4GPZA

Crystal structure of human b type phosphoglycerate mutase h11 phosphorylated form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
242
structure length
241
Chain Sequence
b'AAYKLVLIRGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycerate mutase 1
molecule tags Isomerase, hydrolase
source organism Homo sapiens
publication title Tyr26 phosphorylation of PGAM1 provides a metabolic advantage to tumours by stabilizing the active conformation.
pubmed doi rcsb
total genus 80
structure length 241
sequence length 242
chains with identical sequence B
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4gpzA00
2DWOA 2A6PA 2H4XA 2F90A 3C7TA 2QNIA 4QIHA 3GW8A 2P6OA 4ARSA 1ND6A 2P30A 2YN0A 3D4IA 4D4JA 2WU0A 1UJCA 2P77A 1T8PA 3QPWA 1CVIA 1EBBA 4JOCA 3E9CA 3K4PA 1QWOA 2P9ZA 4JOBA 4ODIA 4PZAA 4TSRA 3HJGA 4PZ9A 4ARUA 4PGMA 1H2EA 1TIPA 3DCYA 3GP5A 4GPZA 2WNHA 1IHPA 3IT3A 3PGMA 5PGMA 3LNTA 1NT4A 3E9EA 3ZHCA 3R7AA 2A9JA 1BQ3A 1E58A 1DKNA 1RPTA 2ENWA 4ARVA 1QHFA 3D8HA 4FDUA 4D4LA 3IT0A 3NTLA 1SK8A 2PA0A 1SK9A 1K6MA 5CU7A 5AJXA 2OWDA 3QPUA 2P2YA 5AJVB 1DKQA 4MA4A 4FDTA 1QFXA 2H4ZA 2RFLA 2P9FA 3FJYA 3MXOA 4GPIB 3FDZB 1ND5A 4AROA 4IJ5A 1DKPA 5HTKA 2P79A 2DWPA 1C81A 2I1VB 1BQ4A 1SKAA 2ENUA 5AJWA 3O0TA 3F2IA 1DKLA 2HIAA 1YFKA 3IT1A 4E3WA 2P6MA 2P2ZA 3QPVA 1FBTA 5AK0A 2EKZA 3F3KA 2P75A 2AXNA 5CDHA 1V7QA 5AJYA 3FDZA 1RPAA 1XQ9A 3MBKA 5CX4A 3EOZA 1C7ZA 3LL4A 3E9DA 4IJ6A 2HHJA 4D4MA 3EZNA 1RIIA 1YJXA 3DB1A 2OWEA 4EMBA 3D6AA 2GFIA 1H2FA 4D4KA 3KKKA 2IKQA 1DKOA 2EOAA 1FZTA 3K4QA 2H52A 3OI7A 5AJZA 1C80A 4EO9A 1BIFA 3BIFA 2YN2A 2HPAA 2BIFA 2H0QA 4HBZA 2WNIA 1V37A 5HR5A 3LG2A 3IT2A 1SKBA 2P9YA 2P78A 3GP3A 3NFYA 1DKMA 1UJBA 1E59A 4JODA 2EKBA
chains in the Genus database with same CATH superfamily
1K92A 2G9QA 5B3AA 1YR1A 2W4MA 1JJFA 5K8CA 2OCDA 1ODJA 4NBKA 2BFDA 4QHYA 1XCMA 2J5KA 5K0SA 2FK7A 2Q4DA 5CLGA 1QV7A 1CRZA 2C7BA 2CNOA 2QD1A 1OAOC 4NZ9A 4QICA 3RSFA 5I7UA 4S0XA 1W7AA 1PW7A 2C0CA 2DCUA 3QNUA 2QVXX 2ZJAA 4QECA 3U3MA 4K6CA 3O90A 1XALA 2O0HA 4LUCA 3K72B 1Q44A 2OO7A 3ANNA 4R7GA 3ONNA 3X1ZA 3TZBA 2YIMA 3JATB 1Z2CA 7AT1A 1IHOA 1L6RA 1U9CA 1JNXX 3I39X 3JVEA 4YVFA 4NEQA 4MK4A 4QXQA 5D3KA 1Q11A 2AHOA 5FPPA 2H1SA 2P6NA 2G4VA 1ZM2A 2Z98A 4UZSA 3UV6A 5DCUA 5CLFA 3TUJC 5LXTB 3UUWA 3O8OB 5KOYA 1GQSA 5FNZA 5FDFA 3ABQB 3LIPA 2B1QA 4JV5B 2ERYA 1HYBA 3CPEA 4Z4GA 5EKTA 1I3KA 1V9SA 2EKPA 5E6SB 5H59A 1ILEA 4A1OA 4KO4S 1N75A 3T4XA 3QF4B 1TL7C 3GGGA 4MAAA 1P3Y1 1UMCB 5AW9A 1NVFA 3W5JA 2IYYA 3FCUB 4LWOA 1JQJC 5H81A 1MDBA 2FDXA 4RJ2A 3R7WB 3GDHA 3K9CA 4E46A 2A8YA 3IQWA 3KXIA 1RJ9A 4HEQA 4KO2S 1UJ2A 3I37X 3ZCPA 3M70A 1E1RD 3DUWA 1G5HA 1MO6A 1ZISA 2X7HA 2VHEA 2XW6A 4Q4LA 3C6KA 1YZUA 1MAVA 5HJ2A 2CBXA 4B32A 5JAMA 3ZJVA 3IE2A 3KKOA 3WWZA 1KGDA 4EDHA 3F2IA 3GOQA 5JLAA 4ABYA 1W85B 3PHLA 1OH6A 1V16B 2PQ0A 2ZTHA 2J1LA 1J7KA 2OUKA 3LCRA 5T3YA 4C7KA 5BV2P 4CM1A 5DGTA 3IJEB 4W6QA 5BO5A 5KREA 3R4VA 4IV5A 2OCAA 3OPVA 2IYWA 3LTNC 2MYNA 3K6SA 3CPHA 4JJIA 5HIKA 2Z4RA 3GFGA 3CLTD 3DZIA 1CUXA 3CF2A 3PNPA 2AN9A 4R2IA 1WXFA 4Q9HA 2MSCB 4UD6A 3ZV4A 4UE2A 1F6DA 3FVQA 3GLSA 2VSYA 3HCFA 3U81A 6ABPA 3UUEA 3THWA 3UF0A 1PQWA 1R37A 2CLEB 1TAUA 2AB0A 3MHPA 1A9TA 1C7FA 1TA9A 5ALXA 4R40A 3OT1A 4IV8A 1OLOA 2VBIA 3W9BA 2P9GA 2WI8A 2OD2A 3KPWA 3DBLB 5SZHB 1SXHA 3PPXA 3CF4G 1WAMA 1GFWA 2RK4A 5IJWA 1C80A 3WE7A 4K8OA 3GMTA 2WM2A 2JI7A 4WN3A 1FX0B 2ZDHA 2AC7A 3KR0A 2BR4A 2PAAA 4G63A 4HEHA 4DGSA 1QWSA 2RHMA 3LY7A 4ZI3A 4FE3A 5A4JA 1X1AA 5AVYA 5K3FA 1Z2AA 2JCVA 4PO9A 4CG3A 5CDSA 1ZJWA 5IAKA 1GOTA 1SU4A 4NR0A 5CJ2A 3OX3A 4AMYA 1Y1KE 2ZJBA 1M0SA 1MC1A 4U7DA 4AJ1A 5FBWB 3E3MA 5DYIA 3GPBA 1U2ZA 2V0NA 3S2ZA 4RKRA 1R0SA 2II6A 4MYCA 2R5FA 3ADDA 1I3NA 1KEEB 4HRVA 3HQ4O 3M5PA 4GVPA 4IQ0A 3K2BA 3TFQA 3KSBC 4B7AA 1ST2A 2EF1A 2F9MA 4MGZR 4RTPA 1IK4A 1BWQA 4B5KA 4ZT3A 1L4KA 1VLHA 2QJRA 4QDXA 2Z43A 1P6UA 1XTBA 4N18A 3TSOA 3AR9A 5IKEA 5ES3A 1ZKMA 1MO4A 2F3PA 1X7XB 1GGEA 3EJWA 1W87A 1SXIA 1VLLA 1I7LA 4ND5A 4PZ9A 4IFEA 5J63A 3RFCA 3N3AC 4FBLA 1Q6ZA 5A3RA 4CETA 2BF4A 2PN1A 2VIIA 5CT9A 3HRIA 4B46A 1DXYA 5JSHA 3D7LA 2JLAA 1Z5OA 1UIMA 2D5LA 2OZVA 3DNFA 2F3RA 3PF8A 4MTLA 1Z6TA 2YC4C 4QUDA 1SD1A 4H6VA 4AL4A 4B9AA 4KMSA 4QX6A 1DWOA 4WEOA 2Z3VA 3SE7A 3QKRB 3BSFA 6NULA 3NIGB 3I12A 3OEHD 1J33A 1M8KA 3AF5A 4IOKA 3Q2IA 4CTNA 3TO5A 4BNUA 1CP3A 3OT5A 4H60A 2ZTSA 1LRKA 4GC9A 4LZPA 4R0VA 5SY6A 2RJNA 4QG3A 3CUUA 5CM8B 4FBMA 3ZV6A 1O08A 2FWAA 3V4VB 1NASA 4DR6B 5IKOA 4UM9D 1QFXA 4W9MC 2IYQA 3HI6A 5DLPA 4LF5B 2PANA 3KOXA 2GCEA 1A3CA 4Q7JB 4JXZA 1T5TA 3ZK7A 4L7QA 2FQYA 4E1VA 5K99A 3W3AA 4K9RA 3V1NA 1C30B 4M60A 5B6JA 3UGKA 3ZCSA 4ZQBA 4GEKA 2G1PA 2JJ8A 1N2GA 2PYZA 4NAUA 1JLSA 5J4HA 5L6MB 2ZQ5A 1JEAA 2QI9F 4G0QA 4P82A 2H2HA 2GPSA 4Y6LA 5AR1A 1VL2A 3HB7A 4MPRA 3O3MB 3PICA 4GNRA 2D1RA 4OV6B 4YQFA 1KAHA 4KBFA 5ALVA 2FZVA 3VRHA 5IBPA 3AR5A 1A4XA 2ECFA 3DKRA 3DJYA 1SBHA 5IDQA 4AJJA 5CG1A 3KQVA 4AX4A 3B36A 5BRNA 3JRNA 2BEWA 1C7EA 1LI5A 2FMTA 4Y67A 1DTWA 1DE0A 3IAEA 4ZP1A 4J0HA 2QGFA 4TKMA 4MGEA 3P8ZA 1F0PA 1DO8A 4TWAA 1Q14A 4RS3A 2I2FA 2VYNA 1QTIA 2IKQA 2NQ8A 2ATIA 2NPFA 4GI3A 1ISMA 3DD5A 4JY7A 2WVJA 3U4AA 4GVXA 1JECA 2ZW9A 3LE8A 3U16A 4CU2A 2OFWA 4MPDA 4RDHA 2A5YB 2TECE 4JQSA 3UMFA 2JB9A 3QTTA 5C4IA 1NN0A 3CSDA 1PWYE 5EY5B 1LSOA 4KR0A 4EHDA 2JH9A 3K30A 1DEKA 1TJPB 4IDBA 5GZ3A 4O3MA 2XB2A 3A1VA 1KJ9A 1VLJA 1JDNA 3OOYA 3PC2A 1M8PA 3R20A 3DC2A 2IF2A 4IDFA 1EDZA 1HI9A 3D31A 1PF7E 1CY8A 2PKQP 4TLDA 5FOXA 3SOZA 1OAKA 4JA2A 3QOWA 5CNMA 2JFXA 2XD9A 1VPDA 2YFKA 2FAXA 1LVGA 1FU7A 1HT1E 2IPXA 3Q10A 2A9KA 3AI3A 4AG3A 3G2HA 3IJPA 3S40A 1OFGA 2F2TA 1MB3A 2HXYA 3TLXA 2WU0A 2BGRA 4C3OB 4IHJA 4IP0A 3A3KA 5CGZA 3VNRA 1GL7A 4AULA 3VX3A 1I5RA 2PQMA 3V1KA 4AP5A 1JIVA 4CI0B 5C37A 2V5AA 4AX8A 5LKRA 1HUQA 1XA4A 3HMQA 4JUCA 3D8RA 4XD7A 5LFAA 1Z26A 2VSOA 3INGA 3RHZA 2QUAA 621PA 2J08A 3ABRB 3TAHA 3VYTB 1X92A 1PFYA 1REQA 4F5DA 5CCEA 5I9SA 5JAQA 2B8JA 2BCGY 5A71A 4PZ0A 1X1CA 2N42A 2X9VA 5EGSA 1C2TA 1XOIA 3HXTA 2WJ6A 3AF2A 4C4ZA 3CHYA 1RTKA 2R7MA 3EXFB 3L6EA 2PMEA 3WRYA 3MQ4A 4FDUA 4H3VA 1I32A 5IAEA 3TR0A 2ZVQX 5FOSA 3VR3D 4UBKA 3SSMA 3OA0A 1P4GA 4YAFA 1CY6A 3DE3X 4Y6PA 3VC1A 3CVXA 1V5IA 1KFCB 3CE6A 3KKNA 1OCEA 5IAAA 4KFSA 4B3BA 3KLMX 1CERA 2GUGA 4GGOA 3R3UA 2NUAB 1E1YA 3K0BA 3VSEA 2IYFA 3C5VA 3EHDA 5EQFA 4F1JA 3KTAB 4LGCA 5JAHA 4CM4B 2Q41A 1L1QA 2HLDA 4I1OA 3LSYA 3P2IA 4AN4A 3QHPA 3DEFA 4QM6A 3W6OA 1FQOA 1J00A 3KB2A 2DLDA 4MR8A 3DL2A 3BEOA 3EH1A 4OP3A 3I5XA 3PUKA 1N2BA 5ARDA 2GEJA 5ESWA 2HK9A 1V5EA 1JDBB 1RZVA 1F12A 3H7IA 5AJWA 5C7IO 2XMBA 3KKLA 2C9OA 4ENWA 4FNMA 4IKPA 5JU6A 2D1FA 1ESEA 2E4AA 2WVGA 1H4SA 5JSFA 2QZ4A 1FFWA 3OJCA 2ZPTX 4BO5A 5GONB 2ANCA 4HZIA 1TU3A 2XXBA 1CUFA 2E4ZA 3BPSA 4S1NA 1QQ7A 2E4WA 1ULSA 3IKTA 1EX9A 2CNLA 5DEIA 2H63A 1BRMA 1T8RA 1TKAA 1U1CA 1YQEA 5ESXA 1G38A 2R11A 1DRVA 2H06A 2NO6A 4HKTA 5ENVA 2QLFA 4R2KA 5ALDA 2PT9A 3TLEA 4PX5A 5FPHA 3UH1A 3F2VA 2FSPA 2XA9A 2PY6A 4YRBA 1QOPB 1VMEA 4YAOA 5G53C 2PGAA 1SVNA 4L9RA 4HT3B 5IXJA 2P62A 1A9ZA 4FFNA 4HZGA 4RM3A 4EG6A 5J4VA 2J5XA 1CUAA 4QLBA 4X71A 1QM5A 3TBFA 4E2WA 4OLAA 2XUDA 1IQUA 3KAPA 4KQ6A 4NU0A 1FB5A 2O2CA 4B1FA 3PDJA 3EEFA 2MIIA 3VYRB 5CDFE 1O5OA 1KU6A 1XPOA 3SI7A 5CCBA 4YRRA 3ANXA 2WU8A 1QPBA 2QLBA 2W6PA 1OVMA 1F2TA 1QUFA 3C98A 4M89A 4OQ4A 4YO7A 3ORSA 4JVLA 2IH5A 1GPDG 1KSGA 4B31A 4XWKA 1J25A 3N2LA 4IF6A 2R8OA 3LUCA 4BNTA 3VNBA 4BO1A 4MRPA 1YS4A 1JA0A 2J59A 3AR6A 4EB6B 5JS6A 1XRMA 1ESDA 1T10A 2NU9A 3DEKA 4XYLA 5BR4A 1PUJA 1E63A 1WMSA 3OQHA 4ECAA 3K16A 3RK0A 4Q9LA 1ENPA 1G7SA 2I4LA 3DPUA 3G2NA 3KZVA 5EE1A 2K7ZA 3D6TB 4C6TB 3VYSB 2QRZA 1G4AE 1DZ3A 1LPBB 1NW5A 1PFKA 1YS9A 3T7SA 1EXMA 3PS9A 1MOQA 3O8QB 2VEOA 5HP4A 4U63A 2CLFB 4H6WA 2J6IA 4Y0VA 2WIGA 3JVDA 2HDNB 4U7TB 4KR2A 1IMJA 2NYAA 4TMTA 1JKFA 3RRMA 3RNOA 4RK7A 1R0KA 1JEYB 4F93B 4LHWA 4MWGA 3ASUA 3ZD8A 2ZZKA 3BHNA 2VQFB 3P97A 4QOHA 5IKMA 4E21A 4HLQB 2BYTA 3BTSA 3I6MA 3P9NA 2G6BA 2YJNA 2OXEA 3KWMA 5TPWA 5B3LA 2BI4A 2B0CA 2HDHA 2PRYA 4KOAA 4P4GA 3X0DA 2ZRQA 2PVSA 1POXA 4GGPA 5ERYA 4FSDA 1OBVA 1JKMA 1R5JA 1L4FA 3EEIA 4Q19A 3WSWA 1OT3A 2J4FA 2X1HA 3WBJA 2ZSJA 4DXAA 5IT0A 3I45A 3LOUA 5EQTA 5ICMA 3KRTA 3SZUA 4KG7A 3FUXA 1QVAA 3FJYA 5CW2A 5AHRA 4AQ7A 3RR2A 1K4YA 5KYXA 3TN7A 4HP8A 2BGNA 1Y34E 4CT4B 1YRQA 4W1RA 3RYHA 2NTYC 1PT5A 2Z0MA 4U9UA 3P5BA 1GR1A 2JAHA 1QGOA 2VTDA 1VKNA 3IVGA 1Z7YA 1GLGA 2P2DA 1NX9A 3KEOA 3Q4GA 2CMDA 4JP5A 4M99A 1CRQA 4EHAA 3LQRA 4PANA 4RE5A 2PX2A 1K5GA 4OL0A 3G0IA 4DDWA 3UMJA 1ISIA 1MDFA 2C7GA 2NVBA 3AHIA 2IP2A 1AQYA 3B9PA 3HR4A 4RGQA 4LVNA 4EG4A 3WAGA 1QFMA 4R68A 3ZDRA 5T64A 1BCRA 3ZWOA 2H4YA 4V39A 4FCWA 5F2NA 2B7LA 4D9KA 1ZNZA 1TM4E 1ZM4A 2BBWA 1DAMA 1JXQA 4E03A 1KIMA 4DQUA 4CF3A 1SXJC 3WGLA 2H2IA 2LBPA 3EQ7A 2WB2A 2DY0A 2EYUA 4YIKA 4YUXA 4ARAA 2ICAA 3GUZA 4Q00A 2RBEA 1PO7A 2ZUDA 1QYDA 4KXNA 3ST7A 5JCPA 1CY2A 1YWGO 2ZKLA 1XQXA 1P61B 1QH1B 3BXHA 1NT2A 1QTRA 1DSSG 4GPEA 2YKGA 3K4QA 5TEWA 2YW2A 1Q0PA 4CDRA 3QF4A 4B3RB 5JVDF 5MFPA 4EBFA 2KYRA 3AWIA 1RBMA 3GLIE 4CQLA 1UT8A 2IXFA 1SCNE 3HKBB 2RI1A 4N0PA 1BHSA 2W6ZA 2WWGA 4EO4A 1B7GO 3FKQA 2HKIA 3ZX5A 1AGPA 3R9IA 4ZOEA 1AKEA 1LTHR 2HSDA 2V6JA 2FVXA 5AM1A 4ENTA 5ITVA 1RYZA 2Q5LA 3O2NA 3FUVA 1JYSA 4OHZA 1OBOA 3G2JA 2QRHA 3K0FB 3N87A 3Q1KA 4IMPA 5E1OA 3RAGA 1LFAA 1L5MA 3HE3A 4ZT7A 2ZATA 4ID9A 4IIHA 3ZE7A 2O2SA 3ZHRA 3O94A 3WGTA 1QGDA 2P5UA 1T34A 4OD0A 3ZHBA 3BORA 521PA 1U8XX 3A05A 4OQXA 3WBBA 4A82A 3NUQA 2RCYA 1KC1A 1E3IA 2H4WA 1KKUA 1SUDA 2JEOA 2R1TB 1AQLA 3DLPX 3NT2A 3QKSA 2OYRA 3WBKA 4BN4A 1U3DA 9LDBA 2Q3BA 1WV1A 2WTAA 1NE2A 2H59A 1AM4D 1NOKA 3L4BC 4L28A 2VG8A 4YUZA 1QK5A 2PZKA 3L5KA 4QYWA 5HBGA 2YWHA 1UC4B 2H00A 1R00A 4XVUA 3JR7A 4LZZA 4U7PB 2CMFA 1H2EA 2QX7A 4FP9A 4IZHA 4XWAA 1DBSA 1Z82A 5KAPA 1V4VA 5L40A 3M6MD 2EARA 1ZMXA 3UMRA 4A8JA 3M4ZA 3CTMA 4X45A 3H1FA 2R5NA 3ILXA 1G5RA 1YDEA 4GMGA 5K0LA 3SZLA 4MRSA 2VZ0A 2R6FA 2RIRA 1R4MA 2WD8A 3HL0A 4ON9A 4YXFA 3JQ7B 1LSSA 1L4UA 3VDMA 3G7NA 1XMVA 1YZLA 4LE2A 3ZOKA 4Q9AA 2XZPA 3AKCA 3UGQA 2MINB 4CIXA 1MVLA 3UAVA 3LQ2A 2O7QA 1VRVA 3QU7A 5J1TB 3BIJA 2H48A 2QRKA 2A3RA 2TYSB 2QTGA 4NMHA 4D0RA 4N48A 3HWWA 2JG3A 4YS6A 3SQOA 3FW1A 1GT91 3TTXA 4IIDA 5I4IA 4BKOA 1WW8A 5KNBA 1W59A 4K7JA 1VPEA 2W6IA 4YONB 4E1AA 1NLFA 1TJNA 1TCVA 2C5EA 3FNEA 3ADPA 4HNQA 1SOMA 4BWYA 5BOVA 3QX7A 2VNSA 1OX4A 1OZHA 3INTA 4YR9A 3FYHA 2QKYA 3OTWA 1Z0IA 4BO7A 5LDDC 1ZIXA 1H5NA 2OK8A 3AC0A 3FWNA 1T9GS 4L8GA 2ODQA 3Q5EA 1BVYF 4ZVOA 4I1VA 3T3DA 1JVBA 1W5FA 1WDLA 1MV5A 4K9MA 1QP7A 1Y80A 1GGFA 2NZUG 1M8FA 3LC1O 4JBNA 1QGUA 4QUIA 3IAAA 4UZEA 1DIRA 1W2WB 2OK7A 1W93A 2P2NA 2R79A 3EVCA 1HDYA 4TWRA 5DZSA 3ZTWA 2G06A 2VUUA 5SICE 3WQBA 4GWKA 5CDTA 1BCRB 4G81A 3OZCA 5A5GA 3DLTA 5HEKA 2CCJA 2WRZA 3PTZA 2CCKA 1WZ2A 4JGGA 3JQAD 3IAUA 3S2GA 4J1TA 4BOYA 2A9PA 2X3YA 1UZUA 3I5MA 2WJPA 3BMQB 1NYLA 4FYJA 4EMBA 3WYFA 4YH1A 2DH5A 1Z33A 5FLKA 4YMUA 4RTSA 4X6LA 3QLVA 4DV3B 4YJ2B 1WY5A 2XQFA 3A6DA 3FMIA 1OASA 1RC1A 4X1OA 1J0EA 1O2DA 1D6SA 5I7AA 3C3BA 4X62B 4EJSC 3BVPA 4F8JA 4JSYA 3OKFA 2V3CC 2FX3A 2JIQA 1W1IA 4DTIA 2ZIGA 4LV6A 1LTQA 5K0EA 1G8HA 1MW9X 1B0PA 4FMPA 2GN6A 2FPKA 3D3WB 2XGSA 3CU5A 2B4RO 1GU7A 2LUOA 2YV4A 3TQRA 4CIDA 2I0FA 3ECAA 2E4XA 1CFJA 2P4QA 3OC0A 1UJBA 4F3RA 2ZJ6A 2WVAA 4QQRA 3L8EA 4CFYA 1A9OA 4KYVA 4Y2TA 5SZKB 3KC2A 4JGIA 1UEJA 3MJ4A 2RGEA 3Q15C 1LK0A 4KH1A 2IH2A 1ISRA 5J58A 4DT1B 3EIWA 1ZD9A 1JL3A 1A88A 4KX3A 2Y71A 3K70C 3CEJA 1N9KA 5ELLA 3VR6A 4FLFA 5CB0A 1L5OA 1MG5A 3UB2A 2GM9A 4DSZA 2UXDB 4GDFA 4D8TA 2ILVA 2XDYA 1NPYA 2YFYA 1U6IA 3BFXA 7ADHA 2HBYA 5EXDA 1FEZA 2R8ZA 2IUSA 2WHRA 3E1KA 2QZ9A 3L6OO 4AJHA 5CEFA 4RSGA 1KBQA 2VQDA 4PC1A 2LNDA 1EZZA 5FTMA 2QT0A 1O87A 2VF5X 3TW6A 3SF8A 4CKCB 3F5MA 3ZCUA 1H8ED 3ZHCA 2AL7A 3KNZA 2KLBA 2WYOA 2Y2VA 3HV0A 2XMGA 5T4FA 2XYHA 4FHZA 3ZBQA 3A2LA 1XZKA 5CURA 2BISA 3BMXA 1JH8A 3MD9A 1FE8A 2FW7A 3MAJA 4GW3A 3ROMA 2BL4A 3SZGA 4OHKA 5AICA 5DMHA 2QLNA 2PPLA 4UVIA 2QW8A 4K3VA 4ZCIA 1WB5A 5LIRA 1PX0A 4M1MA 3K0CC 4B83A 3DDWA 4TMXA 5E9AA 3UMGA 4CTMA 4BAGA 1ZLYA 2CXNA 5EQDA 1P7VA 2P7IA 5K8TA 3G59A 4Z8YA 2VT3A 1ZKDA 3Q88A 4GZ5A 4K9SA 1XQVA 3CNQS 3L2OB 3EASA 4H4DA 4D9FA 1XU4A 1H0HA 1GA4A 3EXEB 3NOOA 3DOUA 2CFRA 2ASEA 5D00A 1AO0A 1M2HA 3GYBA 4ZVVA 1SCUA 1TC2A 2V4MA 4U00A 3ZE9A 1YA4A 1UWKA 4E3WA 2JI9A 3KB1A 4I3FA 4MVXA 2NVOA 1VPLA 4JP8A 1JA1A 2FRDA 1B3RA 1XNGA 3EN0A 4FGJA 3A9SA 4YRNA 1KO1A 4X93A 3D8SA 4KVAA 4EUFA 1XEWX 1T4BA 2F8LA 3GFBA 2J6HA 4DC9A 2H9AA 1E92A 2FJ0A 1CUGA 5T4EA 1G9XA 2AE1A 2C57A 2YWEA 5DTJA 1RXYA 2A2ZA 4FSHA 3A25A 5BN5A 2H08A 2IIBA 3NLLA 3TFWA 3UIEA 2QLLA 2A7QA 3KHTA 4JYCA 1UUFA 1XMOB 4GBGA 2QAGB 5I8ZA 4M8NE 3NHFA 1ABFA 4ZKEA 4DXHA 2JPDA 5LZ7A 3ADCA 4GU5A 3KYDA 2BUCA 4U1RA 5KSZA 3DVLA 2EYQA 1KY3A 4UVGA 3G0BA 2V7PA 1D2MA 4D2IA 2OOSA 3F90A 2RGNC 2OM2A 2VAXA 2ACKA 3SFTA 2FW1A 1Y4SA 4KWHA 1DS6A 3ZHSA 4BVGA 2D1TA 1EE9A 3WL4A 2WU4A 3A0UA 4OMUA 1P0FA 3UNXA 1LBTA 2GF9A 2WDPA 2OZLB 1CY1A 3DLAA 2R65A 2RKOA 3F4KA 2ZTLA 3GCZA 1ILWA 1ZI6A 3E7PA 3GJ0A 3QXGA 4FFVA 2F8TA 4NNOA 3AZQA 4MYSA 5GMOA 4PRYA 4Q1VA 7REQA 3B78A 2O2JA 4DV4B 5TE9A 1D5CA 2DWOA 2V59A 3ZY5A 1PHPA 3M1YA 3WXBA 3LLCA 1LQ2A 3OSUA 2I1LA 1M2VB 2X8WA 2HNKA 1ZD5A 2PJZA 1LBEA 3BS4A 2PQ2A 3ETCA 3PZRA 5AQEA 4OQNA 3X3HA 1G8YA 1M5RA 1EH5A 4JP1A 3FCOA 3M49A 4RFSA 2A92A 4Z3KA 7GPBA 3J81A 4O1MA 4PYKA 5IMBA 3TI9A 4BZPA 1ZM3A 4BECA 1M1YE 2KM1A 1WXDA 9GPBA 3U3ZA 2IDKA 3PNLA 3WGVA 4HNSA 1UPXA 3KT6A 2WILA 1N3BA 4NJEB 3ZZTA 5HUHA 4RV5A 1M2VA 2C2GA 3HWX1 2XIJA 1DUSA 3DMHA 2ZJZA 4GOND 3NVAA 4BLUA 2QENA 4RO0A 3VTZA 4XD2A 4CCWA 3GZNA 4UTRA 1XLTC 5JZMA 1HLGA 4AY6A 2I5PO 2W5UA 2Q4BA 3B48A 2AFIA 3SF8B 1DT3A 1SXJD 1FSZA 2E5WA 1GGNA 1QH1A 2GNAA 2QUZA 3R5FA 4TTVA 3LMKA 4R1TA 2J7PA 1E8MA 1JB1A 3L7MA 1N2JA 3T3MB 1EFCA 2A58A 1E79D 1C9JA 4LY3A 2B35A 2JL1A 1K9VF 1XCPA 2AEJA 4JJEA 2V9ZA 4CPDA 1P62B 2PLNA 4GSLA 4RZSA 1K88A 5CT8A 2VZLA 3D7SA 3EXIB 4Y2VA 3UT0A 3U7FB 2LR0A 3FHJA 3FI9A 3IV7A 5BVGB 3T5CA 3VVLA 5BMOA 2GT1A 1M2WA 2AFIB 2FWPA 2OXRA 1G3RA 3IKMB 3IOEA 4WEQA 5IT4A 5IDWA 2GM4A 3UATA 1TM5E 4LYEA 1OXBB 3IMGA 5CIWA 4G3XA 1FUUA 2ZT7A 2O2YA 4D9IA 2IHKA 4P54A 1LFDB 3NANA 2AR9A 4O4JF 1GGHA 1PWZA 4LI0A 2CY0A 2QV7A 2IIQA 4TTAA 2DFNA 5ECGC 4YRJA 1Z4QA 3V2GA 4TXMA 4HO1X 4BKMA 3N2KB 1WKCA 3LLSA 4LTNA 5DFAA 1W36C 2WMNB 1RP7A 3MGCA 3PUWA 5LPNA 1QHHA 2FP4A 3Q3EA 1USKA 5DHSA 2BFBA 3UWMA 2Z2JA 2DPXA 3BH7A 1RXUA 3DHNA 3ZKAA 1Z9BA 1O8CA 2GBLC 2R1ZA 1Y4AE 1N77A 4QELA 4YJ3F 1JDPA 2ISQA 3Q2OA 1LWOA 1PZFA 2J9XB 1K89A 4G67A 4ISCA 1KYWA 2WR8A 3RVQA 1T5OA 3TPCA 4D92A 1L5NA 2V03A 4HUQB 1XRNA 1Y3AA 3LY5A 4HYTA 2PUDA 3RTGA 3BJEA 2QG6A 1BVHA 2Y6UA 3H5LA 3JWEA 5KHAA 4WJLA 2VQSA 3JYQA 4QGHA 5ALQA 3S27A 2Q6IA 2JVJA 3PDIA 3OZSA 2AOUB 3VXKA 1U98A 1DOZA 4GMDA 3FVWA 4JUAA 4EFDA 3O2SB 1GPH1 4HH0A 5DVZA 4WOKA 4UMDA 1EK2A 4MUNA 3KV1A 2XQJA 4WZZA 3NBQA 4LSGA 2HQRA 1XRRA 3FROA 4S05A 4DCPA 2EKLA 3CVJA 1JWAB 4G07A 1UJCA 1VI2A 3M0EA 5I48A 2BEVB 3UT5B 2L82A 3ZWWA 3VPHA 5HW0A 1R4NB 2RI0A 3ICEA 3V42A 5J9FA 4QGSA 1EFRA 5BP7A 4KPEC 4PZAA 3PL5A 4TZTA 3W6PA 5IYZA 4X1YB 1NJ6A 4D8YA 1QZTA 1WUHS 5A3QA 3PR2B 4QT4A 5IXSA 3AMVA 3Q8LA 1ESMA 2IDMA 3HO8A 1U0JA 4CKBA 1XCGB 3HCEA 4PLFA 4UEKA 4NV1A 2GTPA 1UDBA 2ODAA 4J4TA 1QTQA 3LHKA 5HQ3A 1N0VC 4JX9A 4Q03A 3BREA 4HYQA 1MR3F 1H2AS 3AHCA 3Q7TA 1N2XA 4BWGA 1Y7TA 2DHRA 1QE0A 3N70A 4F5ZA 4YLGA 1SGWA 4Q02A 1JALA 1B93A 4ZQGA 4RHCA 3C16C 3ICVA 4N7MA 4OOEA 2PRSA 4C43A 2PMBA 4HDNA 3RTAA 3IJRA 1PTKA 2EFCB 1ZW1A 1OI3A 4KQ2A 3GD5A 4KWCA 1IBKB 1O5IA 3ZGVA 3OQNA 5DV9A 3G49A 2VCYA 2XVAA 3R3JA 2SNIE 3VO8A 4X24A 3FTEA 4HQNA 3H2ZA 4WFIA 3DEJA 2N1MA 3E3LA 2BCJQ 1ZCAA 4A0SA 5H3LA 3O0TA 3AFGA 1E2NA 4ARZA 1UFVA 3PJGA 4K5QA 4RKWA 3TNLA 4I2VA 3RAJA 1U3GA 2DPGA 2FKAA 4L3WA 5COQA 3U37A 4CMIA 1IFXA 2CDNA 5B2EA 5KDOA 1NHWA 2XXAB 1K86A 1R3DA 1B16A 1SY7A 2JFOA 3C87A 3ED1A 3EUFA 4FGKA 5DX0A 2KBEA 1ZIOA 3IQIX 4ZA2A 1CYDA 3CONA 4EKGA 3MM4A 4ZO9A 2DHEA 1YZGA 3BWXA 3H9JA 2OCLA 5KVVA 1M66A 2ORED 3HU3A 4LRTB 1GNPA 3A3NA 3FNBA 2QS9A 1VJ0A 3LDUA 3SHVA 4YWJA 2H1RA 4HVCA 4JDPA 1JDTA 1F1BA 1WHSB 2YH2A 3FSGD 4KYUA 1YA8A 3VC3A 3OTGA 3UJ8A 4EA8A 2HA5A 1Q2XA 2VF2A 3NJ4A 1YQ9A 2ADFA 4RTRA 1B6SA 1DI0A 1K3TA 3I3OA 3KLBA 3QQPA 3VAYA 3J81k 2B6NA 4ITRC 1NJFA 3ZY6A 1OXSC 2FEAA 2J3EA 3WMXA 1ST3A 1FP6A 1E9VA 4Q47A 2A0WA 5DBHX 1ZZGA 3TLBA 1E2IA 2XMSA 3BSWA 4I4CA 3TCXB 4CLRB 2OV6A 4FX2A 1ISFA 1EE2A 1RWQA 1NZJA 3RT9A 1FJXA 5IVPA 4FJ0A 5DH9A 4F6CA 4PAOA 1XLWA 4AYWA 4LMAA 1H23A 1SC9A 4JH0A 3IA2A 2HC9A 2X4LA 3O1HB 5ABPA 1CF2O 2OGSA 5KNDH 3HBMA 5KX5B 1WTAA 2AXPA 1E59A 3SYLA 1SFRA 5D86A 1PZHA 1RRMA 1Z29A 2MCFA 3AY6A 4ZREA 4A15A 3BWDD 4DBVO 1KI1A 3PEEA 1TAHA 2GN8A 5LZ5A 4G9EA 5DHPA 3UMCA 5JH7A 1C0LA 1JYFA 4HF7A 4QRDA 5C3MA 1XIVA 3ETLA 2ZT8A 1OYOA 1ZD3A 3KAJA 4OB6A 3S1SA 1S1MA 3FCYA 3H1BA 3QMPA 2C54A 2OT3B 1DIAA 2A1TR 2ZYSA 4B6OA 4FDMA 5AOAA 3RVLA 1SXQA 1F6WA 3FLAA 4MVJA 2FPWA 1CUIA 1IONA 3BB1A 3L6DA 1GSIA 3AW9A 1UH5A 1SUCA 3C85A 2VHTA 3M1LA 3Q6NA 5CK4A 4ARUA 1X7DA 1Y7HA 4DC0A 3MWJA 2G09A 3EH2A 1Q0SA 3I6ZA 2GPAA 4RHFA 4UJ3A 4YUYA 3COZA 4FTWA 4TPKA 4YCNA 4YQEA 3CNNA 1E9AA 1O94C 3H6KA 5BQXA 2VSFA 2R7NA 2JGKA 4QPCA 3F6YA 3QU9A 2A0XA 1AGNA 3RYFA 4AN1A 4FD2A 3DAGA 4FKMA 3ZYCA 4UQPA 3IOMA 3IT0A 1CJSA 4CM8A 6REQA 1P2UA 3KJEA 4PPYA 4YT2A 2C29D 1OY1A 3ES9A 3JWPA 2YWBA 4XUGB 4ZXPA 5J1SB 3OM1A 4RESA 4WRRA 3ZJ5A 4BNDA 5ECWA 5KUTA 1YHNA 1CB7A 4NY1A 2WYIA 4FDTA 5M5BA 5BN4A 2GWHA 1G20E 1KTVA 1N7IA 3VR6H 3QE9Y 4CG0A 3A4LA 1EDBA 1ZH2A 3TE6A 2H85A 3ZS9A 4B3GA 3N3BC 3W2GA 1PNQA 4KI0A 1V71A 2X5XA 4XVCA 4M8KA 2XUAA 1RBYA 1U4OA 5AM5A 1TO1E 5FOWA 3T7DA 2DLCX 3RUIA 1PBTA 3V3TA 1CS0A 1Z34A 3HEAA 2CHEA 4CTOA 5HSGA 2I7CA 4XLZA 4ENRA 1BJKA 3G7SA 5T4BA 2M2IA 2RHJA 3LPAA 2JAQA 4XRRA 5M04A 3C8HA 2VWHA 5JIBA 3Q7PA 3X44A 3F9RA 1J39A 1WSWA 2YV5A 3NIBA 4I55B 1PG0A 2R4QA 4AY4A 3ONDA 1L5SA 4G1CA 1C29B 2GZ1A 3PJDA 2BJHA 4LWPA 4WNAA 4O59O 2RH8A 3BIXA 4QRIA 4KL8S 4X94A 3WLIA 5T7BA 3D6UA 2PDAA 1Z5UA 1B8VA 2GEKA 2PUWA 4Q9NA 5JRZA 3SWWA 1KSHA 1S01A 2WQ6A 1D4OA 3QKSB 5IDVA 2OZEA 4BMCA 5I51A 2DHDA 3F6PA 2DM6A 4QPJC 5D7NA 2AVDA 1I3LA 3FJ1A 2UKDA 1ULTA 3RASA 3KWJA 2QLJA 3BDVA 2C5HA 2XT6A 1P7WA 3JPWA 1WXEA 1SCIA 1FVFA 3K5IA 2CVOA 1MRNA 1WMFA 3G0DA 4U5QA 3LBFA 2GYUA 1LI7A 4GGMX 3OMWA 5BW6B 3RUEA 1DG9A 1DV2A 4DV0B 3K9LA 4RLSA 2ST1A 4FUQA 1U02A 1H5UA 1X7YB 1Y5RA 5AVRA 2IDZA 2WKRA 4MW1A 1ENZA 4AUKA 4PYQA 2PSSA 3GHHA 4RIHA 1KAGA 1RYYA 3ELDA 1IZ8A 2ZYIA 5FPYA 5AM2A 5K0NA 5IAGA 1X7XA 2QD4A 4GIBA 4PHFA 4DCCA 5JBQA 3CVYA 3IOBA 4NNJA 5A3SA 5C8YF 1XVAA 5ADHA 3ZYZA 1AK9A 1WVMA 4RCVA 4P34A 1MJHA 4TV8A 1X7WA 2Y0BA 4Q48A 4C78A 1K4KA 2YMPA 1BOOA 3NU1A 4XWYA 2GVDC 1XU7A 4D9EA 5DNYB 1YZKA 3U4DA 3Q3GE 2PUFA 3AERB 3H8JA 5F3RA 4NZMA 4YRIA 1AO3A 5KKAA 1GCAA 1R6BX 1YE8A 1ZI8A 2DWUA 2CVZA 2PKYX 3K1AA 3O9MA 4JC0A 4MQFA 4XM0A 2AMLA 2QZZA 3JZAA 3DDUA 5C8YB 3DMPA 3PQ7A 5FR2A 5B37A 5FTKA 4QOGA 5A9SB 2JJMA 3CRQA 4OFWA 2AG6A 3WWPA 4CMEA 3KFVA 2FEOA 3HEBA 3L7NA 1QKIA 4GO1A 4PAGA 1JSXA 3IXLA 3QM1A 1HFKA 4HDRA 1E1RA 5TQVA 4B6GA 5D84A 4WQMA 4C0KA 1LA2A 1XAHA 5CDFA 3TRJA 1BRTA 1E2LA 4AZ3B 5BQ3A 4QBGB 5FTWA 3QENA 2NU9B 3RHSA 3CWQA 2D4HA 4M7WA 3FFBA 1XC7A 3CT6A 4G65A 4ZI7A 2BEUA 2O0JA 1W0JD 1U90A 2B9EA 7MHTA 2NO0A 3HEMA 4W5TA 4ZPJA 4D4LA 3AUXA 4QPPA 3X2FA 4PNHA 4TYWA 1X1BA 3L6CA 2IXAA 1JBKA 1FRFS 2HLNA 3OLCX 2RMKA 5T4HA 1F14A 1ZMOA 2J0SA 2VTKA 4PAQA 2ZPUA 4JFRA 4JROA 4R3WA 3F8SA 3N39C 2Q4OA 1MORA 2QN6A 5ALTA 1RMTA 1Z5PA 2H4ZA 2QQFA 2XNSA 4LGMA 1TJ4A 1H0SA 4URZR 1E6MA 3EGVA 1N8SA 5C8XA 4OK6A 4TLEA 1DFHA 4ZV4A 4LHSA 5IS2A 2BV3A 3T3EA 1Q20A 1NPTO 4NECA 1JDSA 4ZT4A 1AS2A 1H2RS 1V16A 4HWKA 4KZKA 1ZU4A 1P9OA 3A36A 3LV8A 1GRCA 1IN4A 3H2HA 1HQCA 1JVNA 2IY8A 3AFNA 3QPAA 5AWFC 5AI8A 1J24A 3QUBA 1ORDA 4HEA6 4F21A 4XYGA 1K3UB 2DU8A 5CXSA 1CQPA 4P3PA 1O6BA 5JQWA 3BQMB 2WWIA 1SCKA 1TUEA 3RT1A 4OGGA 4AXXA 4ZZIA 1VSUA 3FSEA 4U5XA 4O5AA 1OOEA 2P11A 4CR6A 1KO4A 2OBYA 3CRVA 2Y67A 3RU9A 2FR1A 4MQ4A 4PVCA 3KOUA 2ZDQA 1ADCA 1UZLA 1E4YA 1SD5A 3LL4A 4ZQEA 5EZYA 4P3YA 3WNDA 4E5PA 3LX5A 4GHWA 4KQJA 2RE8A 5E6UB 1Z88A 2GMWA 4ZALA 4C2AA 3NM5A 4DJTA 1E96A 1QR6A 3OBBA 1U0SY 3EA0A 3HYRA 2IP4A 2WSMA 5DBOA 1G60A 1NBMD 4JI8B 5JNUA 1X9HA 4DCJA 1QRUA 2ZJYA 1O9HA 3ZKWA 5F2EA 2WDZA 2H17A 2XA2A 1E6LA 4E2ZA 1ULAA 3FPCA 5CVVA 4QWWA 4C0JA 2HBZA 4KR9A 1GVHA 1N8TA 2WG1A 4DARA 3X1MA 4CRWB 5L6LB 1G1AA 4M21A 2WZQA 4RZ2A 3KTAA 1WUKS 4S1OA 1Z6ZA 4PXAA 5EG5A 2YFHA 4OQQA 5CB4F 4ENUA 1JFTA 3KTDA 2YHAA 4DS3A 3PNYA 4MKIA 2GJAA 4JLKA 4LQLA 1FOEB 4WBNA 3R76A 1KDTA 3MTQA 3RFUA 2WV9A 3CLSD 3EJ6A 5DRYA 3TQOA 3NYRA 4R1SA 1XVUA 4AWXA 5JZBA 1UWLA 3VJRA 5F9MA 4IV0A 3F47A 2OCGA 5KJCA 5KNBD 4BAUA 4ZAFA 7YASA 2ZBDA 2G82A 1FP4B 1YJ5A 1US8A 1WX1A 3R0IA 4IUDS 2ODBA 4K2HA 2BMDA 5DLDA 3TLYA 3GMSA 1ZIYA 4ZMBA 2C4HA 5JNWA 2J0QA 3VNVA 1RBQA 1YH3A 3JWJA 3C1OA 4R1MA 1SIBE 4AZTA 1JKJB 1V45E 2YV3A 1V43A 3MOIA 4FWBA 2DH6A 3MWFA 3JX9A 5GINE 5EJ5A 1QWOA 3COPA 3P20A 1WU8A 4L2IA 5CDUA 3G85A 4HTAA 1H3FA 1KEVA 3DBHB 3LC7O 4KGXA 4Z3DA 4BNGA 3LF2A 5FA5A 2G25A 2QPLA 4BCCA 1NIJA 2BFBB 3ADBA 2VJYA 3CNOA 1JYEA 1DO2A 1W5EA 3IE0A 3IUNA 1GAJA 1T5IA 2A0KA 2BTOA 4JBYA 5FIUA 3LQYA 4YDQA 5EHZA 1S2GA 1P5ZB 1VJCA 1C1DA 4FZJA 4WX2B 4BYMA 1TFRA 4ZOLB 4M0DA 4FE7A 4IDNA 5SZJA 3Q5GA 3RUFA 3C1AA 1VE6A 1WHSA 2AWNA 2QTNA 1CUEA 2R2GA 1L7BA 3MJHA 4F06A 3KQNA 2QTRA 5I47A 2DFVA 1UBRS 5THQA 4AF6A 4RF4A 5ICCA 4XOIA 1KO5A 4GT1A 3KYDB 3LT4A 4JDUA 4D6YA 1YQTA 4NEGA 4C7VA 5LDGA 3CN9A 1JR3A 4WN9B 2IZ1A 2I6UA 5C34B 1I2CA 1PIWA 3GEPA 2OXFA 2GEVA 1QLWA 5I4BA 4WHMA 4D3SA 4OO3A 1A5SB 5FQNA 1M1NB 4RZIA 1E61A 1XTQA 2J9FA 1JQ5A 3QI2A 3SS9X 4PCUA 4ABTA 3O4HA 5GGXA 1UCFA 2QMUA 1MH9A 2G1KA 2GK3A 1KFEB 2Q45A 3ACDA 5HFJA 3TDKA 2B61A 3LK6A 3ZU6A 4KI7A 4F2HA 3KX2A 5SY9A 5WRFA 2ZROA 3HYTA 4UNIA 4UDOA 3GLHA 1T0JB 5HE8A 3R5HA 4IG4A 5EXSA 2WJYA 3Q9NA 5C5EA 2B4AA 3OCWA 4WZ6A 9ABPA 4AQYB 1TVKA 2WSYB 5EZQA 2DR2A 3WMFA 1W1UA 1GQYA 4ITUA 2IXTA 4CVNA 1D7OA 3OZAA 4KH0A 5JTUA 1AHPA 1UT5A 2G0TA 4RQAA 1FDSA 3CZMA 1KH2A 5JAPA 2DBRA 2VUHB 2HQSA 4RA9B 3VZPA 1LPPA 4UASA 1NULA 1S2IA 1Z0JA 1ORVA 2YZ2A 2O8DA 3HXPA 1C1XB 2ZIVB 3KUUA 1QNLA 4GM1A 4MHTA 3PWTA 3EQ2A 1TU4A 4R2WA 4HDSA 1H2FA 2VNJA 4N6OA 2YYZA 1YUNA 5DEOA 4YUVA 4EQ6B 3MGBA 1N9GB 1IEVA 1RCTE 2HPZA 3G2PA 2FX5A 3HBFA 2ZE7A 4YP6A 3TD9A 3TW8B 3WKEA 2JI6A 4B84A 5IJ0B 1IN1A 1ZVVA 4ZCTA 1C3LA 1IDOA 2QN3A 4L9AA 1J56A 4PPFA 4FFLA 4D43A 5AVTA 1IH8A 3GPLA 5DE3A 4EM6A 1GP2A 1YOVB 1E1QA 3NIDB 2VOJA 4WESB 1EFRD 3DR3A 2HCTA 3DAPA 4QYIB 3FMFA 4O2BB 1M76A 2AOTB 2AMYA 3ZQ4A 4DKJA 4U2CA 2DETA 4EA9A 3OG9A 1R5OA 3OLWA 3VMMA 4W5JA 4FJ2A 4C4AA 1RCFA 4DY4A 1V8OA 2DUJA 4R8KA 5GWXA 3GDWA 5IHXA 4ZI2A 1HSOA 2LIPA 2ORYA 3N2GB 1Q1EA 1WBJB 4PY2A 1JP7A 2QMHA 1S2LA 2WJ4A 2PKRA 1GL6A 4QJIA 1NXSA 1JJAA 3N2IA 3U1BA 1MC4A 2PBRA 2ZANA 3UHAA 4YAGA 3TBHA 4RZXA 1L8LA 3MT0A 2NP7A 4W9RA 4BVAA 2Q6TA 4QTUB 3ZCQA 1GGKA 1IPEA 4F60A 4G1VA 1XEFA 1LS6A 2CUZA 3RTDA 2VPZA 1N2ZA 4NH4A 4RDCA 4GI1A 1XMSA 4Y9UA 1NWCA 1FPQA 2FH5B 4H3KB 2NVUA 3TQQA 4ZAXA 2FR0A 4HXFB 1JTEA 2NZJA 3MWGA 1QG2A 2CL5A 2ZYHA 3S3TA 2W2TA 4AB1A 1Y9JA 3IEKA 4CQJA 3WYCA 3ZLVA 5LXTA 1WCXA 4OY3A 2FQXA 3BQ9A 4UC0A 2HIGA 1BO6A 4XB2A 5EHXA 1KVQA 2PUHA 2VEDA 4UTXA 2MSEB 4M86A 1N8NA 4LXIA 5DBFA 3RQIA 3UAOA 3CEAA 1PSZA 4XM1A 5F23A 5I8WA 4HLUA 3FLEA 2Y99A 1BHQ1 3E22A 3EC1A 4HNGA 1E3DA 1EGMB 5JALA 3R9KA 2BFPA 5DTMA 3T7AA 3AT1A 1HKHA 2G88A 2FB9A 1X0VA 4AROA 5BMVF 4JI0B 1SXJA 3EMBA 5J23A 3EAFA 1X74A 4MDHA 1W4LA 3T7TA 2I1VB 4MKHA 1KYXA 4ND8A 4UJ5A 4B3FX 1QS0A 1GADO 1RKBA 2FZWA 2C3UA 3DVQX 2Z9CA 2CSUA 2P91A 3NWOA 5E0KB 4F71A 4WZBE 5JYEA 1Z2PX 3DFKA 1DKLA 3GPIA 5F3DA 3SNHA 4QUKA 1BEEA 1AURA 2ZIWB 3FFTA 2HA2A 3IVMA 4IJKA 1QAOA 5EMMA 3S2FA 3WIOA 3WNBA 1XFDA 1NVTA 1Z63A 1OI2A 4JEIA 5HZHA 2WPNA 3EGCA 3LUDA 3HY6A 4LCJA 5AKYA 1H2YA 1TF7A 3WL7A 1C7ZA 1DBQA 4IIBA 1CDDA 4QWMA 1SNYA 3L8GA 3A58B 2VWQA 4OXYA 4YDRA 5H8WA 4MCHA 1I7PA 1ORIA 5CLLA 4NPCA 1KEKA 3FZGA 3UKOA 2B25A 1Y9AA 4BNJA 1Y82A 3GZNB 5K2OA 1KK1A 1RWVA 2Q4RA 5HBRA 5LYYA 4HWGA 2GBPA 4F04A 4GX5A 4UQOA 1EYZA 1Y4UA 4MV1A 4Q3CA 3PL1A 4LN1A 4XYBA 1DOHA 3SHOA 1UBFA 1ZUHA 4R5HA 4Z9XA 4H1WA 3W5DA 2J7PD 1PT6A 4G0MA 3R3HA 5CHEA 2CVPA 1KH3A 2GD2A 1AOXA 4FOLA 3GJYA 3KOZA 1RJ9B 2JJ2A 4KE6A 1H1LA 4TX1A 2C4TA 1PJSA 2H0QA 3E5NA 4FEGA 1JLKA 4GBED 1DBPA 3N8DA 4GX0A 1WNFA 1U0BB 3TMYA 3W4JA 5E6RB 5L4SA 3DUFA 1QDUA 4DDHA 2PH5A 4AY5A 5I7WA 4M54A 2WHEA 3T0FA 3PU6A 2ZYVX 3LBNA 2OENG 1FCJA 1RYEA 1Z38A 3I9MA 4I5IA 2HHHB 1SK9A 2XJ9A 3IPRA 3L1VA 4IXTA 3RI3A 2ROQA 4QD3A 3SXUA 4GLFA 4ZWNA 3THOA 1QLHA 3DOCA 1RAAA 2PT6A 3CH7A 3ETDA 4LKRA 1Z4MA 4XGQA 3VH3A 1FYEA 5TQ0B 1U7PA 2AFHA 1GA6A 1FUKA 2NV6A 1IG0A 2OGTA 3N2KA 2B8TA 1QYIA 3RRXA 2ZSEA 4EUHA 4ZYTA 3K4PA 2Q5IA 3STHA 5IJ9B 3PUZA 1E32A 2JK1A 2OZLA 4FPXA 3CVWA 1GTVA 4RMNA 2RHGB 5LQRA 5LQUA 1NGSA 3VNQA 1UBMS 3BMQA 1KAQA 3BCSA 2XT0A 3KZXA 3QVUA 5DGCA 4TQUS 5JNSA 4MR9B 1KR2A 4PLGA 5EWLB 1FJGB 1EWQA 3I05A 2YR0A 3R23A 4C21A 4JI4B 3ETEA 5JNRA 1NQXA 3ZY2A 4IEIA 1VSVA 3N2YA 4BEJA 4GP6A 1AKNA 2H16A 4E4TA 1EHYA 3PHBE 2UUCB 2W8BB 3JQ6A 4BB6A 3A9WA 4YV0A 2CKMA 1ZFNA 1E77A 3PSHA 1X1QA 3HKDA 1EUYA 2CNDA 3GRVA 1PQ4A 1NBAA 3P9ZA 3PEYA 2PFSA 4O3FA 3H13A 4MUAA 5E8JA 4F45A 3F71A 3COSA 3IUQA 3QE3A 3PXEA 2VF7A 4RBNA 4BO2A 2NQTA 4UATA 3QX3A 3GRCA 2H7XA 2P4HX 1NW7A 2P9FA 1UBNA 2V6FA 1D07A 1XA0A 5D3ZA 3TLZA 5JBIA 2ZM5A 2HMVA 3B51X 1KDVA 4BLQA 2YVAA 3M83A 3PA6A 5DNWA 2D00A 3HFJA 5JD5A 1G6HA 3S2UA 1SVSA 3PGJA 1KJZA 3NQ41 1QV9A 1GZ4A 2OOKA 2O2XA 5E9QA 4UAVA 1MF7A 4GOXA 1SVOA 1A9XB 4FYVA 1R8XA 3LHDA 1EVZA 2AH5A 4TYNA 2B82A 3HJFA 2J6BA 3VH4A 3URKA 4BNZA 4N49A 4C5BA 1QKJA 2AX4A 3G88A 3HYNA 4QUHA 1ZVQA 1ESZA 1J0BA 1A97A 2I8CA 3UK0A 3NWBA 1Z6AA 1GZUA 1U80A 1CR6A 4GP7A 2VN8A 4NOKA 5DP2A 3UMVA 2XBLA 1RXIA 4BVEA 5C8VA 3UAZA 3QEBZ 2BCEA 1ZSYA 2QQGA 1FTWA 4PYLA 1J70A 1XP5A 4KQ1A 3FPSA 3NZEA 1CJUC 1CUWA 1V2HE 2IUYA 3B2NA 3GEMA 1P1HA 4L50A 2NSJA 4YJHA 5JSYA 2Q3CA 4TRJA 3F5SA 4D3XA 4MVYA 3JTMA 1XMPA 4OM7A 4E94A 3WV4A 2ISCA 2DB3A 4R2LA 2I29A 2QY6A 4IJUA 2JIZD 2YCBA 4RMJA 3GRRA 5A6VA 4UZFA 3RYCA 2AG0A 3H5WA 2JCSA 1UP7A 3WJ1A 4ZAVA 2Y1XA 4DCUA 2OA0A 2QX6A 4E2YA 4AY2A 2FN9A 4CQMD 4MCIA 5E4YA 1DAOA 3FF4A 1X2EA 4DEVA 3FHLA 4UBOA 5EOVA 4D9MA 2H18A 3SVLA 5GZ6A 1H1LB 1X1RA 2ZJ0A 3WWOA 4D74A 4EUKA 4TTQA 1J2TA 3UK6A 3V33A 1DNPA 1NIPA 3NTRA 1FTSA 1AMOA 4D97A 1IXSB 3OOSA 1YAJA 4LYYA 1KAOA 2B2CA 3K9BA 3K71B 4F0JA 3HA2A 2FNAA 4TZ0A 5LP6A 3FOWA 4H7JA 2QF7A 2GKSA 4OAOA 3ZEIA 4TXLA 1GFSA 4OYHA 1B6RA 2HYIC 5BVHB 5EKSA 2E87A 4KMOA 5JMOA 5BWNA 4Q4HB 1XTVA 4BC1A 1RWWA 3V8RA 3AKEA 3VO1A 2JAPA 4R0MA 2QSJA 3EW9A 4Q82A 3ZDAA 2CFTA 3EFOB 1BVUA 3SLRA 5GONF 1YRHA 5DW3A 2OBMA 4WKPA 1FNBA 5EWMB 5I9IA 4PG8A 4P7FA 1K0FA 4MMYB 1WKBA 5DPMA 3DBHA 3TQCA 4JWKA 3KJHA 2AVNA 5LSAA 2AXQA 2YDXA 1UQTA 1E4VA 2NPIA 4W63A 3G6WA 4FT4A 2C77A 2I78A 3NGMA 4WNIA 1HRKA 2GK4A 3PHHA 3TSCA 3T3PB 4NAHA 2CDCA 4DRXB 3N5KA 4J7AA 1NKVA 3KOMA 2WVHA 3D0OA 4LJ7A 2HMSA 2XBUA 3RC3A 8AT1A 3NBFA 4L5AA 2R84A 4CM7A 3U4IA 1DJMA 3T7KA 4PHTA 1MJ5A 2EZUA 1ORRA 1ZX1A 3LYLA 1K6EA 1PQPA 1FNNA 1VSTA 4HK4A 2FWJA 1OMOA 1J5XA 2WT9A 4K0RA 1EDDA 5L3ZA 4UTPA 2R6R1 4NCIA 2FFBA 3Q8MA 3I2GA 3L0OA 3H7AA 1TGVA 1VCHA 1YRAA 1AN9A 2AFHE 3EEOA 4PYOA 5CUQA 3FWHA 1TYDE 3ZDXB 2ODWA 1E99A 2J3HA 3WNVA 1JIUA 3CFYA 3GYGA 2CBZA 4TS3A 2LGJA 3VZSA 3KSAC 2N0SA 2PXHA 4KAXA 2PBLA 4P4LA 2AN3A 1DWQA 1F3LA 1DU4A 1GEGA 2QYOA 1PK7A 4M7OA 4YC7A 1JFSA 3PNKA 4L75A 4HB4A 2QLTA 2CMKA 4FJ1A 4BFZA 5DCYA 2NLOA 3QF7A 1F2DA 4GBMA 1PE0A 3PCTA 4YCBA 4KLRA 1G21B 4N5LA 2X0FA 1IRXA 3E8SA 5CFZA 4MYDA 4YO8A 1QZXA 4I9HA 3WNQA 1HV8A 3T4EA 5LP6B 1ADBA 5AJYA 3S70A 3GVIA 4RMHA 3R0ZA 1IN8A 4W8HA 3MJEA 4Z1MA 5C80A 4HUTA 1NAIA 1QFSA 1KJJA 1FXWA 2XQIA 1CEQA 2V74B 2XRFA 4N5HX 2QYHA 3O1JC 1I24A 3GEDA 2HK6A 3BE4A 1FDOA 4FXPA 4LKOA 3CO5A 4P35A 4C7XA 5KC8A 2X0NA 2WUGA 2JI8A 4JT2A 3IQXA 3USZA 1RJDA 4MITA 4EABA 1TI7A 3ZDBA 1EWRA 3IAS1 1E1DA 3HWSA 3DM9B 2X3FA 3D59A 1CCWA 2IHVA 2JD0A 3HJHA 3K1JA 4FHCA 1YE5A 1K1EA 4HFNA 1KC3A 1O58A 2WW8A 3CLHA 4CF7A 3GT0A 4DV5B 5AP9A 2NV2B 1K9SA 1BE8A 2AUTA 2D0PB 2RHHA 1SUEA 3D3WA 4OGWA 3SD7A 1KRWA 1BWRA 4ICIA 1IVNA 3PC3A 4IRUB 3LT5A 2GS9A 4JBHA 1E1KA 4RH0A 3SR3A 2GA8A 2ZAIA 2C88A 2XHZA 4ID3A 5EIBD 1WU7A 1C3JA 5LB4A 5KTRA 4O08A 1YOVA 3FUTA 4ZCSA 1CY4A 4X95A 2E4YA 3ULKA 3H97A 3BOSA 1T35A 1V8ZA 4LCEA 4UMFA 3NB0A 2XWPA 4YJDA 3WMGA 3EMKA 4YJ3B 5E8RA 4M9UA 4H7FA 1TE2A 4DV2B 4BU1A 1UXHA 2BSAA 2XMCA 3JWIA 4ND1A 3L49A 3QFFA 5D1NA 5KYUB 3BRWD 2F90A 2Q7XA 2YOFA 2Z5FA 3ENKA 5I7OA 5T41A 2RKWA 4LNAA 1W35A 3MJFA 2QXUA 4RK6A 2IYTA 5TPZD 4MJLA 5DGHA 4HVAA 2J32A 4D96A 1RI2A 3EMVA 1GUYA 5EMHA 5JD4A 3E6AA 3B1XA 1FK8A 3HR8A 2WUDA 5HHTA 2QN9A 4B33A 3U7GA 1C9KA 2FVYA 3IESA 3OWOA 2XDQA 4M3NA 4RA9A 4MCJA 4DLNA 2BM9A 1XDDA 2FGJA 3HGMA 3O8DA 3OPQA 2HWYA 3ANMA 2HCRA 3PKZA 4TUYB 4DIFA 2O8BA 4UNPA 3EOAI 1U04A 1FYWA 1NBEA 1C3VA 1NI4A 1AKYA 4FQ5A 4GS5A 1X86B 1J8QA 4JB2A 4MVWA 4LNUB 3L4EA 3SKXA 4ZT2A 4EPXA 2IXBA 3FUWA 5H3HA 4EMUA 4N76A 2XDWA 4EAAA 2YYYA 3FXAA 3PUVA 1SN7A 5FI5A 1NFRA 1DQYA 2ZIAA 1JQAA 5FULA 1DKNA 2O3SA 3WGGA 2WWHA 3KKPA 5EL0A 1B00A 1HH4A 1X1SA 4FYIA 1U7TA 4P81A 5D2CA 2OAQ1 1C4KA 1PU2A 3EXG1 1TYCA 4G85A 4FEYA 5C8ZA 1JMYA 1I0ZA 1NI4B 1VLZA 4CYMA 3N74A 1BS9A 4YALA 5KX5F 4MNTA 4GM4A 2MTBA 3KSMA 4ER0A 1YTUA 1IQ0A 1JAHA 1F38A 2C9DA 2IELA 4OQMA 4Q5IA 4ESHA 2O1WA 5ITZA 2W70A 3KYIB 2IU0A 4EKDA 6PFKA 1THTA 1UOOA 3O8OA 4TKUA 5LA6A 3UYKA 1QIMA 2HNAA 3NEJA 2PXCA 2Q7DA 4JZYA 4BNWA 3L79A 1YDGA 3L40A 5F4ZA 1T2UA 5ANRB 4RSRA 3ZS8A 2JLWA 3FFWA 1VQ1A 2QM8A 2GAJA 4LXGA 4BMDA 1YBFA 3I2JA 2Z30A 4N8DA 4D9CA 1JTVA 1A2OA 2PM8A 2WLSA 4J0CA 4YRKA 1WBDA 3O8NA 3AI7A 1PL8A 3GGSA 3KP1A 2BFOA 4G9BA 2QK4A 3W34A 4NMMA 4IRMA 1KMHB 4PO3X 3NP9A 2MMGA 1OA0A 2P40A 3TIXB 3E9QA 3GQVA 4Y98A 4JLDA 1XCBA 1DRJA 2Z1DA 4IJ6A 4WZBA 4YQZA 5IJAA 3RAPR 1X7GA 3GRPA 3WGJA 5KC9A 3DV0A 5COAA 3MEQA 5IK2A 5I4KA 4H7KA 4HTFA 2XQVA 3IP3A 3MELA 1JG7A 4XSVA 3P9RA 2X8AA 3MLAA 3SQLA 2VSXA 3LQ4A 4BYGA 1Y8AA 4KMMA 4A2CA 1H2ZA 1MTOA 2IY7A 1A8IA 3NYWA 1JHOA 3MYYA 1XR3A 4LSWA 4Q6BA 4MO2A 3OJFA 3UHPA 4KR6A 1QZUA 3QG5A 4WY5A 3V7NA 4TVSA 5KEIA 1XMJA 2DSNA 1JXMA 1S2MA 4NJMA 1X7ZB 4FC7A 5F64A 4AO8A 4KO1S 5DX1A 2SCUB 1DELA 1KVRA 1USGA 1E1CB 1JIQA 3WIUA 1NLYA 4A0QA 1VIYA 2IZZA 3AOEA 3Q9LA 4B2IA 2UUOA 2W6ID 3QY9A 1XHEA 2BIFA 4HCJA 4AZVA 4CQLB 1A96A 1Z7BA 2H1LA 1TUBB 2JFYA 4J2TA 5F35A 4YGXB 3AP1A 1NXPA 2WMYA 1KEPA 5DB4A 2FR8A 3RKUA 4GZLA 5EIBC 4EVSA 3RYIA 2EV9A 4OYRA 3ICCA 1I4OA 1I6LA 4IIJB 4REOA 2QGZA 6REQB 2I4RA 5GJCA 4XWWA 5E4TA 2QG9A 3WWYA 4PLCA 3S99A 3VNSA 2I9PA 4ZJUA 2FZCA 4I5FA 4EPRA 3H0EA 3T1NA 4B2LA 3G8DA 1D6JA 1EBBA 2WQZA 2H1IA 1Y8ZA 4XR9A 5IUJC 3W1VA 3THWB 3QLUA 1MT0A 3ROQA 3QY0A 4O2LA 2CK3A 3ZW7A 2FPOA 4WNYA 1Y8CA 1Z5VA 1II0A 2WNHA 5COBA 1A9QA 2C94A 1R0RE 2B2XA 3RARA 3A37A 5BYKA 1P3JA 3OPNA 1M6VB 4YIHA 2PZLA 4BB5A 2ONZA 4Q3DA 3WK9A 3BWYA 3EWSA 3QEAZ 3ENNA 2P3LA 3FM9A 5DULA 2I34A 2Y1WA 1BYIA 2VTBA 3N0XA 1U9IC 2KWIA 3GPDG 2O0LA 1GPLA 4URWR 3U4MA 2BI7A 3N8GA 1GDTA 1W36D 2ECPA 3V8VA 2EG9A 2W6OA 3NTLA 4NV0A 4D4GA 4D9BA 1UBKS 2PX8A 2UYGA 2JLZA 1ZS9A 2UUBB 1YO6A 3HXLA 4A8HA 2YRWA 5AJXA 2QSYA 3A6EA 2PEYA 2QIOA 2CJFA 5ER9A 1QYCA 5FT9A 3A1SA 3VAZA 1Q17A 3R8FA 2X19A 3FDZB 1FVHA 4B74A 2RB5A 4JLNA 2FMIA 2PKCA 5HF5A 2MYPA 4IJ5A 4DQVA 3NBYC 5J5VA 5JLJA 4BVKA 2VDRB 1EUQA 4EB8A 1R64A 1VBKA 1C81A 4QOJA 1KE2A 4RHYA 1A2KC 1S2NA 1PYOA 4YHBA 1Y9ZA 5AVKA 1NV8A 1W4ZA 5DP1A 2V55B 2R66A 5G0VA 4K9DA 1VRCA 5AI4A 3T0GA 2QRPA 2GH1A 1DAGA 3QOXA 1OWMA 2BHSA 1I80A 2FEKA 3LRPA 4S12A 4EGAA 3A4TA 4CL2A 5IABA 3NI2A 5K8JB 4IGAA 2W2VA 1RRKA 2I8AA 1K8QA 1D09A 3WKDA 3JAKA 2ZUSA 5U4QA 1MPTA 2DUUA 2G7MC 2IWRA 3V00A 3GPCA 2F1KA 5GAJA 4CIBA 2B6HA 2FFAA 2Q1XA 3WLJA 1ZICA 1VHJA 3OUZA 2WD9A 2AZDA 2HDWA 3N2GA 4NP6A 3L0SA 3EZNA 3REQA 3S29A 3BGSA 2E5FA 1FXSA 3O7WA 4IIGA 5JPCA 4GI2A 2ZG6A 4TN1A 1TDJA 3ITEA 4R1OA 3BDAA 4D8VA 3ZZ0A 4F56A 2B69A 1K75A 1FXUA 2RHLA 1T9BA 1G42A 3EXFA 3HZRA 2TMGA 2HU7A 3MN1A 1MQAA 4M0CA 1FVXA 3SEZA 3RWOA 4EHIA 4NYJR 1TUBA 2O8VA 2YNMD 3FHOA 3R3VA 1EVYA 3D3EA 3PWZA 4LZJA 1HXHA 1Z74A 2IZ0A 3ID6C 1ZL2A 3O4VA 4QOEA 5CYOA 3ZWNA 4YRPA 4EJSB 2AEEA 2A9QA 1SHJA 1TOAA 2OR3A 5LOVF 4DHEA 2ZE6A 4WSOA 5IANA 4BLOA 1GG8A 4KX5A 4OH7A 4Y2HA 3WOHA 1ENOA 4MX8A 1O95A 1UR5A 5IK2D 2OXTA 3FUCA 1T8SA 4KQMA 4P3KA 1LVUA 2OESA 1JMVA 2YXNA 2LD4A 3HV2A 4J75A 1T5HX 1ETHA 3A11A 5ERXA 4FR2A 4Q4CA 3C3JA 2WF9A 4H0CA 3GEEA 1RMQA 5JE8A 2BBSA 3RHFA 1HDGO 4II3A 3RVMA 4HX9A 4URUR 1LPAB 4EIWA 4IGIA 4JXJA 2GILA 2J0EA 2P77A 3LX4A 4IG9A 3RF6A 3KR1A 1LBSA 4NEHB 5FV4A 1MBZA 2FPUA 5KHOC 1PJTA 2QSZA 3HRHA 2DXIA 2XTAA 3LT1A 1JR3D 4QU5A 1FDIA 1ULUA 4Y2RA 4YRFA 5HQTA 1P1FA 4MPJA 5C1OA 4GMFA 5TRTA 2GQ0A 4P7GA 3GVHA 3KL4A 1SVUA 3V8EA 4MWSA 5AKIA 2ZAOA 3UV7A 1L7VC 3BWMA 2OSBA 2V45A 4EPWA 3NHMA 1Q83A 4IKEA 4L4ZA 3VKHA 1Y9DA 2ATCA 3AEQA 3ORHA 2JAUA 3AUUA 3H83A 2NUTB 1D2HA 3TYXA 1FSFA 2OTCA 2QE7A 1PGQA 3K09C 3D6HA 2JK0A 3CH4B 4H7DA 4RXMA 2QY9A 3OZRA 4M1KA 2HK7A 2H57A 2QTTA 2VSNA 2PKWA 1ZUWA 3AQ4A 3AHJA 2X5OA 2ZYGA 3DL0A 2CVFA 2P9JA 3GT7A 4L8LA 3UFXA 1NI3A 3ILSA 3R74A 4D79A 2GI4A 4DAEA 1JG6A 4DLUA 4BXOB 4XM2A 3NH9A 3VJLA 4BJ6A 1HYQA 2GBLA 5KDDA 2CXOA 3PPVA 2CSXA 3IEVA 2XE4A 3EHEA 4C4TA 4CLXA 2PH7A 1AF4A 4D80A 4PZZA 4B0OA 4MVJG 1C1DB 3COYA 4HRYA 4MVJI 4DLPA 4UE6A 4NULA 2EHJA 2ZJ5A 1Z47A 3JYHA 1AGYA 3FTNA 5JDCC 4P8RA 2YWRA 2FSUA 2YWXA 3SYMA 2IS1A 2D54A 4ISBA 2DWPA 4LQCA 3IDZA 1SKMA 1ECGA 3MJVA 5KMGB 5EP3A 1W52X 2R47A 1PV1A 2Q2NA 1RACA 2PT5A 1BMTA 4F4UA 5B7QA 2AFIE 4IXDA 4NBSA 3V55A 2IIPA 1FDUA 4ZHQA 3EXEA 1E9RA 1UPAA 1FBTA 3FCEA 4FS3A 2WPDD 2QD5A 2D74A 3AEUA 3NPMA 1RI3A 5A7GA 4E13A 2CF6A 4LZOA 3ZGYA 4WGGA 4ZRMA 4D45A 2J9ZB 4DKXA 4N01A 2VZ9A 1GCUA 4YXWD 4MVJH 4QJ5A 5AYVA 3BJIC 2GGSA 3OF3A 3K9FC 4QULA 5DWDA 2HHJA 1Z0UA 4JL6A 1V5WA 3B82A 4ZU6X 3CINA 4JR1A 3DZKA 4AJ4A 3D8TA 4IXWA 3C3KA 4MLCA 3GGPA 3M4YA 4O4IF 5FTNA 4B6JA 4DIMA 4CIAA 3IXMA 3OCJA 3AHFA 4C1BA 4PINA 1RMYA 4RZHA 4B09A 3GDFA 1ZP6A 4P98A 2FRVA 1KRXA 1ZRHA 1KAEA 4R2JA 5KTKA 1EFUA 2ODNA 3EUEA 4LVCA 1ODSA 4R4JA 1QQ6A 3G82C 3RWMB 4BJHB 1VKJA 2WWYA 3HGQA 3F4BA 2Q29A 3KB8A 1R74A 3AF3A 5CVCA 1NQ5A 1R9NA 3G3EA 4BVHA 4DNOA 5D01A 4F84A 2FMFA 3VDQA 4AZ0A 3PA8A 4E7OA 3PE6A 4JVSB 4KFUA 4OJYA 3GJSA 1CB0A 3QXHA 2XZOA 2V8OA 4YDSA 1DKUA 3GFRA 1GQFA 2VHUA 3OJWA 1KOGA 3KZ1E 1RADA 3GGOA 3MUFA 1RXCA 3PQCA 1SVIA 1D04A 2PZJA 4I36A 1LGYA 2JJ2D 2H2FA 2WE8A 5TARA 4ZK6A 1SVKA 2TMKA 1KOJA 3HDHA 3T5MA 5ALMA 1QP0A 1SUBA 2QTZA 4F4DA 4CKEA 2J09A 4UUNA 1AH2A 2R1VA 5AXBA 2ARKA 2AJBA 1V25A 2P9HA 3S4YA 1NTRA 2C99A 3VPFA 2IQ5A 4ZHSA 3HU5A 2VJPA 2QE6A 4I50F 1JKXA 4MP3A 1JMKC 2QTFA 5HGXA 1HTWA 2H5JA 6CHYA 4Z1OA 1W96A 3KZOA 4G0YA 3TLAA 3KPVA 1ES9A 1I2DA 3U39A 2PR2A 1SBCA 2C5AA 3D4OA 3E53A 5CJPA 3VHLB 3FHTA 3O1IC 4HAVA 4YASA 5GVRA 4BE9A 4G0OA 5JI2E 1DC8A 4JLAA 3OM9A 2YQ5A 1U1EA 2Z9BA 4YT5A 4ZVPA 1OTYA 1GFIA 4BB9A 4QVKA 5CG2A 2PL1A 5P8WA 5TS3A 2XNCA 2A5LA 1G1MA 1WXGA 3DZDA 4ARVA 4OQDA 1YUMA 4JLJA 3QPDA 1G17A 4J7CA 1WUTA 3O8CA 4YJ2A 3OICA 3BF8A 3KPYA 3QVWA 4QYTA 2VP9A 2XF2A 3HZZA 4RGVA 1V95A 3Q12A 4TGLA 4EHJA 3RADC 2IOYA 1PKXA 2YZ7A 3LUAA 4Y2XA 4DR7B 2JGDA 1E3MA 3T0IA 3WXMA 3GEIA 2A86A 3N2NA 5LP6F 2C58A 2GAFA 1RIFA 3WB0A 3L7LA 2XYPA 3WLRA 1T25A 3LW7A 5FOTA 1H2BA 1P2GA 2IPNA 1I6WA 2EFHB 2VH1A 3UO8B 2H5IA 1JEEA 1LI4A 1N7GA 4P84A 5IHPA 4R9NA 3WC4A 1L8QA 1LC0A 3NBMA 4GI5A 1U9JA 4DF3A 4GKKB 4L8YA 1M6YA 4K6HA 3JRXA 2QN7A 1OYWA 1KOLA 3EXHC 4N0EA 1EFAA 4KNVA 2HIAA 4LC1A 4PYRA 2QAGA 4RIFA 4WKBA 5BN1A 4CQNA 1R2QA 5ECYA 1BU5A 4BGEA 1UDCA 2ADMA 2FN7A 4CUKA 4HVLA 4O2AF 2XA1A 1WCV1 4DTCA 5A1JA 1M74A 4Q4HA 1ZIDA 2IZ5A 2IPMA 4B4DA 1OGJA 4R1UA 2O8CA 2I6QA 3NORA 2O23A 4XLLA 3Q7SA 4RDIA 5BWOA 4KV9A 3K8YA 3L8DA 5LD2B 5DBEX 2I8LA 3O8RA 1HNWB 3KOOA 5DJ5A 3PUIA 2IYSA 1AA6A 4GR5A 2VHXA 3V1MA 2UZIR 1Z8DA 4DIOA 2WAAA 1ZH4A 3BA6A 2FF7A 4LV8B 1X1DA 1JJVA 2ODPA 3E7FA 3LXMA 3HP7A 3R3ZA 5CH8A 1TT5A 3MJTA 2F1OA 2FWNA 2Z1MA 3CW9A 2ZPAA 3HL4A 2DQ4A 3R41A 4MDYA 5LXTF 3VU8A 3VJMA 2OPBA 1IAQA 1XKQA 1Z28A 1I2MA 5H5JA 2NU7A 3EC7A 2P6RA 2YMLA 3OIYA 2QNRA 4AJ9A 4FFRA 2F3QA 1QE3A 2RGAA 3K32A 4MARA 4PW0A 4YBZA 3JYNA 5TDHA 4B4WA 4C2BA 2Z6AA 3UCEA 4QVGA 1ZM9A 1OW3B 3QJYA 3EISA 2VNHA 4GD3Q 3OF2A 1YBHA 4TQGA 3EZLA 2JZCA 4KFTA 3QBEA 2H92A 2PGLA 3MWLA 5FP0A 4E5KA 3W8DA 3MIZA 4K1LA 4HPXB 3DVRX 5JXGA 1FS5A 2X4GA 2P8SA 4YUWA 1RHJA 3PENA 1L7PA 3AESB 1FS4A 4R41A 3TJMA 5GIOE 4Z1MD 2W6CX 3NX4A 3PTAA 1U28C 3F5DA 3K2EA 3PUYA 5K09A 3MTEA 2GVNA 3JVIA 3BD8A 4LJLA 3UJDA 3GFTA 3HCOA 5ETJA 1ZK3A 5KTYA 4KQXA 4PRZA 3ETNA 4KXWA 5U1PA 2HK8A 1II8A 3RJZA 4JOBA 4NE7A 1TVMA 4IMJB 3TJRA 1QHGA 4CF4A 2IPLA 5LOVA 5CFLA 1G9SA 1VGQA 5CCXA 2DYKA 2XKAA 2YJ6A 3GP5A 4A6XA 1A7UA 5BURA 3HMKA 2BP7A 1ULZA 1TJ3A 1OTHA 2C0QA 4NCXA 2JRLA 4R1PA 3ZNOA 2QXTA 2AQKA 3FYDA 1T2AA 4L0DA 1LRJA 3IBCA 3DDZX 2HM7A 2N3ZA 2X8BA 4K9PA 4C06A 3K6SB 5CITA 2O8EB 4XUDA 3REOA 1JT9A 2D1SA 1IEWA 3D3JA 2PRZA 1NP6A 1SCJA 3TTUA 2I7DA 4EH1A 3LKBA 3JASB 1RAHA 4NZNA 1DUVG 5ICEA 4NYIR 1IXRC 1NR1A 2SBTA 1TCUA 4CN9A 1RQ7A 2Q2QA 3IP8A 1B6GA 4G41A 5LMZA 1Z0SA 4NU8X 2HWWA 3QFHA 2BBOA 2GM3A 1NQUA 4NBNA 1QCZA 2IUTA 3QXSA 4QUAA 4N3AA 3WLHA 1E0SA 4BPRA 5C32A 1BDHA 4LJRA 3MXOA 3KVNA 2BMJA 2W8BA 3H18A 3CZRA 3PPYA 4IILA 2NU8A 2J87A 2PCLA 1T6YA 3AHHA 3AOGA 1YQXA 3A9UA 3ZD9A 1M2EA 4ERNA 3TOZA 2OCKA 4C08A 4D57A 3PEWA 4PYMA 3P9SA 1YF3A 4AMVA 3TE7A 2O48X 3WL8A 5BT8A 3JS5A 1D6NA 4RA6A 2OECA 3K3PA 2M1ZA 2ZWIA 2J3KA 1Q19A 4D3ZA 2PGJA 5DIFA 1CR2A 2O1EA 5KJ6A 1W76A 3U44B 4JZKA 3OQPA 4HZUA 4TYPA 4YRSA 2J85A 4OBEA 1VI5A 3N86A 3RJ5A 1EB8A 4KWTA 2XYGA 1Q84A 2XUZA 4NICA 1LZKA 3HDTA 3ML1A 4X3OA 2JGIA 4RPHA 3V32A 2LW7A 2DFKB 1L4GA 3C8DA 4MUHA 4PZLA 4TSFA 5AI6A 2VA9A 4RIIA 2D5IA 4J1SA 2MSKA 3KJFA 1UPBA 5HJ5A 1PK9A 3GH3A 3IX7A 3W5AA 2I9KA 2WFMA 5FWNA 5TVKA 2CNWD 3D6AA 3FR8A 2GFIA 3CRMA 3U3DA 2CLDX 3U7EB 4RD0A 1QONA 2I3GA 2NV0A 4J4HA 4XQGA 4EEZA 2X1MA 4LMBA 4XCQA 4CF6A 2XGGA 2FDRA 1AKMA 3R3WA 4D0GA 2I80A 5BSFA 2XWBF 3N28A 1AS0A 1KMCA 3I28A 4RTJA 2X13A 3JALB 3D5TA 1LDNA 4J16A 4IDOA 3QSYA 1J20A 3LXXA 4MP8A 4L78A 4E4RA 1YHZA 4IX1A 5D3MB 1J1UA 1E7RA 4HBZA 4KWEA 5CX1B 4QJ3A 2FPSA 5FV7A 3JCZA 3CLSC 3LK7A 4XIJA 1A7AA 1YTLA 3C6BA 2KE5A 2QD3A 1M6HA 4KQGA 4CW7A 2AE2A 2DPHA 5KWIA 4UEQA 3HLTA 5J5AA 3FPJA 1H85A 3U5ZB 2A7XA 3AFHA 2R6HA 3EGXB 3X1DA 2TS1A 4IGEA 1LSUA 1S7GA 1T43A 2F59A 2R8BA 1DX9A 3MQ2A 4Q12A 4ARBA 2JHFA 3AK4A 2RHWA 5LQNA 4M9XA 3C7KA 5ALOA 5LC1A 2HH9A 3QVTA 1II8B 1G7CA 2N75A 4K1XA 1RZUA 4LRXA 4UM8B 5EZ6B 2UZ3A 1SXGA 4RACA 1IJFA 1QE5A 1U6KA 2ZK7A 3OFVA 4JJ4A 4B4UA 1YA6A 2AUMA 2XX3A 2D2EA 3BFJA 1HDIA 5CGQB 5KQGA 2BZ1A 1EZ1A 3HA5A 4FFOA 1GQOA 4LNHA 1NDUA 3UK7A 1E9FA 1NHGA 2B5OA 3HJGA 3L84A 3OAAD 5FWXA 5C7OO 4X7BA 4JD5A 5HCIA 2YUIA 5IM5A 4RKQA 1UJ4A 2JDIA 3DCJA 3M3HA 2VYVD 4UU0A 5T57A 1LF0A 1VKHA 4L76A 2FPIA 3SLGA 1RJWA 1BOFA 1WHTB 2PWAA 1QS0B 4GMHA 1XP8A 1L7AA 2JFFA 2ZAGA 2ACVA 2B98A 2D5CA 1SCQA 5FUWA 1G6Q1 2Y3IA 2IYXA 3QVKA 2G36A 5FUQA 3THXA 2VBGA 3B6EA 1RPTA 3TW0A 3F8WA 3TLGA 4MKFA 3A3PA 1H6BA 5HIJA 4ES6A 4N65A 3FPEA 1RYMA 1U94A 2JATA 2WP8J 1M1YA 1CD5A 3H8VA 4IQFA 1I13A 5DCWA 4DNQA 5E6RA 3OX4A 1PJZA 2YVKA 2BC9A 5ALLA 3IDQA 2BHTA 3DBLA 3PX3A 4EGJA 1N2CB 5EJ2A 2ZUVA 3OM0A 3EVTA 2GN4A 4EYSA 3U5TA 2IGBA 5EJ8A 3BGOS 3C41J 4AXBA 4XZ3A 3QLVC 4EVIA 1FJ2A 4TKVB 3IIKA 3GBPA 1EXWA 1OAAA 5B6PA 2O8FA 2G70A 3RV4A 2PTHA 3L1UA 4AUEA 3LPMA 4M36A 4C4YA 3T1TA 2OB2A 1FDRA 3RIEA 4RGYA 3OA2A 4X20B 2D0DA 1BDMA 4Z4EA 4DA4A 4TV8B 1E6CA 3A14A 3IAS6 1NY6A 5BSTA 3WGOA 1WP4A 2PSHA 3FE2A 5L8VA 4LDZA 1H05A 3SBOA 1XN4A 4G8CA 2GOYA 1A2BA 3V4PB 2IYPA 3C3WA 5CA0F 3PC8A 1YZNA 3LZDA 3H1TA 3SVZA 4F3CA 1XDWA 2VAVA 3HJTA 2NTJA 1WMAA 2CC2A 3DDOA 5K7SA 3W9YA 3Q0EA 5CNIA 1GTJ1 4WLVA 1FMTA 3SMVA 1G8AA 1MB0A 2EFDB 3GI1A 2JAWA 3DDNA 5E1MA 3UPTA 2QPTA 4WW0A 5EINA 1CZUA 4NF2A 1PLLA 3O9ZA 3DE2X 1F2UA 4TL6A 4G1FA 3BRWA 4W1QA 3TR5A 3PQ6A 2EOAA 3N6XA 4BZWA 4D56A 4NJMB 3GJZA 3TEMA 4EUEA 3GF4A 4A8TA 1XZGA 3BD9A 2NM0A 3JQEA 4Z6KA 5C51B 4F8YA 2Z58A 2WJWA 3FPLA 3GLKA 4QYIA 1JIXA 4EARA 3REGA 4D8XA 5FNVF 4A0RA 3DKPA 5E2BA 2R97A 4C0SA 1J97A 2CJYA 3RVKA 1GUAA 3E48A 4ZIRB 2AMJA 3AY7A 3MTJA 3D3QA 4WMLA 2PBZA 2PA3A 1UK7A 5F5NA 3S44A 5IAOA 3HJRA 1DQZA 1ORWA 1V3UA 1QU2A 4S1WA 4EY7A 1OVGA 2J30A 4DJJA 5LQMA 3Q7EA 3UMSA 4I1SA 2FYTA 3F6SA 4N5MA 3E1GA 4NENB 3F78A 5EVJA 4RENA 1H8EA 3UJBA 2REQA 2PXXA 1AY0A 3IBGA 4A8JC 1SUSA 3ZHTA 3SS7X 3B6ZA 3NFRA 1PS9A 3RBAA 3KSRA 2ZR0A 2XXJA 4LSMA 3UBMA 4JEMA 3AETA 4I50A 4L16A 1M5TA 3MWEB 2M6RA 4OLHA 5LWHA 4I8DA 4XLTA 2R1VB 5K3EA 5GGYA 4R8SA 1A98A 2TSYB 2V98A 4Z8XA 3MS4A 4I99A 2PJDA 1IN7A 4WERA 3SBEA 3HZHA 2Z3ZA 3ITKA 2JJ1A 3W5VA 3U7QB 2JIBA 5E0OA 1TYZA 4AMBA 2VPIA 4FHGA 4DILA 1G3MA 1SELA 2OD9A 2HSZA 3HJNA 1A4IA 2A9JA 4FONA 4IIJF 3WIBA 1UM9B 3PLRA 4MROA 3KR9A 3BMOA 3QVLA 3SYRA 5BWMA 1VZ3A 2H1HA 2ZUTA 4JYZA 1AB6A 5IAJA 3VKGA 3B9QA 1KPGA 1QHXA 4NOJA 1L5HA 4B4VA 1Z6GA 1U0GA 4O8ZA 3S5UA 1TA4A 1MW8X 3N8KA 1KPHA 1RNLA 4KQIA 1U8EA 2X6TA 3NMUF 1AV7A 3ELYA