT7B 1IQLA 1RFNA 3PO1B 2QY0B 4TWYA 2XBVA 4XOJA 5JB9S 5A8XA 1VJ9U 3QLPH 1Y3XA 4INHA 1TX6A 2DUCA 1RS0A 4I32A 1ACBE 3TK6A 2GKVE 1BTXA 1CHOG 3M35A 1NFUA 4WF8A 1EJMA 1OP8A 2AMPA 1Z1JA 1DSUA 1AQ7A 1GPZA 2AFQB 3ATMA 2BY5X 1FLEE 2PWXA 1TGTA 3LGIA 3HGNA 2XC4A 4LZ1H 1H9IE 3LPRA 1GMHF 1VZQH 1FAXA 2A4RA 2FOEA 4WXVA 4Y8ZA 3RC4A 2BY7X 3GISB 5C2ZA 3D62A 3TK9A 1LKBA 1PPGE 1C4V2 5JB8S 1TABE 5F6MA 1DE7H 4A1TA 2BX3A 2J94A 1AD8H 2G52A 2FZZA 3K9XB 2C90B 1P01A 2EI7A 2ZHQH 1TA6A 1FY8E 4CR9A 1S84A 4AYVB 3TJUA 1JWTA 3MI4A 2GCTC 3H7TA 3LOXA 2OBOA 2TGTA 2C8YB 2SGAA 4MDSA 2ZPSA 3FP7E 4Y0ZE 5HM2A 3BTFE 1AB9B 1ANDA 4ESTE 4B2AA 3F1SB 3PMBB 2PUQH 1D6WA 2IJOB 1ESAA 1GJAB 1WQVH 3A8CA 3BTHE 3WY8A 2EI8A 1TPPA 3RXLA 2OCVB 1WYKA 3NK8A 1G3CA 1F0TA 1TGNA 3RXDA 2STAE 2HGTH 5EQSA 2XTTB 4BAMB 2PV9B 2A7JA 3UREA 1TA2A 1J9CH 2FI4E 4JK6A 3P70B 1ID5H 5DP4A 1HIAB 5FCKA 4GUXA 2ZU1A 2VIPA 1C2FA 5G4BA 4RN6A 4ABGA 1UTMA 3KCGH 2Y7ZA 1KLTA 4CRDA 4Y7BA 1QBNA 4ZXXH 3UWJH 7GCHF 2C8XB 1ANEA 1ZR0A 2AH4X 1VGCC 3DT0H 1LQDB 2O8LA 1QTFA 3HGPA 4MTBA 3M37A 3QUMP 5EQRA 1QURH 1Z6EA 1T4UH 1ZMLA 3VB3A 4ABIA 4UE7H 4E05H 1TONA 1SFIA 5A0CA 1GI5A 2F3CE 3LJJA 3DUXH 3RXAA 2GGVB 4CH8B 1P06A 1VITG 2OP9A 3MU8A 3SGBE 1LPGB 1PJPA 5EPYA 2EA3A 1XVOA 3M7UA 3SV9A 2BLQA 4X6OA 1K1NA 3PTBA 1OX1A 2XC0A 1BZXE 1SGYE 3SV6A 3UTUH 4A6LA 3RM0H 3ZVFA 3FZZA 2XBWA 3VXFH 1AGJA 2OC0A 4NG9H 1RTFB 4K1TA 2Q6FA 3MO6A 2CHAC 1AVGH 2B7DH 4Q7YA 1GDQA 2BB4A 5T3HA 2BD8A 3W94A 2ZG0H 5J4SA 4AX9H 4CHAC 1F0RA 1MTSA 1YPHE 1NRNH 1P04A 3QGNB 3F9EA 1U6QA 4ZHAA 1C1RA 5E0JA 2AS9A 1DUAA 1H1BA 1P2IA 1YYY1 2R2MB 2A5KA 2ZGHA 2OC7A 1LPKB 4Q2KA 3P8OA 2ZFTA 3RDZA 1S81A 2Q6GA 1ARBA 2OLGA 1SGFA 4O9VA 5HM9A 2G4UA 1F0UA 1EX3A 2QA9E 1NC6A 1KTSB 1G9IE 2THFB 1OKXA 4AZ2B 3EYDA 1B0FA 1L1JA 4AYYB 3SU6A 1INCA 1FIWA 1O36A 3HK6B 3DA9B 2SNVA 2WPIS 5AFZH 1ZLRA 5F03A 2FI3E 2BQWB 3SV2H 1GHYH 1Z7KA 1WV7H 1GBAA 1ZHRA 1D3TB 1O2RA 2YNAA 2OQ5A 1XXFA 3V0XA 4Q7XA 1NESE 1GJ9B 4BAOB 3SUFA 2ZCLP 3VB4A 3T2NA 2F9PA 1BBRE 1C2JA 1OP0A 5E2PA 3ZVEA 2G00A 1PPEE 2GP9B 3TJNA 4YOIA 1C5VA 1O3OA 5FX6A 2A0QB 1SLUB 1TRYA 4B71A 4WWYA 1UMAH 3M61U 3BEIB 4OS5A 2VJ1A 8KME2 2Z3EA 2SGPE 1NT1A 3SU2A 3S0NA 1O3KA 4YZUA 3T62A 4KTSA 1QGFA 2OQUA 3BIVH 3E90B 4FUBA 1RJXB 1SGTA 3NCLA 1N6YA 3QZQA 2C8WB 5F8TA 4ABDA 1RIWC 3BTQE 3KEEA 1TMBH 3T27A 1T7CA 1MCVA 1CHOF 2VIVA 5E0HA 2D8WA 1O5EH 1PPBH 2OC1A 4RKJB 2W3IA 5FX5A 3T28A 4GPGA 4OGXA 1A2CH 2B5TB 3A7WA 4AORA 1C4U2 1O3IA 1OYTH 4MPWA 1EPTA 3PTNA 2XWAA 2RG3A 4HTCH 4DJZB 1GI7B 1TBQH 2QIQA 4UEHH 3UNRA 5DG6A 1CGHA 1YF4A 2FXRA 4GCHG 5L30H 1XUIA 5TJXA 3SW2B 1SLVB 3M3VA 1P02A 2STBE 1MD7A 4X6MA 1J17T 2AGGX 1EXFA 1KDQA 1A5HA 3SHAH 7ESTE 1QL9A 5CE1A 5FXLA 1GVKB 1GBEA 2FYRA 2UUFB 1QHRB 1PQ5A 2F91A 2R9PA 1BTHH 1AUJA 1DANH 2XXLA 1C4Y2 2Y6TA 2UUYA 1WTGH 1GDUA 3Q76A 2H9TH 2PTCE 2BDIA 1GBJA 4ZROA 4ZXYH 3ZVCA 3ZYEA 2AERH 4MPUA 3PLBA 1K1LA 2CF8H 4Q7ZA 2ASUB 4NFFA 4X6PA 3L33A 1TPOA 1HB0B 5AHGH 3E8LA 4D8NA 1LPZB 3A7XA 1B7XB 4GHTA 1C1SA 5B6OA 1C1PA 1UCYH 1UK2A 2VINA 1HBTH 1MKWK 4NFEA 3SHCH 1EUFA 1GI8B 9ESTA 3RXBA 1MU6B 2P59A 1PYTC 3Q3YA 1F92A 3EGKH 3MYWA 4Y7AA 3SI4H 1BT7A 1L4DA 4X1SU 1OP2A 1JBUH 2Y80A 1O34A 5FPTA 3SU3A 2Z94A 4NZLA 1WTHD 1AO5A 1CGJE 3TJOA 1SGEE 1DXPA 4X1QU 3RXIA 1QRWA 4K60A 1DITH 3V3MA 1VITF 1UO6A 1EASA 2WPLS 1TE0A 3RXTA 2QXJA 1UJ1A 2ANKH 2PKSC 3SJ8A 2BDYA 1SGIB 3RLYH 2VIQA 5L6NH 2NU0E 1O3BA 2VVUA 4ISHH 1XUHA 1YLCA 5DP5A 1GCTB 3GDSA 3HPTB 2BD7A 1HUTH 1W7GH 4Q80A 4JZFH 3GDVA 1A1RA 1AWFH 1C1NA 2BVRH 2GTBA 3BN9A 4U30A 4CRFA 4YLQH 3RXHA 3ZZDA 5A0AE 2K1QA 3ENSB 5FPSA 3ZZ4A 1V2UT 5GCHG 4HGCA 1Z6JH 1TPAE 2AMDA 2JH6D 3PYHA 5DJ7A 3U8OH 2BZAA 3GYMA 4CRCA 3A7ZA 2BD3A 5DP7A 1GMDG 4UFGH 3LGYA 4X2YA 1LHEH 2FMJA 1UCYK 3SJKA 2PKAA 1RRKA 2J2UA 4O3UA 1RGQA 1IQMA 3UNSA 3TJVA 1TLDA 2EC9H 1KYNA 1ZTLA 4PROA 5A0BA 1SFQB 2GT8A 2GV6A 4FU8A 2ZA5A 3KN2A 3RLWH 4WVPE 1TOMH 3KQDA 1EATA 1O5FH 3A80A 1GGDB 1C5UA 5PTPA 1A5IA 2QC2A 1GL1A 2BY9X 3HATH 1YCPK 3QN7A 1UHBA 3P8NA 2Z9KA 4Y0YE 2UUKB 4R8TB 1E36B 2KAIA 1O2YA 3M36A 1NM6A 4SGBE 4H4FA 3ZZAA 4A7IB 1CA0B 4JYTA 1K1MA 2ALPA 4JZIA 2IN2A 4X8UH 3RU4D 1K2I1 4CREA 4U32A 3EA9A 4OS2A 1T31A 4ZKSU 3DFJA 3UUZA 2QGRA 1P12E 3RXRA 4CRGA 1ABJH 1PQAA 2FX6A 1EZUC 2WV5A 3HKJB 3A8DA 4JYUH 1H9HE 1TMTH 3ZVGA 4ZKRU 1MQ5A 2JH5D 1BRCE 1MD8A 1G32B 3PV4A 5GDSH 4I8JA 1CBWB 3GDUA 4FUIA 2BXUH 1D3PB 3UPEA 3RXGA 1FAKH 2F9UA 4X8SH 3P8GA 4H6TA 5ETXA 3SNAA 5L2ZH 4ZMAH 1P3EA 3MNCA 2Y82A 2A4OA 1GBIA 3M7QA 3MNBA 4GCHF 1BTUA 1QB9A 1O3CA 2XRCA 1VCPA 1HRTH 1ZOMA 3VB5A 1HGTH 2QF3A 1N8OB 1TNJA 2A7CA 1P2MA 1O38A 4Y79A 1C2EA 1Q31A 1TAWA 1FIZA 3TGKE 1XUGA 5E8EH 2AIPA 5TCCA 2C3SA 4WXIA 4DIIH 1C2MA 5HYOA 4TPIZ 2BDGA 2FDAA 4QT8C
chains in the Genus database with same CATH superfamily
5DP3A 1ELGA 1H8IH 2WV9A 1GHVH 3SQEE 3KIDU 3TH2H 4JCNA 2OINA 5EOKA 1EOLA 1F7ZA 1EOJA 4Q4LA 1SGRE 1ZGIA 2JJ1D 5F8ZA 2QXGA 2Q1JA 1BMMH 1SL3A 1ZRKA 2C8ZB 1HAGE 1ABIH 2L74A 1ZPCA 4MLFB 5HXFA 3P95A 2JH0D 4KGAA 1GHWH 1LHCH 3QGJA 1TPSA 5GWZA 1OYQA 4FXGH 2GZ8A 3ZZ9A 4AGKA 4YXWD 3A7YA 2O8UA 2FTMA 3SNDA 1D3DB 3AVZA 3BSQA 1GCTC 3BV9B 4ZAEA 2ZFSA 4IC5A 1TBRH 3TU7H 4GHQA 4H42U 1GBHA 4WMDA 4WH6A 1XMNB 3BTTE 2PSYA 1W7XH 3DSGA 3I77A 1K9OE 3A7VA 3TVJB 3UQVA 1W11U 4FUGA 2H1UA 2WPMS 3FAOA 1GJCB 1ARCA 1AZ8A 3SGAE 4BAHB 2VWNA 4OS4A 1C2IA 1BTWA 4A5TS 3TNTA 4LOYH 1ZZZA 1DWEH 3A89A 3EQ0H 4MNWA 1V2OT 1OWJA 1XUKA 3ZYDA 3LKWA 4JZEH 2ALVA 1SR5C 1TIOA 1Y5AT 2ZI2H 3ATWA 2F9NA 4DCDA 1GI1A 5T1VA 3GCHB 3B23B 4DW2U 4OGYA 3A87A 3A8BA 1QA0A 1ZHMA 2F83A 3A82A 1O2UA 1MTNC 1W14U 1SHHB 3GCTG 1GBFA 1MUEB 1YBWA 3SORA 2F4LA 2QCYA 2QF0A 1TX8A 4I8HA 5FPYA 4ISOA 3SUEA 2JJ2D 1DDJA 3TNSA 4FUDA 3OY5U 2ZEBA 3MQKC 1S85A 2NU4E 1EP6A 4AG2A 1GI6A 3F9HA 3PRBA 1EPTB 5IK2D 2A2QH 2ZDLA 1H9LB 2ZQ2A 3WWBA 1BITA 4I8GA 5GCHF 2HVYB 1P2JA 3E6PH 1XKAC 1TMUH 1W0ZU 1CA0C 1YPHC 2SFAA 1SOTA 1SVPA 3ODFA 2P95A 5H4IB 3ZVAA 2ANYA 3SO3A 5GNDA 1NZQH 4BXSA 4NA9H 3SNBA 4IMQA 1GMDF 3BTDE 3U98H 1KDQB 1AN1E 1O3JA 3A86A 3SZNA 1DVAH 1Y59T 1Q2WA 2O8TA 3FANA 5ESTE 3JZ1B 4K8YA 2FOHA 3U8RH 3OAAD 4CR5A 2R2WU 5GPIB 1CBWC 2C93B 2XNDD 4Y76A 1VCQA 4B2BA 2QYIA 1Z1IA 2AGIX 4U01A 1MCTA 3NRLA 1TALA 2YMSD 2VIDA 3FOAA 3KYGA 2HRVA 2BM2A 1K1JA 2QAAA 4J1YA 1CHGA 1SBWA 1O2WA 3TH3H 4VGCC 1W13U 2CXVA 1TQ7B 3TIUA 5EU8A 1EP5A 3FVFB 3UQOA 1WCZA 4K3JA 2G81E 1O31A 1EZQA 2ZDAH 4YLUA 1AFQB 3K2UA 1OXGA 2WPJS 2BYAX 3VFEA 2P8OC 1ZYOA 1SQAA 1ELDE 2ANWA 1JIMA 3OU0A 1C5QA 3OY6U 4I7YH 5EJLA 1QFKH 2GDEH 5DP8A 1HXFH 1VR1H 3R3GB 1C1UH 2BQ7B 2FESH 1P57B 5ABWA 1KLIH 3V7TA 1S6FA 3C1KA 1H8DH 1ZSLA 2FS9A 5LPRA 2BD2A 3ZV9A 1Z8IB 1S6LA 1E34B 2ODQA 1MAXA 1EJAA 1ESTA 3MU0A 1IQJA 1PFXC 2PGQB 1AKSB 1FY3A 2GDDA 2ZHWH 4ISNA 3RXCA 3U1JB 1V2PT 1ZRBA 4J2YB 4FU7A 2HLCA 1QB6A 2WPDD 2QE7D 2ZNKH 1FN8A 1MKXH 1QBOA 1Y3WA 2ZC9H 1T8MA 2OBQA 2VB0A 1GBLA 3VGCC 3M5MA 1GJ6A 1VCWA 1YWUA 2FIRH 5C1YA 1JMOH 3RXFA 1IHTH 4XBDA 2KCOA 2GZ9A 1A4WH 2HWLB 1NRPH 1V2MT 1YPGH 4F48B 1ZSKA 1C2GA 1P2KA 1PPZA 1QZ8A 2ZCKP 2V6NA 3GY5A 2IOTA 2BQ6B 2BX4A 1GJ5H 1GWAA 3PO1C 1ZPBA 1C1WH 4AN7A 4XBCA 2K0QA 2SNWA 3MH7A 3I78A 4MPXA 5C1XA 2QN5T 2PKAB 3KQ5A 2ZZUH 1THSH 4NCYA 1NBMD 3GCHC 5SGAE 1BRBE 2SGDE 1TNHA 3IITA 2P94A 3ZVBA 1Y3UA 2D26C 2ULLA 2NU1E 1GBBA 1HPGA 5A8YA 3MU4A 1DWCH 4E7NA 5EXLA 1FJSA 1MTUA 4BTIB 4FUHA 4FETA 2ZU2A 4O97A 1MZDA 1ZMJA 1EPTC 4INKA 3GY8A 2VGCB 3U1IB 1N6XA 1OOKB 4NIVA 1ELAA 4D9RA 5EQQA 1QA7A 2KAIB 3S7HB 1COWD 1NU7B 2OUAA 3BG8A 3KF2A 5EIYA 2TGDA 9LPRA 3AK5A 4MNXA 2ZPRA 1TGSZ 3BTWE 1D3QB 3BTGE 2W3KA 1AVXA 4B74A 3RXEA 4DG4A 3BTEE 5CMXH 3P6ZB 1ETSH 4I33A 1HJ9A 4TPYA 5CHAB 2KR7A 3EDXB 1ESBA 2ZDKA 3RC6A 2J4IA 3NPSA 4UONA 5DP9A 1MMJN 4BAKB 1TOCB 1UTNA 3GCTF 1ORFA 4KTUA 3ZZ5A 1TGBA 4NA8A 2GD4B 2A5AA 1AB9C 3BEFB 1AUTC 1NU9A 4Z0KA 1C5SA 1AWHB 1C5TA 4XDEA 1BMLA 3RUOA 1NPMA 1YGCH 1GCDA 1GVLA 1QCPA 1H8HD 3P17H 1J16A 2BZ6H 1LHDH 1YPEH 4MVNA 1DICA 1NRRH 1BBRH 3UWIA 3ZZ3A 1RTKA 1FV9A 1ELBA 2W6ID 4B6FA 1HAZB 2PHBA 1EJNA 5EPNA 1EAWA 1MBMA 3BG4B 5C67A 3QTOH 3KQCA 4NWLA 1GJ7B 4BXWA 4WY3A 1HJAB 4MNVA 3RU4T 1M9UA 2BLVA 3KQBA 7LPRA 3G01A 1ZHPA 1MTWA 1Y5BT 3U28C 4B6EA 2ZGCA 3K6YA 3E3TA 3LGWA 1DSTA 2BDAA 4FOUC 1V2NT 4WH8A 1YM0A 1QJ1B 1UTLM 2H6MA 3M5LA 2FOBA 1V6DA 1FN6A 2GMTB 5E2OA 3BF6H 1HJ8A 3VB7A 2H9HA 5C0UA 4CBNA 2VWOA 3T5FH 3E0NB 2A32A 1K1OA 2V0BA 2H5CA 3A83A 4UDWH 1SMFE 1PPHE 1ZJKA 2AGEX 1Z71A 4RKOB 5F8XA 2V3OH 2CK3D 1O2HA 4O3TA 3FP8E 3E0PB 4WMFA 2G55A 1SGFG 8LPRA 1CU1A 1KXFA 4KELA 3LU9B 1L1NA 1OWKA 2P3FH 3TGJE 2GVFA 4ABBA 1PQ8A 1YPKH 1HFDA 1SG8B 1PYTD 2WYJA 3ZIAD 1D4PB 1P3CA 3SU4A 4YT7H 1HAPH 2PGBB 3TPIZ 1BTPA 3PMAB 4ZKNU 4X6NA 2ZECA 4JZ1A 1YCPM 3S9AA 3LGUA 1TBZH 5EODA 5C3NA 3SQHE 3BIUH 1WXRA 5T6FA 1G36A 2G5NA 5LPEA 1J8AA 3GCNA 1O37A 4K2YA 2TPIZ 3CP7A 2ZGBH 3E16B 4AFSA 4HFPB 3OTPA 3UOUA 2FX4A 1NS3A 3MU1A 1HDTH 4U2WA 3VB6A 4ABEA 6CHAB 2R3YA 1A7SA 4OS7A 1PPFE 4THNH 3PROA 4YTAA 3ZZ7A 4ZUHA 3ZZ8A 3MHWU 1GHBG 1BJVA 2VNTA 1CO7E 2BLOA 2JKHA 3UNQA 2LP6A 1RTLA 5AVDA 4ACBA 2FOFA 3TLOA 2Y5HA 2AEIH 5HGGA 1F5RA 1FNIA 2I6SA 3A85A 2KFWA 1O2OA 3UB0A 1T8OA 2WZQA 1W3CA 4AOQA 2A4QA 2W7UA 2W7SA 2WV4A 2J34A 4MPVA 5CHAC 1MH0A 1UK4A 1HAIH 1O2KA 1O5GH 5C20A 3MNSA 3Q00A 3ZZBA 1EAIA 4YT6H 5DGJA 2UWOA 2ZTXA 1KXEA 1SGQE 3MWIU 1UTQA 2A31A 4I31A 5I25A 2HNTF 2Z7FE 3LC3A 1IHSH 1G2MA 2XC5A 1UVOA 3AAVA 4Y71A 1V2TT 3SNEA 3QTVH 2W6JD 5HIYA 5HIZA 1TX7A 1QRXA 3P92A 1H8ED 1KY9A 3LIWA 1BTYA 1O2GH 4GAWA 5DP6A 5DPAA 3RXKA 4BNRA 1KXAA 2Z9GA 4FUEA 1O39A 4ZH8A 1LMWB 1XUJA 2TRMA 3BEUA 4AG1A 2BXTH 3DSOA 3BG4C 1K0HA 3SJIA 1GL0E 1C5OH 1S83A 2GCHG 4D7GA 4Z6AH 1GHZA 2CJIA 3F2FA 5BPEA 1E79D 1UTPA 1K1IA 1O2PA 5FHTA 2B0FA 1ELCA 4NSVA 3V13A 2Y7XA 1W10U 4IC6A 4ABHA 1K21H 3ZZ6A 5FAHA 1QQ4A 2GCTB 5GIBA 4GSOA 1FY5A 2RA0A 1O32A 2YMSB 1G3DA 4OM9A 2GMTC 2NWNA 4X2VA 3SBKA 3QK1A 1GI9B 3PMJA 1CT4E 4F55A 1PPCE 1BMFD 3VEQB 1AI8H 1LQEA 4B75A 2FTLE 3RMLH 5JBAS 5DO4H 3DD2H 1ZSJA 2XCFA 1IAUA 1FY1A 4D7FA 4X2WA 2WYGA 3EA8A 1K22H 4WJG2 1L1GA 5LPFA 1A0JA 1OS8A 3RXMA 2C4FH 2F9VA 2XW9A 4FU9A 1LHFH 3VPKA 4LK4A 4X2XA 1QNJA 3U9AH 1HAYB 1HXEH 1PQ7A 3ELAH 1D6RA 1HV7A 2CF9H 2W26A 3LONA 4B73A 4XD7D 2DE9A 1E37B 4NZQA 3UR9A 2ZP0H 1P11E 1T8NA 1EZXC 1T8LA 3B9FH 1Z8RA 3I29A 2G8TA 2CGAA 2PP6A 4TWWA 1LKAA 3PLPA 2B9LA 1BMNH 1DWBH 5CDFE 1UTKA 3A7TA 3F0PA 1BHXB 2FO9A 2FEQH 3RXVA 4B1TA 3NUMA 1O2QA 3LC5A 1SI5H 1CVWH 1O2SA 2XCNA 3DFLA 1OWDA 2JETB 2QF4A 1XVMA 3SNCA 4I8KA 1GI2A 1WOFA 1TNGA 1AVWA 2O8MA 2ANMH 1C9PA 4ABFA 1WAYB 2A1DB 1C5MD 2TBSA 1O2JA 1G3BA 1KSNA 2V3HH 1O30A 1CA8B 2CHAB 1BHXF 4Y11E 2VWMA 2GV7A 2F43B 1RXPA 2FI5E 2V7QD 2TGAA 1QL8A 3A84A 3GOVB 4CHAB 1XUFA 1YC0A 2V35A 4LZ4B 1JIRA 2QXHA 4FUJA 1FDPA 2ZU5A 2ZFQH 5JBBS 5C5OA 3UY9A 2HNTC 2WUBA 3RXSA 2WSSD 1O3PB 4WMEA 1E38B 3KYFA 1HAVA 4DY7B 1GJDB 4O03A 2B8OH 2H9EH 3MFJA 1SSXA 2ZFFH 2ZPQA 1FONA 3SUGA 1GGDC 3W1EA 3FP6E 3SN8A 3SI3H 2Z9IA 3SV7A 2PW8H 1SGPE 5L2YH 2Y81A 1E1RD 1C1OA 2BY6X 1IQNA 4X1PU 5K0HA 1D9IA 1DY9A 1SLWB 1C5LH 4A92A 2BVSH 1GHBF 3A81A 1ZPZA 1B5GH 5A2MH 1HLTH 1V3XA 4BOHA 2J98A 2ZHEH 1TNKA 3STJA 1WU1A 2BVXH 2Q6DA 1DX5M 2ZIQH 1O5BB 2K8IA 2VBCA 2ZWLH 1DPOA 1C5PA 4FUFA 4INLA 4CH2B 1C5WB 1P0SH 1A46H 2ZQ1A 2Z6BD 1UVPA 1S0RA 1W2KH 3JZ2B 3M5OA 5J4QA 2VH6A 1UW7A 3N7OA 2ZFPH 3K6ZA 4A1VA 3RXJA 1CGIE 1QIXB 1NFYA 1V2JT 5DSFA 1AE8H 1E0FD 4Y8XA 1RIWB 4OS6A 1V2KT 2LELA 2WPKS 1BCUH 1KXCA 4NSYA 1EAXA 1P10A 1ZTJA 4UFEH 1YPLH 5C94A 4TY7A 5JYIA 1KTTB 4HZHA 1DS2E 3V12A 1LDTT 4YESB 2Z3CA 1BUIA 1N8OC 2ZDVH 1IQFA 4X1NU 1VITH 2Y5GA 3S9BA 5DK1A 1JOUB 1LVOA 2H2ZA 1MZAA 2BDBA 1J15A 2YOLA 1NTPA 3SOSA 4YM9A 5ESBA 3GCOA 1GHAG 2NU2E 2GCHF 1JXPA 1SQTA 1XM1A 1YLDA 1CT0E 2J92A 4MQAA 2P3TB 1O5DH 1SC8U 4GVUA 1V2LT 1AY6H 4MG3A 2A2XH 3PB1E 2HNTE 3M5NA 3OTJE 2J38A 2VIWA 3RM2H 2ILNA 1TQ0B 1TNLA 2QV1A 3D23A 3MH6A 2LNCA 3FN8A 4XSKU 1THPB 1B0EA 2VVVA 3MO9A 2G4TA 1RD3B 4Y6DA 3GS9A 4RSPA 1O5AB 3MH4A 3URDA 1KXDA 4JMYA 4I8LA 2CMYA 4X1RU 2ZO3H 1C2DA 2FWWA 2YNBA 1QRZA 2BD9A 3BTKE 4E06H 1AIXH 3B8JA 3CS7A 1HCGA 2JETC 2Z3DA 1WUNH 4KKDA 5IYTA 5A8ZA 3M3SA 1GBCA 2ODYB 3T26A 1YP9A 5EGMA 1GJBB 1GI0A 2FODA 4NGAH 1A3EH 2RDLA 2O8WA 4NIXA 4ZHLU 1XXDA 3ZVDA 2D1JA 5C5NA 4CBOA 2O9QA 2TIOA 3SJ9A 1BJUA 1SB1H 2BY8X 3ODDA 1Y5UT 2FS8A 3RMNH 1S82A 6GCHG 4XE4A 3MTYA 1JRSA 2P3UB 1BRAA 1ZTKA 1ZMNA 4ISIH 1V2VT 1KLJH 1C2LA 3TGIE 3SU1A 2ZU4A 1DY8A 1ELTA 2AYWA 4IMZA 1FUJA 1XX9A 1FQ3A 1THRH 1LCYA 1SQOA 3CS0A 4JYVH 1SOZA 4D76A 1EB2A 3ITIA 1NY22 1GI4A 1W12U 2PTNA 1O2IA 1TFXA 5LGOA 1C5RA 4K5ZA 1NFXA 4IBLH 4XBBA 1FZZA 5AFYH 5IDKA 3K65B 1KMHB 2PKSB 1T32A 2F9BH 4IN2A 2WHXA 1FXYA 2FLRH 3AASA 3RMOH 3FZDA 3C27B 1EB1H 1UHBB 2BD5A 2ZF0H 4FVDA 1DLEA 1QL7A 4NIYA 2SGEE 1C2HA 3QZRA 1OHHD 1L2EA 4IN1A 1S6HA 8GCHG 1G2LA 1EFRD 1O2MA 1O3EA 1F0SA 4K69A 3F9GA 1AMHA 1MKXK 2CN0H 1X7AC 3LGTA 1GVZA 1BQYA 1MU8B 2LPRA 5LH8A 3ESTA 2HOBA 3SJOA 2FOGA 2BTCE 2W5EA 3Q3XA 1Z8GA 2ZGJA 4F49A 3PM3A 1G30B 1EKBB 1GBMA 1QB1A 1WSSH 3GYLB 3MU5A 1OWHA 1TRMA 4NA7A 4YO9A 2GZ7A 3T25A 2SGFE 5K7RA 1MKWH 2BLWA 1C5XB 1O3AA 2ZTZA 3ZV8A 1K28D 2R0KA 2DE8A 2SGQE 3PMHB 2L6OA 2HPQH 3IG6B 4BTTB 1QJ6B 2XWBI 1EAUA 1P2OA 1ETTH 2VH0A 1GHXH 1O3FA 4CRBA 1BDAA 4ISLA 3SU5A 4YOGA 1MTVA 5EJ1A 3AW0A 3GY2A 3KL6A 4AGJA 1TYNA 4DOQA 4Y8YA 4F4OC 1AFQC 1Y3VA 2GT7A 3MNXA 3NKKA 3AAUA 1LTOA 1SGNE 3QWCH 3A88A 1OWEA 3DCLA 3SU0A 1ZJDA 2VU8E 5B6LA 3PLKA 1ELEE 4FVBA 2Z9LA 1UCYE 3EA7A 3DHKH 1UVUH 1V2QT 3SGQE 4BAQB 1IQGA 2PLXA 1QQUA 1DUEA 1AE5A 1GDNA 1DOJA 1O3DA 3HKIB 4E7RG 2A4GA 1LO6A 1HNEE 1LVMA 4TSFD 2VIOA 3BTME 4GLYA 1FY4A 1LVYA 2PUXB 4DVAU 2ZHDA 1C2KA 2H5DA 1DWDH 1SGDE 4K1SA 4ZKOU 3TH4H 2OXSA 3R0FA 1F5KU 4ZCNA 3GY6A 1GMCG 1NBME 3H7OA 1NRSH 2PFEA 3HK3B 3SZEA 3LJOA 1E35B 3RXPA 1SPJA 2G5VA 1BOQA 4ZHMU 1L0ZA 5EXMA 4D9QA 2A45B 3PWCA 4M9FA 4AB8A 1EZSC 1V2ST 1YPMH 2HPPH 3W95A 2BDCA 3UOPA 1VJAU 2P93A 3LH3A 2XBYA 1TGCA 2HALA 3KQEA 6LPRA 2ZFRH 3F3BA 1YLNA 4RT0A 5C1UA 1HIAA 1GHAF 5JBCS 1CQQA 2FP7B 1SLXB 3RMMH 1Y8TA 5EW1H 1GG6B 3FFGA 2AIQA 2KZ4A 4AFZA 5T6GA 3RXOA 2UWPA 2R0LA 1BBRK 1C1VH 4ASHA 5FBEA 3Q3KA 1GJ4H 2RDEA 1DFPA 3KHVA 4ABJA 1OWIA 3DSPA 1TNIA 1OSSA 2BOKA 4R0IA 2ZKSA 1A5GH 3L3TA 1YCPH 3PV2A 2ZGXH 1HAVB 1O3GA 5FCRA 1A3BH 2J5UA 1AHTH 1IQEA 5EG4A 2OC8A 3TITA 1C1QA 1H4WA 1AKSA 2KM0A 5JBTA 1SHYA 3A8AA 5E0GA 2RFKC 3VXEH 1AZZA 2TGPZ 1P03A 1C1TA 4ABAA 1UK3A 2FOCA 2ZCHP 3H09A 3PWBA 2I6QA 4M7GA 2BHGA 2VGCC 4B2CA 4DURA 1T4VH 8ESTE 2GX4A 5GXPA 1OPHB 4MNYA 3O8CA 1P2QA 2WPHS 2FLBH 1GMHG 1NFWA 1ANBA 1O35A 4H6SB 3UFAA 1Q3XA 1L4ZA 1BB0B 3TK5A 1C5NH 1AU8A 1P2NA 3MO3A 2OD3B 2XNIA 6GCHF 3ATKA 3MMGA 1FPHH 3GY3A 2EEKA 4LXBH 2QF5A 1LHGH 1N1LA 2IPHA 2J98B 4X8VH 1TWXB 4JK5A 3QDZB 5HMAA 1S0QA 1TB6H 4AB9A 4AFUA 3OSYA 1BTZA 4TYDA 3LT3A 1NN6A 1MQ6A 1AFEH 6ESTA 1MAYA 2ZTYA 3URCA 1S5SA 2ESTE 5T6DA 5A09A 1BRUP 2J9NA 3GICB 1MTNB 3SV8A 2BDHA 1ZGVA 1C5ZB 2HVXA 1P05A 1O0DH 1WBGB 1MBQA 2HLDD 1GBTA 1ANCA 4DGJA 2BOHB 2XYAA 3E1XB 8GCHF 3M7TA 2RCEA 1W8BH 4UD9H 1EQ9A 3CENA 1FI8A 3OX7U 1DXWA 1O2XA 1ELVA 2JIZD 1XKBC 4XRNA 3RXQA 1ELFA 2F9OA 2UUJB 4X0WU 4DIHH 1O2NA 1HJAC 3U8TH 2PR3A 3ATIA 1O33A 5I46H 1UTOA 3EE0B 1O2LA 2XBXA 5CHBA 1G37A 2R3UA 3E91A 2EI6A 2A7HA 1KIGH 2ZDMA 1YPJH 3GY4A 2D2DA 1FMGA 2M5TA 2ODPA 4OS1A 1P9UA 2BMGB 1VKYA 3RXUA 7GCHG 2J95A 2Z9JA 3T29A 2KCPA 1DM4B 3O8RA 1DLKB 1UTJA 2WINI 3EAJA 4K8BA 1C5YB 1A0HB 4CRAA 3ZZCA 1V2WT 2FM2A 4X8TH 1JRTA 1NROH 3IWMA 3F68H 1SGCA 3Q77A 5JDUB 1O2VA 3LH1A 1HAXB 3S9CA 2VVCA 1ETRH 3S7KB 1F2SE 5TCAA 1IQKA 2OTVA 4B76A 3KNXA 1O5CB 1W0KD 1QY6A 5GJ4B 1GI3A 3UR6A 4YOJA 2P16A 1HAHH 1IQIA 2J97A 4NIWA 1DT2A 1QR3E 4VGCB 4NWKA 1O3LA 3PV5A 3QX5H 3UIRA 2FOAA 5DKMA 1O3MA 1WQSA 2FOMB 1UVTH 2XOKD 2ZHFH 1QJ7B 1IOEA 4Y10E 2P8OB 4SGAE 1NRQH 1Y3YA 3NWUA 3MH5A 4UFFH 1P8VC 1UVSH 1GG6C 3H5CB 1C1MA 3OFND 1P9SA 1O2ZA 2AMQA 2UWLA 3O8BA 1KXBA 1VGCB 3RP2A 5AF9H 1IQHA 1W0YH 3GY7A 5BRRE 3OYPA 1O3NA 7KMEH 1YKTA 3S69A 1V2RT 3LGVA 3P8FA 4IGDA 1BIOA 1J14A 3MOCA 1F5LA 4BTUB 2ZDNA 2QXIA 5EW2H 1LVBA 1GBKA 1GMCF 4IS5A 1K1PA 2G51A 4KTCA 3D65E 3F6UH 2NU3E 1NO9H 1O3HA 2VWLA 3O8DA 1HAOH 2WUCA 4AFQA 3N7DA 4TY6A 4XFQA 5FBIA 2ZU3A 3KGPA 4K1EA 3NXPA 4UFDH 1A61H 1C9TA 5KGOA 5EXNA 1FPCH 2A5IA 2FPZA 3AW1A 4A1XA 6CHAC 4IW4E 2FYQA 4JZDH 3LDXH 2PSXA 3QO6A 1QBVH 3RU4E 1GBDA 3VGCB 3STIA 4HI3A 2Y5FA 3NZIA 1O2TA 3D49H 4KP0A 1Z8JB 3L6PA 4BANB 3F9FA 1A0LA 3SUDA 1CE5A 2BD4A 1HYLA 1TRNA 2RA3A 1CSOE 2CV3A 3ATLA 4FUCA 1G3EA 1BMAA 3RC5A 3M3TA 1CT2E 3U69H 1P09A 1GJ8B 1BA8B 5JPMH 4DT7B 1IQLA 1RFNA 3PO1B 2QY0B 4TWYA 2XBVA 4XOJA 3UAIC 5JB9S 5A8XA 1VJ9U 3QLPH 1Y3XA 4INHA 1TX6A 2DUCA 1RS0A 4I32A 1ACBE 3TK6A 2GKVE 1BTXA 1CHOG 3M35A 1NFUA 4WF8A 1EJMA 1OP8A 2AMPA 4ASUD 1Z1JA 1DSUA 1AQ7A 1GPZA 2AFQB 3ATMA 2BY5X 1FLEE 2PWXA 1TGTA 3LGIA 3HGNA 2XC4A 4LZ1H 1H9IE 3LPRA 1GMHF 1VZQH 1FAXA 2A4RA 2FOEA 4WXVA 4Y8ZA 3RC4A 2BY7X 3GISB 5C2ZA 3EE7A 3D62A 3TK9A 1LKBA 1PPGE 1C4V2 5JB8S 1TABE 5F6MA 1DE7H 4HG6A 4A1TA 2BX3A 2J94A 1AD8H 2G52A 2FZZA 3K9XB 2C90B 1P01A 2EI7A 2ZHQH 1TA6A 1FY8E 4CR9A 1S84A 2EY4C 4AYVB 3TJUA 1JWTA 3MI4A 2GCTC 3H7TA 3LOXA 4Z1MD 2OBOA 2TGTA 1W0JD 2C8YB 2SGAA 2YMSC 4MDSA 2ZPSA 3FP7E 4Y0ZE 5HM2A 1MABB 3BTFE 1AB9B 1ANDA 4ESTE 4B2AA 3F1SB 3PMBB 2PUQH 1D6WA 2IJOB 1ESAA 1GJAB 1WQVH 3A8CA 3BTHE 3WY8A 2EI8A 1TPPA 3RXLA 2OCVB 1WYKA 3NK8A 1G3CA 1F0TA 1TGNA 3RXDA 2STAE 2HGTH 5EQSA 2XTTB 4BAMB 2PV9B 2A7JA 3UREA 1TA2A 1J9CH 2FI4E 4JK6A 3WW7A 3P70B 1ID5H 5DP4A 1HIAB 5FCKA 4GUXA 2ZU1A 2M2AA 2VIPA 1C2FA 5G4BA 4RN6A 4ABGA 1UTMA 3KCGH 2Y7ZA 1KLTA 4CRDA 4Y7BA 1QBNA 4ZXXH 3UWJH 7GCHF 2C8XB 1ANEA 1ZR0A 2AH4X 1VGCC 3DT0H 1LQDB 2O8LA 1QTFA 3HGPA 4MTBA 3M37A 3QUMP 5EQRA 1QURH 1Z6EA 1T4UH 1ZMLA 3VB3A 4ABIA 4UE7H 4E05H 1TONA 1SFIA 4P00A 5A0CA 1E1QD 1GI5A 2F3CE 3LJJA 3DUXH 3RXAA 2GGVB 4CH8B 1P06A 1VITG 2OP9A 3MU8A 3SGBE 1LPGB 1PJPA 5EPYA 2EA3A 1XVOA 3M7UA 3SV9A 2BLQA 4X6OA 1K1NA 3PTBA 1OX1A 2XC0A 1BZXE 1SGYE 3SV6A 3UTUH 4A6LA 3RM0H 4TT3D 3ZVFA 3FZZA 2XBWA 3VXFH 1AGJA 2OC0A 4NG9H 1RTFB 4K1TA 2Q6FA 3MO6A 2CHAC 1AVGH 2B7DH 4Q7YA 1GDQA 2BB4A 5T3HA 2BD8A 3W94A 2ZG0H 1FX0B 5J4SA 4AX9H 4CHAC 1F0RA 1MTSA 1YPHE 1NRNH 1P04A 3QGNB 5FL7D 3F9EA 1U6QA 4ZHAA 1C1RA 5E0JA 2AS9A 1DUAA 1H1BA 1P2IA 1YYY1 2R2MB 2A5KA 2ZGHA 2OC7A 1LPKB 4Q2KA 3P8OA 2ZFTA 3RDZA 1S81A 2Q6GA 1ARBA 2OLGA 1SGFA 4O9VA 5HM9A 2JDID 2G4UA 4DT4A 1F0UA 1EX3A 2QA9E 1NC6A 1KTSB 1G9IE 2THFB 1OKXA 4AZ2B 3EYDA 5C0TA 1B0FA 1L1JA 3FKSD 4AYYB 3SU6A 5C17A 1INCA 1FIWA 1O36A 3HK6B 3DA9B 2SNVA 2WPIS 5AFZH 1ZLRA 5F03A 2FI3E 1SQRA 2BQWB 3SV2H 1GHYH 1Z7KA 1WV7H 1GBAA 1ZHRA 1D3TB 1O2RA 2YNAA 2OQ5A 1XXFA 3V0XA 4Q7XA 1NESE 1GJ9B 4BAOB 3SUFA 2ZCLP 3VB4A 3T2NA 2F9PA 1BBRE 1C2JA 1OP0A 5E2PA 3WWFA 3ZVEA 2G00A 1PPEE 2GP9B 4Q63A 4YOIA 3TJNA 1C5VA 1O3OA 5FX6A 2A0QB 1SLUB 1TRYA 4B71A 4WWYA 1UMAH 3M61U 3BEIB 4OS5A 2VJ1A 8KME2 2Z3EA 2SGPE 1NT1A 3SU2A 3S0NA 1O3KA 4YZUA 3T62A 4KTSA 1QGFA 2OQUA 3BIVH 3E90B 4FUBA 1RJXB 1SGTA 3NCLA 1N6YA 3QZQA 2C8WB 3OE7D 5F8TA 4ABDA 1RIWC 3BTQE 3KEEA 1TMBH 3T27A 1T7CA 1MCVA 1CHOF 2VIVA 5E0HA 2D8WA 1O5EH 1PPBH 2OC1A 4RKJB 2W3IA 5FX5A 3T28A 4GPGA 4OGXA 1A2CH 2B5TB 3A7WA 4AORA 1C4U2 1O3IA 1OYTH 4MPWA 1EPTA 3PTNA 2XWAA 2RG3A 4HTCH 4DJZB 1GI7B 1TBQH 2QIQA 4UEHH 1WDIA 3UNRA 5DG6A 1CGHA 1YF4A 2FXRA 4GCHG 5L30H 1XUIA 5TJXA 3SW2B 1SLVB 3M3VA 1P02A 2STBE 1MD7A 4X6MA 1J17T 2AGGX 1EXFA 1KDQA 1A5HA 3SHAH 7ESTE 1QL9A 5CE1A 5FXLA 1GVKB 1GBEA 2FYRA 2UUFB 1QHRB 1PQ5A 2GJGA 2F91A 2R9PA 1BTHH 1AUJA 1DANH 3CNRA 2XXLA 1C4Y2 2EQNA 2Y6TA 2UUYA 1WTGH 1GDUA 3Q76A 2H9TH 3F0OA 2PTCE 2BDIA 1GBJA 4ZROA 4RT1A 4ZXYH 3ZVCA 3ZYEA 2AERH 4MPUA 2KCYA 3PLBA 1K1LA 5HKKD 2CF8H 4Q7ZA 2ASUB 4NFFA 4X6PA 3L33A 4AC9A 1TPOA 1HB0B 5AHGH 3E8LA 4D8NA 1LPZB 3A7XA 1B7XB 4GHTA 1C1SA 5B6OA 4RI0A 5DN6D 1C1PA 1SKYE 1UCYH 1UK2A 2VINA 1HBTH 1MKWK 4NFEA 3SHCH 1EUFA 1GI8B 9ESTA 3RXBA 1MU6B 2P59A 1PYTC 3Q3YA 3SYJA 1F92A 3EGKH 3MYWA 4Y7AA 3SI4H 1BT7A 1L4DA 4X1SU 1OP2A 1JBUH 2Y80A 1O34A 5FPTA 3SU3A 2KX4A 2Z94A 4NZLA 1WTHD 1AO5A 1CGJE 3TJOA 1SGEE 5KEDA 1DXPA 4X1QU 3RXIA 1QRWA 4K60A 1DITH 3V3MA 1VITF 1UO6A 1EASA 2IJD1 2WPLS 1TE0A 3RXTA 2QXJA 2OK5A 1UJ1A 4P02A 2ANKH 2PKSC 3SJ8A 2BDYA 1SGIB 3RLYH 2VIQA 5L6NH 2NU0E 1O3BA 2VVUA 4ISHH 2KCAA 1XUHA 3F2HA 1YLCA 5DP5A 1GCTB 3GDSA 3HPTB 2BD7A 1HUTH 1W7GH 4Q80A 4JZFH 3GDVA 1A1RA 1AWFH 1C1NA 2BVRH 2GTBA 3BN9A 4U30A 4CRFA 4YLQH 5EJZA 3RXHA 3ZZDA 5A0AE 2K1QA 3ENSB 5FPSA 3ZZ4A 1V2UT 5GCHG 3N99A 4HGCA 1Z6JH 1TPAE 2AMDA 2JH6D 3PYHA 5DJ7A 3U8OH 2BZAA 3GYMA 3OEED 4CRCA 3A7ZA 2BD3A 5DP7A 1GMDG 4UFGH 3LGYA 4X2YA 1LHEH 2FMJA 1UCYK 3SJKA 2PKAA 1RRKA 2J2UA 4O3UA 1RGQA 3FO8D 1IQMA 3UNSA 5KECA 3TJVA 1TLDA 2EC9H 1KYNA 1ZTLA 4PROA 5A0BA 1SFQB 2GT8A 2GV6A 4FU8A 2ZA5A 3KN2A 3RLWH 4WVPE 1TOMH 3KQDA 1EATA 1O5FH 3A80A 1GGDB 1C5UA 5PTPA 1A5IA 2QC2A 1GL1A 2BY9X 3HATH 1YCPK 2AHME 3QN7A 1UHBA 3P8NA 2Z9KA 4Y0YE 2UUKB 3PRDA 4R8TB 1E36B 2KAIA 1O2YA 3M36A 1NM6A 4SGBE 4H4FA 3ZZAA 4A7IB 1CA0B 4JYTA 1K1MA 2ALPA 4JZIA 2IN2A 4X8UH 3RU4D 1K2I1 4CREA 4U32A 3EA9A 3OEHD 4OS2A 1T31A 4ZKSU 3DFJA 3UUZA 2QGRA 1P12E 3RXRA 4CRGA 1ABJH 1PQAA 3VG8A 2FX6A 1EZUC 2WV5A 3HKJB 3A8DA 4JYUH 1H9HE 3F2GA 1TMTH 3ZVGA 5F53A 4ZKRU 1MQ5A 2JH5D 1BRCE 1MD8A 1G32B 3PV4A 5GDSH 4I8JA 1CBWB 3GDUA 4FUIA 2BXUH 2IPQX 1D3PB 3UPEA 3RXGA 1FAKH 2F9UA 4X8SH 3P8GA 4H6TA 5ETXA 3SNAA 5L2ZH 4ZMAH 1P3EA 3MNCA 2Y82A 2A4OA 1GBIA 3M7QA 1YY3A 3MNBA 4GCHF 1BTUA 1QB9A 1O3CA 2XRCA 1VCPA 1HRTH 1ZOMA 3VB5A 2V3MA 1HGTH 2QF3A 1N8OB 1TNJA 2A7CA 1P2MA 1O38A 4I86A 4Y79A 1C2EA 4ACAA 1Q31A 1TAWA 1FIZA 3TGKE 1XUGA 5E8EH 2AIPA 5TCCA 2C3SA 4WXIA 4DIIH 1C2MA 5HYOA 3N7EA 4TPIZ 2BDGA 2FDAA 4QT8C
chains in the Genus database with same CATH topology
5DP3A 1ELGA 1H8IH 1GHVH 3SQEE 3KIDU 3TH2H 4JCNA 2OINA 5EOKA 1EOLA 1F7ZA 1EOJA 1SGRE 1ZGIA 5F8ZA 2QXGA 2Q1JA 1BMMH 1SL3A 1ZRKA 2C8ZB 1HAGE 1ABIH 1ZPCA 4MLFB 5HXFA 3P95A 2JH0D 4KGAA 1GHWH 1LHCH 3QGJA 1TPSA 5GWZA 1OYQA 4FXGH 2GZ8A 3ZZ9A 4AGKA 3A7YA 2O8UA 2FTMA 3SNDA 1D3DB 3AVZA 3BSQA 1GCTC 3BV9B 4ZAEA 2ZFSA 4IC5A 1TBRH 3TU7H 4GHQA 4H42U 1GBHA 4WMDA 4WH6A 1XMNB 3BTTE 2PSYA 1W7XH 3I77A 1K9OE 3A7VA 3TVJB 3UQVA 1W11U 4FUGA 2H1UA 2WPMS 3FAOA 1GJCB 1ARCA 1AZ8A 3SGAE 4BAHB 2VWNA 4OS4A 1C2IA 1BTWA 4A5TS 3TNTA 4LOYH 1ZZZA 1DWEH 3A89A 3EQ0H 4MNWA 1V2OT 1OWJA 1XUKA 3ZYDA 3LKWA 4JZEH 2ALVA 1SR5C 1TIOA 1Y5AT 2ZI2H 3ATWA 2F9NA 4DCDA 1GI1A 3GCHB 3B23B 4DW2U 4OGYA 3A87A 3A8BA 1QA0A 1ZHMA 2F83A 3A82A 1O2UA 1MTNC 1W14U 1SHHB 3GCTG 1GBFA 1MUEB 1YBWA 3SORA 2QCYA 2QF0A 1TX8A 4I8HA 5FPYA 4ISOA 3SUEA 1DDJA 3TNSA 4FUDA 3OY5U 2ZEBA 1S85A 2NU4E 1EP6A 4AG2A 1GI6A 3F9HA 1EPTB 2A2QH 2ZDLA 1H9LB 2ZQ2A 1BITA 4I8GA 5GCHF 1P2JA 3E6PH 1XKAC 1TMUH 1W0ZU 1CA0C 1YPHC 2SFAA 1SOTA 1SVPA 3ODFA 2P95A 5H4IB 3ZVAA 2ANYA 3SO3A 1NZQH 4BXSA 4NA9H 3SNBA 4IMQA 1GMDF 3BTDE 3U98H 1KDQB 1AN1E 1O3JA 3A86A 3SZNA 1DVAH 1Y59T 1Q2WA 2O8TA 3FANA 5ESTE 3JZ1B 4K8YA 2FOHA 3U8RH 4CR5A 2R2WU 5GPIB 1CBWC 2C93B 4Y76A 1VCQA 4B2BA 2QYIA 1Z1IA 2AGIX 4U01A 1MCTA 1TALA 2VIDA 2HRVA 2BM2A 1K1JA 2QAAA 4J1YA 1CHGA 1SBWA 1O2WA 3TH3H 4VGCC 1W13U 2CXVA 1TQ7B 3TIUA 5EU8A 1EP5A 3FVFB 3UQOA 1WCZA 4K3JA 2G81E 1O31A 1EZQA 2ZDAH 4YLUA 1AFQB 3K2UA 1OXGA 2WPJS 2BYAX 3VFEA 2P8OC 1ZYOA 1SQAA 1ELDE 2ANWA 1JIMA 3OU0A 1C5QA 3OY6U 4I7YH 1QFKH 2GDEH 5DP8A 1HXFH 1VR1H 3R3GB 1C1UH 2BQ7B 2FESH 1P57B 5ABWA 1KLIH 3V7TA 1S6FA 3C1KA 1H8DH 1ZSLA 2FS9A 5LPRA 2BD2A 3ZV9A 1Z8IB 1E34B 2ODQA 1MAXA 1EJAA 1ESTA 3MU0A 1IQJA 1PFXC 2PGQB 1AKSB 1FY3A 2GDDA 2ZHWH 4ISNA 3RXCA 3U1JB 1V2PT 1ZRBA 4J2YB 4FU7A 2HLCA 1QB6A 2ZNKH 1FN8A 1MKXH 1QBOA 1Y3WA 2ZC9H 1T8MA 2OBQA 2VB0A 1GBLA 3VGCC 3M5MA 1GJ6A 1VCWA 2FIRH 5C1YA 1JMOH 3RXFA 1IHTH 4XBDA 2GZ9A 1A4WH 2HWLB 1NRPH 1V2MT 1YPGH 1ZSKA 1C2GA 1P2KA 1PPZA 2ZCKP 2V6NA 3GY5A 2IOTA 2BQ6B 2BX4A 1GJ5H 1GWAA 3PO1C 1ZPBA 1C1WH 4AN7A 4XBCA 2SNWA 3MH7A 3I78A 4MPXA 5C1XA 2QN5T 2PKAB 2ZZUH 1THSH 4NCYA 3GCHC 5SGAE 1BRBE 2SGDE 1TNHA 3IITA 2P94A 3ZVBA 1Y3UA 2D26C 2ULLA 2NU1E 1GBBA 1HPGA 5A8YA 3MU4A 1DWCH 4E7NA 5EXLA 1FJSA 1MTUA 4BTIB 4FUHA 2ZU2A 4O97A 1MZDA 1ZMJA 1EPTC 4INKA 3GY8A 2VGCB 3U1IB 1N6XA 1OOKB 4NIVA 1ELAA 4D9RA 5EQQA 1QA7A 2KAIB 3S7HB 1NU7B 2OUAA 3BG8A 3KF2A 2TGDA 9LPRA 4MNXA 2ZPRA 1TGSZ 3BTWE 1D3QB 3BTGE 2W3KA 1AVXA 4B74A 3RXEA 4DG4A 3BTEE 5CMXH 3P6ZB 1ETSH 4I33A 1HJ9A 4TPYA 5CHAB 3EDXB 1ESBA 2ZDKA 3RC6A 2J4IA 3NPSA 4UONA 5DP9A 1MMJN 4BAKB 1TOCB 1UTNA 3GCTF 1ORFA 4KTUA 3ZZ5A 1TGBA 4NA8A 2GD4B 2A5AA 1AB9C 3BEFB 1AUTC 1NU9A 4Z0KA 1C5SA 1AWHB 1C5TA 4XDEA 1BMLA 3RUOA 1NPMA 1YGCH 1GCDA 1GVLA 1QCPA 3P17H 1J16A 2BZ6H 1LHDH 1YPEH 4MVNA 1DICA 1NRRH 1BBRH 3UWIA 3ZZ3A 1RTKA 1FV9A 1ELBA 1HAZB 2PHBA 1EJNA 5EPNA 1EAWA 1MBMA 3BG4B 5C67A 3QTOH 3KQCA 4NWLA 1GJ7B 4BXWA 4WY3A 1HJAB 4MNVA 3RU4T 1M9UA 2BLVA 3KQBA 7LPRA 3G01A 1ZHPA 1MTWA 1Y5BT 2ZGCA 3K6YA 3E3TA 3LGWA 1DSTA 2BDAA 1V2NT 4WH8A 1YM0A 1QJ1B 1UTLM 2H6MA 3M5LA 2FOBA 1V6DA 1FN6A 2GMTB 5E2OA 3BF6H 1HJ8A 3VB7A 2H9HA 4CBNA 2VWOA 3T5FH 3E0NB 2A32A 1K1OA 2V0BA 2H5CA 3A83A 4UDWH 1SMFE 1PPHE 1ZJKA 2AGEX 1Z71A 4RKOB 5F8XA 2V3OH 1O2HA 4O3TA 3FP8E 3E0PB 4WMFA 2G55A 1SGFG 8LPRA 1CU1A 1KXFA 4KELA 3LU9B 1L1NA 1OWKA 2P3FH 3TGJE 2GVFA 4ABBA 1PQ8A 1YPKH 1HFDA 1SG8B 1PYTD 2WYJA 1D4PB 1P3CA 3SU4A 4YT7H 1HAPH 2PGBB 3TPIZ 1BTPA 3PMAB 4ZKNU 4X6NA 2ZECA 4JZ1A 1YCPM 3S9AA 3LGUA 1TBZH 5EODA 5C3NA 3SQHE 3BIUH 5T6FA 1G36A 2G5NA 5LPEA 1J8AA 3GCNA 1O37A 4K2YA 2TPIZ 3CP7A 2ZGBH 3E16B 4AFSA 4HFPB 3UOUA 2FX4A 1NS3A 3MU1A 1HDTH 4U2WA 3VB6A 4ABEA 6CHAB 2R3YA 1A7SA 4OS7A 1PPFE 4THNH 3PROA 4YTAA 3ZZ7A 4ZUHA 3ZZ8A 3MHWU 1GHBG 1BJVA 2VNTA 1CO7E 2BLOA 2JKHA 3UNQA 1RTLA 5AVDA 2FOFA 3TLOA 2Y5HA 2AEIH 5HGGA 1F5RA 1FNIA 2I6SA 3A85A 1O2OA 1T8OA 1W3CA 4AOQA 2A4QA 2W7UA 2W7SA 2WV4A 2J34A 4MPVA 5CHAC 1MH0A 1UK4A 1HAIH 1O2KA 1O5GH 5C20A 3MNSA 3Q00A 3ZZBA 1EAIA 4YT6H 5DGJA 2UWOA 2ZTXA 1KXEA 1SGQE 3MWIU 1UTQA 2A31A 4I31A 5I25A 2HNTF 2Z7FE 3LC3A 1IHSH 1G2MA 2XC5A 1UVOA 3AAVA 4Y71A 1V2TT 3SNEA 3QTVH 1TX7A 1QRXA 3P92A 1KY9A 3LIWA 1BTYA 1O2GH 4GAWA 5DP6A 5DPAA 3RXKA 4BNRA 1KXAA 2Z9GA 4FUEA 1O39A 4ZH8A 1LMWB 1XUJA 2TRMA 3BEUA 4AG1A 2BXTH 3BG4C 3SJIA 1GL0E 1C5OH 1S83A 2GCHG 4D7GA 4Z6AH 1GHZA 2CJIA 5BPEA 1UTPA 1K1IA 1O2PA 5FHTA 2B0FA 1ELCA 4NSVA 3V13A 2Y7XA 1W10U 4IC6A 4ABHA 1K21H 3ZZ6A 5FAHA 1QQ4A 2GCTB 5GIBA 4GSOA 1FY5A 2RA0A 1O32A 1G3DA 2GMTC 2NWNA 4X2VA 3SBKA 3QK1A 1GI9B 3PMJA 1CT4E 1PPCE 3VEQB 4B75A 1AI8H 1LQEA 5JBAS 2FTLE 3RMLH 5DO4H 3DD2H 1ZSJA 2XCFA 1IAUA 1FY1A 4D7FA 4X2WA 2WYGA 3EA8A 1K22H 4WJG2 1L1GA 5LPFA 1A0JA 1OS8A 3RXMA 2C4FH 2F9VA 2XW9A 4FU9A 1LHFH 3VPKA 4LK4A 4X2XA 1QNJA 3U9AH 1HAYB 1HXEH 1PQ7A 3ELAH 1D6RA 1HV7A 2CF9H 2W26A 3LONA 4B73A 2DE9A 1E37B 4NZQA 3UR9A 2ZP0H 1P11E 1T8NA 1EZXC 1T8LA 3B9FH 1Z8RA 3I29A 2G8TA 2CGAA 4TWWA 1LKAA 3PLPA 2B9LA 1BMNH 1DWBH 1UTKA 3A7TA 1BHXB 2FO9A 2FEQH 3RXVA 4B1TA 3NUMA 1O2QA 3LC5A 1SI5H 1CVWH 1O2SA 2XCNA 3DFLA 1OWDA 2JETB 1XVMA 3SNCA 4I8KA 1GI2A 1WOFA 1TNGA 1AVWA 2O8MA 2ANMH 1C9PA 4ABFA 1WAYB 2A1DB 1C5MD 2TBSA 1O2JA 1G3BA 1KSNA 2V3HH 1O30A 1CA8B 2CHAB 1BHXF 4Y11E 2VWMA 2GV7A 1RXPA 2FI5E 2TGAA 1QL8A 3A84A 3GOVB 4CHAB 1XUFA 1YC0A 2V35A 4LZ4B 1JIRA 2QXHA 4FUJA 1FDPA 2ZU5A 2ZFQH 5JBBS 5C5OA 3UY9A 2HNTC 2WUBA 3RXSA 1O3PB 4WMEA 1E38B 1HAVA 4DY7B 1GJDB 4O03A 2B8OH 2H9EH 3MFJA 1SSXA 2ZFFH 2ZPQA 1FONA 3SUGA 1GGDC 3FP6E 3SN8A 3SI3H 2Z9IA 3SV7A 2PW8H 1SGPE 5L2YH 2Y81A 1C1OA 2BY6X 1IQNA 4X1PU 5K0HA 1D9IA 1DY9A 1SLWB 1C5LH 4A92A 2BVSH 1GHBF 3A81A 1ZPZA 1B5GH 5A2MH 1HLTH 1V3XA 4BOHA 2ZHEH 1TNKA 3STJA 1WU1A 2BVXH 2Q6DA 1DX5M 2ZIQH 1O5BB 2ZWLH 1DPOA 1C5PA 4FUFA 4INLA 4CH2B 1C5WB 1P0SH 1A46H 2ZQ1A 2Z6BD 1UVPA 1S0RA 1W2KH 3JZ2B 3M5OA 5J4QA 2VH6A 3N7OA 2ZFPH 3K6ZA 4A1VA 3RXJA 1CGIE 1QIXB 1NFYA 1V2JT 1AE8H 1E0FD 4Y8XA 1RIWB 4OS6A 1V2KT 2WPKS 1BCUH 1KXCA 4NSYA 1EAXA 1P10A 1ZTJA 4UFEH 1YPLH 4TY7A 5JYIA 1KTTB 4HZHA 1DS2E 3V12A 1LDTT 4YESB 2Z3CA 1BUIA 1N8OC 2ZDVH 1IQFA 4X1NU 1VITH 2Y5GA 3S9BA 5DK1A 1JOUB 1LVOA 2H2ZA 1MZAA 2BDBA 1J15A 2YOLA 1NTPA 3SOSA 4YM9A 5ESBA 3GCOA 1GHAG 2NU2E 2GCHF 1JXPA 1SQTA 1XM1A 1YLDA 1CT0E 2J92A 4MQAA 2P3TB 1O5DH 1SC8U 4GVUA 1V2LT 1AY6H 4MG3A 2A2XH 3PB1E 2HNTE 3M5NA 3OTJE 2J38A 2VIWA 3RM2H 2ILNA 1TQ0B 1TNLA 2QV1A 3D23A 3MH6A 2LNCA 4XSKU 1THPB 1B0EA 2VVVA 3MO9A 2G4TA 1RD3B 4Y6DA 4RSPA 1O5AB 3MH4A 3URDA 1KXDA 4JMYA 4I8LA 2CMYA 4X1RU 2ZO3H 1C2DA 2FWWA 2YNBA 1QRZA 2BD9A 3BTKE 4E06H 1AIXH 3B8JA 3CS7A 1HCGA 2JETC 2Z3DA 1WUNH 4KKDA 5IYTA 5A8ZA 3M3SA 1GBCA 2ODYB 3T26A 1YP9A 5EGMA 1GJBB 1GI0A 2FODA 4NGAH 1A3EH 2RDLA 2O8WA 4NIXA 4ZHLU 1XXDA 3ZVDA 2D1JA 5C5NA 4CBOA 2O9QA 2TIOA 3SJ9A 1BJUA 1SB1H 2BY8X 3ODDA 1Y5UT 2FS8A 3RMNH 1S82A 6GCHG 4XE4A 3MTYA 1JRSA 2P3UB 1BRAA 1ZTKA 1ZMNA 4ISIH 1V2VT 1KLJH 1C2LA 3TGIE 3SU1A 2ZU4A 1DY8A 1ELTA 2AYWA 4IMZA 1FUJA 1XX9A 1FQ3A 1THRH 1LCYA 1SQOA 3CS0A 4JYVH 1SOZA 4D76A 1EB2A 3ITIA 1NY22 1GI4A 1W12U 2PTNA 1O2IA 1TFXA 5LGOA 1C5RA 4K5ZA 1NFXA 4IBLH 4XBBA 1FZZA 5AFYH 5IDKA 3K65B 2PKSB 1T32A 2F9BH 4IN2A 1FXYA 2FLRH 3AASA 3RMOH 3FZDA 3C27B 1EB1H 1UHBB 2BD5A 2ZF0H 4FVDA 1DLEA 1QL7A 4NIYA 2SGEE 1C2HA 3QZRA 4IN1A 1L2EA 1S6HA 8GCHG 1G2LA 1O2MA 1O3EA 1F0SA 4K69A 3F9GA 1AMHA 1MKXK 2CN0H 1X7AC 3LGTA 1GVZA 1BQYA 1MU8B 2LPRA 5LH8A 3ESTA 2HOBA 3SJOA 2FOGA 2BTCE 2W5EA 3Q3XA 1Z8GA 2ZGJA 4F49A 3PM3A 1G30B 1EKBB 1GBMA 1QB1A 1WSSH 3GYLB 3MU5A 1OWHA 1TRMA 4NA7A 4YO9A 2GZ7A 3T25A 2SGFE 5K7RA 1MKWH 2BLWA 1C5XB 1O3AA 2ZTZA 3ZV8A 1K28D 2R0KA 2DE8A 2SGQE 3PMHB 4BTTB 2HPQH 3IG6B 1QJ6B 2XWBI 1EAUA 1P2OA 1ETTH 2VH0A 1GHXH 1O3FA 4CRBA 1BDAA 4ISLA 3SU5A 4YOGA 1MTVA 3AW0A 3GY2A 3KL6A 4AGJA 1TYNA 4DOQA 4Y8YA 4F4OC 1AFQC 1Y3VA 2GT7A 3MNXA 3NKKA 3AAUA 1LTOA 1SGNE 3QWCH 3A88A 1OWEA 3SU0A 1ZJDA 2VU8E 3PLKA 1ELEE 4FVBA 2Z9LA 1UCYE 3EA7A