4GQAA

Crystal structure of nad binding oxidoreductase from klebsiella pneumoniae
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
388
structure length
376
Chain Sequence
b'ARLNIGLIGSGFMGQAHADAYRRAAMFYPDLPKRPHLYALADQDQAMAERHAAKLGAEKAYGDWRELVNDPQVDVVDITSPNHLHYTMAMAAIAAGKHVYCEKPLAVNEQQAQEMAQAARRAGVKTMVAFNNIKTPAALLAKQIIARGDIGEPVRFRGTFDQGFYNDPNLPWSWRCSKTLGGSGALGDLGAHTLSVAQFLLGGIREVTASAQTCLRQRPVPDAEWREVENDDQVQCLVNFDSGAAGVIEASRIAAGRIFGVFWEVSGTEGTLYMDGERFNELQVYRFNDDKHDRGFKTLYAGSQIPAYAGFFGFDFGGGGLGYFDVKVIEVHDLVQGICGDDDCYPNFEFGLQNQRVLSAIEASMVSRRWVNVVKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD binding Oxidoreductase
publication title Crystal structure of NAD binding oxidoreductase from Klebsiella pneumoniae (CASP Target)
rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
total genus 120
structure length 376
sequence length 388
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4gqaA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gqaA01
3QJ5A 1Z7EA 3BTUA 4CLEA 5KTKA 4ZA2A 3T4EA 1B8PA 4BNHA 5BNFA 2AQ8A 3OHSX 3KXDA 1CWUA 1C0KA 1M67A 1QMGA 5BSFA 4UVGA 2H63A 2BF7A 1PL8A 1JVBA 2HO5A 1CEQA 1LDBA 2FY8A 3HDJA 1TEHA 3OJOA 1DJNA 4CJXA 4BUCA 4YAEA 2EJVA 1VJ0A 4RF4A 4DXHA 3MWDB 4NFHA 3IC5A 4PRKA 3C3XA 2EHDA 1Y5MA 2WM3A 5TLSA 4GVLA 3L07A 2FR8A 4IS2A 1EK5A 1J0XO 1K89A 1EBFA 1PJTA 1ZJZA 4DLBA 1LI4A 4B79A 4CLRA 2NTVA 5HBRA 2UVDA 2NQTA 4L73A 4AG3A 1N8KA 1YB5A 1VC2A 3WNQA 4BL5A 3WXBA 3JQDA 3A14A 1NYTA 3C7DB 1X1EA 2BGKA 3UAGA 5A5EA 2AE2A 1NWCA 3GEDA 5K0ZA 1FDTA 1BRMA 1X7DA 1AXGA 2JCVA 4TKMA 3RUFA 2CD9A 1EUCA 2HMVA 3AOGA 2GN4A 4M55A 2D4AA 3QLJA 3DZBA 4II2A 3KZVA 4NFYA 4ZQEA 1HLPA 4CQLA 4TVBA 1Q7GA 1X7GA 5IDYA 4YQZA 3RC9A 2WSBA 4IMPA 1MC5A 3GC6A 2HK9A 4HKTA 2JAPA 1U5AA 2YFQA 4I8XA 3JQCA 5L3ZA 5AYVA 1UDBA 2EKQA 4PLCA 2BI7A 4BNGA 4HX5A 1GY8A 3FRJA 4GMFA 1WLYA 2CDBA 3S2FA 1LC3A 3MZ0A 1DHTA 5HTOA 3TPCA 3IP1A 3M1LA 2Y05A 4EUHA 4FC7A 3VTZA 1ULSA 2D59A 5C37A 1O6ZA 4FFMA 4MVJG 4YJDA 1O0SA 1JU9A 4L4RA 5DZSA 4CM9A 4UVEA 4BO2A 5A4DA 3I6IA 3ENKA 4PG4A 3CUKA 5KWEA 3JD0A 1BG6A 2VHVA 4NK4A 5CPFA 3FNEA 3GQVA 3RBZA 5T67A 1DSSG 4AJOA 2WYUA 5JC1A 3V5NA 3I9JA 2D3TA 2W2LA 3M2TA 2BFAA 4DQVA 5B37A 5A02A 5AXDA 3RUHA 4AJHA 4A7PA 4L0QA 4J0FA 4CQMD 2DUUA 1PGQA 4R3NA 4BNMA 4DMLA 4GKBA 3CMCO 3Q2KA 1X15A 3CEAA 3INTA 3PYMA 4LGVA 2NADA 3RUEA 3TDKA 1KY5A 2VOJA 1NHWA 3FF4A 3LT1A 3O26A 1MG0A 1I2BA 5IZCA 3U49A 3FD8A 1NAHA 4B7UA 5T57A 3IIEA 4NIMA 3G17A 2YHIB 2FMUA 1HXHA 3GFBA 2AQIA 4KMSA 5KOIA 3AM3A 1WMBA 3LU1A 4GX2A 2QHXA 3GMDA 4RVUA 3D64A 5K6AA 1BGVA 2IODA 1K6XA 1WVGA 3H7AA 2YHUA 4E21A 2QW8A 1P33A 2YYYA 3ASUA 2HJRA 4OSPA 4CLOB 2OMEA 2J6IA 1PJLA 4CMCA 4LVCA 1E92A 2AEJA 4A0SA 2J3KA 3E48A 3BTVA 3BHJA 1DFGA 2B0JA 2PZLA 3WLEA 4ROSA 4DL9A 2OXIA 4RF3A 1TLTA 1BHSA 2J3HA 4D46A 1DO8A 1CRWG 1QRRA 3WMXA 3FBTA 1I32A 2HMTA 3PPIA 4J7CA 4ND5A 3S2EA 1GCOA 2XPCA 2P9CA 4DPLA 1M2WA 4NU6A 4JBGA 1FMCA 1P77A 3JQ8A 4CMGA 3WGYA 3WGQA 2ZATA 2PWZA 1U7TA 3RQSA 1O9BA 3DOCA 2IXAA 4FB5A 4Y9DA 1Y6JA 4FBGA 2J3IA 1ZW1A 1ENPA 5THKA 4IDDA 5IN4A 3U4DA 1DIHA 1DAPA 3L9WA 5TJHA 4W82A 2PZMA 3GOHA 2PGJA 1E1MA 4U6QA 5JMPA 1JTVA 4Z6KA 4Z0TA 3NRCA 1YL6A 1BMDA 4MIOA 2B37A 1E6EA 3GG2A 4C7KA 4XD2A 3DOJA 5JYAA 2NVBA 2JCXA 3EVTA 3H9EO 3QWIA 4GI2A 3SX2A 4E32A 5HRUA 4MINA 1E3JA 3GA0A 3DB2A 4BNZA 4D45A 3JD4A 5DCUA 3L4BC 3AW9A 3QVOA 4P38A 2Q49A 4WOKA 1YL5A 2PV7A 5A9RA 1Y8RB 1P1FA 3ZWAA 2DU8A 3H9QA 3ZU4A 4ZJUA 1Y9AA 5TT0A 2IDZA 1OMOA 3BMQB 2X7HA 1G0OA 2O3QA 4D7AA 5JYDA 5JO0A 1K6JA 3C8MA 1DIGA 2Q2VA 3RFVA 2ZJ0A 3JQEA 4MVJP 3WQRA 4CMEA 3PQFA 4N5MA 4WLUA 5CPBA 4JLWA 1IY8A 1U4SA 2CVQA 4RPGA 4R69A 5A06A 3ANLA 4L76A 3F4LA 3DR3A 3U5TA 5JYEA 1D1SA 1A7KA 4QO7A 1M6HA 4J16A 4BNNA 1ZNQO 4B3JA 3QY9A 1H6AA 4P4LA 5BNTA 5C7OO 2EIHA 3K96A 4TRNA 2D5AA 2VTEA 4I1IA 3DBLA 4U7WA 4BB5A 1PS8A 1SB8A 5TF4A 3SLKA 5T6BA 4B3IA 4Z0PA 2P5YA 5JYFA 3PYXA 1F12A 4QSMA 4FD3A 3VZSA 2G76A 3PJGA 4YT5A 3O8QA 3OP4A 2GN9A 1DOHA 1Y1PA 1E7YA 3ZDFA 2O48X 4LCEA 4JX8A 4D0RA 2RHCA 5JAQA 1VLLA 3R3JA 4XIYA 3OJ0A 3HFGA 4OIMA 1F8GA 2PR2A 3VH3A 1MG5A 1LU9A 4BVAA 2EW2A 1YE3A 3A4VA 1ZBQA 2C07A 2H9IA 1ZJYA 5CDSA 4EW6A 4YQYA 4R16A 3RUIA 3TZCA 4TRJA 1I33A 3C24A 3GZNA 3ZW8A 4E12A 2IZZA 4QECA 5JW6A 1GFSA 4WGGA 2XXJA 4YJHA 2X9VA 3ZCXA 3WYBA 1BW9A 1TT5B 3AY6A 4II3A 4FR5A 1XG5A 1ZUD1 5T64A 3VPGA 1X13A 4YT2A 3V2HA 3E82A 3E9NA 3ZHYA 4RQTA 1DC6A 2ZK7A 2ZJ1A 4NZ9A 3IOYA 2P68A 4FFNA 5GMOA 4PZEA 4I5GA 2UYYA 5IDXA 2G0TA 3L77A 3UHAA 3ANMA 5HM8A 1E7RA 4DIBA 4AJPA 5T73A 3P19A 4BO1A 4HNGA 4Q3CA 1A27A 2PH5A 3JYPA 4OQYA 1RJWA 2Y1CA 2Z5LA 1Y5RA 1KOLA 3TFQA 3PK0A 1ML3A 1JW9B 3HQ4O 5U1PA 2J5KA 3A9WA 3ZV6A 4XDYA 4JP3A 3HDHA 1PZGA 4FCCA 5I7SA 4Q3NA 4URFA 2HMWA 1LQTA 2F1KA 3BAZA 5HA5A 4Z3KA 2PD3A 1GQYA 4W9NA 4BB6A 3WB9A 4DLAA 3U3XA 1OZAA 3DBVO 1JA9A 3EGOA 1C1XB 4N18A 3H2SA 3VKUA 1GZ6A 5IZCC 3C7CB 4MVJM 2JL1A 1TA4A 3B70A 3DZFA 3A1NA 3OEYA 1I3MA 3NT4A 1W73A 1G0NA 3GG9A 1ISIA 4RVGA 1R12A 4Z3DA 2GZ2A 3VDRA 1DLJA 3QP9A 3WBBA 1PJCA 3AWDA 1P0FA 4CM9D 2B69A 3UOGA 3NUGA 5K6AC 4UVIA 3ZWCA 4DUPA 4ID9A 3KV3O 3SLGA 3EZYA 3ZGYA 5BSGA 5IFLA 4CM8A 4O0LA 5EIOA 4NFSA 3W4JA 1Y7TA 4D0SA 4O6VA 4BNLA 4D3DA 1PSDA 1Y81A 1GDHA 4B4UA 3QRWA 5KVCA 2X22A 1EBUA 1J49A 1DHRA 1U4OA 1YDEA 4LSWA 4OJNA 4A2CA 2O7QA 1KVQA 2V6MA 3G3EA 1EEHA 3GRKA 3RUAA 4PLGA 2R00A 3INRA 3A28A 5EPOA 4PN3A 2P91A 2WEKA 3SJUA 1YOVA 2I99A 2QRKA 3ZHXA 3NJ4A 5HS6A 4IINA 2A35A 4NBUA 1M6WA 2OORA 4O63O 1FDUA 4K9DA 2I6TA 5ICMA 2PD4A 4QT0A 1KEVA 1MX3A 3GNQA 4G2NA 4DBVO 4UUPA 1C0PA 1A4IA 1UDCA 1HDRA 3WYCA 4YPOA 2VNAA 1BTOA 1T26A 3QWAA 2HAEA 4CUZA 4W6ZA 3TZQA 2PZJA 4J3FA 4M86A 1V6AA 4N5LA 3LF2A 1P31A 2QQ5A 2QRJA 5FEUA 2YDXA 4TRRA 3C1AA 1WWKA 3RUDA 5L7TA 2CF6A 1PQWA 4YR9A 3JQGA 5EJ2A 5L53A 3ASVA 4OQZA 4J49A 4ZGWA 2OL4A 1Z75A 4P22A 3AUSA 4UUOA 1VJTA 2DFVA 2JFFA 3GK3A 1W4ZA 4PG7A 1OC4A 4YACA 4GX1A 2CUKA 4J4BA 2DM6A 3Q3CA 4W4TA 1DIRA 3PWKA 3WBFA 4AICA 3WLFA 4M54A 4CQMA 2GNAA 1YBAA 4B3HA 1R4NB 5JBIA 2WDZA 2Y0DA 3AY3A 3QIVA 1RM0A 4XQCA 2HJSA 1KEWA 3CTMA 3PDUA 2OO5A 2DUWA 4RCVA 3I9LA 4YVFA 1ADCA 1U2DA 5ES3A 2G5CA 3GLQA 2DBZA 3R0IA 4E2ZA 4E3ZA 4MP3A 1QYDA 5KVQA 1ZVMA 3U4IA 4CMEC 2CDAA 4WLFA 2RIRA 3MOIA 1EK6A 1EVJA 3I4CA 2GD1O 4F6LA 4D44A 4NG5A 2FHSA 3UFXA 4PRLA 4MVJH 2Y1OA 3H5AA 5MDHA 2YV1A 4GVXA 2CVZA 4CQLB 2H1SA 3WTCA 1V0JA 5F5NA 4XWYA 4BO3A 2BGMA 1JAYA 1A9ZA 1R37A 3JQ7A 1SZJG 4Q39A 4FFOA 5KKCA 2JJYA 5JO9A 5EQFA 5AXCA 5H82A 1WAMA 3WX0A 3X2EA 4E4YA 2Y68A 4ESOA 3DHEA 5G0UA 3RJ5A 2NSDA 1N2SA 4GLOA 5IF3A 5MGBA 1A72A 1O5IA 3PLNA 1DC3A 1VRWA 1N1EA 1XQ6A 3U62A 2C2XA 4CM3A 1WXDA 3BMCA 1MV8A 3Q0EA 3OFSA 3PRJA 1XYGA 3VPXA 2RH4A 1EUZA 2E6UX 1VKOA 4RDHA 2C20A 3V8BA 3OMLA 1EQ2A 2P2SA 2VUTA 3VKVA 1YJQA 3W8FA 4M89A 3ROQA 1A71A 3GDOA 3S1LA 3DAFA 3ZNOA 3PWSA 1J4AA 4UVHA 3ZNQA 1WZIA 4YJGB 1DRUA 3RC2A 1ENYA 1JWAB 3FPCA 1Y8QB 2HSDA 1YBVA 1U8FO 3AUUA 1CF2O 3HDQA 3LF1A 4ALMA 4B4OA 4BGVA 1PIWA 4E6PA 4E5NA 3RC7A 2O7SA 1ISHA 4XR9A 4IY1A 3ZNPA 4CV2A 4WLVA 5EMHA 3VH4A 1MUUA 3IMFA 3TQHA 4WK6A 1WNTA 3OA0A 4LSMA 1U2GA 3PHLA 3ORFA 4MKZA 4BO0A 4BQRA 3R3SA 5TRTA 1V3TA 1PJSA 5G4LA 3PP8A 1RYDA 3QVWA 4JBIA 3NDIA 1HRDA 4AJEA 5F1OA 2PLAA 3DFUA 1NTOA 5JAZA 1LRJA 3D5QA 3VDQA 1LQUA 3IKVA 1T1SA 4AJ4A 2VOEA 4R51A 1YXMA 2BLLA 1M76A 2JHFA 4G81A 3ST7A 2ZYAA 1KVTA 2GN8A 5ENDA 4ZRMA 2D5CA 1M66A 2IRWA 2GYYA 3EC7A 2V6BA 4I5EA 4OHUA 3PJEA 4MP6A 4DGSA 3L4BA 3JYNA 3TOZA 5IDQA 4AFNA 1CJCA 3U09A 5KCZA 3PFWO 2B5WA 4W9NC 4BGIA 2X0JA 4PG8A 1PTJA 3BHMA 1NPYA 3OQBA 4YDRA 3JQ8B 5FI3A 4TZKA 3W4IA 4IZIA 5DBFA 5TX7A 1JKJA 4PLTA 4MJLA 3HE3A 3LZ6A 4M87A 4XGNA 2Y99A 1D8AA 3I83A 1P1KA 3X2FA 3QWBA 1MFZA 3HB4X 3MOGA 5ICSA 3NAQA 3ZU2A 1B0AA 3FTPA 3LSYA 4RDIA 3ICCA 3EW7A 4E5MA 4YAIA 1ADGA 4OXKA 1ZK4A 1PU2A 1QYVA 2HUNA 4JN6B 3P2YA 3TRIA 3FSRA 4DVJA 2EEZA 2AXQA 1XGKA 2DFDA 2EV9A 1SC6A 2C54A 1ENZA 1HE5A 5U4QA 3BA1A 4A03A 5JXWA 1ISGA 2R00C 1EVIA 3ZI0A 3E18A 1P1HA 1GTMA 3I23A 4ND4A 5F21A 5T8KA 1TI7A 3GT0A 3PHJA 1EVYA 3F46A 1P44A 1E7QA 4QFCA 2NU9A 5F5LA 1HYEA 3HB5X 4PVDA 4OH1A 1QXSA 4HFNA 1IB6A 1N9GA 3HUDA 4EUFA 3D3WA 3W4KA 3DBRB 5ADHA 1R16A 2VUSA 1MFPA 3BHIA 2Q2WA 3KEOA 3CKYA 3DHYA 4ND3A 4AJLA 2BELA 4O5OA 1XSEA 2WE8A 4DQXA 3H9GA 3DQPA 3KYCA 3PQDA 1T2DA 4YA6A 4WLOA 3JQAA 1ZK2A 3LK7A 4GQAA 4FOSA 4YJFB 3HADA 1BDMA 3KRTA 1H6BA 4NHEA 1SOWA 2WD7A 1E77A 1UR5A 1H93A 1IL0A 3PHHA 2ZB3A 1UXHA 2ZYDA 3PIDA 1NP3A 4WCFB 1PR9A 3RROA 4GX5A 1CQJA 2UV8A 2WYWA 3VZQA 1WMAA 2IZ0A 3U4CA 4FPXA 3DOOA 3H5RA 1KERA 4UUMA 4WE3A 1FK8A 1RM3A 1Q0HA 3H3FA 2PFGA 3DZIA 3LYLA 3PLRA 4ZQGA 4CUKA 4GL4A 1GZ3A 3CSDA 3B1FA 4CM4B 1LEHA 1NQ5A 1E0DA 3AU9A 3HWRA 2IZ1A 5COBA 4I5FA 1P9LA 5AVOA 2QZZA 2Y0CA 3F1KA 3ZHBA 1HDOA 8LDHA 1E3EA 5ITVA 1MXFA 3OBBA 2NWQA 3O8QB 1RYEA 2GUGA 5KIAA 3NDRA 4UVDA 4FFLA 3RU7A 1DFIA 1DBVO 1H2HA 2JD1A 2C82A 1UXGA 5GZ6A 1L7EA 3MEQA 4CMKA 3UUWA 1ZSYA 4EJ6A 3EAGA 2WTBA 1JKFA 3T7EA 3EYWA 3TL2A 3OIGA 4Y67A 4YWJA 1YRLA 4CODB 3I9NA 4FFRA 1BVUA 2UAGA 2X5JO 3DMTC 2OGUA 3NDJA 4UAGA 4CMIA 4E0BA 3S55A 4BV9A 2NQ8A 4LCJA 1ARZA 5IDWA 3ZZNA 1GADO 1EMDA 5A9SA 1YONA 2UUOA 3RFXA 2X0NA 1P1RA 1XQ1A 3MJTA 3PZBA 1PX0A 3DFZA 5TC4A 3DTYA 1IPEA 4BKUA 4IIVA 3WICA 4GLLA 2J3JA 1P45A 2J5RA 3RI3A 3LT0A 4XGKA 3PTZA 4XQ9A 1YKFA 1ZIDA 3BXXA 3DZKA 3FBGA 3ZWPA 4EI2A 4BKOA 4LMPA 1MB4A 3OQ1A 3WIEA 2GZ1A 4HY3A 5M6DA 2X9NA 4R1TA 2NACA 1GPDG 4ZICA 4FDAA 4RF2A 1BXZA 2QX7A 1GUFA 2XOXA 5I9LA 4KP7A 5DF1A 1U7HA 3IUPA 2O4UX 4XDZA 3H3JA 1BXKA 1E3LA 2Q2QA 5CDYA 4GMGA 1SO8A 5TGDA 4DIFA 4TROA 3PFFA 2FP4A 3OJEA 2PY6A 2VHXA 3Q11A 4ZN6A 2O2YA 3ZWMA 2FR1A 1UAYA 5H81A 4IDFA 4QUKA 1V35A 1HDCA 4CR6A 3K30A 1PJ3A 4NJMA 4Z9FA 2VWGA 4WLEA 3NYWA 4CPDA 1HSZA 2X5OA 4EEZA 8ADHA 2X4GA 1MXHA 4M8SA 4FSHA 3RIHA 4IJWA 3D4PA 1B8UA 2D0IA 2JFGA 5HWSA 3OM9A 3TSCA 4XRGA 1QSGA 3TZKA 1ZO8A 4K28A 1ZH8A 3K6JA 1LJ8A 3GVHA 4R54A 1UUFA 1GYRA 1XDWA 4DPKA 4C7JA 3LC7O 1DPGA 5G4KA 1YGYA 3H2ZA 5A5FA 4CM8B 1H0KA 2VT3A 3GVCA 2HCTA 3JQFC 1DFHA 3ADPA 4KWIA 3G1TA 4I08A 3T4XA 4D79A 5L9AA 2Q1WA 1OI7A 3ZV5A 4RQUA 4ND1A 2JD2A 3K92A 3PWZA 4OYRA 4ALLA 1I5RA 1YQDA 1U3VA 2EKLA 1ISFA 1G1AA 3MJSA 2CFCA 4Y6RA 5L7WA 4DLLA 1E3WA 1KS9A 3KYDA 3BMOB 3I52A 5HS4A 3QVXA 1J5PA 1F17A 2HMSA 3LLSA 4CLXA 4FOOA 1CYDA 1Z7BA 2D2IA 2P9GA 4L4XA 3GDGA 4JNKA 2ZKLA 4N7RA 1GCUA 2OUIA 5U9CA 3KBOA 2H5LA 1QLHA 1I3LA 2I3AA 4QEDA 2HKIA 2PK3A 4J6FA 4NJOA 1KETA 3FN4A 4IGEA 1UXKA 4LW8A 5G2OA 3RD5A 3RFTA 3ZU3A 3E9MA 2I67A 4GBJA 4XCVA 1XHLA 1ZEJA 2QG4A 1HKUA 3WDSA 4R68A 4H7PA 1T2EA 4J1SA 1ONPA 3H4VA 1DC4A 1GQ2A 3ITKA 4GKVA 5DP2A 3DL2A 1LLDA 5THQA 3AK4A 3TZ6A 5JFOA 4U6SA 2B5VA 4KQWA 2XF8A 5L7YA 5A3JA 4K6CA 4RGBA 2GN6A 1D1TA 1EDZA 3K5PA 4FC6A 5JNLA 3ZWBA 2RHRA 3EY4A 3WNVA 3ZWYA 1A4UA 4CR8A 3D0OA 4XYMA 1HSOA 3B20A 1MP0A 3NT5A 2CF5A 4AL4A 4DTIA 2W2KA 3ON5A 1YL7A 1D7OA 1KVSA 2JFHA 4HWKA 1NFRA 5T8KC 1GU7A 4CQMB 1PGOA 3L6DA 3AOEC 4NU5A 5DCYA 3V2UA 5DBGA 2H6EA 4BGEA 4EGFA 3OECA 3KUXA 1EE2A 3DONA 2JAHA 3ZWXA 1ZSVA 4GGOA 3OA2A 1R4MB 1QV6A 2HRBA 4BNYA 1IE3A 4DYVA 4PLWA 1C0LA 5JCJA 5A1TA 3MJ4A 2Z1NA 1H94A 2VHZA 2Y1DA 3GMSA 4INAA 4J2HA 3U4HA 5I9NA 4WOJA 3G49A 3DAPA 5AQ1A 3QSGA 5BSEA 1LLQA 4BNTA 1LSSA 2B4RO 3GUYA 4IPTA 4AJIA 1ONOA 3JQBC 5JDIA 1IHXA 3OF2A 4Q9NA 4RPHA 2D8AA 5TIIA 5DN9A 4JXKA 1T25A 2R6JA 4Q3BA 2FPPA 3HN2A 1MGOA 4J0EA 4QO8A 4W7IA 4UEKA 1E6UA 4WKGA 4BKQA 5F1KA 3JQ7B 1N7HA 2DBRA 3FHLA 1HLDA 3BZUA 4O1MA 4RZHA 3COSA 1DLIA 1BWSA 1NFQA 1IOLA 3DTTA 4UUNA 1KIFA 2J8ZA 4FGSA 4AJJA 3WIDA 1Z6ZA 2DLDA 4MP8A 4XZ3A 4K6FA 3GVXA 4IXWA 4E30A 1EUDA 3NTQA 4A5OA 1T24A 1VKNA 3BTSA 4IUYA 3JQAD 2GPTA 3DMYA 4GAEA 4LISA 4RLSA 3AI2A 4PLYA 5BT9A 1O95A 3V1UA 5IZ4A 4R3WA 1FDSA 3OJFA 1YDWA 3H9JA 1NVTA 2VWPA 4XGIA 2VWHA 2CZCA 3MJCA 5H83A 4R5MA 5DT9A 2YDYA 4L9RA 1I3NA 1HYHA 3EMKA 1HL3A 4J1NA 4KDFA 2P9EA 5LCXA 4IIUA 2NM0A 2C2YA 1MC4A 2ET6A 4CL8A 4GWKA 4NK5A 4HFRA 3IKTA 2YHIA 5EL0A 2BFMA 4GSKA 1L1FA 4A27A 4OXNA 2Q99A 4TKLA 1GUZA 2NUAA 1H9AA 4KOAA 4HBGA 4XEHA 5GY7A 3PHIA 2X8LA 2A94A 3D4NA 1NQOA 4CLOA 4IBOA 4RZIA 4WNIA 3ZU5A 3SJ7A 4OL9A 3AY7A 4PGFA 1ISJA 1EFKA 2I5PO 3FNGA 3I1JA 2EP7A 4L75A 1ADBA 1JDJA 1PL6A 2B35A 1VSVA 3GGGA 3QQPA 4HFMA 5B12A 1GPJA 6ADHA 3GGPA 5DULA 4LK3A 1LDNA 1W0CA 2X23A 4M1QA 4MO2A 1YS4A 1V8BA 3NV9A 4GPD1 2VHWA 3NTRA 2P4QA 3NGXA 1LX6A 4J91A 5JLAA 4D41A 2NVUB 2GRAA 4JJFA 3SXPA 3GNSA 2AEFA 3OICA 5KKAA 3WS7A 5BQFA 1CETA 2GF2A 2QYTA 1GZ4A 1CIVA 1E6WA 2POQX 5G0SA 1TVEA 1IUKA 2YW9A 1B7GO 4BGUA 1ZMOA 2QIOA 2FZWA 3HJAA 1E1NA 4E5PA 4L8VA 2GR9A 4RPJA 3DEYX 3PJFA 4R9SA 3D7LA 3WFIA 3I4FA 1NAIA 3N7UA 3BMNA 1BXGA 1LDYA 4BNKA 1JVSA 4ONEA 3KHUA 3UH1A 4CV3A 1KBZA 5FWNA 4NDNE 4J7XA 4XQEA 4ZQHA 3P7MA 3GY0A 2PGLA 4D3SA 3C7AA 2NNLD 4D43A 5KJ1A 3GHHA 4BNVA 1UP6A 4MVJF 1IPFA 2FRDA 4WEQA 1QORA 2IYOA 2C29D 4NBRA 2AA3A 2FOIA 2LDBA 3BMQA 4G5HA 4WLNA 2XXBA 2ZTUA 1L7DA 1YO6A 1AHIA 3AI3A 4EYEA 3K9QO 1R15A 2Y0EA 2Z95A 1F0YA 4ZQBA 3GUCA 4CM7A 3AI1A 1KVRA 3RSHA 3K8ZA 3TZHA 9LDTA 4BNFA 1YQGA 3PGXA 3L6OO 4AJNA 2ZTLA 1MA0A 1OFGA 4CLRB 2ZTVA 2ZIZA 1SOVA 2TMGA 3Q9NA 3HG7A 1DRWA 4YTEA 3KYCB 2PNFA 4B4WA 1O89A 1UJMA 1XLTA 4R1SA 1H5QA 3QE3A 1RKXA 5JPIA 3E1KA 4J9UE 1XR3A 3EHEA 4JP2A 4KZPA 5ITWA 1ULUA 3PHGA 1HDXA 4FN4A 5L95A 5KJ6A 1QP8A 3FR7A 1EQUA 3WSWA 5DOVA 3DMTA 1QKIA 2E4AA 4CM1A 5KJEA 2EKPA 2X9GA 3LC2O 4QFDA 3TN7A 4CUJA 1QLJA 4BNXA 2OP0A 5CDUA 3GN2A 1E1KA 3OEWA 2ZCVA 3C1TA 5ILGA 3WQSB 2DAPA 3W8EA 1HEUA 2WWRA 2VZ9A 1ZXLA 3WWZA 3VVCA 3ZWVA 1C3VA 2VYNA 4JCOA 1DRVA 3RKRA 1FJHA 1H6CA 2HK8A 5L4NA 4Q3DA 3TFOA 4MVJA 3KVOA 4OSOA 4WCFC 4AVYA 5LC1A 2C0CA 1NNUA 1ZZEA 1IULA 2HDHA 2WMDA 4GX0A 4XYGA 2CY0A 1ZK3A 2FSSA 5F1PA 3MWEB 2DC1A 5ENVA 4WJZA 4IGFA 3VOSA 3Q6IA 4J90A 4KUEA 4TVOA 4XRRA 1NFFA 3RVDA 1LSJA 3AU8A 4NPCA 5CG2A 1E7SA 1XWFA 3PVZA 3CZRA 4R4JA 1XU9A 5DCWA 5JDIC 4QXMA 1TT5A 1JN0A 1YWGO 3Q1LA 4BO5A 1DEHA 2Y93A 3ITDA 4KWHA 4BO4A 2G82A 3PIIA 4FIZA 4AJKA 2F00A 1HT0A 4JJIA 5A9SB 1VI2A 2NU8A 3W6ZA 4M49A 1Z82A 3UN1A 1YH3A 3IQDB 4JK3A 4IDBA 5A05A 3I3OA 1PQUA 1C1DA 1N7GA 1TT7A 5JDCA 1N92A 3AFMA 3KLMX 4GWGA 4QTZA 1P1JA 1XU7A 2O23A 4O59O 3JD3A 5JCJD 4WECA 3CINA 3LQFA 4PG5A 2BI8A 2EG9A 4EJ0A 4PG6A 2ZTMA 4RVHA 3ZWOA 1NVMB 2AQKA 1A5ZA 2IEBA 3DBHA 2AQHA 4Z0HO 1U3UA 1TXGA 1IHYA 1Q7BA 3JYQA 3JQ6A 4YRBA 3H8VA 1K0UA 3JQFA 1X14A 1YB4A 5TSDA 1PL7A 1SNYA 2WJPA 4ZVVA 5IXYA 3RCBA 3GVIA 4CM6A 4N54A 1C1XA 3MJVA 3EK2A 1RWBA 3DDNA 3VPHA 2C5EA 2JKVA 3OIFA 3FNHA 3RC1A 1SMKA 4DC1A 4KTTE 2EJWA 1E3SA 2ZYGA 3E8XA 3WGIA 3D4OA 2YV3A 3JYOA 4WUVA 3V2GA 3WJ7A 1I10A 1PWZA 3D1LA 5EN4A 3IP3A 5DBIA 1HYGA 3TNLA 5C5IA 1ZSNA 1HF3A 1KY4A 3EUWA 2EERA 3VH1A 5DOZA 2BFOA 4H3VA 4S3MA 5L4LA 1QYXA 5I8WA 1UH5A 3DWFA 1UXIA 3M6IA 3GN1A 3PDJA 3FCOA 3VHRA 5G4KB 1K5HA 1TB4A 4CV1A 5B1YA 1UDAA 3PEFA 1S6YA 4EZBA 4I9HA 2IEDA 1PGPA 1E1LA 2VHYA 5A04A 3RWBA 4YT4A 2SCUA 5LDHA 4CMAA 5CEEA 3P5SA 2JCYA 2O2SA 1Z74A 1PEDA 3I6QA 4IDCA 4IJKA 3KYDB 2E49A 1KYQA 1UP4A 5JY1A 5G0WA 2O3RA 4OMUA 3N74A 3GEGA 5KJFA 4B4VA 1VJ1A 3AOEA 4OGWA 1NM5A 1Q7CA 3Q9UA 4YXFA 3F5QA 1PS9A 4I9NA 2VZ8A 3NTOA 5KNLA 1B26A 4BNJA 1QV7A 3QV1A 3INGA 4PLFA 3ZH2A 2OP1A 3W1VA 3LVFO 2V65A 1WDKA 4XX0A 2A4KA 2DTXA 2YY7A 3KO8A 1U8XX 4TQGA 3UKOA 3R6DA 3JYLA 4E2XA 4J2OA 4J7UA 3RASA 4Q3EA 2YQ5A 4P4NA 2PTGA 2DQ4A 2DVMA 1JWBB 1P3DA 4OXYA 1KC1A 2X1HA 4X54A 3JQBA 2ILTA 5I9MA 3WMWA 1ADFA 4D42A 1U1IA 4P4GA 4BQPA 1H9BA 1QG6A 3KB6A 5JE8A 3JD2A 4R01A 1HDZA 2EW8A 2C59A 1R4NA 2D1YA 2HRZA 2EXXA 2Q1TA 2W2KB 4GH5A 3WGZA 2O3UA 3A06A 4OAQA 1PJ2A 2X6TA 1NPTO 4A26A 5CFZA 1CERA 2PA3A 4JQCA 3DBLB 4CL3A 4PFJA 1T4DA 2YQ4A 1T2CA 1KEUA 4DREA 3TOXA 3CIFA 4Z9XA 2HU2A 3GAZA 5B4UA 4R5HA 4PCVA 4IXTA 4UREA 1V3VA 4NQZA 1VL8A 4B8WA 1E5LA 1E7MA 1B2LA 1HE3A 1ZCJA 2ZQYA 3DHNA 1D4FA 1I8TA 1I2CA 4XA8A 4HP8A 2VCYA 2GSDA 4Y8VA 3I9KA 4F3YA 3UCEA 5JS6A 4XKJA 4BS9A 1VSUA 3FNFA 2O3TA 3T7CA 5JC8A 2R2GA 2DPGA 2EGHA 3PZRA 4E2YA 4RLHA 4Z9YA 2VT2A 1LLUA 1I30A 3VAZA 4WASA 4E33A 1LXCA 1LA2A 1I24A 4JBHA 4OKIA 2UDPA 4EITA 4EUEA 1B8VA 1BVRA 3PI7A 5BSHA 3HZZA 1RPNA 4XQGA 3GZNB 4WPGA 4MVJI 2VNSA 3ZNNA 3ONFA 3RKUA 4MOWA 5AXAA 2BFPA 1PR3A 1LRLA 4H16A 1RM5A 4YJHB 1BW9B 2WYVA 1FXSA 1NASA 1R0KA 4HUJA 3L9XA 1UZMA 1YB1A 3ABIA 4NR0A 3WTBA 2VN8A 3JV7A 2ZB4A 4WNCA 2NV6A 2I3GA 3C85A 3VVBA 4YJGA 2EF1A 3LC1O 2W90A 5I7FA 3EZLA 3KLPX 1E5QA 2AW5A 1WDMA 3DZHA 2GLXA 2GO1A 1Y8QA 1Y9EA 3JTMA 4PLPA 3GPDG 4NBVA 3IS3A 2Q4BA 2CSUA 5TQVA 4IDEA 4YB8A 3VPFA 1GD1O 4ZQFA 2IE0A 4RPLA 4TRMA 1SEPA 1AHHA 4FFPA 4XYBA 1LSUA 3WGGA 3WWYA 4YYZA 2VRCD 3RJ9A 1ORRA 4F6CA 3UCFA 1IZ0A 2Q1SA 4ND2A 3KSDO 4KUHA 1XKQA 3DC2A 5IJZA 4GGPA 1X0VA 1Z73A 1DDOA 5CDGA 2OHXA 4EJMA 3ETEA 2YUTA 2IXBA 1LDMA 3OQ6A 3FR8A 1Q1NA 1OOEA 2VUUA 3ICPA 3GRPA 4RVSA 2Q4EA 3WGHA 1GEGA 1I0ZA 1LBEA 2RBEA 4RJTA 3QW2A 5FI5A 4YAKA 2VYND 5IXSA 3CPSA 3BIOA 2I65A 1O8CA 4ALIA 5JDCC 3PYLA 1U5CA 3G0OA 4A73A 1EFLA 4MVJD 2BGLA 2FWMX 1AUPA 1DXYA 4RL6A 2J5QA 2Q3EA 4BIIA 1IZ9A 2Q50A 4UEOA 3W8DA 1N5DA 3NX4A 4IDAA 5ER9A 1HTBA 2GZ3A 2HQ1A 3ADOA 4YAJA 4B7XA 1HDGO 1PZFA 3LT2A 4IQ0A 2AMFA 3U9LA 2PH3A 4IQGA 1AXEA 3UF0A 5I8ZA 3TF5A 4PLHA 4XYLA 3L4SO 4CMBA 4XB1A 5GZ1A 1GUYA 2C5AA 4DBZA 1HETA 1YOVB 1HZZA 3F1LA 1HE2A 2NLOA 4HXYA 1R6DA 2RCYA 3F5SA 4KDEA 5I7EA 4RV9A 4L74A 3QWFA 1LC0A 3GFGA 2A92A 2AEMA 1EVZA 1XA0A 3C1OA 5CEJA 3BMNB 1NPDA 1DIBA 1BXGB 5A3VA 1H6DA 3HN7A 2O4CA 1JKIA 2YFHA 5FF9A 2YV2A 3UGKA 4WEOA 5JY6A 1LUAA 2CMDA 1OC2A 4YBZA 2PZKA 3WJAA 1XEAA 3VZRA 3K73O 3ROMA 1VPDA 1K3TA 5KVVA 2LDXA 4FQ8A 4FW8A 2PKRA 2IYPA 3BYZA 4FJ0A 3JQGB 5JAIA 2ZB8A 2RAFA 3H65A 1V9LA 2X58A 3K31A 4S1VA 4DRYA 1YJ8A 3E9QA 3STHA 1A9YA 2WD8A 5TT1A 1KC3A 1YVEI 4J9VA 4RO0A 2BH9A 2V6FA 2ZB7A 4BMNA 3JQ9A 3SEFA 1X1TA 1H2BA 5COAA 3DBRA 5C3MA 4N5NA 2UUPA 4K26A 4HADA 1U3TA 4ALNA 3VTFA 1Q2XA 1I36A 2DKNA 3GF4A 4EBFA 5I7VA 1DB3A 3LLVA 1HWYA 4KQXA 4YJFA 1ISMA 4UULA 4W99A 1W8DA 4G65A 4R1NA 3PJDA 3SVTA 2WE7A 3RBXA 2EWMA 2G1UA 6LDHA 5DDIP 5EESA 4BKRA 5BR7A 5JCXA 1DIAA 4RVDA 2FSVA 4ZU3A 5G0VA 4WCFA 5LDGA 5TS3A 3FWZA 2VYVA 4NI5A 1XCBA 1ZK0A 3LDHA 4CMJA 1F14A 3ZHZA 4YEDA 5ILOA 2I9PA 3NGLA 3BTOA 4OM8A 3GHYA 1F8FA 3TJRA 4CM4A 2B83A 4JROA 2Q46A 2RH8A 2CVOA 3OETA 2DTDA 3K2EA 1QYWA 3TWOA 4Q3AA 1GYQA 1XELA 4WCDA 3TL3A 4J4HA 5ER6A 5CHEA 1JAXA 3GEMA 1UXJA 1BDBA 1HDYA 5A9TA 1RM4A 2B36A 1PZHA 1PS0A 2BMAA 3PGJA 4DMMA 4YAGA 5KJCA 3WYEA 1K2WA 4CV0A 1SAYA 3V1TC 3EDMA 4NNJA 4I5DA 4PVCA 2ZCUA 2GCGA 4IS3A 4BNUA 1WP4A 4HNHA 4RF5A 5F3RA 1KVUA 3P2OA 2JD0A 5EQDA 5L4SA 4U5QA 2PD6A 1NWHA 3F47A 2BD0A 2FN7A 3BMCB 5KVSA 4H15A 5TNXA 4FGWA 4NBTA 4PZCA 4A10A 4D3FA 3UVEA 5B4VA 5EERA 3GNTA 2FPGA 4MVJE 4OO3A 4IQ8A 3ULKA 1ID1A 1WW8A 1VL6A 2O3JA 2V6GA 3W6UA 3GPIA 4NBWA 3ZWWA 4HV4A 4MIEA 1GEEA 1KEPA 3OH8A 5AXBA 7ADHA 1YBMA 2AE1A 3S2IA 2OBNA 1EE9A 3D3EA 1ZEMA 2OOSA 1U9JA 3KSZO 4GSLA 4DC0A 3O9ZA 2Y66A 4CMHA 1U3WA 3AFNA 4BV8A 1NR7A 3UXYA 1C1DB 1PJBA 1FDWA 2A9FA 3ETGA 3N58A 4LRTB 3PXXA 4FJ1A 4TSKA 2DBQA 3HHPA 4K1LA 3AUTA 4AJ1A 1DAOA 5CEFA 2W8ZA 5TJ9A 3FPLA 1K6IA 1NXQA 4BHTA 5BNIA 1WDLA 3MCVA 1PWXA 2O50A 2Q22A 3B1JA 3IJPA 4XB2A 3MTJA 2Y1GA 3DZJA 3MTGA 4QQRA 3ZWNA 3L0DA 1W6UA 3GGOA 2V7PA 3DBHB 4R1UA 2DBVO 2VTDA 3M2PA 5COQA 1LRKA 3JCZA 3RBVA 3D5TA 3WFJA 4ITUA 3RAJA 1WZEA 2P5UA 3NJ8A 3AM4A 5JMWA 5K9ZA 9LDBA 1VL0A 2P4HX 1JQBA 2DT5A 5IG2A 4CR7A 4JGBA 1DC5A 3CZMA 3NEPX 3VC7A 1R66A 2CNBA 1PQPA 1PJ4A 4DA9A 3DO5A 2W98A 5L51A 3G79A 4ZHSA 5C7IO 3E5MA 3E6AA 3E5RA 3AJRA 4R41A 3KTDA 4QX6A 1DJQA 1SB9A 1GR0A 1AGNA 3NT2A 1N1GA 2NU7A 1GV1A 4DWVA 4BMSA 2Q45A 2HK7A 5CG1A 4U0KA 4IDGA 1CQIA 4EEXA 3SBOA 1I3KA 4YRDA 1GAEO 4R9RA 1U28A 3QWHA 1ENOA 1ZXBA 3VH2A 4MIYA 2W2LD 1IYZA 3F6YA 2EP5A 1I01A 5G0TA 4NMHA 1NQTA 3ETDA 3KYBA 4ALJA 3GR6A 4U8GA 4J4TA 3G1UA 4E2WA 3PQEA 4E5KA 1UP7A 1GYPA 4TMFA 2HLPA 3BMOA 1LDGA 1C14A 1Q0QA 4OOFA 4BO7A 3V1YA 2QYSA 1LSOA 1BSVA 4ILKA 1T1RA 4PZDA 3OIDA 2QRLA 3F9IA 1T2FA 1Y8RA 1NQAO 3QVTA 1B16A 2NTNA 1Q0LA 4F45A 2GGSA 4XJTA 4DYDA 1T4BA 3FI9A 3I9MA 2OZPA 1JLLA 4IM7A 4DPMA 4DQUA 3QVSA 4F46A 2E82A 4KUGA 1NR1A 2EGGA 2Z1MA 3WQQA 5EINA 3H6KA 4J1QA 4CLHA 2BRUA 5J23A 3R1IA 4YCAA 3ZW9A 4IJUA 4LVUA 1N9GB 1UAGA 4MKXA 3D3WB 3ANNA 4MKRA 1LDEA 4Y98A 2VRBA 3NKLA 4LRSB 1FDVA 4UEJA 1PJQA 3RU9A 5B4TA 3WGTA 4U0JA 4XR4A 3GAFA 3JQAB 4ZRNA 1NBOA 5J9GA 1ZK1A 3E03A 2B4TO 1R0LA 2WD7B 5DP1A 4J1TA 2NU6A 1OAAA 4BNWA 2VQ3A 2OFPA 4CLDA 4B7CA 4XYEA 4TWRA 1UZLA 1M75A 4ALKA 2AG8A 2G17A 2FPIA 3B6ZA 3QA9A 3SC4A 1NX6A 4PLZA 5CDTA 2DPHA 1ZFNA 3IL2A 3L6EA 2X86A 1NVGA 2VRCA 1R4MA 3JQ9C 4C4OA 1X7HA 1XIVA 1J6UA 2JHGA 3O03A 4BKPA 3WOHA 1G6KA 1E3IA 4IMRA 2VWQA 1SCUA 4AJ2A 4Y6SA 3GH3A 3VPSA 2X0IA 2E37A 3OJLA 4XJSA 3UW3A 4PIVA 3ROPA 4OKNA 4J43A 1HE4A 1F06A 2GERA 1D3AA 3S8MA 4TZTA 1PZEA 2AG5A 3AM5A 2ZQZA 3S2GA 3IAHA 2PKQP 2C7GA 5T5QA 4CM5A 7MDHA 3ZV3A 4Y6PA 4YRAA 4I9UA 3FTNA 2BHLA 4NH4A 2TMDA 3IUSA 1SBYA 2C7VA 4PLVA 1SPXA 3K2BA 3KEQA 3QHAA 4CMIB 4BO9A 3DAGA 2VZ0A 3KSUA 1VM6A 4FJ2A 1Z45A 2OBYA 1T2AA 1FF9A 4BNIA 1MLDA 3DZGA 4JJGA 4IJVA 1V3UA 1LNQA 4FS3A 3KM0A 3F4BA 3JD1A 4B8ZA 3H9UA 1B3BA 4HFJA 3WSVA 3ONDA 2VYVD 1R0SA 1B14A 1GV0A 2YJZA 2CDCA 2Y1FA 1AN9A 2PKQO 1QYCA 3IJRA 3WG9A 2FZEA 1S7CA 4YT8A 3JSAA 2FR0A 3CXRA 4E31A 3U0BA 1GQQA 3HNPA 2GASA 1EZ4A 1O94A 1ZMTA 3WR5A 1X0XA 3GZ4A 1PGJA 2NVWA 1CDOA 3RUCA 2X0RA 2GDZA 3HFSA 3SC6A 2O3SA 1ONNA 4P8RA 1QR6A 3Q2IA 5L40A 3CE6A 3AUAA 4L4SA 3ZV4A 1OBFO 2QZ9A 2Y1EA 2YZ7A 2Q1UA 3FWNA 4BO6A 4DIOA 3ROKA 2E48A 1YQXA 5JSFA 3HDYA 1LLCA 4NJMB 5IN5A 5GZ3A 4IZHA 4BMVA 1B15A 1P0CA 3ENNA 1PGNA 3LT4A 4BOYA 3H5NA 3HSKA 4OOEA 2AHRA 1A7AA 5AOVA 1AE1A 5CP8A 3I5MA 1UZNA 3O38A 3I9OA 3GVPA 5C7LO 2PGDA 3VZPA 2BKAA 2XAAA 1WPQA 2B4QA 2I76A 5FFFA 4BO8A 2Y67A 3GDFA 5FYDA 3IDSA 1P1IA 2DTEA 4RVFA 4MDHA 2NVUA 2W4QA 3O4RA 1ZKMA 3MJEA 4RPKA 5IAAA 3B1KA 2X5KO 3ONEA 1GL3A 1E7WA 1HZJA 1C0IA 1P74A 4RORA 4W7HA 4ZD6A 2HMUA 3KOUA 3CH6A 1VE9A 4JIGA 3DXFA 1B3RA 3CMMA 3UICA 5L45A 3WGOA 1SEVA 1E3WB 4LN1A 5DNAA 4E13A 1EDOA 3OSUA 2I66A 4MPDA 4KTVE 3F3SA 4XIJA 5CAEA 4E5YA 3UCXA 3ZN2A 1NHGA 4EDFA 3KETA 3M1AA 2NTJA 3EVNA 1LTHR 4LMRA 1I2ZA 5A03A 5JAMA
chains in the Genus database with same CATH superfamily
4C30A 3N2GA 3SYNA 4B2IA 1Z7EA 4CU5A 4V1CI 3GLGA 3BQ9A 3BTUA 1SKYE 5ALJA 4B3CA 1TEVA 3T4EA 1B8PA 3KEFA 5FPTA 3A0RB 2V5UA 2IOYA 1YRQA 2YIVX 3SI7A 4FYKA 3U4MA 2JGLA 2JNWA 3KXDA 3FUUA 3V4FA 3WADA 4JJAA 2MTBA 1ULBA 2HK6A 2BF7A 1PL8A 3DVLA 3SPXA 3EOAI 4BE9A 4K40A 4H31A 3C6QA 2AZTA 2FY8A 2R8YA 3BE5A 3QYFA 3TLKA 3VHXA 4AF7A 4D8YA 3OJOA 1WXWA 2XWBF 4YAEA 4ZANA 1KSGA 4HGYA 1BFDA 1W48A 3C74A 2IC5A 3SJBA 2EYQA 3C3XA 1EHCA 4GVLA 3L07A 3VJMA 3RU3A 1RKBA 4O4IF 3QF4B 1LGYA 2FR8A 2JHAA 1W0JA 3OOHA 3Q3VA 4DCGA 4B83A 4DEXA 2F3QA 1K89A 2COEA 3CR3C 4IKEA 1ZJZA 3U13A 4A6DA 4CLRA 3W3AH 1S01A 4ZO4A 2Q7XA 1V3QE 4IO1A 1E2FA 3WNQA 2H18A 1J8DA 3CUSA 2H1HA 3JQDA 5LZ8A 1NYTA 2B7BA 3WL8A 2L17A 2KLBA 4X1YA 4V0ME 1EWVA 3PFKA 3B9BA 8ABPA 5K0ZA 4KVGA 1RFLA 4PRZA 3PNYA 4Z86A 5F1YA 2QL7A 1BRMA 1N4DA 3IJ5A 1KKMA 4DRZA 2HY7A 2Y1WA 4M6WB 3RUFA 1UK6A 2CXQA 1OSNA 2R68A 2F1RA 1T5LA 2XB8A 3A6DA 3PDCA 5IASA 2OFWA 3DZBA 5L6LB 5FNZA 1GPWB 3KZVA 4MV4A 2GFIA 1HLPA 1JRLA 2CXXA 2JI8A 5LYJA 1Q7GA 3H9CA 1X7GA 3AL3A 5ED4A 1R10A 2WABA 1M54A 2DPMA 2W8BA 4TZ0A 2JLWA 3RC9A 1MC5A 3AHHA 3F74A 1EIWA 2O05A 5HX7A 1U5AA 5C35A 3HO1A 4GI3A 2C9OA 2GETA 3JQCA 2XJ9A 3L7CA 3QU9A 3SEAA 2WJ3A 3UMCA 1DUSA 4JLSA 4M1YA 2NO6A 2I6SA 4BRZA 1GY8A 5LA6B 5B3JC 3WK6A 3DC7A 5JV5A 5BNWA 1XTBA 4PF1A 2YIDA 1TKCA 1Y7IA 2ZT7A 3BB3A 3DV2A 1FRQA 2BWJA 2PXHA 3IP1A 5HTOA 4ZVNA 1ZWLA 5HIJA 1PYOA 1FZTA 2EDCA 1BMTA 1U2DC 1PFKA 1ULSA 3FVVA 3JSXA 4OK3A 2X2EA 4FFMA 4FLMA 4A8JA 5GPBA 4B2PA 4BXOB 1BO6A 4DIMA 4RIFA 4NQRA 3L0BA 5I7AA 5B53A 3KWFA 3G9XA 4C05A 3JVIA 4TL9A 4ZODA 5DZSA 2J08A 1BE1A 5A7HA 1UDXA 5KYYB 3E9YA 3WYGA 3QG1A 1BE8A 3I6IA 9GPBA 2KJQA 2VDWA 4PG4A 1Q1EA 3KXPA 3X0DA 3X1JA 2QTNA 1I7SB 1BG6A 3I01A 4NK4A 4C6TA 3C39A 3ABSB 3G82C 5CPFA 1O96A 3WI7A 1XKTA 3DEIA 1R9JA 4AJOA 1BZYA 3ZC3A 3MB5A 3K0AA 3CLVA 2W2LA 4D8UA 2FPGB 1VKJA 3FM9A 5AXDA 3GU3A 3L2OB 5BYJA 1N78A 1NSFA 3L40A 1OE0A 2ZROA 1PGQA 4BNMA 4JLAA 4YFVA 1R00A 3I0NA 5C18A 3CMCO 4ZAYA 3INTA 3PYMA 3MMSA 4FYWA 1SM4A 4KXMA 4LOAA 3RUEA 5JJBA 1WCXA 4KDCA 4HGRA 2PRKA 5C4IA 1HQDA 1I9CA 4KQGA 4NOLA 1KFCB 1EFVB 3FAKA 2HF9A 3P9XA 4UTPA 1H69A 5JSZA 3QENA 1MZPA 1UPTA 2QAGA 3BXHA 3IVGA 2UZIR 4O4LF 5AOBA 4GDFA 2JGDA 2FMUA 3P4YA 2HWXA 4I14A 2AQIA 1Z62A 2EVWX 2FXIA 1XU4A 3LD9A 1M7BA 3SFZA 1L7VC 2ZRMA 2CMKA 3LU1A 4N3AA 3LBIA 4RVUA 4TWBA 3D64A 5ALRA 2DJ5A 1BGVA 5K20A 2IODA 3WWOA 1K6XA 3IA2A 3OT4A 4E21A 2B21A 4LBWA 2R7NA 3HUFA 4JQOA 3MQ4A 4IQ4A 4OU4A 2FHPA 1V4BA 4P4TA 3TQOA 4CHTA 5AVVA 2YZKA 2OMEA 1TJPB 3ZJUA 2A5JA 5C8YA 3SWWA 4CEJA 5HUHA 2AEJA 4Y9TA 2B82A 4TZ6A 1QTNA 2SKEA 4TUYF 5EP1A 4TSRA 4BEJA 2O8CB 3BTVA 1K7SN 3L8EA 4Y2XA 2B0JA 1BHO1 2PZLA 3TSOA 5DI3B 3O4JA 4ROSA 3TIXB 3PRHA 3A3PA 3DDWA 1N6LA 2O5CA 4BCDA 3UJHA 4D46A 1WU8A 1DO8A 1KO4A 1B73A 1U8ZA 4PX5A 3WMXA 3FBTA 3TAHA 3UW1A 3CEJA 4EZIA 4HYQA 3V8NA 4PHCA 1S2NA 1GWNA 5MN5A 2JLQA 1UYJA 3TG8A 2FQWA 2WWVD 1L7RA 3RQSA 4W1RA 2VF8A 1U7TA 2B8JA 3EVCA 2FSGA 1B1AA 3EIWA 5FWXA 2IU0A 2J3IA 1ZW1A 3TGWA 4FDMA 1ZN8A 3U4DA 3OOYA 1DIHA 5AW8A 1MTZA 1HMYA 4DUGA 3GOHA 5LZ7A 121PA 2PGJA 1E1MA 2VJMA 4P1ZA 1YUMA 3KLNA 3FFBA 4JC8A 5T7BA 1O4VA 2ZUDA 2V45A 1BMDA 3EEIA 4GZ5A 4MIOA 2B37A 2H1CA 2YZMA 1E6EA 1SCDA 3E3LA 3K0FB 3KXIA 4XD2A 4DAOA 2DKOA 3MPOA 4FT2A 4AMVA 1CEXA 3ZEIA 3KOWA 2B1IA 4L15A 3SX2A 2AI2A 3QEOA 1E3JA 1V11B 4R1MA 4CI0B 2ZG6A 4OQQA 2VQDA 2P41A 2O7RA 5DCUA 3L4BC 5ESRA 2KS6A 4CEIB 1A95A 3QVOA 4P38A 4E6EA 1W30A 1WD7A 2Q49A 3KQMA 3C98A 4WOKA 1CQWA 3ZCPA 2QN1A 2PV7A 3DCYA 4MGYR 3LTNC 1NVWQ 3KQUA 1VMEA 4GYKA 4MWDA 4P7KA 2ERCA 2WAAA 2P9HA 1WUTA 1QIIA 2QVZX 3EODA 3IDAA 4PZLA 3H9QA 3SKVA 3ZU4A 5L3QB 1KI6A 3B85A 5FL7A 3IELA 4EF4A 3WK8A 5KS2A 3BMQB 1ZESA 1G0OA 3VR6D 3IVAA 2O3QA 2X0DA 2OG2A 5JO0A 1B93A 1SK9A 1CZUA 4G23A 2YN2A 3C8MA 2Q2VA 4MUNA 2QQGA 3HA2A 5FORA 3OCVA 2HQOA 2ZJ0A 1IN8A 3RFVA 1SVWA 3T9DA 3TAXA 4ZO6A 1V1MB 2YASA 3PQFA 1LVGA 5LOVF 4P54A 3AINA 1J25A 4MJ3A 1PFYA 2CVHA 2PQ0A 4UE3S 2XWSA 4P7BA 4GT1A 3C6YA 1FX1A 1L9KA 2PWAA 5AJUA 2GAAA 3OUZA 3DR3A 3U5TA 1ZD8A 1SVUA 1D1SA 3U3KA 4BBZA 4AMZA 4MQMA 2WQ6A 3VBEA 1H6AA 1MZVA 5DHFA 5C7OO 2EIHA 4G1UC 2HX1A 4WN3A 4BPRA 2VTEA 3DTVD 4I1IA 5F2EA 5JVDA 1P80A 3DBLA 1CG6A 1J8MF 4PZPA 1TAUA 1WW3A 4G56A 4ZCIA 2XGJA 1OT3A 4KVZA 3F97A 1AZLA 4ZHQA 3SLKA 3BQMB 4CF6A 1Q6ZA 2Y0PA 4I55F 2P5YA 3LH5A 3KQSA 4R8KA 1BJRE 2MSWA 5JYFA 2FDXA 4V0RA 3PR2B 4DV2B 2GJ4A 1UKAA 1YVPA 1AJEA 4QSMA 2ATXA 2H16A 2GXSA 3DR5A 3GPCA 1R6XA 4XTRA 3NHYA 3CCBA 2N75A 4YT5A 5AK5A 5J40A 5JU6A 2RG1A 4LF8B 4BMOB 1TPZA 3V4VB 1DOHA 1M10A 2V9ZA 3E8SA 3Q3HA 2O48X 5HE8A 4JX8A 2NAPA 1GFIA 2CLHB 1NMZA 1L5QA 2GJAA 3EXG1 3MINA 4IJ6A 4MHSA 4XM0A 5JAQA 3OJ0A 4OIMA 4B85A 4W5RA 1F8GA 2HF2A 4Q4JA 3VH3A 1L7XA 5T4BA 3QV2A 3AP2A 4MW4A 4GYJA 1LU9A 4BVAA 1SKQA 2RCNA 1GO2A 1YE3A 4NBNA 5AKEA 2C97A 3ZHOA 2H9IA 1ZJYA 1Z08A 3U37A 3IWDB 3IUNA 1U0EA 2Q1YA 1QGZA 3OZCA 4YQYA 2FG7C 3FPHA 4R16A 1BU5A 1DUVG 1CQPA 1SZPA 1RJFA 2ADMA 2VH1A 4MEAA 3TZCA 3TZLA 3VGJA 4PYRA 2WUEA 1U4NA 1NBMA 4ZZ2A 4E12A 2JVKA 2ZUUA 2NUBA 2XYVA 1TJ5A 2XXJA 4KMMA 4YJHA 5FIUA 2X9VA 3ZCXA 2FB9A 3H0EA 4X1KB 3AY6A 5AJVB 3ED1A 4LEIA 2GCPA 2RI0A 3NCTA 2O8FB 3FXAA 2X1VA 4KFSA 1PD1A 1FMFA 1IVYA 1MJ5A 3WL7A 4LHXA 5JZBA 3AL0C 1OH6A 3I2FA 4Z4GA 4C03A 1GU1A 2IP2A 3RS9A 5ECDA 1EPUA 3IOYA 4R2KA 3ZXXA 3RSZA 2PS9A 3S2ZA 3D43A 1U1EA 1RSZA 2OM2A 4D4LA 5FLEX 2K7ZA 5B58C 5KO2A 4TXJA 2ZSKA 3C41J 2X1MA 3QOXA 1E7RA 1WQ3A 1YK0A 2PX8A 4BO1A 2E1RA 4HNGA 1DI0A 3F9RA 5KYWA 1NYRA 2RGWA 3KL4A 4YPFA 4TTVA 4OQYA 2W11A 2Y1CA 1M2HA 2PVCA 3TFQA 3EVAA 1S7GA 3PK0A 3BWCA 3OF3A 1NW5A 3I4LA 4LXXA 5EC8A 3UJ8A 2O5RA 3E22B 3O2QB 4RE6A 3ZV6A 2OVBA 3A7DA 4ESVA 3A31A 4JP3A 3HDHA 3IXQA 4FCCA 5FTMA 4URFA 1D5CA 4E88A 4ZTUB 5H7XA 1BXRB 4GKKB 1SUEA 1VP9A 2DYKA 2WIJA 3BJZA 2M9MA 3AR2A 4XD7D 1E96A 4DLAA 1YTLA 4TYNA 2EX0A 2BGJA 5JS7A 3U6KA 1JA9A 3VKUA 1CVLA 2AW3A 4FHDA 1QQ5A 2JL1A 1TA4A 2UYQA 1TVKA 3DZFA 3ZXSA 1I3MA 1G4HA 1W73A 2WU8A 3TQTA 1IONA 4HVAA 3MRXA 4GIBA 1H85A 2MSNA 4WZBE 2OECA 4ZI3A 4Z3DA 3VSEA 2W6IA 3EXIA 2RJ3A 3WO1A 4TLCA 1Z4QA 2YX1A 1ZZGA 5B1IA 2QJWA 4JENA 4P0QB 1QOPB 4UVIA 3CWQA 5E2BA 2X3YA 1NW8A 2H07A 2CBGA 4L7QA 1U2RA 4CM8A 4JUIA 1Y7TA 3VHLB 1OFHA 4MQEA 3QK7A 4UEWA 4B4UA 2P90A 4FMCF 2XCQA 2X22A 2VJAA 4LSWA 1DHRA 5IYZB 2IS2A 3RFCA 4XH9B 2LE0A 3PE3A 4K46A 4A2CA 3AEQB 1Q1BA 3G3EA 1ZKDA 2W7TA 3O9VA 3VOBA 4GM0A 4BZPA 3AEUA 1FW8A 3A28A 2NYAA 2QY9A 2A5YB 2P91A 2WEKA 1RAFA 1YOVA 2I99A 2ZIGA 2ZR7A 2ZSEA 2VT6A 3IV9A 3NJ4A 4UMDA 1MF7A 4RKFA 1Y4DE 5HS6A 1IQ0A 2VK2A 3SGLA 5ALIA 1CZOA 5IBCA 4O3FA 2J30A 2OORA 2V6JA 5FBKA 1RJ9B 5T3YA 3RF6A 2H5JA 2RI1A 2PD4A 2VDQB 1KEVA 2WAMA 3GCGA 4QT0A 4AS1A 3CZQA 1TYBE 3CWZA 3C3JA 3CF4G 2F9LA 2WHRA 3W5IA 5JALA 3L8GA 4MR8B 1RP1A 4ZOAA 1FTWA 4HWRA 4DBVO 1A4IA 1TW2A 1HDRA 1RWQA 3WYCA 4Q9JA 1HDEA 2VNAA 3QWAA 3HA3A 1SU6A 2DPYA 3EUAA 5EWJA 1SHZA 4RMNA 2J87A 2FWIA 2WD9A 3KP1A 2ZZNA 2SKDA 3A4IA 3HBLA 3Q7TA 4Z53A 4BV3A 5HF8A 4BECA 4W63A 3DV9A 2TECE 4GDMA 1AF4A 2IZ5A 3NIFB 3ZKWB 4BE7B 4YR9A 2F8MA 5EJ2A 1P7WA 2QLFA 3CUUA 3IDQA 1UINA 4FD2A 2EBWA 3L0IB 4PXSA 5EGNA 2QUKA 1M34A 3IUEA 1YOBA 4KQ2A 3ONVA 4F12A 4L50A 2YXDA 2H3EA 4R0NA 5HTKA 2DFVA 3HXMA 5CJJA 3GLGE 4IUBS 2XIJA 5DRYA 2IUTA 2PH7A 1YA8A 2FE1A 3EPLA 2IXGA 4GX1A 4OHKA 4Y30A 4EO4A 2DEUA 1E66A 1PWYE 4YY3B 1JLSA 1MCZA 5H9WA 3PWKA 2B4AA 3TI9A 2HD4A 1Z38A 4Q3LA 5SZIA 4AICA 3IT1A 4F60A 1K4MA 2OGZA 2Q5IA 2GNAA 4QXQA 4EYOA 4WOCA 1DAMA 1JFFB 1I4WA 5FLKA 2IBTA 1DAEA 2EJTA 1XQVA 3S6JA 3I1YA 2Y0DA 3UPDA 2Q6TA 1N6KA 3M3HA 3PDUA 2DUWA 4RCVA 4RTOA 4P4UA 2ZS8A 3RABA 1N2XA 4GP7A 4A0RA 3GLQA 3SIXA 4E09A 1G5QA 4E3ZA 1OBOA 4MH0R 3IAXA 4B2YA 5JZOA 5JQGA 1YQQA 2QTBA 1DMRA 2LZ0A 5KVQA 1JX6A 1DAGA 2G83A 2H0QA 4U00A 2ZREA 1CF4A 2XMDA 3QBDA 2ZYUX 1HYQA 1YASA 1Z6AA 1W581 2ZS7A 4L2IB 4R9NA 4DR5B 4JVOA 1T6ZA 3CX4A 3I4CA 4Y0VA 3TPFA 4C4TA 4F6LA 2FHSA 1YVUA 3OZTA 4YDSA 2OPHA 3UYLA 2GF0A 5KUTA 1LJLA 3A7EA 3UZUA 4LYDA 3JS5A 1BIFA 2VP5A 2YV1A 1YIOA 1S02A 1Z33A 3UWOA 1S5PA 3KQTA 4MXDA 3ECAA 4PC1A 1DX4A 1SUFA 4O4HB 3PEEA 5LNK1 5JMTA 4DQLA 1S3SA 1IWOA 1O2DA 1A9ZA 5HF9A 1R37A 3JQ7A 1YU6A 1SZJG 4J6EA 5D6NA 5AKKA 3V97A 5HSGA 3CR7A 3UJ7A 1Q0SA 5JO9A 5NLLA 4F5EA 2FNAA 2CVPA 1N2BA 5BO5A 5HZHA 2QRUA 3P26A 4DG9A 3K9NA 1LB1B 1T0JB 2VZLA 2XCTB 1SRQA 1VHDA 3PR1A 3LBAA 3K9WA 1KRWA 3EIOA 3ZDCA 4FFBB 1A72A 3OFVA 3IQWA 4I3FA 3RJTA 5KX5F 1VRWA 5ECWA 4CM3A 3U62A 1Q21A 3HWSA 1EGMB 3BMCA 3K0CC 1VMIA 1Z15A 3T15A 2O1WA 4Y9UA 3GLTA 1XYGA 3VPXA 1SZCA 2RH4A 1GL9B 4RGQA 2IYRA 1VKOA 1L6RA 4ZEOA 4RDHA 1L1EA 2C20A 2WC1A 3RSFA 2QORA 1EQ2A 1FUUA 2VUTA 1KE2A 1YJQA 3U9TA 4LYYA 5AT1A 5C7YA 3ROQA 3GDOA 2QRNA 3DAFA 5CIQA 3PXEA 5KQSA 4MUGA 5F64A 3ZNQA 3K3PA 4HX2A 1FLNA 1WZIA 1DQYA 1DRUA 4QOIA 3BC1A 1YIAA 3JWIA 2J32A 2Y9MB 4LA4A 5KCMA 1DEKA 4BUJA 4P36A 2DUMA 3OHPA 4Q4LA 3G8DA 1EFRD 4YRIA 4XTCS 1G7TA 2DQZA 1TZJA 3LF1A 4Q15A 5EJMA 4RS3A 4X95A 1F2TA 4X7RA 5DHRA 4B4OA 5K51A 1NJ6A 1EFDN 1PIWA 4E6PA 3VZBA 4XR9A 3OX3A 1UMCB 5EMHA 1GCIA 3NRJA 4M1MA 1T5OA 1KPIA 1N2GA 3I2JA 3BN3A 3IMFA 3LCUA 1WNTA 3JWPA 4PGMA 4OCZA 1EJ0A 2AS0A 2GD0A 2OWEA 1LY1A 2PCJA 5H0IA 3TVTA 4HXEB 4LXTA 4Y6GB 3ZWDA 5KNDH 2GPJA 3ORFA 1J0CA 5CVEA 3U80A 3R3SA 4BFZA 3BE6A 1V3TA 4DZTA 2YMPA 4GBGA 4P92A 1P81A 3KNZA 3QVWA 3M1YA 3DKIA 2ZU0C 4GZMA 1CS0B 3HWWA 2QL5A 3RVSA 4D2IA 5E0OA 1LRJA 2CEKA 5J5VA 1LQUA 1C1HA 3DL0A 3I2KA 1T1SA 1TRKA 1AQYA 1HL7A 2BLLA 2R84A 3MC1A 3KAKA 5TVGA 3T35A 4GQIA 1GZUA 4ZRMA 2D5CA 5IHPA 3UTCA 1VOTA 1ODSA 2H11A 2F9MA 3BWEA 4QQFA 2UUBB 2GYYA 1H2WA 4OHUA 4I5EA 4DGSA 3I8OA 3PJEA 4MP6A 4F97A 3JYNA 3KJIA 2QTVA 1IRIA 3A9RA 1XZPA 1EHYA 2ZRJA 2PGOA 4TVSA 4JI1B 2AJLI 5KCZA 4AKGA 4F6RB 3KJXA 5H3LA 1BA2A 4PG8A 1L5SA 1PTJA 3CHYA 1Z18A 4LWOA 4O4JA 3ZQJA 2BHSA 2I7CA 5FI3A 1KKUA 3N7AA 4HDRB 3F5MA 3QEMB 5TX7A 5LMCA 4KYTA 1K75A 1MT0A 3GYGA 3IE2A 3ZLVA 3KWLA 3PNPA 3D2CA 1EX9A 2Y99A 4UZEA 4XGQA 1D8AA 4ZT3A 1MU0A 4RTJA 1ZJ5A 3JASB 1K9VF 3MAAC 1YHZA 2OCKA 3TM5A 4UAJA 3I28A 3L7MA 5AI5A 3UAVA 3HB4X 2PDAA 3E9EA 3NAQA 4YLYA 2APJA 2HA4A 2IVZA 4L3OA 3ZI7A 2XECA 1G5RA 4QUHA 1GAQA 3SHTA 1B0AA 4P81A 1NI4A 2QZ4A 5CYGA 5FBHA 1ZNYA 1ACJA 2EZ4A 3EW7A 1ZG3A 4MQ4A 5KQMA 4HRVA 4TS9A 5B30A 1K8XB 1D0VA 1G7RA 2WICA 1XEXA 2BGNA 3P2YA 4HWTA 4IWYA 1EG2A 4A0GA 4Q05A 3GJTA 4X91A 2G40A 5HIIA 2OYSA 4Z49A 2E55A 3FMPB 3RREA 1SC6A 3CRVA 1KYZA 1UANA 3X43A 1E5XA 3PD0A 3VJRA 3G7UA 2QYHA 3BA1A 4HDKB 4US2R 1GTMA 3G5AA 4Q7JB 5F21A 3RVJA 1NQXA 1D2RA 3I2IA 3GT0A 4C0XA 1B6SA 4N6GA 1YNOA 1RQLA 1UKBA 1Z6TA 2O2XA 5F5LA 4BRSA 4RW0A 3N53A 1DKUA 4ZOBA 4TMYA 4B4KA 4EUFA 2OO3A 2OCPA 1J56A 3KC2A 4GW3A 3LNCA 1LD3A 5EGSA 3DBRB 3JXEA 5ADHA 1R16A 3BHIA 4JQYA 3WWCA 5D3ZA 1N6HA 3N39C 3CKYA 4JT2A 4RHTA 4YBRA 4Z2YA 4O5OA 5DTMA 1Q11A 5FYQA 2FETA 4CBVA 1KA9H 1ZD5A 2C2BA 3QIAA 1SBTA 1T2DA 4YA6A 4WLOA 4LOIA 1ZONA 4GQAA 4YJFB 1WQ4A 3HADA 3SYRA 5TV2A 1I2DA 1P2SA 1BDMA 3QHPA 5HQ3B 1RWXA 2P2GA 2V58A 2HJHA 2WD7A 3O84A 4RH0A 3ZU6A 3DZ2B 4A23A 3W9SA 4QG3A 1DWPA 3PHHA 4DR3B 2VL7A 2FRDC 3QMMA 1NP3A 4BQOA 4KGXA 3HJBA 4G25A 3NNDA 3AVUA 4LHYA 3U4CA 4I1PA 1CUAA 1FK8A 1Q0HA 4NOJA 3IIKA 1NC1A 3LYLA 5GM2A 3IEPA 1XCMA 4O2AF 5D7BA 4GL4A 2OV6A 3RM3A 3FSEA 1ODLA 3WQBA 1NOJA 3AU9A 1LK7A 4MMZB 3Q7QA 3BOSA 5HVNA 4XD7A 2Y0CA 3K2QA 3D8RA 1RRVA 3OBBA 3AJ8A 4RGYA 4KLAA 3O8QB 1KSFX 5CXSA 3ZHRA 2XZPA 4P3PA 3DJYA 1U0LA 2JZNA 4W1QA 3UO8B 3DA8A 3RVKA 4FFLA 1QK3A 4NJEA 1XRLA 2ZJ4A 4HAZA 3RU7A 3UNXA 5BSUA 3WHLA 3CX7A 3ND7A 2UYCA 2C82A 3K4QA 3NQ41 2R8XA 1L7EA 1ECFA 3MEQA 3VYWA 2Z56A 2X77A 3EYWA 3T7EA 1ULHA 4KFCA 1N25A 4YWJA 2REQA 5C31A 1YRLA 4ZVQA 2DERA 1KSHA 2MMGA 1CNMA 3ZD8A 1Q0PA 4CODB 1POWA 2HCFA 3IOMA 4I50A 4JL5A 2NP6A 3N6XA 4WGFA 4GPZA 4AZSA 3MBOA 3SDBA 4E0BA 2PZGA 3O4HA 1P4GA 2HL6A 4P93A 1ARZA 4DLYA 1YULA 1VYUA 1GKKA 2FSUA 4Y7DA 1JNXX 1QOQB 1WIWA 2FFRA 1UFQA 4KNVA 5FUWA 4EGCB 3EW9A 3PZBA 5TC4A 3T5GA 3TECE 4QOGA 3DTYA 2OXEA 2ZRBA 4MV1A 2DQKA 3B1YA 4EGJA 1KQ3A 5M5BA 5LXTB 3FDZA 1ESNA 2C83A 5CJ2A 2QVLA 1J2TA 3LT0A 3PXAA 1M1NA 3PTZA 1Y8CA 1YKFA 2QE7A 1E9SA 3BXXA 3O8OB 4GR9A 3ZWPA 4LMPA 5CB4B 3IHWA 2FOLA 4PTLA 2VKQA 2RAVA 2VDVE 1ZUWA 4K6OA 4K9PA 4RD4A 2ATVA 1UFRA 4P5PA 4BYGA 5ITZA 1IZ7A 3EN0A 4IVQA 4OGFA 2C7OA 2HGSA 3ZW7A 1O03A 3LECA 4C1BA 5JSYA 2X9NA 5WRFA 4R1TA 4OFWA 4ZICA 1DOZA 2MSDB 3DDUA 3KDAA 3OLZA 3PIRA 2QN3A 4RD3A 4M1SA 4WXPA 4WQMA 3LL7A 1IUOA 4RESA 3LYAA 2R96A 4YRZA 1ZJWA 1SHKA 4ZXPA 4B6QA 4J0HA 5DF1A 1ATIA 1U7HA 3G59A 3SX0A 2Q2QA 3A9CA 3DVSX 6GPBA 1I6LA 4NZZA 4PYOA 1QGUB 4DIFA 4TROA 2Q0XA 2FP4A 1PDWA 1U0OC 2VHXA 4FEYA 4IWNA 3WE7A 3U26A 2NSHA 3TRKA 2GB4A 5LIPA 1G18A 1JMYA 1QHEA 1S2MA 5H81A 3IUJA 4H7FA 3QW4B 4BB0A 2QBYA 4KE8A 2IWHA 1V35A 3U31A 1K63A 5E3HA 3TUXA 3LRXA 1FW6A 5BYKA 1NUTA 1EA5A 2RK3A 2QPAA 4L16A 3DCJA 4WKOA 1M2FA 2C57A 4I99A 4RM3A 4HDNA 4Q66C 1BGXT 3WFZA 1G291 4L72A 4Z9FA 4C4RA 2ARKA 4QNNA 1C3EA 1NKVA 3CUTA 2H8KA 2VWGA 3BH7A 3IERA 1HSZA 3PTLA 4WLEA 5TY0A 4OHZA 2W37A 4EEZA 2QXTA 2VBFA 3NONA 4EYQA 3GFRA 4KGZA 1P5RA 4FSHA 2JIZD 3RIHA 3NBYC 3TVYA 4AQYB 3EMDA 1RPAA 3D4PA 1NT4A 3KGDA 1MAUA 2CHUA 2JFGA 1U2GC 3FYHA 3I73A 3OM9A 1RPTA 4DV3B 4XRGA 5G3ZA 3TZKA 1XJ5A 4NE2A 1ZH8A 5FWYA 5JBQA 2YXPX 4G4SO 3SG0A 5MN6A 4R54A 2NU7B 1XDWA 1Y9ZA 2QX8A 4DPKA 4KN9S 4EB6A 2ROQA 4LSZA 3T7JA 3CJTA 3G8YA 4KQHA 3THYA 5FDFA 3GVCA 3U60B 3S2SA 1CYEA 2ZJAA 4Q18A 5JT1A 1T1IA 4L5CA 2YHAA 2YFYA 1JUDA 4HB2A 4KWIA 4YR7A 4BMCA 1RWVA 4D79A 3WO0A 1AKMA 3HCWA 2OHOA 3PWZA 4GLJA 1TQ2A 4OYRA 4FNAA 3UOAB 1GGKA 621PA 2DFKB 2H1RA 1ID8A 4Y18A 1G1AA 1XCLA 4BQNA 2BISA 3CFYA 1U7ZA 5DN6D 1KH3A 1SKBA 4R1QA 1W87A 2XZTA 4CVNA 3HWX1 4QGSA 3QVXA 1J5PA 2MMCA 1F17A 3QKSA 1O4WA 1B6TA 1KOJA 1X19A 1YS1X 3LLSA 1RFGE 4EUKA 1CUJA 5BQ3A 3LDGA 1XXHB 2JIBA 2OLEA 2VXOA 4BLWA 2ZZMA 3GDGA 4UMVA 4H18A 5I5GA 1K7XB 2OR3A 4HJXA 2BOVA 3OZXA 4HNQA 3KBOA 3NEYA 3SQLA 1E4YA 2HJWA 1WLSA 4OQLA 1I3LA 2I3AA 1NQVA 4QEDA 4R84A 2XQIA 4DSTA 2C7PA 4BX8A 3D8BA 4J6FA 3QBEA 4IGEA 3QXHA 2HSGA 3OM1A 2WIBA 5F35A 1TQDA 2BPOA 4LW8A 1D8TA 5EKUA 1RR6A 1W85B 2R1UA 1OWPA 5G2OA 4B0PA 3WMEA 2I67A 1ZINA 4GBJA 4R81A 4B84A 5HYVA 2BY4A 2HYDA 2MINA 4A4DA 2W2XA 4BFSA 1OZFA 3BORA 3A1FA 2JASA 3SU8A 5JFOA 4HZIA 4M98A 3AK4A 1FYFA 4R1OA 5FO0A 3A1EA 1VP3A 5A3JA 3A1UA 3R0JA 3ABZA 3K5PA 4FC6A 1EDZA 5E9WA 5G53C 1KMHA 2EC5A 2XGGA 4ZCMA 4FP9A 3TTSA 1TW3A 3GRZA 4P83A 3WNVA 3TCKA 4MHTA 1DINA 1L3IA 2HSWA 3AT1A 3PD7A 1MP0A 3B20A 4AL4A 4DTIA 1JHOA 1DWOA 3ON5A 1M8FA 2AI3A 1WSDA 1YL7A 1D7OA 4ON9A 5FP0A 5TMPA 1B1CA 1C7IA 4OP3A 2V74B 2P9JA 4G41A 4BEBA 1DO0A 3EPBB 3PA6A 4CQMB 5I5EA 4DR7B 3C3YA 4G0OA 3SZRA 1NLZA 4DDKA 4JODA 4EGFA 2PL3A 3KUXA 3H99A 1BE0A 2CK3D 3JATB 5AESA 1A1VA 4B80A 3SYKA 3LX6A 4HX9A 2GEVA 4YK7A 1ZSVA 1DZ3A 4CL2A 3OA2A 5C5DA 4M22A 1JQAA 4BNDB 1JDBC 3H87A 2DUNA 1C0LA 4PLWA 3W05A 5JAUA 4LQDA 1XF1A 3MJ4A 5JD3A 5TGTA 2Z1NA 3ZZMA 1IN7A 3AUFA 2Y1DA 1A8UA 3EVFA 4ZAVA 4ZCTA 4KREA 3S8YA 1ZGGA 4HUQA 4N8EA 3LUFA 2QVXX 1AT1A 2ZITA 4YCSA 2J67A 5BSEA 2C7QA 1F6WA 1COWD 1GZ5A 1LLQA 4BNTA 2A7XA 3QX3A 2B4RO 1YCHA 1FTQA 1PT6A 1DT3A 2ACKA 3AXSA 3GUYA 3JQBC 3TLJA 5JDIA 2JLZA 2FWPA 3LPMA 1RAEA 1UMDB 1CE8A 2WFAA 3OF2A 3R3WA 3O82A 4Q9NA 4YRJA 4F71A 5I47A 4CG1A 4X66B 5TIIA 3UMJA 2H57A 4FMDB 2AJDA 2XCIA 3AO0B 3F6BX 4PZ0A 1FUIA 4PY2A 1E6UA 4WKGA 3W2EA 3TX6A 1QZXA 3KAPA 4Y1FA 4JJ8A 4XX1A 3EEOA 4FR2A 1LPNA 1T8YA 1OLUA 2IEIA 3M4XA 3OE5A 3FHLA 1FCJA 2Z04A 3QFFA 1GM5A 4MROA 2AVNA 2ODWA 4ETNA 1NFQA 2Q2NA 4LBVA 5IPFA 1GCAA 1IOLA 3IULA 1N2OA 7REQB 2VDOB 3UV7A 3VSDA 3ABRB 4Q37A 3WIDA 1Z6ZA 5H3HA 2WMNB 1P7VA 4EX7A 1DXOA 4XZ3A 1ITZA 3VC2A 3ZK9A 1KFEB 4E30A 1EUDA 3NTQA 4B1FA 2OBFA 3DE0X 4QUJA 5FX2A 3L7BA 1TQ6A 2GPTA 4RLSA 4LISA 4QE3A 3CZ9A 5BT9A 4PLYA 3VNUA 1TD1A 3V1UA 4UU7A 1ORIA 3KQOA 1WSAA 1I0IA 3VTKA 4ZIRB 3H9JA 3DZDA 1XDGA 5J2UA 2C5GA 2ZB2A 3QUSA 5CB0A 5CJPA 3RK1A 4BVGA 3NLLA 1VZ3A 2FK7A 2IIQA 2X4LA 2H2HA 1RADA 3G23A 1OPRA 4Q9DA 2CZCA 3MJCA 3W7VA 3GJ3A 2ZANA 1T3SA 2YDYA 4L9RA 3RYFB 5CCXA 1EZ1A 4NU0A 4TYMA 4DGQA 4ENRA 3G5MA 5DHAA 5AI6A 4IIUA 2NM0A 4ME6A 4RWEA 5FFMA 1JTFA 2CNDA 3W3AD 1X7WB 3OZUA 2ZUCA 4IX9A 5CVUA 1ICIA 3QEKA 1K06A 3OZRA 4R9UC 4BDSA 4HQKA 2VJQA 3JAKB 2YHIA 3CC8A 3PPVA 4OQ4A 5BORA 4C3OB 4PQYA 4QIHA 3IUQA 1Q3KA 2GWHA 4F1JA 5D51S 3G5UA 4K2AA 3IWBB 3T06B 1GUZA 3EZ7A 1C80A 4KOAA 4KO1S 4WBXC 4XEHA 4ARSA 2H9YA 3RHTA 4FKZA 2UXBB 2M1ZA 2ZJZA 3I5AA 3WZMA 1XT6A 3EHDA 4ZREA 3F78A 4D82A 1QQBA 2X8LA 2WF6A 3D4NA 5JS2A 4LZLA 1E98A 2AJTA 4IHJA 5FTWA 4RZIA 3K70B 3MLBA 4PBRA 2C9DA 4XWAA 5BSRA 2GCEA 4PGFA 3SF8A 2HC9A 1ISJA 1EFKA 1E3DA 1Z2CA 4TPKA 4M4SA 4RX1A 4A6EA 2WU0A 1EM8A 1Z7YA 3R3VA 1GGMA 1WB5A 4L75A 1C9JA 1K88A 3DFIA 1DTWA 3GGGA 1NN3A 5B12A 3MT0A 3SQXA 1FJ2A 2XMBA 3FGZA 1OX4A 3BSSA 3IAUA 4RMHA 3MWLA 2CJWA 5CD9A 1Z2DA 3TZBA 3QYPA 5BV1A 5EJ9A 1LDNA 1L8QA 2X23A 4M1QA 4KX5A 4UBIA 1A8PA 3QUQA 1NE2A 1GZSA 3KCNA 1XWWA 2VP2A 1GGHA 3ND6A 4HEQA 3KKPA 4IDNA 4RZXA 3FCSB 3PUVA 3VYVA 5IEJA 2QM7A 5KYNA 2Y1KA 3DH0A 2F6RA 3PEWA 2JA2A 2WHQA 4JP5A 1HFJA 2H5EA 3SXPA 3NVAA 1GHTA 3PB3A 1CETA 4YO8A 3RH0A 3FG9A 4EF6A 2K6GA 4DJEC 5KOYA 3ZD6A 1IMOA 2P4SA 4Q1VA 5CX4A 3TLYA 1B7GO 1Y6QA 5CXUA 1Z5GA 4XOUA 4EYKA 1KFKB 2A14A 4Y2UA 2JHCA 4L8VA 1QTIA 3ES9A 1FDIA 5KMGA 3DEYX 4W5HA 1W9MA 2MR5A 4R83A 3D6NB 2FRXA 3M5WA 4OMFG 5AQEA 1Z2PX 1NV9A 1NAIA 1K3FA 1MD9A 2C84A 1UBFA 1LDYA 2QP4A 1DAFA 4BNKA 2Z0MA 1IEXA 3G2KA 3KHUA 3O4FA 3SSNA 1DEXA 2GK3A 3CRQA 4JWTA 1ZXXA 3TUJC 1UBGA 1MEOA 4J7XA 1MC8A 4KO2S 2FF7A 1JDPA 2QT0A 2XNCA 1L5RA 4ZVLA 4MA5A 3GY0A 1OGIA 1WKBA 2X4DA 3ANTA 2HJVA 3C7AA 1H22A 1Q12A 4YAWA 1EVLA 2ZGVA 5KJ1A 1VL5A 4P4SA 4P0PB 4QXPA 5DM4A 5C9ZA 4MVJF 2LBPA 2A9RA 3HCRA 2IYOA 2C29D 2QGZA 4NBRA 5AI0A 5CVCA 3RSCA 3A6KA 4Q4CA 3G0DA 3WYFA 4G5HA 4QBGB 4M1EA 4XWTA 5ALDA 2VI5A 1L7DA 3E7FA 4DY4A 4KH1A 1HZZC 1P7YA 4PCUA 2B61A 3I30X 4Q21A 5EE1A 1TZBA 2Z95A 1M6VA 1X7XB 2KW5A 2ZWIA 1JHRA 3FZEA 3GUCA 3ND5A 3NWJA 4RK6A 1L8AA 1E69A 5D00A 1JHVA 2Z8YM 3RSHA 3T7SA 4B0OA 1EXVA 3LCCA 1P0IA 2G67A 4FSDA 4OYHA 1YQGA 3LY5A 4GE0A 4Y2HA 1HYBA 1Y1QA 4Q7KA 3VVLA 2BZ0A 4HMPA 4UXIA 8LDHA 1OFGA 3AMVA 3HBFA 4B6RA 2ZIZA 1P5FA 2QX9A 4H0CA 4YTEA 2ECPA 2WU4A 3O93A 4TM7A 3ED5A 4MV6A 3PICA 4P3NA 4JXJA 4M1WA 1XLTA 4MS3B 1FX0A 1JR4A 1YMUA 1RKXA 2ZYHA 3STXA 4C0KA 4MVWA 3F3MA 4JP2A 1T29A 4UU8A 5JNTA 2ODEA 3H75A 2XQGA 4L08A 2ZRHA 1HDXA 4FN4A 4QPCA 5HK8A 1Z8HA 4JYCA 3V4PB 1EQUA 5IH7A 4O02B 1B23P 1J2EA 3DMTA 3LUKA 1QKIA 4MLPA 1OIVA 3H1AA 2GCOB 3CRZA 3MWKA 5K09A 3LX8A 2WF7A 1AS3A 1OU0A 4J0DA 1W4LA 2BDEA 2PX4A 2JJ1D 4G36A 3GN2A 1AHNA 3H2BA 4P53A 1D6NA 4TXNA 3M83A 3WQSB 1J2YA 3QU5A 3W8EA 4C06A 2AD5A 2WHPB 1H0HA 2WWRA 2VZ9A 3AEZA 1JT2A 3HY4A 4Y6LA 3HVJA 4BVBA 3FYDA 3O21A 2NUTA 1QYRA 2CXHA 3R8XA 2O52A 2O8DB 5BPFA 3BD6A 2GAJA 1OAOC 4JOCA 2VYNA 4RQBA 4JCOA 1SXIA 1DRVA 4P80A 1KU6A 3QE4A 3BXZA 3RKRA 5KI6A 1TYZA 2HK8A 3V8PA 1L1QA 4DANA 3LKVA 2A5DA 3ONWA 5HCUA 1QMPA 1VRVA 2F90A 3AEYA 4AVYA 4Z1OA 2AFHB 1NNUA 1NRWA 3QXJA 5IAKA 3WZLA 1U8AA 2GARA 1RQXA 1ZLXA 1E9FA 3EXHA 3MWEB 2W2QA 5ENVA 1WW2A 5LMUB 3C5WP 4J90A 2GNOA 1ODTC 4XRRA 4X7MA 3L92A 3RVDA 1LSJA 1L7OA 1T0HB 2IT1A 3AU8A 4NPCA 4NV1A 3CZRA 2D2VA 4BC0A 3SM9A 3X1XA 4RZ2A 4BZQA 4QXMA 4JUCA 4KN6A 1JI0A 3Q1LA 1BS2A 2CNKA 4O4IB 1P6QA 1QH8A 1SG0A 1D9ZA 1XFDA 3RADC 2G82A 4AJKA 1F4LA 2F00A 5IJ0B 1SUIA 4JJIA 3HM9A 5A9SB 2NU8A 2DT8A 4LF5B 1Z82A 2C4WA