4GPTA

Crystal structure of kpt251 in complex with crm1-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antileukemic activity of nuclear export inhibitors that spare normal hematopoietic cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/inhibitor
molecule keywords GTP-binding nuclear protein Ran
total genus 59
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gptA00
5DI3A 2OLKA 3HYTA 3OIUA 3H84A 4N3NA 1Z07A 4C7OB 2WWGA 4DJTA 2IYUA 5TXGA 1Z28A 4DCVA 1YZQA 2GF0A 4L9SA 1BMFA 5JFGA 2DB3A 4PXAA 4LJ7A 1JR3A 1F48A 4NP6A 3WYAA 2OBLA 3AUXA 4NL4H 1E3MA 1GIAA 3PUZA 2CJWA 4Q9JA 5FOSA 1SQ5A 2KSQA 3EARA 2ZE8A 2V7QD 5LB4A 3CNLA 1E6CA 2CNWD 2W2XA 5FUYA 5L3RA 1KNXA 4ACAA 5H70A 3E70C 2HYDA 1J70A 2GZDA 1ZMXA 3H2YA 5DI3B 1CLUA 4A9AA 4AD8A 2XZLA 2JLSA 3A1SA 3FHTA 2WWFA 1QDEA 3M1IA 2X2FA 4W7SA 1IN4A 1IN8A 4HAZA 3KDSE 4NYMQ 1ZU4A 2BV3A 2R62A 3KKMA 4PQRA 4L15A 2CJWB 3W8NA 2WJJA 1MABA 5DLQC 1PVOA 4GP6A 3U2QA 2WWYA 3T1OA 2VHCA 1FL9A 2QSZA 1W0JD 5FOUA 4IDPA 4V0NA 4QOSA 4A82A 3QNUA 3F3YA 3ND9A 4PZZA 2EFHB 2ZYWX 3CH5A 3RS7A 4J0QA 2RGNA 4B71A 2UVQA 4A0FA 5BN4A 3QXJA 2OFOA 2DFTA 2ATVA 5FL7A 3REFA 5EUQB 1G41A 4C0LA 3CR8A 5DNYB 4BE7B 1OXUA 3QIAA 1MO6A 1N2CE 5KNBA 1XP8A 5SZIA 5JZVA 2QTHA 2G83A 4Q4JA 4I1SA 4DZZA 3VAAA 2IX3A 2IYWA 3K0CC 5KU1A 1CJKC 1ZM3A 1HYQA 4MYTA 1KAGA 4LV5B 4G0NA 3EIHA 3W5JA 2H8KA 5JI3E 4ZDJA 2RHDA 4Q1EA 4DCTA 1KI8A 1NSFA 2ERYA 2F7SA 4LHXA 3UG6A 1J7KA 1YE8A 4H1UA 4TMTA 5CK4A 1NIPA 2N42A 3QPVA 5AJXA 4WA7A 2IL1A 1LS1A 3C8UA 2C77A 2JGNA 2ZJ8A 1WP9A 4NCJA 2YWEA 3SBEA 5F9HA 3WHKA 4A2QA 3T12A 3SQXA 1R10A 3W3AA 4P0TA 3ZZ0A 3VKGA 4AKEA 4MRNA 3U4QA 2ZRDA 5G53C 3GQBA 4M9XA 3CX8A 2NPFA 1YRAA 4S2EA 4V0LA 1XMVA 4LI0A 1DAKA 3X1ZA 4URUR 1ZJ6A 4Q9IA 1OB5A 3HWSA 4PZLA 2IA5A 3BB1A 1CF4A 2VHQA 1OH7A 1YR7A 3DZDA 2P6UA 4HUQB 4TYPA 1P3JA 4RZ2A 3IPXA 1CJMA 2A9KA 3LAWA 2VA8A 5FBLB 2ONJA 1NKSA 4M1SA 1NBME 2XNDA 2PZEA 3P4YA 2ZIAA 4LHYA 4XTCS 1NVWQ 2R44A 1P2VA 3L0IB 3S1AB 1GL7A 1KJYA 1J90A 1W5SA 1GZSA 2H17A 1ZUNB 4PSAA 4RD3A 4C0SA 3AVUA 3NH9A 4Q7LA 2WOOA 5FL7D 4DCSA 1X8JA 1US8A 2JASA 4WBSA 3IIKA 4GOJA 2O8DA 4C4PA 3PEYA 1ZCBA 3FMIA 2J0UB 4MUAA 1Q20A 3OEED 2QROA 4JVNA 2IYTA 1SXJC 1W49A 4HB4A 4PPGA 2FPKA 4N0DA 421PA 2QMUA 3IIJA 2ZE7A 5CDFE 4OJQA 1XD2B 3EG5A 3BE4A 2RAPA 3R9IA 1G3MA 1NVUQ 2JJ2A 1U2RA 2BMEA 1R0XA 2Q21A 2Z5FA 4AKIA 1ZYUA 1KMHB 3KKPA 2IYSA 1G6HA 3SZRA 2GXUA 3OIYA 4B48A 4Q9KA 3HPQA 4TMWA 4F92B 3K1JA 3MMPA 4B74A 2ZRCA 3QOFA 3L43A 5DYGA 1KDPA 5FBWB 5K8LA 4I1VA 4R2IA 2JJ1D 1W36C 5JHHB 4IW3B 1DG1G 3UIEA 2RGNC 3JZMA 2LCFA 5LD2B 3IKJA 2O52A 3BFXA 4NHOA 4BEBA 1ZBDA 2IYLD 3BS4A 1S4QA 2IYZA 1DAEA 3A4MA 4OHXA 1F60A 3DM5A 2IWRA 2AD1A 1E2MA 4QHYA 1IM2A 1BS1A 1TU4A 5HR5A 1MOZA 1J99A 4Q9HA 2Z43A 5FOTA 1A4RA 4LJ5A 3W6OA 3ONWA 2F3TA 2RH5A 4QBFA 3OFND 4TL7A 4EJSB 3B6EA 3GLFE 3OESA 4TLBA 4R9UC 3QKTA 1I4TD 1CP2A 4JL6A 2BEKA 2Q9CA 2FSGA 2FG5A 4K8OA 4JYCA 4Z1MD 2GXSA 2QTVB 2BMDA 4ESHA 1RZ3A 1VIYA 1N6LA 1RJ9B 2D4HA 2F1RA 2LKCA 3NVAA 4L16A 3GJ7A 1U0LA 2JJ8A 1OYYA 1G3IA 1XB2A 1NG1A 4TYYA 1TQ2A 4CIDA 5FTJA 4HB3A 2J0SA 4LY6A 4QBIA 1W36D 1CULC 2QG6A 1KMHA 2VPPA 2VF7A 2YKGA 2NO6A 4MKHA 4IOLA 4XTRA 2XTMA 3VHLB 4DLVA 1E9BA 3SJCA 3TW8B 1Z6YA 3LV8A 3THOA 1P9NA 2ZS8A 1T9HA 4BASA 2BJWA 1N6HA 4EPYA 4Q66C 4IXNA 3LBIA 4YMWA 3I5XA 2QMOA 3RRZA 5HPYB 1ONBA 3SNHA 2Z0MA 1K8RA 5G40A 3VKHA 1KI3A 1E2GA 1S2MA 4CEIA 5J4KA 1KY2A 3DMDA 2ZTSA 2VHJA 3OZXA 4BLPA 1FZQA 1SVSA 2JJ2D 3C16C 4RZ3A 1UEJA 1X1SA 3K9GA 3ZVNA 3U44B 3EA0A 1NN0A 5IK2A 3GPLA 1E2PA 2C03A 4PC3A 4A15A 1ZUHA 2PBRA 1C9KA 2ZSFA 2G88A 3VR5A 3Q85A 2YVUA 4Q7KA 5DIFA 2ZU0C 3ADDA 2QMEA 4Y0VA 2ZI5A 2GZHA 4YMSA 2IYXA 4B34A 5J4HA 1E0SA 4LK2A 4AYWA 4LBVA 3U3RA 1I2MA 1G19A 1R5OA 2VHTA 2ZAOA 2FJUA 3CONA 4QGGA 3VX4A 4V0ME 4OI1A 2B8WA 2QMHA 4EDHA 5C2JB 1OH6A 2QBYA 3CM0A 1JI0A 4CF7A 4JKYA 2BCJQ 1U9IA 1ZU5A 2NO1A 1JXMA 4PANA 1NF3A 2N46A 4EUNA 5KNDA 1GRRA 1EG7A 1YZTA 2AXPA 2OSBA 4ITRC 5EZ5A 3U3MA 5JCPA 2OG2A 3QKSB 2JLRA 3VR1A 4RD0A 3CB4A 3RLFA 1MH1A 1W46A 3A4LA 4KYIB 1FNMA 3U4QB 4EPVA 3OE7A 1Q1BA 2P3SA 4DLTA 5KSOA 1NBMA 5GJWC 4DWJA 1E32A 2CEAA 3GEHA 3I32A 4MH0R 1LTQA 1Z0DA 5D3MA 2FZ4A 3CO5A 2FPMA 1IN6A 2Z4SA 4KJZA 3RS2A 4F93B 1QHNA 3OHMA 2ZJZA 2HV8A 3BOSA 4OQXA 2AXNA 4LZZA 1XTRA 2XJ9A 3CUEF 1OW3B 3DEFA 2WJYA 1VMAA 1XTQA 2QE7D 4JLJA 1RVDA 3NEYA 4CZ2A 4ESVA 1F2TB 2XJ4A 4RD2A 1U0HC 4DDWA 4OHVA 3W34A 3KJIA 3T35A 3X1WA 4JLPA 1Q3HA 4B32A 4ZIRB 1W5TA 4UNPA 2C95A 1AS3A 4IVRA 3CRRA 5TVKA 3SE0A 3ZZTA 4M1MA 1X1RA 4B47A 2WWHA 4EQ6B 4NCKA 4OL0A 5JJLA 5KSPA 2VP2A 4TN1A 2D2FA 4I99A 1F3OA 4IOMA 2RKOA 3KJEA 4NE2A 5DYIA 1FMLA 2FFQA 4RD1A 2B21A 2G0NA 4Q4AA 4JLKA 4RSGA 5FPHA 5B57C 4Q9LA 4BZPA 2VL7A 1E9FA 4BUJA 1FNNA 1ZVQA 4ARZA 2O0KA 1UJ2A 1VYVA 2OCYC 3K9NA 1KY3A 3GCGA 3QG1A 3VR2A 2RGDA 2FMXA 1E96A 1GNQA 2XX3A 4IRUB 1IHUA 1XXHE 3FYHA 3P20A 4URXR 3BFVA 3QVUA 4US0R 2QAGA 3IBYA 3L0OA 2BDTA 1PLKA 4V0MA 3AVTA 1GKYA 3FKSA 3AP3A 4DSUA 2ZEJA 4M8NE 2FSIA 2FSHA 4A0HA 4UNQA 3AKCA 2C78A 2V6JA 5JEDA 4JMPA 4DHEA 2BM1A 2ZROA 3V9PA 1BOFA 1V43A 3OE7D 2ERXA 1QHSA 2OE2A 1NNEA 2F6RA 1E4VA 2VQSA 5AWFC 1YR8A 2IXFA 3THXA 1VCNA 2ZRFA 3QVVA 5B58C 3I61A 3CPJB 1U9IC 4A0GA 4Q21A 1GITA 4NBSA 2A5DA 2RGGA 3AF2A 4K81B 4Q4HA 4BFSA 3ZVMA 1E0AA 4OHZA 2EFGA 2ZM5A 2CMKA 3BH0A 2XNSA 1M1YE 1Y63A 2IXGA 4TMVA 3TK1A 4LJ6A 1UBGA 2QSYA 2GNOA 3QEJA 1NLYA 4JLBA 3IUYA 5G41A 4DB4A 1KJZA 1OXTA 4AKHA 4U7DA 1UAAA 4JL5A 5G3YA 1D2MA 1XJQA 2BM0A 2G3YA 1KI4A 4L8GA 1S8FA 1OFTA 3RVBA 1SVWA 4QJ3A 1VECA 3ICQB 1KGDA 1KSGA 3LWNA 2ZRLA 3FHOA 1T3HA 4XH9B 1ZM4A 4D80A 4NCIA 2YINC 4GPTA 4RZUA 1NVVQ 3K70D 1F2UA 1DBSA 4JSTA 4POAA 5HKKA 3FDIA 3DVLA 4KSCA 3UK6A 4HAYA 4EAQA 3KQKA 3U61B 2KJQA 2GAAA 1QHYA 3AVOA 5KO2A 3ZS9A 3BORA 4LJ9A 1GWNA 1EFTA 1G7SA 1P7CA 2NO0A 1KAOA 5FTKA 4DIDA 1VYUA 3B1VA 3VX3A 2DBYA 1OIVA 2WICA 3L0PA 4QNRA 5JS8A 1K5DA 1DOAA 2BHRA 4TWZA 3TIFA 3DOFA 3I8XA 4ZCLA 2IW3A 3UMRA 3ZVRA 5J4YA 3TNFA 1A2KC 4HAXA 5LD2C 1XEWX 1G8PA 5H8WA 1G18A 3SR0A 1MKYA 1P9RA 2QRZA 2WJIA 3THXB 4XD7A 4P4SA 3T34A 1OH5A 2WVJA 4DT1A 4LGMA 4E09A 4DLUA 2RGXA 1RE0A 1NBMD 3LFUA 3DHWC 3AF1A 2D2EA 1UKYA 4JBYA 3TUZC 4WZ6A 5IHPA 3HU2A 2ZYUX 4AIIA 4JLMA 3QG5A 1QVRA 4Q48A 5CIWA 2ORVA 3BRWD 2HCJB 2ZETA 4LYJA 3CPEA 1TF7A 3MJHA 1DS6A 4IEIA 2IUUA 3X2SA 4EIWA 2ZSEA 1CJTC 3NWJA 5C1BA 2CE2X 2PEZA 1TQ6A 2DHRA 1GAJA 3TH5A 4C2UA 4JVLA 1S9DA 2BVNA 1UM8A 2J7KA 1SXJD 5J40A 2P6RA 3A1VA 1Z6AA 1Q1ZA 1E1RD 2RCNA 3GFPA 4GFDA 3RDPA 1QRAA 4LJ8A 2VLIA 4IFEA 1G5PA 4MKFA 3GLFA 3B60A 3QENA 1G64A 3GFOA 1SVIA 1YVDA 2PZGA 1WB9A 2HXSA 3LBNA 4E22A 4Q19A 1Q3TA 2OLJA 4RZXA 1RIFA 3TSWA 3BXZA 4X8MA 3HP1A 4P3YA 2B7BA 4D6PA 1XU4A 5KPDA 4L4UA 2WPDA 3A37A 5K8TA 2NPIA 3CZQA 3CRVA 5JECA 3FVQA 1ZC3A 4AK9A 5FTNA 2GEVA 2YZ2A 1OF1A 1U8AA 4BRWA 5G3ZA 1U90A 2BEJA 1E2QA 1EWQA 1OV4A 3OAAA 5TMPA 4KFUA 1XCPA 2YYZA 2F43A 5SZKB 4EKDA 4F91B 4B3FX 3QF4A 1II8A 1MO5A 2ZITA 3RC8A 1QG4A 3BJIC 1QHIA 5BYJA 4I1UA 2O8BA 1F2TA 3DO6A 1VG1A 2OESA 1CXZA 1ZUIA 2F1JA 4XVQA 2MMCA 2JIZD 1GNRA 1E79D 1UADA 4EPTA 1OKKA 3RNLA 4A8JB 4MDEA 1EX7A 1Z0IA 1G4UR 1QHHB 4B43A 3PUVA 4UXJA 4D81A 4XWAA 2BCGY 2F9MA 1ZD8A 3N70A 3QXSA 5D3QA 3TRFA 3AVQA 2VSFA 1D8TA 1SVLA 1R4AA 3MWLA 1Q1QA 3H1TA 4A2WA 4U5XA 3A58B 1M34E 2AK2A 1KZGB 1ZM2A 1QVAA 3AQ4A 4BFWA 2ZSDA 1TAGA 3T1TA 4QXAA 2PMKA 3AUYA 2JLYA 5EE1A 2IEYA 3M0EA 1BYUA 2UZIR 5JMTA 2PH1A 2W6JD 4RFSA 2OBMA 2ZVPX 3THYB 1TMKA 1W4AA 4FW9A 3VR6A 1Z06A 4DRZA 4BFXA 2JLVA 2OILA 3RS3A 3SEAA 2ZRKA 2DY1A 1RPZA 2EVWX 3PEUA 1T5LA 2I3BA 3TVTA 4CDGA 2XZPA 1KI1A 1N5KA 4RCYA 5AJYA 4D82A 4QRHA 1DAGA 4MYUA 3IBGA 3QSYA 2OO7A 4OK5A 2FGJA 4F4CA 1FTSA 1E2FA 3K0FA 5DN6A 2W6IA 1MO3A 1IXZA 2VF8A 3AGPA 3PQCA 5EP2A 3I3SR 3FOZA 1S0UA 3GLHA 5JWHA 2RMKA 1BH2A 1KOFA 4LBZA 3VKWA 2GF9A 3DPUA 3HYRA 4NZYA 1EESA 4OHWA 2O8CB 2ASEA 4Q4AB 3B2EA 4XWKA 1O87A 2ODEA 3W9YA 3NEJA 1T6NA 1YZUA 1E9RA 3C41J 1G8FA 2CDNA 2X19A 3Q7QA 2OT3B 1H8ED 2Q9BA 3QF7A 3EPKA 4IVPA 4FWIB 3SFZA 2D06A 2WWWA 2CCJA 3EASA 1TEXA 2HYIC 1BMFD 3GJ6A 1ZRHA 1VTKA 3LO5A 2QTFA 3ADCA 2GJAA 1ZIOA 2PX3A 3H0KA 4NYJQ 5FR1A 5C4GB 3W8RA 3GLGA 3RWMB 4OHYA 5EXTA 1L4UA 2WAYA 4RKFA 3UMFA 2WSMA 1DO2A 2FSFA 4MQBA 1IN7A 1W4CA 1XXHA 1IJEA 6Q21A 1U0JA 1LF5A 1NN3A 2DWPA 4MKIA 4Q01A 2HXYA 2ZS9A 3RS5A 1T3SA 5K8IA 3BWDD 5H68A 3U6BA 1FX0A 2MSDB 3CRMA 1A5TA 2ZAMA 3E2IA 3N2EA 4Q1FA 2ZJAA 2F55A 2C96A 1ZNZA 2H57A 2JATA 3TKLA 4DEYA 3EX7C 5FOWA 1AQYA 4Q1DA 3ZQJA 1MV5A 4D4JA 1SKQA 2BKEA 3BIFA 5BYKA 1I4DD 2GETA 1Z6XA 4FD2A 3IIMA 4KFSA 1ZNWA 2KE5A 4ZDIA 2IUTA 2J3EA 4II7A 1NG9A 1ZIPA 4CT4B 1LY1A 1N3BA 3VR3A 1CRQA 2AN9A 4LSGA 1CU1A 1E9SA 2RGBA 1FQKA 2A5YB 5AR1A 4UNNA 4ZKDA 4NCHA 1DO0A 2GKSA 4M21A 2WSSD 3GLHE 3A1UA 3GEIA 2OM2A 2O5VA 3PV0A 4M1TA 2VTKA 4KLNA 1JEEA 4HLDA 4B3XA 2GJ8A 3SI7A 4M2LA 1N25A 4PQFA 1UF9A 5SZJA 2CHQA 1XPOA 3LQQA 3GFTA 4HAUA 4MGZR 2C04A 1RRGA 4BECA 1TADA 1IXSB 2PCJA 1WBDA 4B44A 4YMVA 3IILA 1SXJE 4G5RA 3H86A 2O8BB 2R8RA 1EXMA 2XGJA 4LYAA 4QGAA 2O8FA 1JALA 1II9A 4DLXA 4EFLA 4HDOB 1DAFA 2XXAA 4URYR 3KXIA 3NBFA 1P73A 5DI9A 3FGNA 1P62B 2XTZA 4ASUD 1TQDA 4TMKA 3IQWA 4WXRA 1NLFA 1TTTA 5FL3A 4TLAA 1F2UB 4G01B 1Z6TA 1OJLA 4DCNA 4OJKA 5ANRB 4K46A 4LBWA 4DB2A 3TMKA 4B3DA 1KKMA 3RRNA 1LS6A 4E07A 3RS0A 2VRWA 1NVVR 2ZXUA 3JVUA 1GDDA 1HE8B 3LW8A 5EXSA 5FUWA 2IUSA 1XMSA 2CCKA 3B5JA 3SFVA 2G1JA 4W5HA 3OAAD 2QM8A 4TQAA 2KI5A 3Q5EA 4LYHA 3WMFA 3NBXX 4OBEA 3CWQA 4BFZA 1MRSA 3IO3A 4HUQA 1U99A 2R6FA 3AKDA 2JCSA 4BFYA 4CEJA 4RFSB 4JVMA 4MA4A 4D0GA 1Q12A 5AUOB 1NVXQ 2Q6TA 3LLMA 2WBLC 2J41A 5EZ6B 1IY0A 1AM4D 2JAQA 3TSOA 1JEDA 4GT1A 2F3RA 5UKDA 2HUPA 2GILA 2H16A 1FUUA 2HLDD 2H1LA 3EWAA 3PUWA 1G8YA 4ZDKA 3C14C 2WOJA 4CEHA 1S1MA 3CF0A 4HLCA 3KZ1E 1ZD1A 1G291 5J5CA 1KJWA 2XTNA 1QF9A 3PIRA 2IHYA 2W2TA 5C18A 1UFQA 2HT6A 2FWRA 3TLXA 1W48A 3TBKA 2RB4A 2Z83A 1IJFA 2P2LA 2P65A 1K5GA 1RW4A 2ZI7A 3GEEA 4HSEA 2DWQA 4O2LA 3SC3A 2KWIA 4FCTA 3MLEA 3GJ8A 3UMSA 1LF0A 1KDOA 4GZLA 1VCIA 4GNKA 1OIWA 4XWOA 5KSYA 3SYKA 4AWXA 2W6JA 3O8RA 4KV9A 3RWOA 4KYUA 1IONA 4O2RA 3THYA 1M7GA 3EW9A 2BIFA 2K5UA 2PX0A 3IEUA 3FPAA 3QUSA 3WRXC 5HKKD 1WMSA 2V8OA 3AGQA 3IDQA 3LX8A 1IY1A 3NHBA 4LDJA 4ZO4A 1DARA 4X8LA 2R65A 5AUQA 2WZQA 5FPSA 3VU9A 3AF4A 4DXAA 2ZRGA 2VP5A 4D4MA 2YV5A 4HZUB 3EAQA 1XEXA 4D0LB 1W1WA 4UQOA 1TEVA 1YR6A 1HT1E 3DKVA 3AB3A 3G5UA 3HDTA 1SXJB 1GNPA 3GLIA 1OB2A 2WJGA 1VPLA 1N6OA 4A8JC 3U7GA 4ABYA 4HUTA 1KNQA 2LWIA 3KTAB 1GM5A 5GVSA 1S96A 4X8HA 1E98A 4MKGA 3X1XA 1IOZA 2VP4A 4JL8A 3C4JA 3RSLA 3SJZA 2HCBA 3R7WB 1ZINA 3SJBA 2HDNB 1KZ7B 1PLLA 5IF9A 5E7MA 2FU5C 4Q02A 1KDRA 1XRJA 4A2PA 3CWZA 1XTKA 2ZYTX 4UXHA 2PT7A 1UKZA 3HPRA 4Z8YA 3ZD7A 4MGKR 4UNRA 4Q4HB 1S9HA 3B82A 4TL9A 5FBQB 4IVQA 4QKQA 4ZI2A 4JSYA 5F3WB 2GCNA 5DH9A 4D26A 2OXRA 4JLVA 2ZR7A 1U98A 1HQYE 3PFIA 1RJ9A 2AFIE 4BFVA 2AKYA 5P21A 3R7WA 4TT3D 4BWYA 4DSOA 4LV6A 1VHTA 1SVKA 1X3SA 2IS2A 4TTRA 5KSZA 2FOLA 1AN0A 1P9WA 2G9NA 1EWRA 1G20E 2IT1A 2ZRNA 3C5CA 4B3GA 2ZSBA 3ECCA 5LDDC 1A1VA 4LJ4A 3TR5A 5L3VA 1BKDR 1NJGA 1KI2A 2JLZA 1PUJA 2DFLA 3SYLA 5M04A 1XEXB 4YXWA 2I4IA 2WWXA 1NMYA 3HU3A 4FMDF 3TAHA 3T61A 2FFHA 1UBEA 2AKAB 1OKKD 4UJ3A 2GESA 5JSZA 2P0EA 3EPHA 2GEUA 3DKPA 2QPTA 3QKRA 2ZI9A 2A7QA 4GI7A 1M8PA 1YR9A 2H7VA 2WJHA 2BWJA 2XOKD 2FEMA 4FIDA 4JBXA 2WHXA 3M6AA 3KQLA 3QPUA 3ZS8A 4E5UA 3ETLA 4WZAE 3U44A 1P2SA 3KX2A 3KJHA 5TB5A 1Z3IX 5EJEA 1W44A 5CB8A 2QAGB 4PPQA 4M0LA 1R2QA 3E5HA 3N5CA 4V0OA 3B1ZA 3ADBA 3KUDA 4JJKA 2IEZA 1LNZA 1O3YA 4IJMA 1T5IA 1XCMA 5BWMA 2ZR0A 521PA 4R7ZA 4TMXA 2ZJOA 4G5OA 3WHLA 3V4RA 2V3CC 5JJIA 3FTQA 4M1YA 4Y0AA 5L3QB 3U6KA 5GJCA 2OHFA 5CM8B 3K53A 3ZLJA 2VBCA 3NH6A 5TY0A 1IQPA 1G8GA 4DUGA 2X1VA 5EE0A 3K9HA 4RVCA 2MSCB 2BMFA 2WV9A 1G7CA 3B9PA 3WP1B 3WNDA 4TSFA 1C4OA 3KKQA 2GVDC 4KBFA 4P31A 2IYRA 4B35A 2EYQA 3AVPA 2CLDX 2E87A 3TVDA 1ZP6A 1E79A 2O0HA 2FV8A 4M1KA 3ZIAD 1E2LA 2B8TA 4M22A 5B30A 2GRJA 2V6IA 1XEWY 1NSTA 2FH5B 5FTMA 1E0JA 1IBRA 4IDHA 2TMKA 2ZREA 1XMJA 4TMZA 2A78A 3GLFB 3AP1A 3Q9LA 2NGRA 1N6KA 4BLSA 1G5TA 3BH6A 2YWHA 3MGCA 4IDQA 1IAQA 1KK0A 3TAUA 1TUIA 4MYCA 2WMNB 3KKOA 3RC3A 4H1VA 1N5IA 1WE2A 2YHSA 3K0AB 1NJFA 3CR7A 5C4MA 1WRBA 3WNBA 1A82A 4PAMA 2QGZA 5FTLA 3SQWA 4FN5A 5L3SA 1R0WA 3BERA 1D6JA 4BZXA 4M9QA 2QBYB 5GJBA 1NY5A 4B3BA 5DN6D 2DFNA 4GOKA 2ZRMA 2XXAB 2QN6A 1T0HB 1JXOA 4FCVA 1XD9A 1AZSC 2R6CA 1P6XA 5E95A 3T15A 2NOAA 2JJ1A 1II0A 2GJKA 1KO5A 4LPSA 4P33A 4TTPA 2FDCA 3O47A 4EPXA 4ACBA 2ORIA 3P4XA 4Z8XA 1X8KA 1I2DA 2PLFA 2EFCB 3I62A 1M2OB 2QNRA 4C0JA 1VCOA 2J7PD 4BFUA 4V02A 3K0SA 2E1RA 3T5GA 2ZR9A 4A8JA 1NMZA 2RGAA 3FKSD 1MABB 3L8ZA 2W83A 4MYHA 3F8TA 3BBPA 1VG0B 3L8YA 3I8SA 1OT3A 1D2EA 1M74A 1FW6A 4NMMA 4W5JA 2YOFA 3AM1A 4DBLC 3KQUA 5FOXA 4A36A 4M4SA 1ZNXA 4JLAA 1FQJA 1OXSC 3MUFA 2R6AA 1TL7C 3LVQE 2IF0A 3I73A 2J1LA 2P6NA 3MSXA 4ON9A 4Z1MA 2ODNA 1EFHA 2MSEB 2XB4A 1W2HA 1W2GA 3K8YA 4HZIA 4PO9A 1U81A 4QBGB 4YMUA 4MGIR 2EYUA 2C9OA 2ZE5A 3GJ5A 4NDZA 4PR0A 2F9LA 3CKLA 4BRUA 4F7WA 1XPUA 2HLDA 1CBUA 2ZPTX 5AK0A 1ANKA 1DAMA 1NL3A 4LJYA 4RJLA 3LA6A 1CEEA 3PG5A 1KO4A 4OQLA 2YWGA 2EWVA 4I81A 5HTKA 3MD0A 4G5GA 1JJVA 1I4LD 4OI2A 2V4ZA 2CLCX 4ARZB 5JRZA 1SULA 1E2IA 3NBYC 1CJUC 3Q72A 5FOVA 1GFIA 3K0EA 4LOAA 3NBZC 1YJ5A 3ASYA 3B13B 4BLQA 2Q3HA 3TQCA 5KTYA 3K70C 2VSOA 3AVYA 2ORWA 5JSZB 3FFBA 3T1VA 3U7EB 2G77B 3OF5A 4GBMA 3VR4A 2GK6A 3EZ7A 1EFRA 3QKRB 4YLGA 2GAOA 4JVSB 2IS4A 2A5GA 2QT1A 3SBDA 1P2UA 1Q1EA 2GJ9A 2PCLA 1HV8A 1M7BA 4ZDWA 2G6BA 1KO8A 4KBGA 2WPDD 4CEHB 4O3MA 4AKGA 1DAHA 3U7HB 1VHLA 2GEDA 2WIBA 4AC9A 4AG5A 4GMXA 4QG7A 2FF7A 3U3KA 3P32A 2QEQA 5JLJA 1B23P 1JECA 3SJAA 5CITA 5JWRA 3W6PA 1MR3F 1XF9A 1Z2CA 1P75A 3KQHA 5EXPA 1CR0A 2DFKB 1SVOA 5CM9C 1JQJC 2ZANA 4DLSA 2C9YA 3WYFA 2RGCA 4GSYA 5F98A 1E69A 2JIZA 2UKDA 5BQ5A 4GOXA 2EU8A 1SVMA 1CR4A 2QENA 3KXKA 3VNVA 3MCAA 1G5RA 4LPKA 3WYGA 4HB0A 1W0KD 3KKNA 2PJZA 2O8DB 4Z51A 2FZLA 1S3SA 3REGA 2IBMA 1NP6A 3E1SA 1G17A 3NDPA 3AVVA 4GMDA 5A0FA 2C8VA 2A5FA 3SS8A 2Q3FA 4BQSA 2N1BA 2ZU6A 2YWFA 5KDDA 4DDVA 3PITA 1D2NA 1Z47A 2IHBA 2CXXA 3UG7A 1DADA 1UKVY 3TUJC 4NONA 1AJEA 1XJCA 4BGDA 3FMFA 4QHSA 1L2TA 2BBTA 5GJVC 1TPZA 4C30A 1OHHD 3QBTA 4TYWA 4PHFA 3K0AA 4RY2A 1LW7A 1T4GA 5F9FA 1E0KA 3TQFA 1NN5A 3QBVA 2JLQA 4PQYA 1NLZA 1RFLA 4URVR 4M53A 5L3SB 2QQEA 4IDOA 2HT1A 1D9ZA 2CBZA 3EXAA 2CK3A 4KVAA 1VG8A 2IF2A 1TU3A 3AVWA 4P32A 2VEDA 3KJGA 2VHUA 4GZMA 2C5LA 1RC8A 4RD4A 1GOTA 3IHWA 4LJAA 4LWZA 1E2JA 4Q7JB 2H92A 2WJVA 4HI0E 1N6NA 4MRPA 1SKYB 5JJKA 4B6FA 1AKYA 2NIPA 1BO6A 1ZNYA 1E9CA 4GRAA 2X2EA 4JJZA 3OIWA 4NYIQ 4EJSA 3SYNA 2IS6A 4KFRA 2F43B 4RCZA 4OI0A 3MFYA 1S1CA 2GCOB 2ATXA 2WKQA 2ZQ5A 3WBJA 1KKLA 2QZ4A 1KSHA 1L8QA 2QL6A 5L3QA 3GLGB 2H5EA 4R71A 1R0YA 4WOPA 2PJRA 1CR1A 3B9QA 1K6MA 1E2NA 3ASZA 5KDLA 2EFDB 2D3WA 3UATA 1HTWA 5AJVB 4XVUA 2WM9B 3CBQA 3TE6A 3UANA 4DDTA 3CIOA 2FGKA 3MJRA 3C5HA 1QHGA 1JR6A 1QZXA 3LBHA 2ZRIA 1AIPA 2GCOA 1KK3A 1T91A 1CS4C 2W2VA 1Z0JA 5KNCA 3EIEA 1ZD9A 2GBLA 3IO5A 4KAXA 1XX6A 2FNAA 3F0TA 3HR7A 3U3OA 1W0KA 1FPMA 3LD9A 3FMPB 2A5JA 1N0VC 2GWHA 3VHXA 4DLRA 1FP7A 2CE7A 4BLOA 1VYTA 3KB1A 3QPWA 3VU9B 1N6PA 4DSNA 2KBEA 3Q3JB 3IEVA 1IXRC 3QXHA 3T5DA 1TUEA 4KFTA 4WVFA 1AZTA 3CF6R 1II8B 3M4YA 1PUIA 2HF8A 2JDIA 1CJVC 2CHGA 1XJ0A 3GP8A 2X77A 3EPJA 4URZR 2NO7A 4HEJA 1N5JA 4AG6A 1RRPA 4OK6A 4JBWA 3JZAA 1P5ZB 5IK2D 4Q7MB 4TT3A 4Q4LA 3CRQA 2YNMA 4MITA 1XDBA 1HA3A 4XOIA 5GVRA 5DSZA 4PC1A 3RHFA 5L8VA 2ODWA 5KUTA 1AKEA 721PA 1OYWA 1COWD 4P4TA 4G1UC 4HAWA 2J9RA 2AD5A 3X1DA 1H8EA 5FPTA 2L0XA 1U8ZA 2O0JA 5JBQA 1AGRA 3BAFA 4ZV4A 1JPNA 3BB3A 4BFTA 821PA 2J0UA 2QPAA 2EW1A 4MDFA 3LNCA 1Q21A 4H9GA 3P27A 1T8TA 1S3GA 1CIPA 2O8EB 5EP4A 2QM7A 2XOKA 5EUMA 4OQFA 5AUPB 1P60A 3RABA 4QHTA 5HE9A 1UKEA 3X1YA 2C2HA 2NG1A 4JZKA 1E9EA 1JB1A 2J45A 3EIQA 1G4AE 4MUBA 1ETUA 2HEIA 1Z83A 3OFNA 5FBRB 4BLRA 2A30A 4MRVA 4G5SA 2OEPA 4FCWA 4D0NA 4R2HA 1XNJA 1GL9B 1GG2A 2P5SA 3WNCA 2O8EA 1KO1A 2D62A 1NIJA 3UPUA 1G6OA 1WDTA 1X86B 3PJRA 4AYTA 2EFEB 4LRWA 1XCGB 3CZPA 5CJPA 3BH7A 2OXCA 2IXEA 5HCNA 4DIEA 3C7KA 3RS4A 5IRCD 3AF0A 1E99A 4PSKA 4V03A 4DVGA 2DYKA 1HE1C 2PLRA 5EE5B 4PPFA 4US2R 4M9SA 1X6VA 2DPXA 1VKJA 1N6IA 3AF3A 5LPNA 3WY9A 1Q0UA 4ERNA 3A1WA 3Q8XB 3P26A 3A1TA 1HH4A 1R5NA 3U5ZB 2NMVA 3EZFA 1XTSA 4IDNA 1DTSA 1XFAA 2R6DA 2CVFA 3I92A 2GZAA 3EZ2A 4YQFA 4XVRA 5CLLA 3S1AA 2ZRHA 1WF3A 2GCPA 2OCPA 2QP9X 1TQ4A 3NHAA 1F5NA 4HDCA 4TYQA 3HJNA 1BYIA 3U7FB 1LFDB 1SHZA 1KI6B 3MWYW 1FMJA 5JI2E 3K9LA 5JWOA 4W9MC 1KK2A 2ZUDA 3GJ0A 5EP3A 1CKEA 3B1XA 4FMCB 2AK3A 4C0HA 5E3HA 2AX4A 4YDSA 4GDFA 3L2OB 3KQNA 2OV2A 2AWOA 5FI1B 1HY3A 3ZJYA 2V7QA 4ASUA 4LC1A 1E2KA 1CTQA 2QAJA 2Q9AA 4WW0A 1OFIA 4QM6A 1AGPA 1OH8A 4UJ5A 1N6RA 1YZLA 2BMJA 3FKQA 1SHKA 2W58A 1YHNA 2IK8A 2QP3A 2D7DA 1P61B 4CRWB 3EC2A 1B0UA 2LKDA 2ECKA 3UXMA 4BZQA 1Z0AA 1E9AA 1P72A 3RANA 1HEIA 3G82C 4M1WA 4RD6A 1G21E 5CLQA 2GBLC 3T1QA 2FA9A 4LHVA 1ZW6A 4L5BA 2D74A 3VMFA 1U8YA 1WBBA 3A6PC 4QBHA 2OCBA 2ANBA 4PSVA 4C0BA 4N0EA 2WTUA 3O8DA 1EFCA 2WMOB 3WMEA 1RKBA 1G16A 4Q1AA 1A7JA 1JPJA 1TF5A 2IYYA 4HAVA 3SHWA 3SDZA 3ZDQA 4CEJB 2J5XA 2OUKA 1ZC4A 3PEWA 1CR2A 1E2EA 3SHFA 3GLIE 2E9SA 1ZM7A 1UDXA 4DKXA 2V54A 4NU0A 1G3UA 5FPYA 4JKIA 3KUCA 1EGAA 1JAIA 2FPLA 1QBKC 2VSXA 4AYXA 2W0MA 1U94A 1KYIA 2CL0X 3AP2A 3HU1A 3K09A 1YZKA 1E2HA 2QE7A 1T0JB 1Z2AA 1GP2A 2FFAA 1UDWA 2G1KA 4FI3C 2OFWA 1D5CA 1NY6A 2ZI6A 1WCV1 4A1FA 1GILA 8OHMA 4B33A 1XTIA 1E1QD 4NYMR 3DM9B 5TV2A 3MRSA 4GL2A 5H1YA 2UZ3A 4LHZA 3CX6A 2SHKA 2NTYC 3I1FA 4KSBA 4Z54A 5BW8A 3PCRB 3ND8A 2PT5A 1GKUB 4QC2A 3RRYA 1FX0B 4YXWD 2V1XA 4KVGA 2DCUA 4RFVA 1JR3E 2HF9A 2RHMA 2WWIA 5DGXA 1GRQA 2GHIA 5KHOC 4C7OA 4KI0A 2AHOA 3FB4A 4KO8A 2QUZA 2J7PA 4LX0A 1MT0A 4A6XA 4MRSA 5JHGB 2FX3A 1TX4B 4B2PA 3B8HA 4HZUA 5IT5A 3TR0A 2YOHA 1WXQA 4I1OA 1YRBA 5AJWA 4ZCIA 4EJSC 2DWOA 3HR8A 1XEFA 4YONB 3WBKA 3V00A 2ZYVX 3NIBA 3LXRA 4EQ6A 1AA9A 3Q5DA 1SXJA 1J2JA 3GLIB 1UBFA 4JLNA 4Q47A 5J4LA 4IKEA 3DDCA 4CW7A 4ILEA 3KTAA 3LXXA 2BBWA 3ZQ6A 4PAOA 1QG2A 3ICEA 3PXGA 4C0QC 4P4SB 1ZM9A 4C0KA 2W00A 4KLZA 4IXMA 1DEKA 4DLZA 3GJ4A 1YKSA 1KSJA 4ZPXA 1UPTA 3B1WA 3B78A 3K0CA 4JLOA 4XJXA 4EFMA 2I1QA 5ELXA 1AS2A 4B3CA 2CL7X 2J0VA 5CYOA 1G9XA 4TZ0A 5A5GA 4TQUS 5F2EA 1Z8FA 2J46A 2YC2C 2CLSA 2QP4A 4ZIRA 3SOPA 2ZE6A 1HT2E 3ZD6A 2G0TA 3AKYA 4ZCMA 2IWHA 1UBCA 3EZ9A 3CNOA 4TL8A 3NKVA 4CEIB 2ZJBA 3QKSA 4A0RA 2VP0A 3T06B 4HLQB 1COWA 1JR3D 4BEJA 1V5WA 2CCGA 2V55B 1OFHA 3LY5A 3OEHA 1AK2A 2FEOA 1Z22A 4PPNA 1ESNA 1G8HA 3PR1A 3FE2A 1VCMA 1E2DA 1PV4A 3GD7A 3F5FA 2R6GA 2Q3MA 5B2ZA 4XIGS 1ESMA 1H65A 2CK3D 3MG9A 4PC6A 2I1VB 1R8SA 1T8UA 5DE3A 4KHZA 5DHAA 1XZQA 1QHHA 3GLHB 2XSZD 3L82B 4KCGA 4O0MA 3O8CA 4DLYA 4LV8B 3J81k 4FXPA 3TGPA 4PTLA 1GTVA 2JEOA 3EZ6A 4US1R 5DO9A 5GADl 2O8CA 1LVGA 1KK1A 1KO7A 2AFHE 2B92A 4QGHA 2ZUCA 4U02A 1H8HA 4E03A 4IHQA 4TQ9A 1A2BA 3VFDA 1WQ1R 5TDHA 3C15C 4R98A 2QU8A 4PHGA 2PEYA 4JS0A 2QI9C 2KB0A 4AY2A 4EPWA 2Z4RA 4WZBE 4XD7D 3D6TB 2JLUA 3RYTC 4XSGA 3ADKA 4OQMA 5FR2A 1ZAKA 1DE0A 3DMNA 1IY2A 1C1YA 3DL0A 3PEVA 1Z0KA 1KDTA 3R20A 2JA1A 3BK7A 1SZPA 1AS0A 2CNWA 5E7IA 3RAPR 3DZ8A 3WXMA 1MRNA 3CW2A 1XZPA 5J4VA 3L0SA 1YU9A 221PA 4MRRA 4NTZA 2JLWA 1Q44A 1E1RA 1HQCA 1VG9B 3WRYC 2J0QA 4Q18A 2BC9A 1NRJB 3RRMA 2ZI4A 4ZI3A 1Z6GA 1GRNA 3A4NA 4GP7A 5J47A 4L9WA 2ZS7A 1RYHA 2GVZC 5CK5A 3QY0A 1BIFA 4HDQB 2NZ8A 3LVRE 2OAP1 5AJZA 3TSZA 3W90A 3B7GA 3I5YA 3OEHD 3DOEA 5CJ2A 2PZFA 3OIVA 3UWOA 4Q5IA 2EQBA 3TUIC 5HZKA 1DAIA 1R6BX 5HE8A 3D31A 2MMGA 3U3JA 3THWB 4IFBA 2V1UA 1ODFA 2WSSA 1J8YF 5FBVB 3VTKA 5KDOA 1JJ7A 1RYFA 1QHXA 3PENA 2VO1A 4WIAA 4D2IA 3CRW1 1EX6A 2OCAA 3NTUA 1NKTA 4LBYA 2H18A 4UXIA 2FE4A 3H4MA 2B6HA 5LBIA 3VQTA 4HB2A 1XPRA 1R0ZA 4X8OA 1H8HD 5JS7A 2CVHA 4PAQA 1P4SA 1OIXA 3R9XA 4EPRA 4F38A 5FFMA 4A6PA 1Z0FA 1PZNA 3A8TA 3AKEA 2FFBA 3QEOA 1G1MA 1GL6A 1OFUX 2PL3A 2QY9A 2EWWA 4PZYA 1JBKA 1FFHA 3B85A 3UWKA 5TARA 1MO4A 1VIAA 2IYQA 4FMDB 5EE9A 1G7TA 2VP9A 4LHWA 2CHVA 5E4FA 1W47A 5CYPA 3KFVA 2IYVA 4B6EA 2OFXA 3TW4A 2KBFA 4YC7A 3VNUA 4QL3A 1KIMA 4P4UA 1P2TA 5KYKA 4HLUC 3BD9A 4NYJR 2GTPA 1KHTA 1DG3A 4HLUA 2J59A 5JCZA 4FMBB 5C46F 3OEEA 1W4BA 5AUNB 4DSTA 2XEXA 4CT5A 4D4KA 3MAAC 4BLTA 4DT1B 1TNDA 1W0JA 1Z29A 3UKDA 4IEEA 2JDID 2QORA 3IQXA 4DDUA 4TLDA 1FP6A 2J87A 2QQ0A 1LB1B 4FMCF 4PHHA 3ZZUA 2Z6VA 4PX9A 2VH5R 4B76A 2WKRA 2IS1A 2O8FB 3RSOA 1OLOA 2P5TB 1EFRD 4OI4A 4F4IA 1XWIA 5HCIA 1YQTA 5EP1A 3R8CA 2RGEA 1F6BA 1KTVA 3G0HA 3FMOB 4RKEA 3ZGXA 2NZJA 3ZYCA 3K09C 4G5QA 4Q4JB 4C9BA 4NYIR 5KOYA 4JYBA 2C98A 3JVVA 3CH4B 3W6NA 3AEZA 4QJ4A 3TJZA 1PLJA 4B2IA 3LX5A 3V4FA 2W0SA 2REBA 1DELA 2OZEA 2REXB 3NC0C 4PC2A 1FTNA 1G3RA 2GDJA 4JT4A 4UNSA 4CGZA 1KMQA 121PA 4PFSA 2JLXA 1R5BA 4PHTA 1HURA 3ZVLA 2X8AA 3BGWA 2D7CA 3NC1C 2F1IA 3N2IA 3CLVA 1JNYA 4FINA 4TSFD 2QAGC 2AR7A 4KODA 3K70B 2QT0A 1N5LA 1SGWA 4OYHA 5E7JA 3D3QA 4N1AA 2XZOA 1WA5A 2B7CA 2YC4C 2ZRJA 5EXXA 4DUGD 4B75A 3W5IA 4CVNA 3ZIAA 3ZH9B 5HZHA 2IC5A 2A3RA 1KI7A 4M9ZA 5CIQA 2VIIA 4QJ5A 4DLWA 3QF4B 4OKSA 1PJRA 2V9PA 3FWYA 1M6NA 3QI2A 1R8QA 2WKPA 4YDHB 4C0AC 1UEIA 1AQUA 2BJVA 3GJ3A 2REOA 2XNDD 2OAQ1 4Q03A 4V0KA 3SU8A 1GUAA 5KPJA 1T3LA 2C9CA 4CYMA 2BOVA 5EE3A 3WMGA 1E1QA 1OHHA 2HJGA 3LRPA 4A4DA 1N0UA 1FOEB 5LB2A 1L4YA 1ZCAA 3I4LA 4ZKEA 4PO1A 2A2ZA 4FWTA 4JIMA 4LUCA 3D7MA 2WAXA 4KU4A 5FH9A 2ZRBA 3W3ZB 4NH0A 3Q7PA 4QGFA 3GJXC 5JRJA 3QE0A 3R8FA 2ONKA 4MGYR 2HJVA 2QRNA 5B64A 1G3QA 1JQLB 4JLDA 4D4LA 4DCUA 2GXQA 4WAUA 4URWR 2CL6X 4LC0A 1VDZA 1E4YA 5FI0B 1EFUA 2Q0HA 2C99A 5BN3A 2GK7A 3EA5A 3CF2A 3MWKA 1ELOA 5BXQC 1W7AA 1XD2A 2P67A 5FUXA 4DEXA 5CB6A 3QQ5A 1EK0A 4U00A 2XSZA 4M1OA 3AV0B 1M7HA 3FFAA 4W5WA 5K8UA 5BN5A 4YMTA 3U60B 3LLUA 3NXSA 1W36B 1E9DA 1XTJA 2BBSA 2ZSAA 3O8BA 4B73A 2PMDA 1HUQA 3AH8A 3B1YA 3SN6A 4HYYA 1XBTA 4NPHA 3R9WA 2QA5A 3PUYA 4NKRA 2GJSA 2XITA 5IDVA 4QNMA 2F1HA 5D3MB 3KB2A 5DISB 3FHCB 1XD8A 1GSIA 4UKDA 1YZGA 4DC9A 2XB2A 2ZRPA 2ZUBA 1XMIA 1RRCA 2QGNA 2ZI3A 4C3ZA 2AWNA 5A4JA 1L7VC 3WP0A 4OQNA 3EC1A 4TLEA 621PA 2DR3A 2ZJYA 4TYNA 2XAUA 3CPHA 1J8MF 2ZVQX 3LQRA 2ANCA 1W4RA 1DVRA 1Z08A 3BFKA 3MWJA 2VP6A 4O25A 1RRFA 4IOKA 4IOJA 3BC1A 3IPYA 4QM7A 3CNNA 1D9XA 2BKUA 4S35A 4TTQA 5FUVA 3NDBB 1YZNA 3BB4A 1OPXA 1OSNA 2NQ2C 4HATA 4I4LA 4B2LA 3QJYA 3LH5A 3KFXA 2R9VA 4AI6A 3CX7A 4LCBA 4KITB 2ODBA 2ZJ5A 3GMTA 3LW7A 2FN4A 3LDAA 1NI3A 2ZRAA 2WIAA 2R2AA 1LV7A 1FUKA 2NO9A 1Q57A 1G7RA 4Q1BA 3K0FB 3EWSA 1R7RA 1XXHB 3KXLA 5CDFA 5EQTA 5FPKA 1KSFX 1X8LA 4Q1CA 4PO8A 1N0WA 4D25A 3KL4A 1IN5A 1GVNB 1Z5ZA 4TZ6A 2AL7A 4QFMA 3PVSA 1US8B 4WXPA 2BBOA 1E94E 3QXXA 3QXCA 1NN1A 1Q22A 2YJTD 2YOGA 1OXXK 4JT2A 3GLGE 5JEEA 5SZHB 4OK3A 4A92A 3THWA 2Y8EA 1NMXA 4BPBA 2W6ID 1Y3AA 4TLCA 1TF2A 3P1JA 5DHFA 4TL6A 4Q00A 4AURA 3EPLA 1CRPA 2GXAA 1GKIA 4F4JA 3IHLA 3I72A 4EFNA 2QPOA 3NG1A 3PUXA 4LYFA 4NCNA 4C2TA 1KI6A 4XSHA 3QKUA 3AVXA 1SKYE 1OE0A 1JAHA 2GA8A 4G3XA 4KXFB 3A36A 1Z63A 3D8BA 2VYFA 3IGFA 2ZJ2A 1KI9A 4PC7A 2OBNA 1DPFA 1OXVA
chains in the Genus database with same CATH superfamily
2BDEA 1ZD3A 5DI3A 5K8JB 2GN8A 1O97C 1U0RA 4C7OB 4JOSA 1L7AA 4DJTA 4PZUA 3OE4A 1JG1A 4HJRA 2IYUA 2JCBA 4J8PA 2FW7A 3V2IA 1JEYA 1C80A 5FEMA 2WTMA 2G4VA 1X8XA 1DIHA 3ESYA 5BSTA 2OBLA 1DJNA 2QMQA 4FM9A 1GIAA 3H5IA 2X7XA 3R41A 2KSQA 2WDZA 5LB4A 2ZE8A 2V7QD 4EATA 1W8DA 1IWBB 1SNYA 2CNWD 2RC5A 5L3RA 5IAAA 4U7TB 4Y9RA 3WS7A 3AHJA 2DM6A 3CNQS 3D2LA 1HBJA 1ZN2A 2YN4A 1ACJA 2R1UA 4I50F 4XM0A 1X92A 4A9AA 4DEVA 4HVCA 4LRUA 5IARA 4AZ3A 2WWFA 1QDEA 1QX4A 1VI5A 2X2FA 3NT2A 2G9QA 4W7SA 5CR9A 3CLSC 8ABPA 1RQLA 4ZEWA 3VUFA 1ZU4A 2BV3A 3KKMA 3M89A 4MPPA 5CCEA 5H83A 2WNHA 2X1HA 2CB0A 2BZSA 4L15A 1V3UA 4IF6A 4KDCA 2GB4A 3QPBA 1KWGA 5AQ1A 2QV0A 1UQUA 2O1WA 3GARA 3BEOA 5CURA 4CM8B 3HCWA 2W42A 3BXOA 3RUCA 1FL9A 1W0JD 4V0NA 3ICOA 4A82A 1XTPA 3S7ZA 4PICA 4X7MA 3Q15C 2MU1A 1UPBA 4L1KA 1ZW1A 2XLBA 3F3YA 4JXJA 4BYGA 3JV7A 1TUGA 3RS7A 1USGA 3KDPA 4KFCA 1Y8ZA 6GPBA 2BCEA 5B53A 4IQFA 1T5SA 4ZALA 4LF7B 2ZUFA 2Z2XA 5BR7A 3QXJA 3D8SA 3HU5A 1NW7A 1OU4A 4NZNA 2B2NA 4YIKA 5FL7A 1HORA 2GN1A 5EUQB 4C0LA 4PYJA 3O4HA 5CJJA 5KJ6A 5E2AA 3QIAA 5EEHA 3J81A 2JNWA 2R5FA 5HF6A 3NYQA 1JSXA 1VE9A 2OKCA 2ZBEA 5SZIA 1KU0A 2Y1KA 4NU6A 1IAVA 1ZJYA 3E23A 3AONB 2IYWA 3KSMA 1JHYA 1RRKA 5PNTA 3VAAA 1XQ1A 5KU1A 2DP4E 2NPOA 3AG6A 3A9VA 4RSHA 4G0NA 2DX7A 2LCIA 2MINB 3PQEA 3HBNA 2A4MA 2VJOA 2Z57A 4ZDJA 4WWHA 1L3BA 1NSFA 2ERYA 4PRZA 3UG6A 4RXMA 4EVRA 1ISPA 1IRIA 3NW9A 4HGPA 5ECDA 3H2JA 4BVAA 1EWKA 4C01A 1ST2A 2E4AA 3GH3A 3A7DA 4NLLA 4N5LA 4P5PA 3RC2A 1LS1A 3C8UA 2ZJ8A 3JYHA 5IEBA 4ZYZA 5KYKA 3UGJA 1WP9A 2PH7A 4X54A 1E1LA 3SBEA 1NRXA 2VRBA 4A2QA 4P0TA 3L7JA 4JA2A 3VKGA 5TPWB 3RC9A 4AKEA 2VWQA 2E82A 3W4KA 1MJHA 3M9WA 4FVTA 2PUJA 3CX8A 1Q77A 4V38A 5DHQA 4V0LA 1FW8A 5ER9A 1XMVA 4PCUA 4ENUA 1G2IA 1LLUA 4FQ5A 4HS9A 4Q9IA 4QASA 3O0TA 4U8GA 4K88A 5T4HA 1ENPA 3ZDXB 3K32A 1V1RB 3ZKWA 4I4TA 4Q3CA 1HK7A 2OBYA 1YR7A 3HE3A 4FUTA 1I14A 5AOVA 3UQYS 1ZH8A 3P9YA 1JFVA 5E3JA 4R9SA 3DOHA 2A9KA 4ABTA 3KLNA 3ONEA 5ADVA 2Q2OA 5B4VA 1A1SA 4NX2A 1BFKA 1NBME 1VGVA 4DJAA 1P5RA 4LHYA 3D3WA 1L0BA 1NVWQ 1GZ5A 4QIHA 2PUFA 2ZKIA 3I53A 3S1AB 3SEFA 1Q14A 3L7OA 3Q6IA 4JBIA 2FVYA 3WAJA 3GUUA 4E94A 3T7IA 1GZSA 1U9YA 3VI4B 3QK7A 4E1AA 7REQB 2QX8A 1U1FA 3U81A 5AKHA 4UOQA 3SM3A 4YJ3A 1T8YA 3SOZA 3AJEA 2ZRQA 2RC6A 1XZLA 1T6YA 2VYND 1YDGA 4TXNA 5KNBD 1US8A 3TSAA 4UHJA 3SXUA 1XQYA 5AK5A 4ZCQA 1NVGA 1FDIA 4K9PA 5EJ9A 1T43A 4NZOA 1MMFB 3RC7A 5U1PA 2LDBA 1Q20A 2Q99A 3KQTA 3KXPA 2QROA 3GUHA 2BPOA 4JVNA 2IYTA 1SH7A 4ZT6A 1SJ9A 4PPGA 3T7KA 4QVIA 4KHPB 2QMUA 1W1UA 1L5VA 3MCWA 5KWVA 2JGLA 3O4VA 4DV6B 9MHTA 1B8VA 5CBKA 3I9JA 1XD2B 1E3WA 3EG5A 5K4AA 1Y5IA 2RAPA 3H16A 3PJDA 1NVUQ 3E35A 2JJ2A 5JMOA 1R0XA 3Q2IA 2RHGB 4HNGA 4TUYB 1OA1A 1ZYUA 3NEAA 5G02A 2IYSA 3I23A 1PZFA 2B1RA 2GXUA 1EA7A 5GZ3A 2XYQA 1YACA 3EULA 1FSFA 4KQ9A 4P5DA 4DQ0A 4QTUB 4I19A 3CN7A 4TS1A 3T4EA 1WU7A 2Q0QA 3G49A 2CNNA 5CVUA 4KMOA 2H1VA 4LY0A 3RJTA 1H1LB 3GPBA 4G4JA 3CTPA 4R2IA 2A35A 3P9XA 4TYMA 1W36C 2QX6A 3MCVA 2ACKA 4JR1A 4GR5A 3WAKA 3KZOA 1XROA 2OQVA 4B8YA 4PG8A 2B4YA 5ESRA 1BDJA 1DAEA 2IYZA 3KTFA 3JR3A 4FGKA 2WSYB 1YJCA 4BO0A 2XBUA 1RR6A 2IWRA 2XGOA 2AD1A 1OUMA 1WHSA 4GZ6A 4ER6A 1BS1A 1TU4A 2Z8YM 1MOZA 1PT8A 3CVYA 2Z43A 3L6EA 1ISSA 3HYSA 4LC9A 2G76A 3D6HA 3BUSA 1PR6A 4B3JA 4Y1EA 3DW3X 2VZ8A 3LCCA 4GUDA 2PYZA 1QO9A 3NOQA 4JGIA 3OFND 4TL7A 4EKIA 4FFDA 1WW8A 3GVPA 3GLFE 2H4ZA 5AI0A 3L01A 4ID3A 4OGLA 4R9UC 4HWGA 2IY8A 4WUTA 4JL6A 1CP2A 2WD9A 4K8OA 2FG5A 4MUGA 4OMCA 4CKXA 4JYCA 3WWPA 3WOHA 3U40A 3W5HA 4AQYB 1OPRA 1H22A 2LKCA 3U48A 3ZE6A 2HGZA 5HKOA 3HS3A 2PSFA 3N8NA 1SBCA 4CN8A 2PPVA 1L6IA 1U0SY 3DAFA 4P7FA 1XB2A 1P77A 3F98A 4ECAA 3DEAA 2DLCX 3ZHVA 1TQ2A 3WRXA 3ZVKA 5FTJA 4TYYA 4UVIA 4HB3A 1X80A 1CFJA 2J0SA 1WBJB 2EQ5A 3PE4A 2XRZA 1A9PA 3HJUA 4PYMA 3G1WA 1U80A 2VF7A 5B6IA 2YKGA 4XWWA 4F56A 2BFPA 2FSSA 4GECA 2FX2A 4QOIA 3D1VA 2VJMA 1KEPA 2FYTA 2HPAA 1MPXA 1A8HA 1JMKC 4JGBA 3AFGA 5KZMB 3OWHA 3THOA 1P9NA 5ITZA 4MHTA 1T9HA 2WVHA 1GTMA 4Y98A 5H7XA 4DMKA 2BJWA 3C1UA 2FEKA 5M29A 3ABRB 5L6LB 2B8JA 1XQ6A 2H1OA 1V4BA 3SICE 5K20A 4IXNA 2NV0A 1X9HA 5HPYB 4G1EB 1ONBA 1XC7A 1LU9A 4RHXA 2X86A 1KI3A 4AWBA 4C6HA 2B82A 1S2MA 4BB6A 2B34A 5J4KA 3OZEA 5KTKA 4Z53A 2VHJA 5ILOA 2HBQA 1FZQA 2BFMA 4R40A 1RXIA 3DB2A 1Q2XA 1X1SA 2ZSIA 2LNDA 3K9GA 3VYWA 4EH1A 3Q8MA 4HDRA 3EA0A 3EXHA 1A8IA 3UWMA 4FLEA 1OWNA 3U49A 1IEQA 1UPAA 4K40A 2C03A 4AU1A 4AXXA 3IEMA 4HH0A 5F73A 2PBRA 1R9GA 3ZY2A 1J00A 4GE3A 3Q85A 4OGGA 5DIFA 3ZJ5A 5HFAA 4Y0VA 2O6LA 4ZVQA 5JU6A 2GZHA 4GGOA 3ZWDA 3ZX5A 3S1LA 4F5ZA 4LK2A 4Q4JA 2UUPA 4OUKX 4OXXA 1R5OA 1XUOA 1YR1A 4GS5A 2ZAOA 4NDNE 4YDRA 3AR6A 5AK4A 1NR5A 1U5BB 5TGDA 2FJUA 4EY5A 5AOAA 5BUQA 3CONA 4QGGA 3ISTA 2NAFA 1Z56C 3OE5A 2HA5A 5FXMA 4XWOA 1OYOA 4M0PA 4MPDA 2O1SA 4RL6A 1IJKA 1DU4A 3F6EX 4RVOA 3V46A 2QBYA 4DFDA 3UV7A 5A06A 2BCJQ 3G85A 3MTJA 4FYHA 1ZU5A 2HU5A 2NO1A 2P9GA 2Y1XA 4JELA 5E2BA 1THMA 2GZ2A 4G65A 4ALLA 4EHLA 2DQSA 5KNDA 5BSEA 1J8QA 3CEJA 1I2BA 2R1VB 2OSBA 2AXPA 3D1LA 4ITRC 5DCLA 5EZ5A 4J4BA 2PUDA 4GSLA 5IBPA 3U3MA 4CU2A 2JLRA 1DC5A 2QQFA 2MSNA 3DMPA 1TZJA 3A4LA 4KYIB 3K31A 3DO5A 4B6GA 3KM0A 4FFOA 3LS2A 1Q1BA 2Y0BA 1K89A 1DT5A 4X60A 2ZVDA 5GJWC 1NMQA 1ZD4A 1E32A 2H7XA 2R6HA 3E53A 3GEHA 3ORYA 3I32A 1Z73A 1PF7E 4F9FA 4G0VA 3KIPA 1Q91A 2O3UA 2FZ4A 3CO5A 1EIWA 3K5WA 3JW8A 4GLJA 4YAWA 4UTRA 4UMVA 4KJZA 5T6BA 3RS2A 3BT7A 1V7PC 1NYQA 4M8SA 3ZWCA 3BOSA 5H81A 3FGOA 4IHAA 2AXNA 4RVHA 5L7TA 1C30A 2XJ9A 5ALEA 1OW3B 3DEFA 3E7PA 2ZUEA 4ME6A 1VMAA 1XTQA 2QE7D 3HEMA 3KELA 3NEYA 4OSPA 1A5BB 2UYQA 4JCCA 5EYPB 4DDWA 4EGFA 1VSTA 2DULA 4OHVA 3KJIA 4REQA 3I1YA 5D3ZA 2CSXA 1SCJA 1FYXA 1Q3HA 4JLPA 1HLDA 5JOQA 5AP9A 1WB4A 3N05A 2HPZA 2PUAA 1AS3A 2AV6A 3OPVA 1QNLA 4JSRA 4XFDA 4LWQA 1F0YA 1K8ZB 4G1FA 3PDIB 3SE0A 5K0SA 1XNQB 3LQ2A 3NHLA 4G4SP 3WL7A 1BDBA 1QO0D 1YMVA 4EQ6B 3SDBA 3SS9X 2IHJA 4MUYA 3K0HA 5JJLA 1XFDA 3EGVA 4RTLA 1M0EA 2I4OA 3Q87B 1F3OA 5CX1A 3AJRA 3OP1A 4IOMA 5EGSA 1JQBA 3WQBA 4RD1A 3BTOA 1QFSA 1XTBA 2UZ1A 1KEVA 3COPA 4JLKA 1C2YA 3GGGA 3UUWA 3IC5A 1JG4A 2DSTA 3TTUA 1JKJB 2XUDA 2MTBA 3EZYA 4QEZA 3VKVA 1W94A 2OM6A 1VYVA 3QG1A 3WGHA 1KY3A 1L7BA 3VR2A 1I8TA 1F9AA 1YB1A 2R4UA 2RGDA 2XX3A 1KQNA 7ADHA 3COSA 3FYHA 1PZGA 2WVAA 5AW1A 3IBYA 3L0OA 3TRIA 3IBTA 4V0MA 1VZ3A 2HHAA 4XX1A 1XAGA 4KO1S 1Y7PA 3I30X 1TZCA 2FSHA 5EHQA 4GX0A 1JAZA 2I4LA 2XYVA 4A0HA 2CLKB 4UNQA 4ARAA 1RBMA 4HZGA 2CYBA 4OSOA 2IDMA 4H1HA 3UMJA 3P9PA 1H1TA 4RABA 4WCFA 1P31A 4LSZA 4G0ZA 4Y7CA 3U19A 3K9CA 1D04A 1BOFA 1WNTA 1EX9A 3V9PA 3VJMA 1G60A 1QHSA 3V5NA 1F2DA 2XMRA 1E4VA 1TJ5A 1XZ8A 3EBLA 4PZDA 3NHZA 2IXFA 4D8VA 1XLVA 1VCNA 3H3JA 4M37A 1DQPA 3NFYA 4HFNA 3NXKA 3FNRA 3IB6A 3K2QA 3NPAA 4KK3A 1ODTC 3U1BA 1GITA 3WRYA 2Q07A 4K81B 3HJGA 4BFSA 2BW0A 2Q2NA 4ZO7A 4KH0A 1FIUA 4AZ0A 2A9OA 3L7KA 4FYYA 2CFIA 5CUQA 2XQKA 4QLOA 3TK1A 1U2EA 2Q5JA 1BJTA 4IDCA 2QSYA 4DB4A 4JLBA 1TYCA 1X7GA 3RYFB 1K7XB 1KBZA 4B3MB 1QH0A 1D2MA 3K5IA 3MJSA 1C5KA 1OGIA 2JJYA 3WYBA 3P2YA 5BUZA 3IL2A 1TM1E 5CT5A 3ICQB 2LVBA 4FWBA 2QOEA 2D5IA 3M2PA 3FHOA 1T3HA 2F8MA 2C4HA 1VL1A 5GOTA 3G5AA 1E60A 4UTXA 2FR8A 4P81A 2ORYA 4RZUA 1BQEA 4KQFA 3TOCA 3IUQA 4U7PB 1DBSA 1YDHA 3IAXA 2XE4A 4JSTA 3MRTA 1K5PA 2EEZA 1DQSA 1JKJA 4FB5A 4KXNA 2IHKA 3FROA 1UBJS 1ABFA 1N8TA 3F49S 5KO2A 1QHYA 3IPCA 4AMZA 2WD7A 1P7CA 4CXMA 3VR4D 3QVSA 1KFBB 3M3DA 1VMDA 4X3PA 3VX3A 2DBYA 1OIVA 3DMTA 4XPIA 4HP8A 1LTHR 1Z7YA 2EDAA 5JS8A 1DOAA 1QH9A 4TWZA 3DEJA 1JEAA 3EXG1 5ALYA 1NW9B 1QDLB 1G98A 4HQ0A 2P9EA 3E7FA 4HN2A 4M1EA 2V5AA 3MTGA 3MOIA 4JI8B 2O5CA 2J9ZB 3TOVA 2ZIGA 4YYEA 4HRVA 1TU0A 4J3NA 5EINA 5TMEA 3TLYA 1M6EX 3TMAA 5H8WA 1ZISA 2R66A 1ZMOA 3A4YA 3TZKA 3O26A 3V4OA 5I3CA 2FW9A 4LRTB 2O4UX 3KOZA 4JDPA 3VPXA 1OH5A 2P78A 3DLAA 2RGXA 1NLUA 3V3TA 1FFEA 1XCOA 2OWEA 2D2EA 3AF1A 5D7BA 3TF5A 2JHGA 2B0JA 2YCBA 2YN0A 1PK8A 1QPGA 1TA9A 4WZ6A 2ZYUX 2SECE 5F5LA 1PBTA 3CUWA 4L3VA 4YP6A 3PYLA 4JP2A 3YASA 1FQWA 4AIIA 3UJ7A 3HKBB 4C4RA 3ID6C 3RBVA 4Q48A 1G59A 5EZYB 3L7MA 2HCJB 3PFCA 5SICE 2Q46A 1SUFA 3R3WA 3X2SA 5A9SB 4R1TA 1S5PA 2ZSEA 2J33A 3A2KA 3VO2A 5I01A 4IG9A 4D3YA 3R5FA 3GEDA 1M0TA 2I87A 3LQYA 3Q4GA 4BGVA 3URMA 4JVLA 1EDOA 3VNAA 1TOAA 2ZSHA 4BIIA 4R7GA 1Z6AA 2RHJA 2W22A 3UC9A 2RCNA 4N9WA 4IZ6A 2Q8PA 4GFDA 3RDPA 1QRAA 4TKMA 3RUAA 1YDWA 2C9DA 1G5PA 4MUNA 1A2QA 3B60A 4K9NA 3VU0A 2R7KA 1PGQA 1LK5A 5K7SA 2AN5A 4EARA 1P5HA 1CQJA 1ENYA 5LMCA 5EEGA 5LDHA 3LBNA 1WB9A 2I76A 1W34A 1Y8AA 3D2CA 1RYNA 3FUWA 1Q3TA 4O4IF 1X7WA 2PT9A 1DX4A 4N03A 4WZAB 4KPEC 4MAAA 4LE2A 4OJTA 3HA5A 5EZQA 3TSWA 1Q0SA 3AHHA 1TQ8A 1TJPB 4W9RA 4P3YA 3ZDYB 4D6PA 4EUKA 3HB9A 4PZCA 4L4UA 3LCUA 2B36A 4PCLA 3A37A 5JYBA 5MN5A 1U63A 3K5HA 2NPIA 5B7NA 5BNIA 1X7XA 4NV0A 5JECA 1BXRA 1ZC3A 4KE7A 4RIEA 3V2GA 3QVJA 1DDGA 1OF1A 4NS4A 4HNSA 1MJ5A 1JMVA 4CKCB 1Y6FA 1P33A 2BEJA 3E18A 3NO4A 1THTA 1K3TA 4O6VA 2YYZA 3FM9A 2F43A 3ZH2A 1OZHA 4B3FX 1L7QA 1C1XA 1O57A 1V3TA 2QDXA 2ZITA 2EP8A 3GUYA 3DBLB 5TPWA 5DX0A 1MC1A 1C4XA 4I1UA 4H7FA 4EABA 4TVSA 1CXZA 3QE9Y 1K7EB 1ZUIA 2R96A 5BN4B 2CBGA 4JI0B 1QRDA 1NQTA 4G41A 1GNRA 3ILHA 1PP4A 1UADA 2NYAA 4BE4A 4EPTA 4BNWA 4C07A 5CFOA 4IKPA 1X7YA 3FYCA 1SBYA 1G4UR 1QHHB 4R2LA 1VIMA 3PUVA 3JYOA 2X0RA 3QXSA 3KALA 1ZD8A 2H0QA 4AKSA 3NHYA 1KQPA 1P3DA 5T41A 3D0OA 3RAEC 1M1ZA 4YRQA 2PWZA 4ZAYA 1TGYA 1NC3A 1N0HA 1K9SA 1R4AA 4IP0A 3CGGA 4O2AA 1BGXT 4PRLA 4MI1A 2A9VA 1CPYA 2GYYA 4U5XA 3N74A 4I5EA 3DFFA 4QU8A 5D85A 1KZGB 2WKSA 5TVGA 4E5PA 1QVAA 1MX3A 2P8SA 4M7WA 4F0JA 3ZDAA 1TAGA 1IHPA 3O94A 3O3OB 2REQB 2QTMA 4BP9A 2NWQA 1TMGE 4Q05A 5AKXA 4BLUA 5I48A 1GJRA 4CLHA 1BYUA 1P4JA 4UBLA 4CHTA 3TNDA 2O6HA 3IURA 1OCEA 3PPVA 3LGAA 4FW9A 1XZKA 3DF9A 4MW9A 4Y9SA 1Z06A 4MGHA 3TOSA 4DRZA 1KZ6A 1M33A 2OILA 3IOMA 2ZRKA 3RS3A 1RPZA 2EVWX 2JLVA 1RXWA 1CEYA 4CDGA 3MSCA 1FUIA 2A33A 4MWTA 4ECEA 3NUGA 3ETDA 3NAZA 1DAGA 4QRHA 3IBGA 2OO7A 2MR5A 1ZMTA 2FGJA 4DUPA 1Z4OA 1E2FA 3K0FA 2JEZA 1Z9BA 2W6IA 1MO3A 1IXZA 1UODA 2BRUC 2VF8A 1BS2A 3AGPA 3EZLA 3PQCA 5EP2A 3FOZA 1MJNA 3GLHA 4MV7A 1XLTA 1KBQA 1Z15A 1GDTA 4KRFA 4DRXB 2WJ3A 1T0PA 3OUTA 3GVXA 1YZHA 1QDUA 2EX1A 1UK8A 4LW8A 4K9MA 2O8CB 5EZSA 3EY9A 2Q4OA 4YR7A 2HSGA 4CKEB 1E20A 4E5NA 1JQKA 4INZA 4YP7A 1JMYA 2YZGA 1T6NA 1RJWA 3ODPA 1QK4A 4F1JA 4GGPA 1JWLA 3LT0A 2CDNA 2OT3B 3FPLA 2AI1A 4QRDA 3IJEB 2QD5A 4QSMA 4R5MA 2JH3A 3SFZA 3AM3A 2D06A 4ZOAA 3LK7A 4AX4A 2WWWA 2OV8A 3I9MA 1K7CA 1TEXA 3ICWA 3KLBA 1BMFD 2HSJA 1ZRHA 3FTFA 2CVQA 1JZTA 4KDFA 1DC8A 1X38A 3G8CA 3H0KA 4IO1A 1EM8B 2QR5A 4NYJQ 5C4GB 1EP1B 3KKZA 5ITVA 4KRXA 1SB9A 4FT4A 3MJVA 3FWNA 4Y6PA 1KAMA 5DF1A 1D7OA 1L4UA 2ZYGA 4FUQA 4RKFA 1ULAA 3UMFA 5K0JA 4CM9A 1TAUA 1IN7A 1W4CA 3DYBA 4O63O 3KOUA 2DT8A 4ZT5A 2ZZKA 1T3SA 2PSDA 3BWDD 3DLCA 4G0PA 2PGDA 4KWCA 5K8IA 1FX0A 2MSDB 4J6EA 4JT9A 4QD3A 4ZRDA 4YRMA 3AIOA 1R27A 4N39A 4C87A 1SXPA 2ZJAA 2C96A 4UE3S 3JWHA 4N18A 3C1AA 2HHJA 4AZ0B 1AQYA 5ICMA 1WW3A 3VZDA 1RDFA 1SKQA 4D97A 3I2KA 1I4DD 5FLEX 2WD8A 5CB4A 1QIGA 3BK2A 3IIMA 4FD2A 5EJ4A 3VPGA 4KFSA 1Y8RA 2Y76A 4BTEA 1FFCA 5CNMA 3FOFC 4FI3F 3LUDA 3OE1A 3A3OA 4KQIA 1OXMA 1H6AA 1K63A 2C7PA 1T9KA 2I2CA 4UTZA 2VSNA 1Q6ZA 5L3ZA 3ZWNA 4FNMA 4LSGA 4CLRB 2ZWPA 2ODPA 4KXLA 3OO0A 3S81A 2W9XA 2A67A 1USVA 2RGBA 2A5YB 4DXHA 1G1AA 1WDMA 1AK9A 3OLWA 4GL4A 2D0OB 2YNMD 4UNNA 1BE6A 3MFQA 2OHIA 3ONNA 4G2TA 2ZBPA 1VE6A 4FE4A 4NCHA 4RAQA 5HQJA 3S6JA 4BJHB 4EW2A 2WSSD 2YV4A 5HRUA 4G4IA 3UGQA 4ZANA 4GOND 1POXA 1X94A 2H5LA 5BSUA 1B0PA 3REOA 2WD7B 1F7VA 1TIPA 1A4IA 2H59A 5EIHA 4WPGA 1F1JA 4AZTA 1C0KA 2O5VA 4M1TA 3W3AH 2C4NA 1JEEA 2GRAA 2ATCA 2IY7A 2D8MA 4HLDA 4NNPA 3RFVA 4Q15A 4BKRA 5I4KA 1L4NA 3TFQA 4PQFA 1P45A 3AFMA 1JYEA 1UF9A 3KQPA 3M6UA 2GTHA 2JI7A 3DE7X 4NOKA 1DXQA 5F4BA 4DWVA 4UFPA 4OXRA 2PE5A 5CA0A 1YFJA 1RRGA 3NJ4A 2G36A 3P19A 2UYOA 1WXXA 2DT5A 4KGDA 5JCXA 1WBDA 1R0CA 2JKVA 4BDSA 1EXMA 1Y81A 5JSFA 2XGJA 4M0MA 3SAJA 4EFLA 4DLXA 5B1EA 2CMFA 2HN9A 3N3BC 1TLLA 4G5XA 3KXIA 3EG9A 4G67A 2IZ5A 4P58A 3FGNA 2OYCA 4HCJA 5D1HA 1W93A 4TM7A 2F3QA 1TQDA 3LBYA 4WXRA 4I9UA 1NLFA 4TLAA 2BFAA 4WK4B 4F9GA 1Z6TA 1SIOA 1OJLA 3JQFA 2V59A 2V6GA 3GDOA 4IZOA 4K46A 4LBWA 4OJKA 5FA5A 3T3IA 4B3DA 4TKVA 2V0CA 3RS0A 2VRCA 2KM1A 3KHSA 1M2OA 2WM8A 4HT3B 3L5KA 2JA2A 1GDDA 2O50A 3LW8A 1D4ZA 1NQWA 1W59A 4H6PA 4M8LA 4R3UC 4WKBA 4F86A 4HNTA 4BXOA 4UZFA 1MB0A 4DR3B 3AY6A 3SFVA 4B84A 4W5HA 2OCLA 3A3NA 1GG5A 3V4VB 4TQAA 1MIHA 1X13A 4I2VA 4YHHB 4PN3A 1V1RA 3ZKWB 4LYHA 2YIDA 4HWKA 1I3OA 9LDTA 3OJWA 3NBXX 4OBEA 3IBCA 1M8FA 3IO3A 4XDGA 4BX9A 1JI3A 3OEWA 3PGKA 2EZ8A 2C88A 3LUJA 1E1CA 3WK7A 5AUOB 2WBLC 3RUFA 1VMEA 1GKKA 3BCHA 3R8XA 4GP9A 1GQOA 1NBIA 4DQKA 5EIXA 3P45A 4AMVA 2XWQA 2HUPA 4OHPA 1NMSA 5FA8A 3V6MA 2PKQP 2H1LA 3UMVA 1GPWB 2HFJA 2PU7A 2EJWA 4OP1A 3CF0A 4ZDKA 4HLCA 5KX5B 5L4SA 2Q6KA 1H9BA 1G291 1ZD1A 3KZ1E 3BK1A 3G5LA 1QIDA 2IIPA 2RBGA 1C30B 3WLFA 4ZVOA 2W2TA 4B7XA 2Q62A 3M5DA 1UFQA 2HT6A 3W0LB 4DTIA 3W1EA 1LK0A 2FEAA 4F1WA 1KRWA 1FA9A 1YOVA 2W6NA 3B1JA 4I50B 1JEYB 5HKLA 1N4AA 2ADOA 3HHPA 2P2LA 3DUWA 1L5HB 3GEEA 2ZI7A 3CUKA 2G5GX 1E64A 4JX9A 4ER7A 4UEQA 2D59A 2B94A 4FCTA 4L6CA 1EJBA 1K9VF 1EU1A 3AY0A 3LUPA 4GZLA 3I2HA 5KSYA 1B6GA 3I39X 1GQYA 4E5KA 4P84A 1LPPA 1TVMA 4KV9A 4DY4A 3O8RA 1PFWA 1UZAA 3PNLA 4OVKA 1YVUA 4KYUA 4LMPA 4PGAA 1PQWA 2HA3A 4BFLA 2D6FA 3MWFA 5A5EA 2BIFA 3IEUA 5JNTA 2YFQA 4H0NA 4NPAA 2GEFA 5JQGB 3KK0A 1F4PA 1IY1A 1WCYA 1ZSVA 3NHBA 4JC5A 4TVKA 8MHTA 2ZWOA 2BUAA 4YQEA 1Q16A 5DTIA 4DBZA 3AF4A 1FDSA 3HKEB 4BX2A 2COUA 1IC6A 1BA3A 4AW9A 3ES9A 4GD3Q 1XEXA 3PC6A 4QPNA 3T54A 2JCGA 2C3YA 2EJTA 3MQ2A 3RAGA 4B83A 4D0LB 5FUMA 4KR6A 3CIFA 1HT1E 3DKVA 2BI8A 4JJEA 2HWWA 2WIGA 4YCMA 3L8DA 4EHHA 5LZ4A 1DIGA 3OQIB 4IIJA 1L6RA 2VN8A 1NDUA 1CC1S 2PNJA 5B1YA 3BMQB 1VPLA 3DG9A 4A8JC 2XMSA 4XGNA 1DQRA 4Y2TA 4JXZA 3SKVA 1E98A 4MR9A 2O2DA 5K3OA 4K05A 2XUFA 1U5AA 4JL8A 3PEFA 1F8XA 1U3CA 4RZHA 5D84A 3SJZA 4ZQFA 2ACVA 4RL4A 2HCBA 3ROZA 3TTYA 1ZINA 3K8OE 3DE5X 2CLIB 1ECGA 4LAFA 1KZ7B 1WQ4A 4IH4A 1NZDA 5LA6B 3ZE2B 3ZCPA 3T5AA 3ZHOA 3ZHUA 2PKQO 1NHGA 4TTAA 1J9EA 4JYZA 1B1CA 5DMXA 5JQGF 2H2FA 2ETXA 2PT7A 4TTJA 4B8WA 2WILA 3H9QA 4QKQA 4X64B 1KVTA 3EB9A 4A26A 2WAAA 2GCNA 2JJMA 2ZATA 5LYJA 4ETWA 2HLNA 1SR8A 1L5ZA 1MTOA 2AFIE 3PFIA 4LSWA 4BFVA 2AKYA 1NVAA 2W8BB 4NR0A 4CQNA 1X7DA 4BTLA 2JB9A 4H0CA 3OPQA 1VHTA 2ECOA 3EVBA 2HK7A 3ZU4A 2ZXEA 4TTRA 5KSZA 1VA5A 5BNTA 2BEWA 3HVJA 1QG6A 1Z8DA 3P0HA 4KQEA 5DPMA 4NFSA 3C5CA 3CNHA 4ENTA 4TMFA 3QVOA 3KQMA 3T1YB 3L6UA 3AM5A 3TR5A 3NDIA 3JXEA 2FLKA 3E1KA 2X9LA 3SCZA 4B4DA 5L3VA 3U39A 2JLZA 2YIMA 1VHDA 1FFXA 3K05A 4TTVA 4EHJA 2AEJA 1RFGE 1XEXB 4YXWA 1JTEA 3HU3A 4LNUB 3T61A 1C7ZA 1TW2A 2AKAB 3DFZA 5HF5A 4UJ3A 3NGXA 2GESA 4BLVA 2JFNA 1SIBE 4FFSA 1TKCA 3EFEA 3EPHA 3B51X 1ECFA 1KEWA 4MMZB 3FNEA 3F6PA 1KAEA 3BMQA 4LOKA 1S2LA 4MIKA 4CNQA 2ZI9A 3USES 8ADHA 2HNKA 1J42A 4GI7A 5DNDA 4N76A 2H7VA 1K2WA 4JBXA 1L5SA 4WK2B 3KQLA 3RREA 1BD3A 4I9FA 2EHDA 5M3BA 4E5UA 4RPKA 1Z4NA 3G9XA 4BKUA 1G42A 1QP8A 3ZZMA 1SU8A 3OLXA 4M0FA 2ZJ1A 3GMIA 2GCGA 2O19A 2QAGB 4AJ2A 2FFJA 4L73A 2DJIA 3AF5A 3PGA1 4M0LA 1XZCA 3AUSA 5GV7A 1UT5A 2RGUA 4R1UA 3TVYA 4DYDA 3LCVB 1AUOA 3KUDA 3M2TA 4R8SA 2PT6A 2PBZA 4U9IS 521PA 3WHLA 2X0FA 4CMEC 2ZJOA 4G5OA 3S2GA 2P2DA 2X0IA 4OP3A 2FZEA 3MJCA 4M1YA 4PBSA 4Y0AA 5AKEA 5KOHA 1NQUA 1CB7A 5CM8B 2Q5IA 3K53A 5GJCA 3NH6A 5TY0A 2QJWA 4UHEA 1V26A 1IQPA 3CE6A 3E5RA 3ETJA 3UAWA 3K9HA 1SUIA 3U37A 2CLLB 2VDQB 3GXOA 4MRMB 4CCAA 3WFZA 1C7EA 3PZBA 1CUJA 3WNDA 4IQGA 7ABPA 3UJDA 1C4OA 1WOMA 5BUSA 5DCUA 2GVDC 3JARA 2H2HA 1XAJA 3NTXA 4P31A 4B35A 5BPFA 3N28A 3ZE1B 3QTBA 4E31A 2ZJ3A 2E87A 4LRYA 5LZ8A 2HPHA 1S8AA 5GY7A 1F0PA 2FV8A 3TVDA 5AK6A 4O4JF 1OZ0A 2OFPA 5FCDA 1TO6A 1I4OA 4KRGA 3NDJA 2B8TA 3M5CA 4ZU3A 3SY8A 2GRJA 4BQIA 2V6IA 2JFHA 3OKCA 3L04A 1K2VN 1NSTA 1ONSA 2IXTA 3IUNA 4C21A 4CFSA 5HM6A 4KQ6A 1ECJA 5K0ZA 2OSVA 1JG6A 4S0XA 1XELA 1J22A 2B2CA 1XMJA 4TMZA 2Q5FA 2IHNA 5LQJA 2XDWA 4C6RA 2NGRA 2O54A 1JIQA 1JA1A 4BLSA 3VPSA 3MGCA 4IDQA 1TD9A 4MYCA 3LY8A 2ASVA 1FU7A 3LF1A 4EOGA 4LCEA 3VYTB 4IRXA 4IH9A 2Y1DA 3MINA 2AMYA 4IDAA 3K0AB 3CR7A 3OU7A 1U7TA 1WRBA 5C4MA 4XQEA 2EL7A 3H04A 1UEXC 1DRVA 3KVNA 4KQKA 1TYAE 4QO8A 4FFMA 3UAVA 1KQ3A 2AFHB 1SC4A 3R0XA 1DJQA 4E2XA 3BERA 1BFUA 2G7ZA 4KXUA 1D6JA 3GV0A 1SU4A 4M9QA 2JLAA 5B7PA 1NY5A 1OI7A 5C4IA 4GOKA 2H6EA 1I33A 4KK4A 3OZCA 2PUCA 4BNFA 3GDGA 4LRQA 2R6CA 1P6XA 2PKWA 2YMPA 2KS6A 2NOAA 1W88B 2ZBDA 1II0A 4B0OA 4OPMA 3PD1A 2A8YA 3Q0TA 2QHXA 4LPSA 4P33A 3O47A 2Y92A 4F6RA 2H1HA 2FPOA 4MMYB 2ET6A 3B6IA 3MT9A 3BWEA 1G4HA 2PLFA 1FRVA 1C9JA 3DL2A 4R2MA 2GD1O 1M2OB 4R84A 5H4HA 3S4YA 4C0JA 4Q3DA 4MEJA 4D9EA 1LGYA 3OD5A 2UZ1B 5H0IA 3ACCA 4GMKA 1PK7A 3T5GA 1IG3A 2BKAA 3PRJA 3JAMA 3JYLA 4WLEA 1GA4A 3FKSD 3DDHA 3OC6A 1K06A 3L8ZA 1MN6A 1JEJA 2JI6A 4QVKA 4MYHA 4C20A 4Q3EA 1CDOA 2ACEA 1OT3A 3DAYA 3KNZA 2VJPA 3RIEA 3OURA 2YOFA 3TTTA 1PVDA 3PUIA 4EO7A 2Z8XA 2LRHA 3IV9A 4ZC8A 4IILA 4IGEA 1I7NA 2Q5QA 1ISRA 2P2YA 5DM1A 3R7DA 4DG8A 4Z1MA 4B17A 2HRCA 4EGCB 2P6NA 2AIRA 1CQIB 3BWYA 5LP6A 2ODNA 4AIRA 1W2HA 2QLJA 1DIOB 4HZIA 4PO9A 2ZTUA 4QBGB 2XNHA 1Z6QA 4WOBA 4MGIR 2C9OA 4J2TA 4N8SA 4NDZA 1QMPA 2VUIB 4XR9A 5BWBA 4Y6RA 4ND8B 2FHPA 2PNFA 4MJLA 5J5AA 3KAJA 1NL3A 5HHTA 4MROA 3PG5A 1H69A 1KO4A 1QNFA 2GCIA 3R75A 4L5JA 2O3RA 4QELA 5TEWA 2AEMA 1PJLA 5GM2A 3U0BA 2MINA 3HFRA 3L3BA 1JJVA 3MWDB 3PE6A 4Z4EA 4B7CA 4ARZB 5JRZA 3ZWOA 1YQQA 5CD1A 3NVMB 3AKZA 2WK1A 1QOPB 3NBYC 5KNDH 5FOVA 1TM3E 3K0EA 1M10A 1YJ5A 4U8HA 3ZYZA 5DWQA 3C6XA 5AI9A 4BLQA 4YCCA 3VMMA 2VAWA 4BU0A 1NV9A 2C4KA 2ETVA 1Y1KE 5TT0A 2VJKA 2YV3A 4GBMA 1DBPA 1KR2A 1UJMA 2A9PA 1UWKA 2RHHA 3FCOA 3EZ7A 1XXLA 3SIWA 3V6LA 3V7YA 1YAJA 2P9CA 1XZJA 1Y1RA 2ONCA 3IE2A 2IW1A 1QGOA 3KT6A 4BB5A 1B16A 2HV9A 5F5XA 5THXA 1M7BA 1U0GA 1YKFA 1MAVA 1U2PA 4ZMRA 1H0SA 1J4AA 1DMRA 4KBGA 5BXYA 5LUAA 1J97A 4LQ4A 4AC9A 2WIBA 3BAZA 1XTTA 4GMXA 1WWKA 4R8RA 4B5LA 5BQOA 3P32A 2QEQA 5JLJA 1B23P 5IMSA 2VK1A 1C0PA 2M32A 3NWBA 4QQ8A 1V6AA