4GQCA

Crystal structure of aeropyrum pernix peroxiredoxin q enzyme in fully-folded and locally-unfolded conformations
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
LVELGEKAPDFTLPNQDFEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKMAQLEKANAEVLAISVDSPWCLKKFKDENRLAFNLLSDYNREVIKLYNVYHEDLKGLKMVAKRAVFIVKPDGTVAYKWVTDNPLNEPDYDEVVREANKIAGELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol peroxidase
publication title Mapping the Active Site Helix-to-Strand Conversion of CxxxxC Peroxiredoxin Q Enzymes.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 43
structure length 160
sequence length 160
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gqcA00
1GSYA 3F3RA 5CRDA 2G0FA 2VD1A 1SL0B 4LA1A 2YANA 1KTEA 5D9VA 1ON4A 1KBNA 4HQSA 3M9JA 4L5OA 3G7IA 2K18A 1PQNA 5IOWA 1MDIA 2RM5A 1MEKA 3IDVA 5FWGA 2V6KA 3HHVA 3A2VA 5D96A 4TR1B 3A2WA 5ECRB 4JR6A 1RW1A 2YJ7A 4X43A 3L0HA 1XWGA 5JCGA 1GUKA 2C0GA 2VCQA 2QKEA 4RQRA 1NHOA 4YQMA 4IJ3A 4WKWA 3DYRA 1XVQA 2M80A 4ECCA 3EU4A 1QK8A 2N5FA 4Z7XA 1G7EA 1MDKA 1VF4A 3CXGA 5DALB 2GQLA 6GSVA 5ELAA 1O8WA 3W6GA 2RM6A 2LUSA 13GSA 3DRNA 4ID0A 3ZIVA 3GSSA 2B7KA 2YCDA 4GCIA 4ZBAA 2WRTA 4JZQA 2RUEA 1XXUA 5E4WA 1TXXA 2LQQA 2PERA 2IJYA 4V1Ap 4DSSB 4NHZA 4ULXA 3P2AA 4F0CA 2HZFA 4K9ZA 2OE3A 4EE0A 1XWKA 1Q4JA 2I9HA 1AAZA 3P7XA 2MMNA 2I81A 3UVHA 3MNGA 4F82A 3DGQA 4GQCA 1TU8A 3L9SA 4MK3A 5G5FA 3FRCA 2CX4A 2AB6A 4XHMA 5ECHB 5F8BA 1A0RP 3HXSA 2KLXA 3CSIA 3TCOA 3VLNA 4IVFA 4ZB8A 1THXA 5J9BA 2GDRA 3TKSC 4MABA 1XWAA 5B6MA 1M2BA 4FIWA 3W8SA 2HLSA 1K0NA 4TR4A 5HR0A 1GP1A 1VF3A 2BMXA 3LORA 3HVXA 3TJBA 1TDIA 3H93A 4QL9A 5B8BA 3LSZA 4ML6A 1TRWA 4TKYA 3IOSA 4AF2A 1T4ZA 1EOHA 5AN1A 5HR2A 5HR1A 2WFCA 4OMVA 3RDWA 1T1VA 3HJMA 4IN0A 3VWXA 2CV4A 3QR6A 3Q6OA 3WGDA 1GSFA 1VF2A 1M0UA 3KXOA 1DE1A 2JZTA 19GSA 3ZZXA 3C71A 3GSTA 1PA3A 5IO2A 1WPIA 3HKRA 3ME7A 4FH8A 5IM9A 5AIXA 2HZEA 1K0OA 1RK4A 2YZHA 5KN0A 3UAPA 4KSMA 3FY7A 3G9BA 4HJMA 1YDKA 1AQXA 1PSQA 4TN8A 3I6AA 4HU7A 4MA9A 3TKSE 2DJJA 1R4WA 1R5PA 1JZOA 2IMEA 4RI6A 4POKA 3M8NA 2H8LA 3K8NA 3GX0A 4KNDA 3HCZA 1UVZA 5DCGA 2LRTA 2IL3A 4TR3A 3PR8A 4IKHA 5DBQA 1OYJA 3KEBA 5IOXA 3GH9A 1B9YC 1X9WB 2YP6A 1F9MA 3HDCA 1TKDB 3HA9A 1K0DA 5IPHA 4IGJA 4POBA 1R7HA 1YF0A 3WT2A 2B6MA 1B9XC 2YJHA 1CQGA 1F6MC 4XS4B 1A0FA 4L0WA 2MMAA 1MDJA 1ERWA 1M7TA 4IP6A 3ZVJA 1Z3EA 3LEFA 3O3TA 4I2TA 3DIEA 2FA4A 2H1BA 4ZBBA 3F4RA 1JHBA 1IYHA 3WT1A 3KH7A 4KE3A 2HRNA 1ZYEA 2MMOA 4FO5A 1HQOA 5D9WA 1XIYA 1Z5YE 4MPGA 4FYUA 3KIJA 5D9TA 4BWQA 1O81A 2QSIA 2C1YA 2N5BA 1JZWA 1ZCPA 3FK8A 3S9FA 1RQMA 4AGSA 3H8QA 4MF6A 1T8EB 4OCFA 2E2MA 3GKNA 2GT6A 3CBUA 2LRCA 1OE7A 2PGTA 1PD21 5KN1A 1NHYA 4IHUA 5EY6A 4GSNA 3VI7A 1QQ2A 3TJJA 4O92A 3Q19A 3TOUA 1BG5A 2H0IA 1ILOA 2IFQA 1BEDA 3UMAA 1DSBA 3IA1A 11GSA 6GSTA 5GZZB 1K3YA 4EUYA 4WR5A 2EIRA 2LQOA 1FOVA 1M9BA 2F9SA 2GSSA 16GSA 2O85A 2I4AA 2L5LA 1AXDA 4YH2A 5C00A 2EIQA 1LJRA 2TRCP 5IMFA 4JE1A 2VCVA 14GSA 3HY2A 3VWVA 4E8HA 3H4KA 3PINA 4TXOB 2OBKA 3O6TA 3KTLA 1U6TA 5JWOB 2OBIA 4I8BA 17GSA 5AGYA 1G7OA 4WETA 3UL3A 1GTUA 3HJOA 4F9ZA 3F4SA 4ECJA 2IMDA 3TB2A 2GSRA 1XVWA 1Z7PA 1GSUA 3UEMA 4XIHA 1SKRB 3IXRA 3FR9A 2ZNMA 3I43A 1Z6NA 2IMIA 1A23A 2P0GA 2LNTA 2RIIA 4K0GA 1FAAA 5F07A 3IAS2 2A2RA 1A8YA 3KMNA 1USBA 1WWJA 1K0BA 4YQVA 5L71A 5DAKB 4IP1A 4MH3A 3GRXA 4TXVA 3L9UA 1GUMA 2LTKA 3A2XA 4GQFA 1WE0A 2A2SA 2KUCA 1XZOA 2FGXA 1Y25A 1YZXA 1WJKA 2JACA 4GF0A 2XHFA 3QCPA 3C8EA 2K9FA 5B6NA 3DVXA 3WGEA 2L5OA 4AJ7A 5HR3A 3TKRA 4N0ZA 1GLQA 2FWGA 1I9DA 2PMTA 2VCWA 4TW5A 3VPTA 2GVPA 4QQ7A 4EKZA 3F0IA 2I3YA 1GUHA 1UN2A 5CRGA 1FO5A 2VL2C 5ECLB 1PX6A 2FWHA 4QL7A 4OWYA 2YPMA 1T3BA 1N2AA 2O8VB 4OFTA 5DJLA 3A5WA 1X5EA 1G6YA 2H75A 5IO0A 4KGIA 2VD0A 1PX7A 1H4OA 4XRDA 3J7Yk 1F2EA 3RPPA 3UOMA 4LMVA 3TRXA 4PX1A 1OC3A 4JEDA 3WGXA 2JZRA 1O85A 2HYXA 5EPFA 2OADA 2IFQB 1B48A 4JRRA 4TOPA 2ON5A 3KTBA 3P8WA 2ES7A 3KD0A 3DD3A 4DVCA 3EE2A 4D73A 2NTOA 3GL3A 2X64A 4TR0A 1SK2A 2VOCA 3HYPA 3LGCA 3MAKA 1A8LA 1SJIA 3L9VA 3EURA 2VCTA 1QFNA 2WZ9A 4ZBDA 1Y6EA 3FEUA 2X8GA 1M2DA 2N5AA 5JCWA 2X8HA 1KEBA 3QFBC 3IR4A 4Q5RA 1EWXA 10GSA 5CNWA 2CX3A 2R5GA 5FT3A 1WP0A 2O7KA 2AHEA 1W89A 1K0MA 4KX4A 5ECNB 2VM2A 1OKTA 3L78A 4MDCA 1YF1A 2R37A 4I5QA 1FW1A 4NHWA 3GHAA 4IELA 4HUAA 3U5RE 3LQ7A 1T4YA 2NPBA 2K8VA 5IMDA 1PKWA 1X9SB 1VGLA 3HVSA 2H6XA 5G2ZA 4F03A 4V2LA 3M0FA 1HNBA 3BCKA 5IQYA 2GTUA 3RHBA 5A4WA 4LL4B 8GSSA 2HXKA 4OO5A 4X0XA 2TRXA 2OE1A 3ZVJD 3ERGA 2CT6A 1GRXA 3F6DA 4BVYA 1PKZA 5KN3A 3LYKA 1TRSA 2R3XA 3LXTA 1BX9A 4IW9A 1AUCA 1TRUA 2GGTA 5GSTA 3Q74A 4MH2A 1ML6A 4PURA 4PXOA 3TKPA 3F3QA 3LWAA 1V9WA 1YKAA 5ECKB 1WRYA 5HQPA 4L5LA 4O32A 2PBJA 5IMCA 2DMMA 1R26A 2YV7A 5J3RA 3ZYWA 6GSSA 5CAXA 1SK0A 4PQIA 2HRFA 4PUFC 4AJ8A 20GSA 2H01A 2IMFA 2KOKA 4J2FA 2P5RA 4WBRD 1S3AA 2H6ZA 2LKUA 4MCUA 1TK5B 4XS6A 4CHSA 1UA5A 5H5QA 3IRAA 4K6XA 4N11A 4K7NA 5H5SA 2J23A 3KGKA 4MP4A 1SD9A 1U3IA 4G10A 3QD9A 5F0GA 4D73B 1BAYA 2E0QA 4O5RA 2L4CA 1T7PB 2YWMA 1XCCA 6GSUA 3APOA 1ZZYA 4EF0A 1MD3A 3CTFA 3EMPA 5H5RA 2EIOA 4EDYA 3TOTA 5B7CA 5CYYA 4FYCA 2Z9SA 2XBIA 3FZ9A 1M2AA 1EEJA 2VLVA 5B8AA 2PU9C 3EWLA 4TVEA 1EGRA 4V2MA 1URMA 4GSTA 5A4UA 1AW9A 3Q18A 1V57A 1FB6A 4J56E 2GZZA 2CAIA 5GAPD 3D0ZA 2C80A 3V1WA 3E3EA 1ZMAA 2HNLA 1NW2A 3BJ5A 1GSDA 4Q5FA 3GTUA 4TRXA 2MBTA 2OACA 4HZ4A 4WF4A 2DSAA 1N8JA 4HI7A 3DMLA 5ABRA 3FZ4A 4MF5A 1K3OA 4HZ2A 2C3QA 2WULA 2B1KA 3KMOA 3VURA 5GAND 2OJLA 2DC5A 1GULA 2JU5A 2H71A 1JFUA 1HD2A 1NM3A 4K7IA 2M72A 2X8CA 4KDYA 3ME8A 18GSA 3EU3A 3C7MA 5D9XA 3ZRDA 4ML1A 2IPAA 3FR6A 1THOA 4BVXA 3QAVA 2DIZA 4F0BA 4MF7A 4PNGA 4PNFA 2LJAA 4KA0A 2H72A 2LS5A 5J9CA 1SYRA 3M3MA 3KJYA 2GLRA 2XBQA 2KP1A 4YAVA 5ECIB 1O6JA 2L6CA 4HEA2 4CDOA 2GT5A 3ZLPA 3SWLA 5EL8A 2CVKA 1SJZA 2REMA 4PUAA 5JWRB 1EV4A 4KUNA 2YNXA 2F3MA 5J4UA 1FVKA 2EC4A 3E0UA 2C0DA 1YEXA 2CA8A 3CTGA 4HQZA 2KHPA 1J08A 3I69A 3ZMLA 2HFDA 4MJCA 1ZGNA 3N9JA 3JCML 2VCXA 4PQ1A 1R5AA 4MJEA 2ZCTA 2LSTA 3CRUA 2LJKA 5ID2A 4G19A 1YY7A 2AAWA 5A5KA 1DBYA 2FD3A 3D4TA 1F3BA 5DDLA 2HZEB 5LNKe 3U6VA 1E2YA 1T00A 1YEPA 4HOJA 2WJUA 1ST9A 22GSA 3UBLA 2FWEA 4XTSA 2YOIA 2P31A 2VL3A 3ERWA 3O76A 1TRVA 3FKFA 5ELGA 1U87A 2E2GA 3TRPA 3QMXA 5HFKA 1TU7A 2B3SA 1F37A 3MDKA 5LD0A 5IMAA 2OKAA 3GFKA 3HZ4A 1GSEA 1SKWB 3HZ8A 2M46A 1VRSD 2FY6A 2H76A 1FG4A 4MPFA 3F8UA 4I97A 1ZOFA 2NDOA 4AJ6A 1PL1A 3SBCA 4MZCA 1JZRA 3EYTA 1O73A 4BL7A 4PGTA 3BBYA 4POLA 4I2UA 3HJPA 3N5OA 1YQ1A 5EVOA 4HDEA 1BJXA 3ISOA 3ZIJA 4MJAA 4MZBA 1JLWA 1LU4A 1BYEA 2DJ0A 1X5DA 3P90A 3QAWA 4DSQA 4GLTA 4ACSA 5LCZA 2DJKA 1FVJA 3DEXA 3RPNA 3QDNA 3VWWA 1MD4A 4DSSA 3IC4A 3FHKA 3ERFA 1Z9HA 4ZXGA 4EXJA 2YWIA 3IV4A 3NIVA 1A24A 3CYNA 4KSOA 3GNJA 5DQSA 3DKSA 1GLPA 2GS3A 4LLRA 1ACVA 2F8AA 3PGTA 4HS1A 1SYXA 5HFIA 1GTBA 2LJRA 3NZNA 1SENA 3D21A 2PVQA 3CSHA 2YZUA 4ZL7A 1GL8A 4ZILA 3WD6A 3F6FA 4EDZA 2PPTA 3GA4A 2BTOT 1VF1A 5G1LA 1XW6A 2K8SA 3F9UA 2HE3A 2YV9A 1WOUA 1ZL9A 2LNSA 2QGVA 1BQ7A 2ALBA 1OC8A 2ON7A 2BJXA 1TW9A 3LJRA 3APSA 2A4VA 3IPZA 5G1KA 2CZ2A 4K1FA 3H79A 1A2MA 5ID2B 3FW2A 5DJMA 3ZREA 4F2IA 1B4PA 3HVVA 2FWFA 2CQ9A 5DCHA 2RUFA 4NXIA 1DUGA 3PH9A 3GIXA 1EEMA 2IIYA 1M9AA 3KCMA 3IK7A 3OR5A 3QFAC 1TOFA 4GSSA 1A2LA 1EP8A 2B5EA 1XBSA 2GZPA 1CQHA 2PUKC 2YWNA 2VLUA 4E8EA 4DEJA 3GYKA 2WB9A 4NAXA 4YAPA 2C0EA 3EINA 1HYUA 1HNCA 2V1MA 4WEYA 3GKXA 3IE3A 1V98A 3D22A 3FR3A 2MYGA 4KCEA 4KH7A 2VM1A 1ZYQB 5F05A 2XC2A 4NMUA 1LBKA 2VO4A 4G9HA 3DXBA 2HT9A 1SKSB 1MTCA 2DBCA 2L6DA 2VUPA 1OKDA 3LYPA 2IMKA 2I1UA 5AISA 3ZITA 2O87A 2R2JA 4NPBA 4ZL8A 3C73A 4MMMA 5CRHA 3ZTLA 1Q98A 1XW5A 5ECMB 3QAGA 2NBSA 2JSZA 1K0AA 2YWOA 4JR4A 5G5EA 4XCSA 4XS4A 5E59A 3UIWA 2L4QA 2FNOA 1JLVA 4ECIA 2GZYA 4K0NA 1GSSA 3LXZA 2HI7A 5CP1A 5FHIA 1SJ6A 2VL2A 2K6VA 5IMVA 5F06A 4FYBA 1AQVA 1X9MB 1PN9A 2H74A 3DWVA 2H1AA 6GSXA 1OE8A 3VPQA 3IBHA 1GNEA 3VFIA 4GRFA 5KEJA 2DJ3A 4MJBA 4J57E 2FA8A 4XS1A 3CRTA 1G6WA 3I9V2 2VLTA 2RLIA 5CO3A 2AUVA 3KM6A 3GV1A 2NVLA 3IK9A 4N0VA 2ZUPA 1Z7RA 2VCZA 1GTIA 4PQHA 1W4VA 3F4TA 4HU9A 1NSWA 1C72A 1J9BA 1FHEA 4ZB9A 4WBJA 1GH2A 1PRXA 5CRWA 3C1RA 2TIRA 3D4MA 1EZKA 7GSSA 4I6XA 1EP7A 4WXTA 2CZ3A 2IN3A 3VI5A 1O8XA 2D2ZA 3D6IA 3W8JA 4O7HA 3IHQA 2WCIA 6GSYA 3H1NA 5IIZA 2XPEA 1A2JA 4GTUA 2GQKA 4IJIA 2AYTA 3GURA 4ZL9A 2JZSA 3FZ5A 1SL1B 3GH6A 4N10A 5IPGA 4ISDA 4K8MA 3RAZA 4EC0A 3WYWA 1TK8B 4TXOA 3TRQA 3UJ1A 1XWCA 4NWYA 1K0CA 3VWUA 2DIYA 3CSJA 5INYA 4JBBA 3ED3A 2H0HA 4X1UA 4K7OA 2WS2A 5G30A 1XFLA 3TJFA 2JADA 2V2GA 5ECQB 3TDGA 3TKQA 1XWBA 1M99A 3MSZA 1U88A 12GSA 4ZB6A 4ILFA 1U3AA 4K2DA 3BD2A 4IQAA 4NV5A 3LG6A 4WF5A 2GSTA 3NOFA 3HD5A 2JSYA 4P3YB 2F8FA 1GWCA 2J9HA 2L57A 2VIMA 3FZAA 1WIKA 1ERTA 2C4JA 5DAKA 4DSRA 2YN1A 4OO4A 2CVBA 3TUEA 1EGOA 4OD7A 1EOGA 1QXHA 1AIUA 1YKCA 4Q5QA 4POMA 4ZIJA 3TJKA 1SL2B 1JZDA 3ZFBA 4V1Ag 4LMWA 2FHEA 2AJQB 2DJ2A 2WGRA 1V40A 1SU9A 3J7Yb 3ZFLA 2FCHA 3TKSA 4BPYA 4L8EA 5AIVA 4OCEA 3E9JB 1FB0A 5A4VA 2OE0A 4EVMA 2R6KA 3UBKA 3GL5A 3TJGA 2B5YA 4EO3A 2H0GA 1X5CA 2H6YA 1XOAA 3US3A 5J5NA 4OFNA 5D8IA 3F63A 2CAQA 4RI7A 3D5JA 3MWHA 2H1DA 2R4VA 1TP9A 2GQMA 2PWJA 5D73A 2C3NA 2GSQA 1TI1A 4KB3A 1G0TA 4RUVA 2E7PA 3RHCA 4NV2A 1OC9A 2LRNA 2HSHA 4H86A 1GSQA 1IYIA 1QUWA 4Q5NA 1B4QA 4YQUA 3R2QA 2AV4A 3L4NA 4BA7A 1OVNA 3KP9A 1ERVA 1F3AA 5ECSA 2C8UA 3KP8A 1SK1A 5JWQB 1DE2A 4KCAA 4V2NA 1B8XA 4G2EA 2H66A 3M1GA 1E6BA 4IS0A 3TGZA 3G7JA 1UC7A 3UARA 4ECBA 2C3TA 6GSWA 2H1GA 4TR1A 3ZMKA 1Z6MA 2FUG2 4HJ2A 5C04A 4IBPA 4GWRA 2H19A 9GSSA 1TJDA 3M9KA 1QMVA 4MZWA 2V32A 1V58A 1XPVA 1TTZA 3GTUB 4GXZA 5GSSA 3GUSA 4JU5A 5D93A 1PMTA 4IQ1A 2H70A 4KDXA 1QGVA 2LEGA 1H75A 1XW9A 2PVOC 2DJ1A 4KW6A 1S3DA 3APQA 2MZCA 5ENUA 3KH9A 4OFMA 5DALA 2H73A 2MMZA 4KAEA 2B7JA 3IAM2 3GKMA 4RQXA 2B5XA 4MLYA 2B1LA 2WDUA 3AY8A 2HSYA 4L0UA 3GMFA 5CREA 1WMJA 4BWSA 1YJ6A 2FLSA 2VAFA 1I5GA 5ECOB 3GN3A 1S3CA 2VL9A 2DMLA 1AQWA 1GNWA 1ABAA 1EV9A 1K3LA 4EL1A 5HFGA 3GKKA 3GX8A 3QOUA 2P5QA 1OAZA 2KP2A 2XPDA 3VK9A 4WR4A 5IMZA 3KZQA 5COHA 1KNGA 2V6OA 2C0FA 5DVBA 1GTAA 3BCIA 1PL2A 1TK0B 3CMIA 2PN8A 4LL1B 5G31A 3FYGA 2MBSA 1SD8A 2IWTA 2F51A 3A3TA 3BOAA 5JCUA 5J41A 1V2AA 2JL4A 3LFLA 3DVWA 1XOBA 5ECPB 2CVDA 3EMXA 3C1SA 5DQYA 2QC7A 3ZL5A 1PGTA 3G7YA 1J0FA 1OC9B 1X0RA 1O7UA 4KDUA 2L59A 1HNAA 3EVIA 2O89A 3UVTA 1AC1A 1TI3A 1ERUA 3RBTA 4CW9A 2LV3A 3QPMA 2H30A 3EC3A 4XRAA 5KN2A 2X99A 2DLXA 2V41A 2OA7A 4N30A 2G2QA
chains in the Genus database with same CATH superfamily
1GSYA 3F3RA 5CRDA 2G0FA 2VD1A 1SL0B 4LA1A 2YANA 1KTEA 5D9VA 1ON4A 1KBNA 4HQSA 3M9JA 4L5OA 3G7IA 2K18A 1PQNA 5IOWA 1MDIA 2RM5A 1MEKA 3IDVA 5FWGA 2V6KA 3HHVA 3A2VA 5D96A 4K5RA 4TR1B 3A2WA 5ECRB 4JR6A 1RW1A 2YJ7A 4X43A 3L0HA 1XWGA 5JCGA 1GUKA 2C0GA 2VCQA 2QKEA 4RQRA 1NHOA 4YQMA 4IJ3A 4WKWA 3LW9A 3DYRA 1XVQA 2M80A 4ECCA 3EU4A 1QK8A 4BL7B 2N5FA 4Z7XA 1G7EA 1MDKA 1VF4A 3CXGA 5DALB 2GQLA 6GSVA 5ELAA 1O8WA 3W6GA 2RM6A 2LUSA 13GSA 1ZYNA 3DRNA 4ID0A 3ZIVA 3GSSA 2B7KA 2YCDA 4GCIA 4ZBAA 2WRTA 4JZQA 2RUEA 1XXUA 5E4WA 1TXXA 2LQQA 2PERA 2IJYA 2HSMA 4V1Ap 4DSSB 4NHZA 4ULXA 3P2AA 4F0CA 2HZFA 4K9ZA 2OE3A 4EE0A 1XWKA 1Q4JA 2I9HA 1AAZA 3P7XA 2MMNA 2I81A 3UVHA 3MNGA 4F82A 3DGQA 4GQCA 1TU8A 1M3JA 3L9SA 4MK3A 5G5FA 3FRCA 2CX4A 2AB6A 4XHMA 5ECHB 5F8BA 1A0RP 3HXSA 5KOXA 2KLXA 3CSIA 3TCOA 3VLNA 4IVFA 3CQFA 4ZB8A 1THXA 5J9BA 2GDRA 3TKSC 4MABA 1XWAA 5B6MA 1M2BA 4FIWA 3W8SA 2HLSA 1K0NA 4TR4A 5BMUA 5HR0A 1GP1A 1VF3A 2BMXA 3LORA 3HVXA 3TJBA 1TDIA 3H93A 4QL9A 5B8BA 3LSZA 4ML6A 1TRWA 4TKYA 3IOSA 4AF2A 1T4ZA 1EOHA 5AN1A 5HR2A 5HR1A 2WFCA 4OMVA 3RDWA 1T1VA 3HJMA 4IN0A 3VWXA 2CV4A 3QR6A 3Q6OA 3WGDA 1GSFA 1VF2A 1M0UA 3KXOA 1DE1A 2JZTA 19GSA 3ZZXA 3C71A 3GSTA 1PA3A 5IO2A 1WPIA 3HKRA 3ME7A 4FH8A 5IM9A 5AIXA 2HZEA 1K0OA 1RK4A 2YZHA 5KN0A 3UAPA 4KSMA 3FY7A 3G9BA 4HJMA 1YDKA 1AQXA 1PSQA 4TN8A 3I6AA 4HU7A 4MA9A 3TKSE 2DJJA 1R4WA 1R5PA 1JZOA 2IMEA 4RI6A 4POKA 3M8NA 2H8LA 3K8NA 3GX0A 4KNDA 3HCZA 1UVZA 5DCGA 2LRTA 2IL3A 4TR3A 3PR8A 4IKHA 5DBQA 1OYJA 3KEBA 5IOXA 3GH9A 1B9YC 1X9WB 2YP6A 1F9MA 2QA2A 3HDCA 1TKDB 3HA9A 1K0DA 5IPHA 4IGJA 4POBA 1R7HA 1YF0A 3WT2A 2B6MA 1B9XC 2YJHA 1CQGA 1F6MC 4XS4B 1A0FA 4L0WA 2MMAA 1MDJA 1ERWA 1M7TA 4IP6A 3ZVJA 1Z3EA 3LEFA 3O3TA 4I2TA 3DIEA 2FA4A 2H1BA 4ZBBA 3F4RA 1JHBA 1IYHA 3WT1A 3KH7A 4KE3A 2HRNA 1ZYEA 2MMOA 4FO5A 1HQOA 4K5SA 5D9WA 4BIKA 1XIYA 1Z5YE 4MPGA 4FYUA 3KIJA 5D9TA 4BWQA 1O81A 2QSIA 2C1YA 2N5BA 1JZWA 1ZCPA 3FK8A 3IHGA 3S9FA 1RQMA 4AGSA 3H8QA 4MF6A 1T8EB 4OCFA 2E2MA 3GKNA 2GT6A 3CBUA 4O5QA 2LRCA 1OE7A 2PGTA 1PD21 5KN1A 4A5PA 1NHYA 4IHUA 5EY6A 4GSNA 3VI7A 1QQ2A 3TJJA 4O92A 3Q19A 3TOUA 1BG5A 2H0IA 1ILOA 2IFQA 1BEDA 3UMAA 1DSBA 3IA1A 11GSA 6GSTA 5GZZB 1K3YA 4EUYA 4WR5A 2EIRA 2LQOA 1FOVA 1M9BA 2F9SA 2GSSA 16GSA 2O85A 2I4AA 2L5LA 1AXDA 4YH2A 5C00A 2EIQA 1LJRA 2TRCP 5IMFA 4JE1A 2VCVA 14GSA 4ICYA 3HY2A 3VWVA 4E8HA 3H4KA 3PINA 4TXOB 2OBKA 3O6TA 3KTLA 1U6TA 5JWOB 2OBIA 4I8BA 17GSA 5AGYA 1G7OA 4WETA 3UL3A 1GTUA 3HJOA 4F9ZA 3F4SA 4ECJA 2IMDA 3TB2A 2GSRA 1XVWA 1Z7PA 1GSUA 3UEMA 4XIHA 1SKRB 3IXRA 3FR9A 2ZNMA 3I43A 2DKIA 1Z6NA 2IMIA 1A23A 2P0GA 2LNTA 2RIIA 4K0GA 1FAAA 3MYDA 5F07A 3IAS2 2A2RA 2R0GA 1A8YA 3KMNA 1USBA 1WWJA 1K0BA 4YQVA 5L71A 5DAKB 4IP1A 4MH3A 3GRXA 4TXVA 3L9UA 1GUMA 2LTKA 3A2XA 4GQFA 1WE0A 2X49A 2A2SA 2KUCA 1XZOA 2FGXA 1Y25A 1YZXA 1WJKA 2JACA 4GF0A 2XHFA 3QCPA 3C8EA 2K9FA 5B6NA 3DVXA 3WGEA 2L5OA 4AJ7A 5HR3A 3TKRA 4N0ZA 1GLQA 2FWGA 2QA1A 1I9DA 2PMTA 2VCWA 4TW5A 3VPTA 2GVPA 4QQ7A 4EKZA 3F0IA 2I3YA 1GUHA 1UN2A 5CRGA 1FO5A 2VL2C 5ECLB 1PX6A 2FWHA 4QL7A 4OWYA 2YPMA 1T3BA 1N2AA 2O8VB 4OFTA 5DJLA 3A5WA 1X5EA 1G6YA 2H75A 5IO0A 4KGIA 2VD0A 1PX7A 1H4OA 4XRDA 3J7Yk 1F2EA 3RPPA 3UOMA 4X4JA 4LMVA 3FMWA 3TRXA 4PX1A 1OC3A 4JEDA 3WGXA 2JZRA 1O85A 2HYXA 5EPFA 2OADA 2IFQB 1B48A 4JRRA 4TOPA 2ON5A 3KTBA 3P8WA 2ES7A 3KD0A 3DD3A 4DVCA 3EE2A 4D73A 2NTOA 3GL3A 2X64A 4TR0A 1SK2A 2VOCA 3HYPA 3LGCA 3MAKA 1A8LA 1SJIA 3L9VA 3EURA 2VCTA 1QFNA 2WZ9A 4ZBDA 1Y6EA 3FEUA 2X8GA 1M2DA 2N5AA 5JCWA 2X8HA 1KEBA 3QFBC 3IR4A 4Q5RA 1EWXA 10GSA 5CNWA 2CX3A 2R5GA 3A5IA 5FT3A 1WP0A 2O7KA 2AHEA 1W89A 1K0MA 4KX4A 5ECNB 2VM2A 1OKTA 3L78A 4MDCA 1YF1A 2R37A 4I5QA 1FW1A 4NHWA 3GHAA 4IELA 4HUAA 3U5RE 3LQ7A 1T4YA 2NPBA 2K8VA 5IMDA 1PKWA 1X9SB 1VGLA 3HVSA 2H6XA 5G2ZA 4F03A 2UZ8A 4V2LA 3M0FA 1HNBA 3BCKA 5IQYA 2GTUA 3RHBA 5A4WA 4LL4B 8GSSA 2HXKA 4OO5A 4X0XA 2TRXA 2OE1A 3ZVJD 3ERGA 2R0PA 2CT6A 1GRXA 3F6DA 4BVYA 1PKZA 5KN3A 3LYKA 1TRSA 2R3XA 3LXTA 1BX9A 4IW9A 1AUCA 1TRUA 2GGTA 5GSTA 3Q74A 4MH2A 1ML6A 4PURA 4PXOA 3TKPA 3F3QA 3LWAA 1V9WA 1YKAA 5ECKB 1WRYA 5HQPA 4L5LA 4O32A 2PBJA 5IMCA 2DMMA 1R26A 2YV7A 5J3RA 3ZYWA 6GSSA 5CAXA 1SK0A 4PQIA 2HRFA 4PUFC 4AJ8A 20GSA 2H01A 2IMFA 2KOKA 4J2FA 2P5RA 4WBRD 1S3AA 2H6ZA 2LKUA 4MCUA 1TK5B 4XS6A 4CHSA 1UA5A 5H5QA 3IRAA 4K6XA 4N11A 4K7NA 5H5SA 2J23A 3KGKA 4MP4A 1SD9A 1U3IA 4G10A 3QD9A 2HRAA 5F0GA 4D73B 1BAYA 2E0QA 4O5RA 2L4CA 1T7PB 2YWMA 1XCCA 4FQUA 6GSUA 3APOA 1ZZYA 4EF0A 1MD3A 3CTFA 3EMPA 5H5RA 2EIOA 4EDYA 3TOTA 5B7CA 5CYYA 4FYCA 2Z9SA 2XBIA 3FZ9A 1M2AA 1EEJA 2VLVA 5B8AA 2PU9C 3R3EA 3EWLA 4TVEA 1EGRA 4V2MA 1URMA 4GSTA 5A4UA 1AW9A 3Q18A 1V57A 1FB6A 4J56E 2GZZA 2CAIA 5GAPD 3IC8A 3D0ZA 2C80A 3V1WA 3E3EA 1ZMAA 2A2PA 2HNLA 1NW2A 3BJ5A 1GSDA 4Q5FA 3GTUA 4TRXA 2MBTA 2OACA 4HZ4A 4WF4A 2DSAA 1N8JA 4HI7A 3DMLA 5ABRA 3FZ4A 4MF5A 1K3OA 4HZ2A 2C3QA 2WULA 2B1KA 3KMOA 3VURA 5GAND 4BVYB 2OJLA 2DC5A 1GULA 2JU5A 2H71A 1JFUA 1HD2A 5KOWA 1NM3A 4K7IA 2M72A 2R0CA 2X8CA 4EIQA 4KDYA 3ME8A 18GSA 3EU3A 3C7MA 5D9XA 3ZRDA 1XG8A 4ML1A 2IPAA 3FR6A 1THOA 4BVXA 3QAVA 2DIZA 4F0BA 4MF7A 4PNGA 4PNFA 2LJAA 4KA0A 2H72A 2LS5A 5J9CA 1SYRA 3M3MA 3KJYA 2GLRA 2XBQA 2KP1A 1ZYPA 4YAVA 5ECIB 1O6JA 2L6CA 4HEA2 4CDOA 2GT5A 3ZLPA 3SWLA 5EL8A 2CVKA 1SJZA 2REMA 4PUAA 5JWRB 1EV4A 4KUNA 2YNXA 2F3MA 5J4UA 1FVKA 2EC4A 3E0UA 2C0DA 1YEXA 2CA8A 3CTGA 4HQZA 2KHPA 1J08A 3I69A 3ZMLA 2HFDA 4MJCA 1ZGNA 3N9JA 3JCML 2VCXA 4PQ1A 1R5AA 4MJEA 2ZCTA 2LSTA 3CRUA 2LJKA 5ID2A 4G19A 1YY7A 2AAWA 5A5KA 1DBYA 2FD3A 3D4TA 1F3BA 5DDLA 2HZEB 5LNKe 3U6VA 1E2YA 1T00A 1YEPA 4HOJA 2WJUA 1ST9A 22GSA 3UBLA 4USSA 2FWEA 4XTSA 2YOIA 2P31A 2VL3A 3ERWA 3O76A 4YKFA 1TRVA 3FKFA 5ELGA 1U87A 2E2GA 3TRPA 3QMXA 5HFKA 1TU7A 2B3SA 1F37A 3MDKA 5LD0A 5IMAA 2OKAA 3GFKA 4O5UA 3HZ4A 1GSEA 1SKWB 3HZ8A 2M46A 1VRSD 2FY6A 2H76A 1FG4A 4MPFA 3F8UA 4I97A 1ZOFA 2NDOA 4AJ6A 1PL1A 3SBCA 4MZCA 1JZRA 3EYTA 1O73A 4BL7A 4PGTA 3BBYA 4POLA 4I2UA 3HJPA 3N5OA 1YQ1A 5EVOA 4HDEA 1BJXA 3ISOA 3ZIJA 4MJAA 4MZBA 1JLWA 1LU4A 1BYEA 2DJ0A 1X5DA 1PN0A 3P90A 3QAWA 4DSQA 4GLTA 4ACSA 5LCZA 2DJKA 1FVJA 3DEXA 3RPNA 3QDNA 3VWWA 1MD4A 4DSSA 3IC4A 3FHKA 3ERFA 4BVXB 1Z9HA 2X4AA 4ZXGA 4EXJA 2YWIA 3IV4A 3NIVA 1A24A 3CYNA 4KSOA 4K2XA 3GNJA 5DQSA 3DKSA 1GLPA 2GS3A 4LLRA 1M3IA 1ACVA 2F8AA 3PGTA 4HS1A 1SYXA 5HFIA 1GTBA 2LJRA 3NZNA 1SENA 3D21A 4G0KA 4YKGA 2PVQA 3CSHA 2YZUA 4ZL7A 1GL8A 4ZILA 3WD6A 3F6FA 4EDZA 2PPTA 3GA4A 2BTOT 1VF1A 5G1LA 1XW6A 2K8SA 3F9UA 2HE3A 2YV9A 1WOUA 1ZL9A 2LNSA 2QGVA 1BQ7A 2ALBA 1OC8A 2ON7A 2BJXA 1TW9A 3LJRA 4CY6A 3APSA 2A4VA 3IPZA 5G1KA 2CZ2A 4K1FA 3H79A 1A2MA 5ID2B 3FW2A 5DJMA 3ZREA 4F2IA 1B4PA 3HVVA 2FWFA 2CQ9A 5DCHA 2RUFA 4NXIA 1DUGA 3PH9A 3GIXA 1EEMA 2IIYA 1M9AA 3KCMA 3IK7A 3OR5A 3QFAC 1TOFA 4GSSA 1A2LA 1EP8A 2B5EA 1XBSA 2GZPA 1CQHA 2PUKC 2YWNA 2VLUA 4E8EA 4DEJA 3GYKA 2WB9A 4NAXA 4YAPA 2C0EA 3EINA 1HYUA 1HNCA 2V1MA 4WEYA 3GKXA 3IE3A 1V98A 3D22A 3FR3A 2MYGA 2A4HA 4KCEA 4KH7A 2VM1A 1ZYQB 5F05A 2XC2A 4NMUA 1LBKA 2VO4A 4G9HA 3DXBA 2HT9A 5BRTA 1SKSB 1MTCA 2DBCA 2L6DA 2VUPA 1OKDA 3LYPA 2IMKA 2I1UA 5AISA 3ZITA 2O87A 2R2JA 4NPBA 4ZL8A 3C73A 4MMMA 5CRHA 3ZTLA 1Q98A 1XW5A 5ECMB 3QAGA 2NBSA 2JSZA 1K0AA 2YWOA 4JR4A 5G5EA 4XCSA 4XS4A 5E59A 3HVNA 3UIWA 2L4QA 2FNOA 1JLVA 4ECIA 2GZYA 4K0NA 1GSSA 3LXZA 2HI7A 5CP1A 5FHIA 1SJ6A 2VL2A 2K6VA 5IMVA 5F06A 4FYBA 1AQVA 1X9MB 1PN9A 4KF9A 2H74A 3DWVA 2H1AA 6GSXA 1OE8A 3VPQA 3IBHA 1GNEA 3VFIA 4GRFA 5KEJA 2DJ3A 4MJBA 4J57E 2FA8A 4XS1A 3CRTA 1G6WA 3I9V2 4PTSA 2VLTA 2RLIA 5CO3A 2AUVA 3KM6A 3GV1A 2NVLA 3IK9A 4N0VA 2ZUPA 1Z7RA 2VCZA 1GTIA 4PQHA 1W4VA 3F4TA 4HU9A 1NSWA 1C72A 1J9BA 1FHEA 4ZB9A 4WBJA 1GH2A 1PRXA 5CRWA 3C1RA 2TIRA 3D4MA 1EZKA 7GSSA 4I6XA 1EP7A 4WXTA 2CZ3A 2IN3A 4G0LA 3VI5A 1O8XA 2D2ZA 3D6IA 3W8JA 4O7HA 3IHQA 2WCIA 6GSYA 3H1NA 5IIZA 2XPEA 1A2JA 4GTUA 2GQKA 4IJIA 1S3RA 2AYTA 3GURA 4ZL9A 2JZSA 3FZ5A 1SL1B 3GH6A 4N10A 5IPGA 4ISDA 4EIPA 4K8MA 3RAZA 4EC0A 3WYWA 1TK8B 4TXOA 3TRQA 4Z2TA 3UJ1A 1XWCA 4NWYA 1K0CA 3VWUA 2DIYA 3CSJA 5INYA 4JBBA 3ED3A 2H0HA 4X1UA 4K7OA 2WS2A 5G30A 1XFLA 2HRKA 3TJFA 2JADA 2V2GA 5ECQB 3TDGA 3TKQA 1XWBA 1M99A 3MSZA 1U88A 12GSA 4ZB6A 4ILFA 1U3AA 4K2DA 3BD2A 4IQAA 4NV5A 3LG6A 4WF5A 2GSTA 3NOFA 3HD5A 2JSYA 4P3YB 2F8FA 1GWCA 2DKHA 2J9HA 2L57A 2VIMA 3FZAA 1WIKA 4Z2UA 1ERTA 2C4JA 5DAKA 4G0IA 4DSRA 2YN1A 4OO4A 2CVBA 3TUEA 1EGOA 4OD7A 1EOGA 1QXHA 1AIUA 1YKCA 4Q5QA 4POMA 4ZIJA 3TJKA 1SL2B 1JZDA 3ZFBA 4V1Ag 4LMWA 2FHEA 2AJQB 2DJ2A 2WGRA 1V40A 1SU9A 3J7Yb 3ZFLA 2FCHA 3TKSA 4BPYA 4L8EA 5AIVA 4OCEA 3E9JB 1FB0A 5A4VA 2OE0A 4EVMA 2R6KA 3UBKA 3GL5A 3TJGA 4Z2RA 4MNNA 2B5YA 4EO3A 2H0GA 1X5CA 2H6YA 1XOAA 3US3A 5J5NA 4OFNA 5D8IA 3F63A 2CAQA 4RI7A 3D5JA 3MWHA 2H1DA 2R4VA 1TP9A 2GQMA 2PWJA 5D73A 2C3NA 2GSQA 1TI1A 4KB3A 1G0TA 1FOHA 4RUVA 2E7PA 3RHCA 4NV2A 1OC9A 2LRNA 2HSHA 4H86A 1GSQA 1IYIA 1QUWA 4Q5NA 1B4QA 4YQUA 3R2QA 2AV4A 3L4NA 4BA7A 3PPUA 1OVNA 3KP9A 1ERVA 1F3AA 5ECSA 2C8UA 3KP8A 1SK1A 5JWQB 1DE2A 4KCAA 4V2NA 1B8XA 4G2EA 2H66A 3M1GA 1E6BA 4IS0A 3TGZA 3G7JA 1UC7A 3UARA 4ECBA 2C3TA 6GSWA 2H1GA 4TR1A 3ZMKA 1Z6MA 2FUG2 4HJ2A 5C04A 4IBPA 4GWRA 2H19A 9GSSA 1TJDA 3M9KA 1QMVA 4MZWA 2V32A 1V58A 1XPVA 1TTZA 3GTUB 4GXZA 5GSSA 3GUSA 4JU5A 5D93A 1PMTA 4CY8A 4IQ1A 2H70A 4KDXA 1QGVA 2LEGA 1H75A 1XW9A 2PVOC 1PFOA 2DJ1A 4KW6A 1S3DA 3APQA 2MZCA 5ENUA 3KH9A 4OFMA 5DALA 2H73A 2MMZA 4KAEA 2B7JA 3IAM2 3GKMA 4RQXA 2B5XA 4MLYA 2B1LA 2WDUA 3AY8A 2HSYA 4L0UA 3GMFA 5CREA 1WMJA 4BWSA 1YJ6A 2FLSA 2VAFA 1I5GA 5ECOB 3GN3A 1S3CA 2VL9A 2DMLA 1AQWA 1GNWA 1ABAA 1EV9A 1K3LA 4EL1A 5HFGA 3GKKA 3GX8A 3QOUA 2P5QA 1OAZA 2KP2A 2XPDA 3VK9A 4WR4A 5IMZA 3KZQA 5COHA 1KNGA 2V6OA 2C0FA 5DVBA 1GTAA 3BCIA 1PL2A 3EPTA 1TK0B 3CMIA 2PN8A 4LL1B 5G31A 4HSCX 3FYGA 2MBSA 1SD8A 2IWTA 2F51A 3A3TA 3BOAA 5JCUA 5J41A 1V2AA 2JL4A 3LFLA 3DVWA 1XOBA 5ECPB 2CVDA 3EMXA 3C1SA 5DQYA 2QC7A 3ZL5A 1PGTA 3G7YA 1J0FA 1OC9B 1X0RA 1O7UA 4KDUA 2L59A 1HNAA 3EVIA 2O89A 3UVTA 1AC1A 1TI3A 1ERUA 3RBTA 4CW9A 2LV3A 3QPMA 2H30A 3EC3A 4XRAA 3MIXA 5KN2A 2X99A 2DLXA 2V41A 2OA7A 4N30A 2G2QA
chains in the Genus database with same CATH topology
1GSYA 3F3RA 5CRDA 2G0FA 2VD1A 1SL0B 4LA1A 2YANA 1KTEA 5D9VA 1ON4A 1KBNA 4HQSA 3M9JA 4L5OA 3G7IA 2K18A 1PQNA 5IOWA 1MDIA 2RM5A 1MEKA 3IDVA 5FWGA 2V6KA 3HHVA 3A2VA 5D96A 4K5RA 4TR1B 3A2WA 5ECRB 4JR6A 1RW1A 2YJ7A 4X43A 3L0HA 1XWGA 5JCGA 1GUKA 2C0GA 2VCQA 2QKEA 4RQRA 1NHOA 4YQMA 4IJ3A 4WKWA 3LW9A 3DYRA 1XVQA 2M80A 4ECCA 3EU4A 1QK8A 4BL7B 2N5FA 4Z7XA 1G7EA 1MDKA 1VF4A 3CXGA 5DALB 2GQLA 6GSVA 5ELAA 1O8WA 3W6GA 2RM6A 2LUSA 13GSA 1ZYNA 3DRNA 4ID0A 3ZIVA 3GSSA 2B7KA 2YCDA 4GCIA 4ZBAA 2WRTA 4JZQA 2RUEA 1XXUA 5E4WA 1TXXA 2LQQA 2PERA 2IJYA 2HSMA 4V1Ap 4DSSB 4NHZA 4ULXA 3P2AA 4F0CA 2HZFA 4K9ZA 2OE3A 4EE0A 1XWKA 1Q4JA 2I9HA 1AAZA 3P7XA 2MMNA 2I81A 3UVHA 3MNGA 4F82A 3DGQA 4GQCA 1TU8A 3L9SA 4MK3A 5G5FA 3FRCA 2CX4A 2AB6A 4XHMA 5ECHB 5F8BA 1A0RP 3HXSA 5KOXA 2KLXA 3CSIA 3TCOA 3VLNA 4IVFA 4ZB8A 1THXA 5J9BA 2GDRA 3TKSC 4MABA 1XWAA 5B6MA 1M2BA 4FIWA 3W8SA 2HLSA 1K0NA 4TR4A 5BMUA 5HR0A 1GP1A 1VF3A 2BMXA 3LORA 3HVXA 3TJBA 1TDIA 3H93A 4QL9A 5B8BA 3LSZA 4ML6A 1TRWA 4TKYA 3IOSA 4AF2A 1T4ZA 1EOHA 5AN1A 5HR2A 5HR1A 2WFCA 4OMVA 3RDWA 1T1VA 3HJMA 4IN0A 3VWXA 2CV4A 3QR6A 3Q6OA 3WGDA 1GSFA 1VF2A 1M0UA 3KXOA 1DE1A 2JZTA 19GSA 3ZZXA 3C71A 3GSTA 1PA3A 5IO2A 1WPIA 3HKRA 3ME7A 4FH8A 5IM9A 5AIXA 2HZEA 1K0OA 1RK4A 2YZHA 5KN0A 3UAPA 4KSMA 3FY7A 3G9BA 4HJMA 1YDKA 1AQXA 1PSQA 4TN8A 3I6AA 4HU7A 4MA9A 3TKSE 2DJJA 1R4WA 1R5PA 1JZOA 2IMEA 4RI6A 4POKA 3M8NA 2H8LA 3K8NA 3GX0A 4KNDA 3HCZA 1UVZA 5DCGA 2LRTA 2IL3A 4TR3A 3PR8A 4IKHA 5DBQA 1OYJA 3KEBA 5IOXA 3GH9A 1B9YC 1X9WB 2YP6A 1F9MA 2QA2A 3HDCA 1TKDB 3HA9A 1K0DA 5IPHA 4IGJA 4POBA 1R7HA 1YF0A 3WT2A 2B6MA 1B9XC 2YJHA 1CQGA 1F6MC 4XS4B 1A0FA 4L0WA 2MMAA 1MDJA 1ERWA 1M7TA 4IP6A 3ZVJA 1Z3EA 3LEFA 3O3TA 4I2TA 3DIEA 2FA4A 2H1BA 4ZBBA 3F4RA 1JHBA 1IYHA 3WT1A 3KH7A 4KE3A 2HRNA 1ZYEA 2MMOA 4FO5A 1HQOA 4K5SA 5D9WA 1XIYA 1Z5YE 4MPGA 4FYUA 3KIJA 5D9TA 4BWQA 1O81A 2QSIA 2C1YA 2N5BA 1JZWA 1ZCPA 3FK8A 3IHGA 3S9FA 1RQMA 4AGSA 3H8QA 4MF6A 1T8EB 4OCFA 2E2MA 3GKNA 2GT6A 3CBUA 4O5QA 2LRCA 1OE7A 2PGTA 1PD21 5KN1A 4A5PA 1NHYA 4IHUA 5EY6A 4GSNA 3VI7A 1QQ2A 3TJJA 4O92A 3Q19A 3TOUA 1BG5A 2H0IA 1ILOA 2IFQA 1BEDA 3UMAA 1DSBA 3IA1A 11GSA 6GSTA 5GZZB 1K3YA 4EUYA 4WR5A 2EIRA 2LQOA 1FOVA 1M9BA 2F9SA 2GSSA 16GSA 2O85A 2I4AA 2L5LA 1AXDA 4YH2A 5C00A 2EIQA 1LJRA 2TRCP 5IMFA 4JE1A 2VCVA 14GSA 4ICYA 3HY2A 3VWVA 4E8HA 3H4KA 3PINA 4TXOB 2OBKA 3O6TA 3KTLA 1U6TA 5JWOB 2OBIA 4I8BA 17GSA 5AGYA 1G7OA 4WETA 3UL3A 1GTUA 3HJOA 4F9ZA 3F4SA 4ECJA 2IMDA 3TB2A 2GSRA 1XVWA 1Z7PA 1GSUA 3UEMA 4XIHA 1SKRB 3IXRA 3FR9A 2ZNMA 3I43A 2DKIA 1Z6NA 2IMIA 1A23A 2P0GA 2LNTA 2RIIA 4K0GA 1FAAA 3MYDA 5F07A 3IAS2 2A2RA 2R0GA 1A8YA 3KMNA 1USBA 1WWJA 1K0BA 4YQVA 5L71A 5DAKB 4IP1A 4MH3A 3GRXA 4TXVA 3L9UA 1GUMA 2LTKA 3A2XA 4GQFA 1WE0A 2X49A 2A2SA 2KUCA 1XZOA 2FGXA 1Y25A 1YZXA 1WJKA 2JACA 4GF0A 2XHFA 3QCPA 3C8EA 2K9FA 5B6NA 3DVXA 3WGEA 2L5OA 4AJ7A 5HR3A 3TKRA 4N0ZA 1GLQA 2FWGA 2QA1A 1I9DA 2PMTA 2VCWA 4TW5A 3VPTA 2GVPA 4QQ7A 4EKZA 3F0IA 2I3YA 1GUHA 1UN2A 5CRGA 1FO5A 2VL2C 5ECLB 1PX6A 2FWHA 4QL7A 4OWYA 2YPMA 1T3BA 1N2AA 2O8VB 4OFTA 5DJLA 3A5WA 1X5EA 1G6YA 2H75A 5IO0A 4KGIA 2VD0A 1PX7A 1H4OA 4XRDA 3J7Yk 1F2EA 3RPPA 3UOMA 4X4JA 4LMVA 3FMWA 3TRXA 4PX1A 1OC3A 4JEDA 3WGXA 2JZRA 1O85A 2HYXA 5EPFA 2OADA 2IFQB 1B48A 4JRRA 4TOPA 2ON5A 3KTBA 3P8WA 2ES7A 3KD0A 3DD3A 4DVCA 3EE2A 4D73A 2NTOA 3GL3A 2X64A 4TR0A 1SK2A 2VOCA 3HYPA 3LGCA 3MAKA 1A8LA 1SJIA 3L9VA 3EURA 2VCTA 1QFNA 2WZ9A 4ZBDA 1Y6EA 3FEUA 2X8GA 1M2DA 2N5AA 5JCWA 2X8HA 1KEBA 3QFBC 3IR4A 4Q5RA 1EWXA 10GSA 5CNWA 2CX3A 2R5GA 3A5IA 5FT3A 1WP0A 2O7KA 2AHEA 1W89A 1K0MA 4KX4A 5ECNB 2VM2A 1OKTA 3L78A 4MDCA 1YF1A 2R37A 4I5QA 1FW1A 4NHWA 3GHAA 4IELA 4HUAA 3U5RE 3LQ7A 1T4YA 2NPBA 2K8VA 5IMDA 1PKWA 1X9SB 1VGLA 3HVSA 2H6XA 5G2ZA 4F03A 2UZ8A 4V2LA 3M0FA 1HNBA 3BCKA 5IQYA 2GTUA 3RHBA 5A4WA 4LL4B 8GSSA 2HXKA 4OO5A 4X0XA 2TRXA 2OE1A 3ZVJD 3ERGA 2R0PA 2CT6A 1GRXA 3F6DA 4BVYA 1PKZA 5KN3A 3LYKA 1TRSA 2R3XA 3LXTA 1BX9A 4IW9A 1AUCA 1TRUA 2GGTA 5GSTA 3Q74A 4MH2A 1ML6A 4PURA 4PXOA 3TKPA 3F3QA 3LWAA 1V9WA 1YKAA 5ECKB 1WRYA 5HQPA 4L5LA 4O32A 2PBJA 5IMCA 2DMMA 1R26A 2YV7A 5J3RA 3ZYWA 6GSSA 5CAXA 1SK0A 4PQIA 2HRFA 4PUFC 4AJ8A 20GSA 2H01A 2IMFA 2KOKA 4J2FA 2P5RA 4WBRD 1S3AA 2H6ZA 2LKUA 4MCUA 1TK5B 4XS6A 4CHSA 1UA5A 5H5QA 3IRAA 4K6XA 4N11A 4K7NA 5H5SA 2J23A 3KGKA 4MP4A 1SD9A 1U3IA 4G10A 3QD9A 2HRAA 5F0GA 4D73B 1BAYA 2E0QA 4O5RA 2L4CA 1T7PB 2YWMA 1XCCA 4FQUA 6GSUA 3APOA 1ZZYA 4EF0A 1MD3A 3CTFA 3EMPA 5H5RA 2EIOA 4EDYA 3TOTA 5B7CA 5CYYA 4FYCA 2Z9SA 2XBIA 3FZ9A 1M2AA 1EEJA 2VLVA 5B8AA 2PU9C 3R3EA 3EWLA 4TVEA 1EGRA 4V2MA 1URMA 4GSTA 5A4UA 1AW9A 3Q18A 1V57A 1FB6A 4J56E 2GZZA 2CAIA 5GAPD 3IC8A 3D0ZA 2C80A 3V1WA 3E3EA 1ZMAA 2A2PA 2HNLA 1NW2A 3BJ5A 1GSDA 4Q5FA 3GTUA 4TRXA 2MBTA 2OACA 4HZ4A 4WF4A 2DSAA 1N8JA 4HI7A 3DMLA 5ABRA 3FZ4A 4MF5A 1K3OA 4HZ2A 2C3QA 2WULA 2B1KA 3KMOA 3VURA 5GAND 4BVYB 2OJLA 2DC5A 1GULA 2JU5A 2H71A 1JFUA 1HD2A 5KOWA 1NM3A 4K7IA 2M72A 2R0CA 2X8CA 4EIQA 4KDYA 3ME8A 18GSA 3EU3A 3C7MA 5D9XA 3ZRDA 4ML1A 2IPAA 3FR6A 1THOA 4BVXA 3QAVA 2DIZA 4F0BA 4MF7A 4PNGA 4PNFA 2LJAA 4KA0A 2H72A 2LS5A 5J9CA 1SYRA 3M3MA 3KJYA 2GLRA 2XBQA 2KP1A 1ZYPA 4YAVA 5ECIB 1O6JA 2L6CA 4HEA2 4CDOA 2GT5A 3ZLPA 3SWLA 5EL8A 2CVKA 1SJZA 2REMA 4PUAA 5JWRB 1EV4A 4KUNA 2YNXA 2F3MA 5J4UA 1FVKA 2EC4A 3E0UA 2C0DA 1YEXA 2CA8A 3CTGA 4HQZA 2KHPA 1J08A 3I69A 3ZMLA 2HFDA 4MJCA 1ZGNA 3N9JA 3JCML 2VCXA 4PQ1A 1R5AA 4MJEA 2ZCTA 2LSTA 3CRUA 2LJKA 5ID2A 4G19A 1YY7A 2AAWA 5A5KA 1DBYA 2FD3A 3D4TA 1F3BA 5DDLA 2HZEB 5LNKe 3U6VA 1E2YA 1T00A 1YEPA 4HOJA 2WJUA 1ST9A 22GSA 3UBLA 4USSA 2FWEA 4XTSA 2YOIA 2P31A 2VL3A 3ERWA 3O76A 4YKFA 1TRVA 3FKFA 5ELGA 1U87A 2E2GA 3TRPA 3QMXA 5HFKA 1TU7A 2B3SA 1F37A 3MDKA 5LD0A 5IMAA 2OKAA 3GFKA 4O5UA 3HZ4A 1GSEA 1SKWB 3HZ8A 2M46A 1VRSD 2FY6A 2H76A 1FG4A 4MPFA 3F8UA 4I97A 1ZOFA 2NDOA 4AJ6A 1PL1A 3SBCA 4MZCA 1JZRA 3EYTA 1O73A 4BL7A 4PGTA 3BBYA 4POLA 4I2UA 3HJPA 3N5OA 1YQ1A 5EVOA 4HDEA 1BJXA 3ISOA 3ZIJA 4MJAA 4MZBA 1JLWA 1LU4A 1BYEA 2DJ0A 1X5DA 1PN0A 3P90A 3QAWA 4DSQA 4GLTA 4ACSA 5LCZA 2DJKA 1FVJA 3DEXA 3RPNA 3QDNA 3VWWA 1MD4A 4DSSA 3IC4A 3FHKA 3ERFA 4BVXB 1Z9HA 2X4AA 4ZXGA 4EXJA 2YWIA 3IV4A 3NIVA 1A24A 3CYNA 4KSOA 4K2XA 3GNJA 5DQSA 3DKSA 1GLPA 2GS3A 4LLRA 1ACVA 2F8AA 3PGTA 4HS1A 1SYXA 5HFIA 1GTBA 2LJRA 3NZNA 1SENA 3D21A 4G0KA 4YKGA 2PVQA 3CSHA 2YZUA 4ZL7A 1GL8A 4ZILA 3WD6A 3F6FA 4EDZA 2PPTA 3GA4A 2BTOT 1VF1A 5G1LA 1XW6A 2K8SA 3F9UA 2HE3A 2YV9A 1WOUA 1ZL9A 2LNSA 2QGVA 1BQ7A 2ALBA 1OC8A 2ON7A 2BJXA 1TW9A 3LJRA 4CY6A 3APSA 2A4VA 3IPZA 5G1KA 2CZ2A 4K1FA 3H79A 1A2MA 5ID2B 3FW2A 5DJMA 3ZREA 4F2IA 1B4PA 3HVVA 2FWFA 2CQ9A 5DCHA 2RUFA 4NXIA 1DUGA 3PH9A 3GIXA 1EEMA 2IIYA 1M9AA 3KCMA 3IK7A 3OR5A 3QFAC 1TOFA 4GSSA 1A2LA 1EP8A 2B5EA 1XBSA 2GZPA 1CQHA 2PUKC 2YWNA 2VLUA 4E8EA 4DEJA 3GYKA 2WB9A 4NAXA 4YAPA 2C0EA 3EINA 1HYUA 1HNCA 2V1MA 4WEYA 3GKXA 3IE3A 1V98A 3D22A 3FR3A 2MYGA 2A4HA 4KCEA 4KH7A 2VM1A 1ZYQB 5F05A 2XC2A 4NMUA 1LBKA 2VO4A 4G9HA 3DXBA 2HT9A 5BRTA 1SKSB 1MTCA 2DBCA 2L6DA 2VUPA 1OKDA 3LYPA 2IMKA 2I1UA 5AISA 3ZITA 2O87A 2R2JA 4NPBA 4ZL8A 3C73A 4MMMA 5CRHA 3ZTLA 1Q98A 1XW5A 5ECMB 3QAGA 2NBSA 2JSZA 1K0AA 2YWOA 4JR4A 5G5EA 4XCSA 4XS4A 5E59A 3UIWA 2L4QA 2FNOA 1JLVA 4ECIA 2GZYA 4K0NA 1GSSA 3LXZA 2HI7A 5CP1A 5FHIA 1SJ6A 2VL2A 2K6VA 5IMVA 5F06A 4FYBA 1AQVA 1X9MB 1PN9A 4KF9A 2H74A 3DWVA 2H1AA 6GSXA 1OE8A 3VPQA 3IBHA 1GNEA 3VFIA 4GRFA 5KEJA 2DJ3A 4MJBA 4J57E 2FA8A 4XS1A 3CRTA 1G6WA 3I9V2 4PTSA 2VLTA 2RLIA 5CO3A 2AUVA 3KM6A 3GV1A 2NVLA 3IK9A 4N0VA 2ZUPA 1Z7RA 2VCZA 1GTIA 4PQHA 1W4VA 3F4TA 4HU9A 1NSWA 1C72A 1J9BA 1FHEA 4ZB9A 4WBJA 1GH2A 1PRXA 5CRWA 3C1RA 2TIRA 3D4MA 1EZKA 7GSSA 4I6XA 1EP7A 4WXTA 2CZ3A 2IN3A 4G0LA 3VI5A 1O8XA 2D2ZA 3D6IA 3W8JA 4O7HA 3IHQA 2WCIA 6GSYA 3H1NA 5IIZA 2XPEA 1A2JA 4GTUA 2GQKA 4IJIA 2AYTA 3GURA 4ZL9A 2JZSA 3FZ5A 1SL1B 3GH6A 4N10A 5IPGA 4ISDA 4EIPA 4K8MA 3RAZA 4EC0A 3WYWA 1TK8B 4TXOA 3TRQA 4Z2TA 3UJ1A 1XWCA 4NWYA 1K0CA 3VWUA 2DIYA 3CSJA 5INYA 4JBBA 3ED3A 2H0HA 4X1UA 4K7OA 2WS2A 5G30A 1XFLA 2HRKA 3TJFA 2JADA 2V2GA 5ECQB 3TDGA 3TKQA 1XWBA 1M99A 3MSZA 1U88A 12GSA 4ZB6A 4ILFA 1U3AA 4K2DA 3BD2A 4IQAA 4NV5A 3LG6A 4WF5A 2GSTA 3NOFA 3HD5A 2JSYA 4P3YB 2F8FA 1GWCA 2DKHA 2J9HA 2L57A 2VIMA 3FZAA 1WIKA 4Z2UA 1ERTA 2C4JA 5DAKA 4G0IA 4DSRA 2YN1A 4OO4A 2CVBA 3TUEA 1EGOA 4OD7A 1EOGA 1QXHA 1AIUA 1YKCA 4Q5QA 4POMA 4ZIJA 3TJKA 1SL2B 1JZDA 3ZFBA 4V1Ag 4LMWA 2FHEA 2AJQB 2DJ2A 2WGRA 1V40A 1SU9A 3J7Yb 3ZFLA 2FCHA 3TKSA 4BPYA 4L8EA 5AIVA 4OCEA 3E9JB 1FB0A 5A4VA 2OE0A 4EVMA 2R6KA 3UBKA 3GL5A 3TJGA 4Z2RA 4MNNA 2B5YA 4EO3A 2H0GA 1X5CA 2H6YA 1XOAA 3US3A 5J5NA 4OFNA 5D8IA 3F63A 2CAQA 4RI7A 3D5JA 3MWHA 2H1DA 2R4VA 1TP9A 2GQMA 2PWJA 5D73A 2C3NA 2GSQA 1TI1A 4KB3A 1G0TA 1FOHA 4RUVA 2E7PA 3RHCA 4NV2A 1OC9A 2LRNA 2HSHA 4H86A 1GSQA 1IYIA 1QUWA 4Q5NA 1B4QA 4YQUA 3R2QA 2AV4A 3L4NA 4BA7A 3PPUA 1OVNA 3KP9A 1ERVA 1F3AA 5ECSA 2C8UA 3KP8A 1SK1A 5JWQB 1DE2A 4KCAA 4V2NA 1B8XA 4G2EA 2H66A 3M1GA 1E6BA 4IS0A 3TGZA 3G7JA 1UC7A 3UARA 4ECBA 2C3TA 6GSWA 2H1GA 4TR1A 3ZMKA 1Z6MA 2FUG2 4HJ2A 5C04A 4IBPA 4GWRA 2H19A 9GSSA 1TJDA 3M9KA 1QMVA 4MZWA 2V32A 1V58A 1XPVA 1TTZA 3GTUB 4GXZA 5GSSA 3GUSA 4JU5A 5D93A 1PMTA 4CY8A 4IQ1A 2H70A 4KDXA 1QGVA 2LEGA 1H75A 1XW9A 2PVOC 2DJ1A 4KW6A 1S3DA 3APQA 2MZCA 5ENUA 3KH9A 4OFMA 5DALA 2H73A 2MMZA 4KAEA 2B7JA 3IAM2 3GKMA 4RQXA 2B5XA 4MLYA 2B1LA 2WDUA 3AY8A 2HSYA 4L0UA 3GMFA 5CREA 1WMJA 4BWSA 1YJ6A 2FLSA 2VAFA 1I5GA 5ECOB 3GN3A 1S3CA 2VL9A 2DMLA 1AQWA 1GNWA 1ABAA 1EV9A 1K3LA 4EL1A 5HFGA 3GKKA 3GX8A 3QOUA 2P5QA 1OAZA 2KP2A 2XPDA 3VK9A 4WR4A 5IMZA 3KZQA 5COHA 1KNGA 2V6OA 2C0FA 5DVBA 1GTAA 3BCIA 1PL2A 3EPTA 1TK0B 3CMIA 2PN8A 4LL1B 5G31A 3FYGA 2MBSA 1SD8A 2IWTA 2F51A 3A3TA 3BOAA 5JCUA 5J41A 1V2AA 2JL4A 3LFLA 3DVWA 1XOBA 5ECPB 2CVDA 3EMXA 3C1SA 5DQYA 2QC7A 3ZL5A 1PGTA 3G7YA 1J0FA 1OC9B 1X0RA 1O7UA 4KDUA 2L59A 1HNAA 3EVIA 2O89A 3UVTA 1AC1A 1TI3A 1ERUA 3RBTA 4CW9A 2LV3A 3QPMA 2H30A 3EC3A 4XRAA 3MIXA 5KN2A 2X99A 2DLXA 2V41A 2OA7A 4N30A 2G2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSY A;  3F3R A;  5CRD A;  2G0F A;  2VD1 A;  1SL0 B;  4LA1 A;  2YAN A;  1KTE A;  5D9V A;  1ON4 A;  1KBN A;  4HQS A;  3M9J A;  4L5O A;  3G7I A;  2K18 A;  1PQN A;  5IOW A;  1MDI A;  2RM5 A;  1MEK A;  3IDV A;  5FWG A;  2V6K A;  3HHV A;  3A2V A;  5D96 A;  4TR1 B;  3A2W A;  5ECR B;  4JR6 A;  1RW1 A;  2YJ7 A;  4X43 A;  3L0H A;  1XWG A;  5JCG A;  1GUK A;  2C0G A;  2VCQ A;  2QKE A;  4RQR A;  1NHO A;  4YQM A;  4IJ3 A;  4WKW A;  3DYR A;  1XVQ A;  2M80 A;  4ECC A;  3EU4 A;  1QK8 A;  2N5F A;  4Z7X A;  1G7E A;  1MDK A;  1VF4 A;  3CXG A;  5DAL B;  2GQL A;  6GSV A;  5ELA A;  1O8W A;  3W6G A;  2RM6 A;  2LUS A;  13GS A;  3DRN A;  4ID0 A;  3ZIV A;  3GSS A;  2B7K A;  2YCD A;  4GCI A;  4ZBA A;  2WRT A;  4JZQ A;  2RUE A;  1XXU A;  5E4W A;  1TXX A;  2LQQ A;  2PER A;  2IJY A;  4V1A p;  4DSS B;  4NHZ A;  4ULX A;  3P2A A;  4F0C A;  2HZF A;  4K9Z A;  2OE3 A;  4EE0 A;  1XWK A;  1Q4J A;  2I9H A;  1AAZ A;  3P7X A;  2MMN A;  2I81 A;  3UVH A;  3MNG A;  4F82 A;  3DGQ A;  4GQC A;  1TU8 A;  3L9S A;  4MK3 A;  5G5F A;  3FRC A;  2CX4 A;  2AB6 A;  4XHM A;  5ECH B;  5F8B A;  1A0R P;  3HXS A;  2KLX A;  3CSI A;  3TCO A;  3VLN A;  4IVF A;  4ZB8 A;  1THX A;  5J9B A;  2GDR A;  3TKS C;  4MAB A;  1XWA A;  5B6M A;  1M2B A;  4FIW A;  3W8S A;  2HLS A;  1K0N A;  4TR4 A;  5HR0 A;  1GP1 A;  1VF3 A;  2BMX A;  3LOR A;  3HVX A;  3TJB A;  1TDI A;  3H93 A;  4QL9 A;  5B8B A;  3LSZ A;  4ML6 A;  1TRW A;  4TKY A;  3IOS A;  4AF2 A;  1T4Z A;  1EOH A;  5AN1 A;  5HR2 A;  5HR1 A;  2WFC A;  4OMV A;  3RDW A;  1T1V A;  3HJM A;  4IN0 A;  3VWX A;  2CV4 A;  3QR6 A;  3Q6O A;  3WGD A;  1GSF A;  1VF2 A;  1M0U A;  3KXO A;  1DE1 A;  2JZT A;  19GS A;  3ZZX A;  3C71 A;  3GST A;  1PA3 A;  5IO2 A;  1WPI A;  3HKR A;  3ME7 A;  4FH8 A;  5IM9 A;  5AIX A;  2HZE A;  1K0O A;  1RK4 A;  2YZH A;  5KN0 A;  3UAP A;  4KSM A;  3FY7 A;  3G9B A;  4HJM A;  1YDK A;  1AQX A;  1PSQ A;  4TN8 A;  3I6A A;  4HU7 A;  4MA9 A;  3TKS E;  2DJJ A;  1R4W A;  1R5P A;  1JZO A;  2IME A;  4RI6 A;  4POK A;  3M8N A;  2H8L A;  3K8N A;  3GX0 A;  4KND A;  3HCZ A;  1UVZ A;  5DCG A;  2LRT A;  2IL3 A;  4TR3 A;  3PR8 A;  4IKH A;  5DBQ A;  1OYJ A;  3KEB A;  5IOX A;  3GH9 A;  1B9Y C;  1X9W B;  2YP6 A;  1F9M A;  3HDC A;  1TKD B;  3HA9 A;  1K0D A;  5IPH A;  4IGJ A;  4POB A;  1R7H A;  1YF0 A;  3WT2 A;  2B6M A;  1B9X C;  2YJH A;  1CQG A;  1F6M C;  4XS4 B;  1A0F A;  4L0W A;  2MMA A;  1MDJ A;  1ERW A;  1M7T A;  4IP6 A;  3ZVJ A;  1Z3E A;  3LEF A;  3O3T A;  4I2T A;  3DIE A;  2FA4 A;  2H1B A;  4ZBB A;  3F4R A;  1JHB A;  1IYH A;  3WT1 A;  3KH7 A;  4KE3 A;  2HRN A;  1ZYE A;  2MMO A;  4FO5 A;  1HQO A;  5D9W A;  1XIY A;  1Z5Y E;  4MPG A;  4FYU A;  3KIJ A;  5D9T A;  4BWQ A;  1O81 A;  2QSI A;  2C1Y A;  2N5B A;  1JZW A;  1ZCP A;  3FK8 A;  3S9F A;  1RQM A;  4AGS A;  3H8Q A;  4MF6 A;  1T8E B;  4OCF A;  2E2M A;  3GKN A;  2GT6 A;  3CBU A;  2LRC A;  1OE7 A;  2PGT A;  1PD2 1;  5KN1 A;  1NHY A;  4IHU A;  5EY6 A;  4GSN A;  3VI7 A;  1QQ2 A;  3TJJ A;  4O92 A;  3Q19 A;  3TOU A;  1BG5 A;  2H0I A;  1ILO A;  2IFQ A;  1BED A;  3UMA A;  1DSB A;  3IA1 A;  11GS A;  6GST A;  5GZZ B;  1K3Y A;  4EUY A;  4WR5 A;  2EIR A;  2LQO A;  1FOV A;  1M9B A;  2F9S A;  2GSS A;  16GS A;  2O85 A;  2I4A A;  2L5L A;  1AXD A;  4YH2 A;  5C00 A;  2EIQ A;  1LJR A;  2TRC P;  5IMF A;  4JE1 A;  2VCV A;  14GS A;  3HY2 A;  3VWV A;  4E8H A;  3H4K A;  3PIN A;  4TXO B;  2OBK A;  3O6T A;  3KTL A;  1U6T A;  5JWO B;  2OBI A;  4I8B A;  17GS A;  5AGY A;  1G7O A;  4WET A;  3UL3 A;  1GTU A;  3HJO A;  4F9Z A;  3F4S A;  4ECJ A;  2IMD A;  3TB2 A;  2GSR A;  1XVW A;  1Z7P A;  1GSU A;  3UEM A;  4XIH A;  1SKR B;  3IXR A;  3FR9 A;  2ZNM A;  3I43 A;  1Z6N A;  2IMI A;  1A23 A;  2P0G A;  2LNT A;  2RII A;  4K0G A;  1FAA A;  5F07 A;  3IAS 2;  2A2R A;  1A8Y A;  3KMN A;  1USB A;  1WWJ A;  1K0B A;  4YQV A;  5L71 A;  5DAK B;  4IP1 A;  4MH3 A;  3GRX A;  4TXV A;  3L9U A;  1GUM A;  2LTK A;  3A2X A;  4GQF A;  1WE0 A;  2A2S A;  2KUC A;  1XZO A;  2FGX A;  1Y25 A;  1YZX A;  1WJK A;  2JAC A;  4GF0 A;  2XHF A;  3QCP A;  3C8E A;  2K9F A;  5B6N A;  3DVX A;  3WGE A;  2L5O A;  4AJ7 A;  5HR3 A;  3TKR A;  4N0Z A;  1GLQ A;  2FWG A;  1I9D A;  2PMT A;  2VCW A;  4TW5 A;  3VPT A;  2GVP A;  4QQ7 A;  4EKZ A;  3F0I A;  2I3Y A;  1GUH A;  1UN2 A;  5CRG A;  1FO5 A;  2VL2 C;  5ECL B;  1PX6 A;  2FWH A;  4QL7 A;  4OWY A;  2YPM A;  1T3B A;  1N2A A;  2O8V B;  4OFT A;  5DJL A;  3A5W A;  1X5E A;  1G6Y A;  2H75 A;  5IO0 A;  4KGI A;  2VD0 A;  1PX7 A;  1H4O A;  4XRD A;  3J7Y k;  1F2E A;  3RPP A;  3UOM A;  4LMV A;  3TRX A;  4PX1 A;  1OC3 A;  4JED A;  3WGX A;  2JZR A;  1O85 A;  2HYX A;  5EPF A;  2OAD A;  2IFQ B;  1B48 A;  4JRR A;  4TOP A;  2ON5 A;  3KTB A;  3P8W A;  2ES7 A;  3KD0 A;  3DD3 A;  4DVC A;  3EE2 A;  4D73 A;  2NTO A;  3GL3 A;  2X64 A;  4TR0 A;  1SK2 A;  2VOC A;  3HYP A;  3LGC A;  3MAK A;  1A8L A;  1SJI A;  3L9V A;  3EUR A;  2VCT A;  1QFN A;  2WZ9 A;  4ZBD A;  1Y6E A;  3FEU A;  2X8G A;  1M2D A;  2N5A A;  5JCW A;  2X8H A;  1KEB A;  3QFB C;  3IR4 A;  4Q5R A;  1EWX A;  10GS A;  5CNW A;  2CX3 A;  2R5G A;  5FT3 A;  1WP0 A;  2O7K A;  2AHE A;  1W89 A;  1K0M A;  4KX4 A;  5ECN B;  2VM2 A;  1OKT A;  3L78 A;  4MDC A;  1YF1 A;  2R37 A;  4I5Q A;  1FW1 A;  4NHW A;  3GHA A;  4IEL A;  4HUA A;  3U5R E;  3LQ7 A;  1T4Y A;  2NPB A;  2K8V A;  5IMD A;  1PKW A;  1X9S B;  1VGL A;  3HVS A;  2H6X A;  5G2Z A;  4F03 A;  4V2L A;  3M0F A;  1HNB A;  3BCK A;  5IQY A;  2GTU A;  3RHB A;  5A4W A;  4LL4 B;  8GSS A;  2HXK A;  4OO5 A;  4X0X A;  2TRX A;  2OE1 A;  3ZVJ D;  3ERG A;  2CT6 A;  1GRX A;  3F6D A;  4BVY A;  1PKZ A;  5KN3 A;  3LYK A;  1TRS A;  2R3X A;  3LXT A;  1BX9 A;  4IW9 A;  1AUC A;  1TRU A;  2GGT A;  5GST A;  3Q74 A;  4MH2 A;  1ML6 A;  4PUR A;  4PXO A;  3TKP A;  3F3Q A;  3LWA A;  1V9W A;  1YKA A;  5ECK B;  1WRY A;  5HQP A;  4L5L A;  4O32 A;  2PBJ A;  5IMC A;  2DMM A;  1R26 A;  2YV7 A;  5J3R A;  3ZYW A;  6GSS A;  5CAX A;  1SK0 A;  4PQI A;  2HRF A;  4PUF C;  4AJ8 A;  20GS A;  2H01 A;  2IMF A;  2KOK A;  4J2F A;  2P5R A;  4WBR D;  1S3A A;  2H6Z A;  2LKU A;  4MCU A;  1TK5 B;  4XS6 A;  4CHS A;  1UA5 A;  5H5Q A;  3IRA A;  4K6X A;  4N11 A;  4K7N A;  5H5S A;  2J23 A;  3KGK A;  4MP4 A;  1SD9 A;  1U3I A;  4G10 A;  3QD9 A;  5F0G A;  4D73 B;  1BAY A;  2E0Q A;  4O5R A;  2L4C A;  1T7P B;  2YWM A;  1XCC A;  6GSU A;  3APO A;  1ZZY A;  4EF0 A;  1MD3 A;  3CTF A;  3EMP A;  5H5R A;  2EIO A;  4EDY A;  3TOT A;  5B7C A;  5CYY A;  4FYC A;  2Z9S A;  2XBI A;  3FZ9 A;  1M2A A;  1EEJ A;  2VLV A;  5B8A A;  2PU9 C;  3EWL A;  4TVE A;  1EGR A;  4V2M A;  1URM A;  4GST A;  5A4U A;  1AW9 A;  3Q18 A;  1V57 A;  1FB6 A;  4J56 E;  2GZZ A;  2CAI A;  5GAP D;  3D0Z A;  2C80 A;  3V1W A;  3E3E A;  1ZMA A;  2HNL A;  1NW2 A;  3BJ5 A;  1GSD A;  4Q5F A;  3GTU A;  4TRX A;  2MBT A;  2OAC A;  4HZ4 A;  4WF4 A;  2DSA A;  1N8J A;  4HI7 A;  3DML A;  5ABR A;  3FZ4 A;  4MF5 A;  1K3O A;  4HZ2 A;  2C3Q A;  2WUL A;  2B1K A;  3KMO A;  3VUR A;  5GAN D;  2OJL A;  2DC5 A;  1GUL A;  2JU5 A;  2H71 A;  1JFU A;  1HD2 A;  1NM3 A;  4K7I A;  2M72 A;  2X8C A;  4KDY A;  3ME8 A;  18GS A;  3EU3 A;  3C7M A;  5D9X A;  3ZRD A;  4ML1 A;  2IPA A;  3FR6 A;  1THO A;  4BVX A;  3QAV A;  2DIZ A;  4F0B A;  4MF7 A;  4PNG A;  4PNF A;  2LJA A;  4KA0 A;  2H72 A;  2LS5 A;  5J9C A;  1SYR A;  3M3M A;  3KJY A;  2GLR A;  2XBQ A;  2KP1 A;  4YAV A;  5ECI B;  1O6J A;  2L6C A;  4HEA 2;  4CDO A;  2GT5 A;  3ZLP A;  3SWL A;  5EL8 A;  2CVK A;  1SJZ A;  2REM A;  4PUA A;  5JWR B;  1EV4 A;  4KUN A;  2YNX A;  2F3M A;  5J4U A;  1FVK A;  2EC4 A;  3E0U A;  2C0D A;  1YEX A;  2CA8 A;  3CTG A;  4HQZ A;  2KHP A;  1J08 A;  3I69 A;  3ZML A;  2HFD A;  4MJC A;  1ZGN A;  3N9J A;  3JCM L;  2VCX A;  4PQ1 A;  1R5A A;  4MJE A;  2ZCT A;  2LST A;  3CRU A;  2LJK A;  5ID2 A;  4G19 A;  1YY7 A;  2AAW A;  5A5K A;  1DBY A;  2FD3 A;  3D4T A;  1F3B A;  5DDL A;  2HZE B;  5LNK e;  3U6V A;  1E2Y A;  1T00 A;  1YEP A;  4HOJ A;  2WJU A;  1ST9 A;  22GS A;  3UBL A;  2FWE A;  4XTS A;  2YOI A;  2P31 A;  2VL3 A;  3ERW A;  3O76 A;  1TRV A;  3FKF A;  5ELG A;  1U87 A;  2E2G A;  3TRP A;  3QMX A;  5HFK A;  1TU7 A;  2B3S A;  1F37 A;  3MDK A;  5LD0 A;  5IMA A;  2OKA A;  3GFK A;  3HZ4 A;  1GSE A;  1SKW B;  3HZ8 A;  2M46 A;  1VRS D;  2FY6 A;  2H76 A;  1FG4 A;  4MPF A;  3F8U A;  4I97 A;  1ZOF A;  2NDO A;  4AJ6 A;  1PL1 A;  3SBC A;  4MZC A;  1JZR A;  3EYT A;  1O73 A;  4BL7 A;  4PGT A;  3BBY A;  4POL A;  4I2U A;  3HJP A;  3N5O A;  1YQ1 A;  5EVO A;  4HDE A;  1BJX A;  3ISO A;  3ZIJ A;  4MJA A;  4MZB A;  1JLW A;  1LU4 A;  1BYE A;  2DJ0 A;  1X5D A;  3P90 A;  3QAW A;  4DSQ A;  4GLT A;  4ACS A;  5LCZ A;  2DJK A;  1FVJ A;  3DEX A;  3RPN A;  3QDN A;  3VWW A;  1MD4 A;  4DSS A;  3IC4 A;  3FHK A;  3ERF A;  1Z9H A;  4ZXG A;  4EXJ A;  2YWI A;  3IV4 A;  3NIV A;  1A24 A;  3CYN A;  4KSO A;  3GNJ A;  5DQS A;  3DKS A;  1GLP A;  2GS3 A;  4LLR A;  1ACV A;  2F8A A;  3PGT A;  4HS1 A;  1SYX A;  5HFI A;  1GTB A;  2LJR A;  3NZN A;  1SEN A;  3D21 A;  2PVQ A;  3CSH A;  2YZU A;  4ZL7 A;  1GL8 A;  4ZIL A;  3WD6 A;  3F6F A;  4EDZ A;  2PPT A;  3GA4 A;  2BTO T;  1VF1 A;  5G1L A;  1XW6 A;  2K8S A;  3F9U A;  2HE3 A;  2YV9 A;  1WOU A;  1ZL9 A;  2LNS A;  2QGV A;  1BQ7 A;  2ALB A;  1OC8 A;  2ON7 A;  2BJX A;  1TW9 A;  3LJR A;  3APS A;  2A4V A;  3IPZ A;  5G1K A;  2CZ2 A;  4K1F A;  3H79 A;  1A2M A;  5ID2 B;  3FW2 A;  5DJM A;  3ZRE A;  4F2I A;  1B4P A;  3HVV A;  2FWF A;  2CQ9 A;  5DCH A;  2RUF A;  4NXI A;  1DUG A;  3PH9 A;  3GIX A;  1EEM A;  2IIY A;  1M9A A;  3KCM A;  3IK7 A;  3OR5 A;  3QFA C;  1TOF A;  4GSS A;  1A2L A;  1EP8 A;  2B5E A;  1XBS A;  2GZP A;  1CQH A;  2PUK C;  2YWN A;  2VLU A;  4E8E A;  4DEJ A;  3GYK A;  2WB9 A;  4NAX A;  4YAP A;  2C0E A;  3EIN A;  1HYU A;  1HNC A;  2V1M A;  4WEY A;  3GKX A;  3IE3 A;  1V98 A;  3D22 A;  3FR3 A;  2MYG A;  4KCE A;  4KH7 A;  2VM1 A;  1ZYQ B;  5F05 A;  2XC2 A;  4NMU A;  1LBK A;  2VO4 A;  4G9H A;  3DXB A;  2HT9 A;  1SKS B;  1MTC A;  2DBC A;  2L6D A;  2VUP A;  1OKD A;  3LYP A;  2IMK A;  2I1U A;  5AIS A;  3ZIT A;  2O87 A;  2R2J A;  4NPB A;  4ZL8 A;  3C73 A;  4MMM A;  5CRH A;  3ZTL A;  1Q98 A;  1XW5 A;  5ECM B;  3QAG A;  2NBS A;  2JSZ A;  1K0A A;  2YWO A;  4JR4 A;  5G5E A;  4XCS A;  4XS4 A;  5E59 A;  3UIW A;  2L4Q A;  2FNO A;  1JLV A;  4ECI A;  2GZY A;  4K0N A;  1GSS A;  3LXZ A;  2HI7 A;  5CP1 A;  5FHI A;  1SJ6 A;  2VL2 A;  2K6V A;  5IMV A;  5F06 A;  4FYB A;  1AQV A;  1X9M B;  1PN9 A;  2H74 A;  3DWV A;  2H1A A;  6GSX A;  1OE8 A;  3VPQ A;  3IBH A;  1GNE A;  3VFI A;  4GRF A;  5KEJ A;  2DJ3 A;  4MJB A;  4J57 E;  2FA8 A;  4XS1 A;  3CRT A;  1G6W A;  3I9V 2;  2VLT A;  2RLI A;  5CO3 A;  2AUV A;  3KM6 A;  3GV1 A;  2NVL A;  3IK9 A;  4N0V A;  2ZUP A;  1Z7R A;  2VCZ A;  1GTI A;  4PQH A;  1W4V A;  3F4T A;  4HU9 A;  1NSW A;  1C72 A;  1J9B A;  1FHE A;  4ZB9 A;  4WBJ A;  1GH2 A;  1PRX A;  5CRW A;  3C1R A;  2TIR A;  3D4M A;  1EZK A;  7GSS A;  4I6X A;  1EP7 A;  4WXT A;  2CZ3 A;  2IN3 A;  3VI5 A;  1O8X A;  2D2Z A;  3D6I A;  3W8J A;  4O7H A;  3IHQ A;  2WCI A;  6GSY A;  3H1N A;  5IIZ A;  2XPE A;  1A2J A;  4GTU A;  2GQK A;  4IJI A;  2AYT A;  3GUR A;  4ZL9 A;  2JZS A;  3FZ5 A;  1SL1 B;  3GH6 A;  4N10 A;  5IPG A;  4ISD A;  4K8M A;  3RAZ A;  4EC0 A;  3WYW A;  1TK8 B;  4TXO A;  3TRQ A;  3UJ1 A;  1XWC A;  4NWY A;  1K0C A;  3VWU A;  2DIY A;  3CSJ A;  5INY A;  4JBB A;  3ED3 A;  2H0H A;  4X1U A;  4K7O A;  2WS2 A;  5G30 A;  1XFL A;  3TJF A;  2JAD A;  2V2G A;  5ECQ B;  3TDG A;  3TKQ A;  1XWB A;  1M99 A;  3MSZ A;  1U88 A;  12GS A;  4ZB6 A;  4ILF A;  1U3A A;  4K2D A;  3BD2 A;  4IQA A;  4NV5 A;  3LG6 A;  4WF5 A;  2GST A;  3NOF A;  3HD5 A;  2JSY A;  4P3Y B;  2F8F A;  1GWC A;  2J9H A;  2L57 A;  2VIM A;  3FZA A;  1WIK A;  1ERT A;  2C4J A;  5DAK A;  4DSR A;  2YN1 A;  4OO4 A;  2CVB A;  3TUE A;  1EGO A;  4OD7 A;  1EOG A;  1QXH A;  1AIU A;  1YKC A;  4Q5Q A;  4POM A;  4ZIJ A;  3TJK A;  1SL2 B;  1JZD A;  3ZFB A;  4V1A g;  4LMW A;  2FHE A;  2AJQ B;  2DJ2 A;  2WGR A;  1V40 A;  1SU9 A;  3J7Y b;  3ZFL A;  2FCH A;  3TKS A;  4BPY A;  4L8E A;  5AIV A;  4OCE A;  3E9J B;  1FB0 A;  5A4V A;  2OE0 A;  4EVM A;  2R6K A;  3UBK A;  3GL5 A;  3TJG A;  2B5Y A;  4EO3 A;  2H0G A;  1X5C A;  2H6Y A;  1XOA A;  3US3 A;  5J5N A;  4OFN A;  5D8I A;  3F63 A;  2CAQ A;  4RI7 A;  3D5J A;  3MWH A;  2H1D A;  2R4V A;  1TP9 A;  2GQM A;  2PWJ A;  5D73 A;  2C3N A;  2GSQ A;  1TI1 A;  4KB3 A;  1G0T A;  4RUV A;  2E7P A;  3RHC A;  4NV2 A;  1OC9 A;  2LRN A;  2HSH A;  4H86 A;  1GSQ A;  1IYI A;  1QUW A;  4Q5N A;  1B4Q A;  4YQU A;  3R2Q A;  2AV4 A;  3L4N A;  4BA7 A;  1OVN A;  3KP9 A;  1ERV A;  1F3A A;  5ECS A;  2C8U A;  3KP8 A;  1SK1 A;  5JWQ B;  1DE2 A;  4KCA A;  4V2N A;  1B8X A;  4G2E A;  2H66 A;  3M1G A;  1E6B A;  4IS0 A;  3TGZ A;  3G7J A;  1UC7 A;  3UAR A;  4ECB A;  2C3T A;  6GSW A;  2H1G A;  4TR1 A;  3ZMK A;  1Z6M A;  2FUG 2;  4HJ2 A;  5C04 A;  4IBP A;  4GWR A;  2H19 A;  9GSS A;  1TJD A;  3M9K A;  1QMV A;  4MZW A;  2V32 A;  1V58 A;  1XPV A;  1TTZ A;  3GTU B;  4GXZ A;  5GSS A;  3GUS A;  4JU5 A;  5D93 A;  1PMT A;  4IQ1 A;  2H70 A;  4KDX A;  1QGV A;  2LEG A;  1H75 A;  1XW9 A;  2PVO C;  2DJ1 A;  4KW6 A;  1S3D A;  3APQ A;  2MZC A;  5ENU A;  3KH9 A;  4OFM A;  5DAL A;  2H73 A;  2MMZ A;  4KAE A;  2B7J A;  3IAM 2;  3GKM A;  4RQX A;  2B5X A;  4MLY A;  2B1L A;  2WDU A;  3AY8 A;  2HSY A;  4L0U A;  3GMF A;  5CRE A;  1WMJ A;  4BWS A;  1YJ6 A;  2FLS A;  2VAF A;  1I5G A;  5ECO B;  3GN3 A;  1S3C A;  2VL9 A;  2DML A;  1AQW A;  1GNW A;  1ABA A;  1EV9 A;  1K3L A;  4EL1 A;  5HFG A;  3GKK A;  3GX8 A;  3QOU A;  2P5Q A;  1OAZ A;  2KP2 A;  2XPD A;  3VK9 A;  4WR4 A;  5IMZ A;  3KZQ A;  5COH A;  1KNG A;  2V6O A;  2C0F A;  5DVB A;  1GTA A;  3BCI A;  1PL2 A;  1TK0 B;  3CMI A;  2PN8 A;  4LL1 B;  5G31 A;  3FYG A;  2MBS A;  1SD8 A;  2IWT A;  2F51 A;  3A3T A;  3BOA A;  5JCU A;  5J41 A;  1V2A A;  2JL4 A;  3LFL A;  3DVW A;  1XOB A;  5ECP B;  2CVD A;  3EMX A;  3C1S A;  5DQY A;  2QC7 A;  3ZL5 A;  1PGT A;  3G7Y A;  1J0F A;  1OC9 B;  1X0R A;  1O7U A;  4KDU A;  2L59 A;  1HNA A;  3EVI A;  2O89 A;  3UVT A;  1AC1 A;  1TI3 A;  1ERU A;  3RBT A;  4CW9 A;  2LV3 A;  3QPM A;  2H30 A;  3EC3 A;  4XRA A;  5KN2 A;  2X99 A;  2DLX A;  2V41 A;  2OA7 A;  4N30 A;  2G2Q A; 
#chains in the Genus database with same CATH topology
 1GSY A;  3F3R A;  5CRD A;  2G0F A;  2VD1 A;  1SL0 B;  4LA1 A;  2YAN A;  1KTE A;  5D9V A;  1ON4 A;  1KBN A;  4HQS A;  3M9J A;  4L5O A;  3G7I A;  2K18 A;  1PQN A;  5IOW A;  1MDI A;  2RM5 A;  1MEK A;  3IDV A;  5FWG A;  2V6K A;  3HHV A;  3A2V A;  5D96 A;  4K5R A;  4TR1 B;  3A2W A;  5ECR B;  4JR6 A;  1RW1 A;  2YJ7 A;  4X43 A;  3L0H A;  1XWG A;  5JCG A;  1GUK A;  2C0G A;  2VCQ A;  2QKE A;  4RQR A;  1NHO A;  4YQM A;  4IJ3 A;  4WKW A;  3LW9 A;  3DYR A;  1XVQ A;  2M80 A;  4ECC A;  3EU4 A;  1QK8 A;  4BL7 B;  2N5F A;  4Z7X A;  1G7E A;  1MDK A;  1VF4 A;  3CXG A;  5DAL B;  2GQL A;  6GSV A;  5ELA A;  1O8W A;  3W6G A;  2RM6 A;  2LUS A;  13GS A;  1ZYN A;  3DRN A;  4ID0 A;  3ZIV A;  3GSS A;  2B7K A;  2YCD A;  4GCI A;  4ZBA A;  2WRT A;  4JZQ A;  2RUE A;  1XXU A;  5E4W A;  1TXX A;  2LQQ A;  2PER A;  2IJY A;  2HSM A;  4V1A p;  4DSS B;  4NHZ A;  4ULX A;  3P2A A;  4F0C A;  2HZF A;  4K9Z A;  2OE3 A;  4EE0 A;  1XWK A;  1Q4J A;  2I9H A;  1AAZ A;  3P7X A;  2MMN A;  2I81 A;  3UVH A;  3MNG A;  4F82 A;  3DGQ A;  4GQC A;  1TU8 A;  1M3J A;  3L9S A;  4MK3 A;  5G5F A;  3FRC A;  2CX4 A;  2AB6 A;  4XHM A;  5ECH B;  5F8B A;  1A0R P;  3HXS A;  5KOX A;  2KLX A;  3CSI A;  3TCO A;  3VLN A;  4IVF A;  3CQF A;  4ZB8 A;  1THX A;  5J9B A;  2GDR A;  3TKS C;  4MAB A;  1XWA A;  5B6M A;  1M2B A;  4FIW A;  3W8S A;  2HLS A;  1K0N A;  4TR4 A;  5BMU A;  5HR0 A;  1GP1 A;  1VF3 A;  2BMX A;  3LOR A;  3HVX A;  3TJB A;  1TDI A;  3H93 A;  4QL9 A;  5B8B A;  3LSZ A;  4ML6 A;  1TRW A;  4TKY A;  3IOS A;  4AF2 A;  1T4Z A;  1EOH A;  5AN1 A;  5HR2 A;  5HR1 A;  2WFC A;  4OMV A;  3RDW A;  1T1V A;  3HJM A;  4IN0 A;  3VWX A;  2CV4 A;  3QR6 A;  3Q6O A;  3WGD A;  1GSF A;  1VF2 A;  1M0U A;  3KXO A;  1DE1 A;  2JZT A;  19GS A;  3ZZX A;  3C71 A;  3GST A;  1PA3 A;  5IO2 A;  1WPI A;  3HKR A;  3ME7 A;  4FH8 A;  5IM9 A;  5AIX A;  2HZE A;  1K0O A;  1RK4 A;  2YZH A;  5KN0 A;  3UAP A;  4KSM A;  3FY7 A;  3G9B A;  4HJM A;  1YDK A;  1AQX A;  1PSQ A;  4TN8 A;  3I6A A;  4HU7 A;  4MA9 A;  3TKS E;  2DJJ A;  1R4W A;  1R5P A;  1JZO A;  2IME A;  4RI6 A;  4POK A;  3M8N A;  2H8L A;  3K8N A;  3GX0 A;  4KND A;  3HCZ A;  1UVZ A;  5DCG A;  2LRT A;  2IL3 A;  4TR3 A;  3PR8 A;  4IKH A;  5DBQ A;  1OYJ A;  3KEB A;  5IOX A;  3GH9 A;  1B9Y C;  1X9W B;  2YP6 A;  1F9M A;  2QA2 A;  3HDC A;  1TKD B;  3HA9 A;  1K0D A;  5IPH A;  4IGJ A;  4POB A;  1R7H A;  1YF0 A;  3WT2 A;  2B6M A;  1B9X C;  2YJH A;  1CQG A;  1F6M C;  4XS4 B;  1A0F A;  4L0W A;  2MMA A;  1MDJ A;  1ERW A;  1M7T A;  4IP6 A;  3ZVJ A;  1Z3E A;  3LEF A;  3O3T A;  4I2T A;  3DIE A;  2FA4 A;  2H1B A;  4ZBB A;  3F4R A;  1JHB A;  1IYH A;  3WT1 A;  3KH7 A;  4KE3 A;  2HRN A;  1ZYE A;  2MMO A;  4FO5 A;  1HQO A;  4K5S A;  5D9W A;  4BIK A;  1XIY A;  1Z5Y E;  4MPG A;  4FYU A;  3KIJ A;  5D9T A;  4BWQ A;  1O81 A;  2QSI A;  2C1Y A;  2N5B A;  1JZW A;  1ZCP A;  3FK8 A;  3IHG A;  3S9F A;  1RQM A;  4AGS A;  3H8Q A;  4MF6 A;  1T8E B;  4OCF A;  2E2M A;  3GKN A;  2GT6 A;  3CBU A;  4O5Q A;  2LRC A;  1OE7 A;  2PGT A;  1PD2 1;  5KN1 A;  4A5P A;  1NHY A;  4IHU A;  5EY6 A;  4GSN A;  3VI7 A;  1QQ2 A;  3TJJ A;  4O92 A;  3Q19 A;  3TOU A;  1BG5 A;  2H0I A;  1ILO A;  2IFQ A;  1BED A;  3UMA A;  1DSB A;  3IA1 A;  11GS A;  6GST A;  5GZZ B;  1K3Y A;  4EUY A;  4WR5 A;  2EIR A;  2LQO A;  1FOV A;  1M9B A;  2F9S A;  2GSS A;  16GS A;  2O85 A;  2I4A A;  2L5L A;  1AXD A;  4YH2 A;  5C00 A;  2EIQ A;  1LJR A;  2TRC P;  5IMF A;  4JE1 A;  2VCV A;  14GS A;  4ICY A;  3HY2 A;  3VWV A;  4E8H A;  3H4K A;  3PIN A;  4TXO B;  2OBK A;  3O6T A;  3KTL A;  1U6T A;  5JWO B;  2OBI A;  4I8B A;  17GS A;  5AGY A;  1G7O A;  4WET A;  3UL3 A;  1GTU A;  3HJO A;  4F9Z A;  3F4S A;  4ECJ A;  2IMD A;  3TB2 A;  2GSR A;  1XVW A;  1Z7P A;  1GSU A;  3UEM A;  4XIH A;  1SKR B;  3IXR A;  3FR9 A;  2ZNM A;  3I43 A;  2DKI A;  1Z6N A;  2IMI A;  1A23 A;  2P0G A;  2LNT A;  2RII A;  4K0G A;  1FAA A;  3MYD A;  5F07 A;  3IAS 2;  2A2R A;  2R0G A;  1A8Y A;  3KMN A;  1USB A;  1WWJ A;  1K0B A;  4YQV A;  5L71 A;  5DAK B;  4IP1 A;  4MH3 A;  3GRX A;  4TXV A;  3L9U A;  1GUM A;  2LTK A;  3A2X A;  4GQF A;  1WE0 A;  2X49 A;  2A2S A;  2KUC A;  1XZO A;  2FGX A;  1Y25 A;  1YZX A;  1WJK A;  2JAC A;  4GF0 A;  2XHF A;  3QCP A;  3C8E A;  2K9F A;  5B6N A;  3DVX A;  3WGE A;  2L5O A;  4AJ7 A;  5HR3 A;  3TKR A;  4N0Z A;  1GLQ A;  2FWG A;  2QA1 A;  1I9D A;  2PMT A;  2VCW A;  4TW5 A;  3VPT A;  2GVP A;  4QQ7 A;  4EKZ A;  3F0I A;  2I3Y A;  1GUH A;  1UN2 A;  5CRG A;  1FO5 A;  2VL2 C;  5ECL B;  1PX6 A;  2FWH A;  4QL7 A;  4OWY A;  2YPM A;  1T3B A;  1N2A A;  2O8V B;  4OFT A;  5DJL A;  3A5W A;  1X5E A;  1G6Y A;  2H75 A;  5IO0 A;  4KGI A;  2VD0 A;  1PX7 A;  1H4O A;  4XRD A;  3J7Y k;  1F2E A;  3RPP A;  3UOM A;  4X4J A;  4LMV A;  3FMW A;  3TRX A;  4PX1 A;  1OC3 A;  4JED A;  3WGX A;  2JZR A;  1O85 A;  2HYX A;  5EPF A;  2OAD A;  2IFQ B;  1B48 A;  4JRR A;  4TOP A;  2ON5 A;  3KTB A;  3P8W A;  2ES7 A;  3KD0 A;  3DD3 A;  4DVC A;  3EE2 A;  4D73 A;  2NTO A;  3GL3 A;  2X64 A;  4TR0 A;  1SK2 A;  2VOC A;  3HYP A;  3LGC A;  3MAK A;  1A8L A;  1SJI A;  3L9V A;  3EUR A;  2VCT A;  1QFN A;  2WZ9 A;  4ZBD A;  1Y6E A;  3FEU A;  2X8G A;  1M2D A;  2N5A A;  5JCW A;  2X8H A;  1KEB A;  3QFB C;  3IR4 A;  4Q5R A;  1EWX A;  10GS A;  5CNW A;  2CX3 A;  2R5G A;  3A5I A;  5FT3 A;  1WP0 A;  2O7K A;  2AHE A;  1W89 A;  1K0M A;  4KX4 A;  5ECN B;  2VM2 A;  1OKT A;  3L78 A;  4MDC A;  1YF1 A;  2R37 A;  4I5Q A;  1FW1 A;  4NHW A;  3GHA A;  4IEL A;  4HUA A;  3U5R E;  3LQ7 A;  1T4Y A;  2NPB A;  2K8V A;  5IMD A;  1PKW A;  1X9S B;  1VGL A;  3HVS A;  2H6X A;  5G2Z A;  4F03 A;  2UZ8 A;  4V2L A;  3M0F A;  1HNB A;  3BCK A;  5IQY A;  2GTU A;  3RHB A;  5A4W A;  4LL4 B;  8GSS A;  2HXK A;  4OO5 A;  4X0X A;  2TRX A;  2OE1 A;  3ZVJ D;  3ERG A;  2R0P A;  2CT6 A;  1GRX A;  3F6D A;  4BVY A;  1PKZ A;  5KN3 A;  3LYK A;  1TRS A;  2R3X A;  3LXT A;  1BX9 A;  4IW9 A;  1AUC A;  1TRU A;  2GGT A;  5GST A;  3Q74 A;  4MH2 A;  1ML6 A;  4PUR A;  4PXO A;  3TKP A;  3F3Q A;  3LWA A;  1V9W A;  1YKA A;  5ECK B;  1WRY A;  5HQP A;  4L5L A;  4O32 A;  2PBJ A;  5IMC A;  2DMM A;  1R26 A;  2YV7 A;  5J3R A;  3ZYW A;  6GSS A;  5CAX A;  1SK0 A;  4PQI A;  2HRF A;  4PUF C;  4AJ8 A;  20GS A;  2H01 A;  2IMF A;  2KOK A;  4J2F A;  2P5R A;  4WBR D;  1S3A A;  2H6Z A;  2LKU A;  4MCU A;  1TK5 B;  4XS6 A;  4CHS A;  1UA5 A;  5H5Q A;  3IRA A;  4K6X A;  4N11 A;  4K7N A;  5H5S A;  2J23 A;  3KGK A;  4MP4 A;  1SD9 A;  1U3I A;  4G10 A;  3QD9 A;  2HRA A;  5F0G A;  4D73 B;  1BAY A;  2E0Q A;  4O5R A;  2L4C A;  1T7P B;  2YWM A;  1XCC A;  4FQU A;  6GSU A;  3APO A;  1ZZY A;  4EF0 A;  1MD3 A;  3CTF A;  3EMP A;  5H5R A;  2EIO A;  4EDY A;  3TOT A;  5B7C A;  5CYY A;  4FYC A;  2Z9S A;  2XBI A;  3FZ9 A;  1M2A A;  1EEJ A;  2VLV A;  5B8A A;  2PU9 C;  3R3E A;  3EWL A;  4TVE A;  1EGR A;  4V2M A;  1URM A;  4GST A;  5A4U A;  1AW9 A;  3Q18 A;  1V57 A;  1FB6 A;  4J56 E;  2GZZ A;  2CAI A;  5GAP D;  3IC8 A;  3D0Z A;  2C80 A;  3V1W A;  3E3E A;  1ZMA A;  2A2P A;  2HNL A;  1NW2 A;  3BJ5 A;  1GSD A;  4Q5F A;  3GTU A;  4TRX A;  2MBT A;  2OAC A;  4HZ4 A;  4WF4 A;  2DSA A;  1N8J A;  4HI7 A;  3DML A;  5ABR A;  3FZ4 A;  4MF5 A;  1K3O A;  4HZ2 A;  2C3Q A;  2WUL A;  2B1K A;  3KMO A;  3VUR A;  5GAN D;  4BVY B;  2OJL A;  2DC5 A;  1GUL A;  2JU5 A;  2H71 A;  1JFU A;  1HD2 A;  5KOW A;  1NM3 A;  4K7I A;  2M72 A;  2R0C A;  2X8C A;  4EIQ A;  4KDY A;  3ME8 A;  18GS A;  3EU3 A;  3C7M A;  5D9X A;  3ZRD A;  1XG8 A;  4ML1 A;  2IPA A;  3FR6 A;  1THO A;  4BVX A;  3QAV A;  2DIZ A;  4F0B A;  4MF7 A;  4PNG A;  4PNF A;  2LJA A;  4KA0 A;  2H72 A;  2LS5 A;  5J9C A;  1SYR A;  3M3M A;  3KJY A;  2GLR A;  2XBQ A;  2KP1 A;  1ZYP A;  4YAV A;  5ECI B;  1O6J A;  2L6C A;  4HEA 2;  4CDO A;  2GT5 A;  3ZLP A;  3SWL A;  5EL8 A;  2CVK A;  1SJZ A;  2REM A;  4PUA A;  5JWR B;  1EV4 A;  4KUN A;  2YNX A;  2F3M A;  5J4U A;  1FVK A;  2EC4 A;  3E0U A;  2C0D A;  1YEX A;  2CA8 A;  3CTG A;  4HQZ A;  2KHP A;  1J08 A;  3I69 A;  3ZML A;  2HFD A;  4MJC A;  1ZGN A;  3N9J A;  3JCM L;  2VCX A;  4PQ1 A;  1R5A A;  4MJE A;  2ZCT A;  2LST A;  3CRU A;  2LJK A;  5ID2 A;  4G19 A;  1YY7 A;  2AAW A;  5A5K A;  1DBY A;  2FD3 A;  3D4T A;  1F3B A;  5DDL A;  2HZE B;  5LNK e;  3U6V A;  1E2Y A;  1T00 A;  1YEP A;  4HOJ A;  2WJU A;  1ST9 A;  22GS A;  3UBL A;  4USS A;  2FWE A;  4XTS A;  2YOI A;  2P31 A;  2VL3 A;  3ERW A;  3O76 A;  4YKF A;  1TRV A;  3FKF A;  5ELG A;  1U87 A;  2E2G A;  3TRP A;  3QMX A;  5HFK A;  1TU7 A;  2B3S A;  1F37 A;  3MDK A;  5LD0 A;  5IMA A;  2OKA A;  3GFK A;  4O5U A;  3HZ4 A;  1GSE A;  1SKW B;  3HZ8 A;  2M46 A;  1VRS D;  2FY6 A;  2H76 A;  1FG4 A;  4MPF A;  3F8U A;  4I97 A;  1ZOF A;  2NDO A;  4AJ6 A;  1PL1 A;  3SBC A;  4MZC A;  1JZR A;  3EYT A;  1O73 A;  4BL7 A;  4PGT A;  3BBY A;  4POL A;  4I2U A;  3HJP A;  3N5O A;  1YQ1 A;  5EVO A;  4HDE A;  1BJX A;  3ISO A;  3ZIJ A;  4MJA A;  4MZB A;  1JLW A;  1LU4 A;  1BYE A;  2DJ0 A;  1X5D A;  1PN0 A;  3P90 A;  3QAW A;  4DSQ A;  4GLT A;  4ACS A;  5LCZ A;  2DJK A;  1FVJ A;  3DEX A;  3RPN A;  3QDN A;  3VWW A;  1MD4 A;  4DSS A;  3IC4 A;  3FHK A;  3ERF A;  4BVX B;  1Z9H A;  2X4A A;  4ZXG A;  4EXJ A;  2YWI A;  3IV4 A;  3NIV A;  1A24 A;  3CYN A;  4KSO A;  4K2X A;  3GNJ A;  5DQS A;  3DKS A;  1GLP A;  2GS3 A;  4LLR A;  1M3I A;  1ACV A;  2F8A A;  3PGT A;  4HS1 A;  1SYX A;  5HFI A;  1GTB A;  2LJR A;  3NZN A;  1SEN A;  3D21 A;  4G0K A;  4YKG A;  2PVQ A;  3CSH A;  2YZU A;  4ZL7 A;  1GL8 A;  4ZIL A;  3WD6 A;  3F6F A;  4EDZ A;  2PPT A;  3GA4 A;  2BTO T;  1VF1 A;  5G1L A;  1XW6 A;  2K8S A;  3F9U A;  2HE3 A;  2YV9 A;  1WOU A;  1ZL9 A;  2LNS A;  2QGV A;  1BQ7 A;  2ALB A;  1OC8 A;  2ON7 A;  2BJX A;  1TW9 A;  3LJR A;  4CY6 A;  3APS A;  2A4V A;  3IPZ A;  5G1K A;  2CZ2 A;  4K1F A;  3H79 A;  1A2M A;  5ID2 B;  3FW2 A;  5DJM A;  3ZRE A;  4F2I A;  1B4P A;  3HVV A;  2FWF A;  2CQ9 A;  5DCH A;  2RUF A;  4NXI A;  1DUG A;  3PH9 A;  3GIX A;  1EEM A;  2IIY A;  1M9A A;  3KCM A;  3IK7 A;  3OR5 A;  3QFA C;  1TOF A;  4GSS A;  1A2L A;  1EP8 A;  2B5E A;  1XBS A;  2GZP A;  1CQH A;  2PUK C;  2YWN A;  2VLU A;  4E8E A;  4DEJ A;  3GYK A;  2WB9 A;  4NAX A;  4YAP A;  2C0E A;  3EIN A;  1HYU A;  1HNC A;  2V1M A;  4WEY A;  3GKX A;  3IE3 A;  1V98 A;  3D22 A;  3FR3 A;  2MYG A;  2A4H A;  4KCE A;  4KH7 A;  2VM1 A;  1ZYQ B;  5F05 A;  2XC2 A;  4NMU A;  1LBK A;  2VO4 A;  4G9H A;  3DXB A;  2HT9 A;  5BRT A;  1SKS B;  1MTC A;  2DBC A;  2L6D A;  2VUP A;  1OKD A;  3LYP A;  2IMK A;  2I1U A;  5AIS A;  3ZIT A;  2O87 A;  2R2J A;  4NPB A;  4ZL8 A;  3C73 A;  4MMM A;  5CRH A;  3ZTL A;  1Q98 A;  1XW5 A;  5ECM B;  3QAG A;  2NBS A;  2JSZ A;  1K0A A;  2YWO A;  4JR4 A;  5G5E A;  4XCS A;  4XS4 A;  5E59 A;  3HVN A;  3UIW A;  2L4Q A;  2FNO A;  1JLV A;  4ECI A;  2GZY A;  4K0N A;  1GSS A;  3LXZ A;  2HI7 A;  5CP1 A;  5FHI A;  1SJ6 A;  2VL2 A;  2K6V A;  5IMV A;  5F06 A;  4FYB A;  1AQV A;  1X9M B;  1PN9 A;  4KF9 A;  2H74 A;  3DWV A;  2H1A A;  6GSX A;  1OE8 A;  3VPQ A;  3IBH A;  1GNE A;  3VFI A;  4GRF A;  5KEJ A;  2DJ3 A;  4MJB A;  4J57 E;  2FA8 A;  4XS1 A;  3CRT A;  1G6W A;  3I9V 2;  4PTS A;  2VLT A;  2RLI A;  5CO3 A;  2AUV A;  3KM6 A;  3GV1 A;  2NVL A;  3IK9 A;  4N0V A;  2ZUP A;  1Z7R A;  2VCZ A;  1GTI A;  4PQH A;  1W4V A;  3F4T A;  4HU9 A;  1NSW A;  1C72 A;  1J9B A;  1FHE A;  4ZB9 A;  4WBJ A;  1GH2 A;  1PRX A;  5CRW A;  3C1R A;  2TIR A;  3D4M A;  1EZK A;  7GSS A;  4I6X A;  1EP7 A;  4WXT A;  2CZ3 A;  2IN3 A;  4G0L A;  3VI5 A;  1O8X A;  2D2Z A;  3D6I A;  3W8J A;  4O7H A;  3IHQ A;  2WCI A;  6GSY A;  3H1N A;  5IIZ A;  2XPE A;  1A2J A;  4GTU A;  2GQK A;  4IJI A;  1S3R A;  2AYT A;  3GUR A;  4ZL9 A;  2JZS A;  3FZ5 A;  1SL1 B;  3GH6 A;  4N10 A;  5IPG A;  4ISD A;  4EIP A;  4K8M A;  3RAZ A;  4EC0 A;  3WYW A;  1TK8 B;  4TXO A;  3TRQ A;  4Z2T A;  3UJ1 A;  1XWC A;  4NWY A;  1K0C A;  3VWU A;  2DIY A;  3CSJ A;  5INY A;  4JBB A;  3ED3 A;  2H0H A;  4X1U A;  4K7O A;  2WS2 A;  5G30 A;  1XFL A;  2HRK A;  3TJF A;  2JAD A;  2V2G A;  5ECQ B;  3TDG A;  3TKQ A;  1XWB A;  1M99 A;  3MSZ A;  1U88 A;  12GS A;  4ZB6 A;  4ILF A;  1U3A A;  4K2D A;  3BD2 A;  4IQA A;  4NV5 A;  3LG6 A;  4WF5 A;  2GST A;  3NOF A;  3HD5 A;  2JSY A;  4P3Y B;  2F8F A;  1GWC A;  2DKH A;  2J9H A;  2L57 A;  2VIM A;  3FZA A;  1WIK A;  4Z2U A;  1ERT A;  2C4J A;  5DAK A;  4G0I A;  4DSR A;  2YN1 A;  4OO4 A;  2CVB A;  3TUE A;  1EGO A;  4OD7 A;  1EOG A;  1QXH A;  1AIU A;  1YKC A;  4Q5Q A;  4POM A;  4ZIJ A;  3TJK A;  1SL2 B;  1JZD A;  3ZFB A;  4V1A g;  4LMW A;  2FHE A;  2AJQ B;  2DJ2 A;  2WGR A;  1V40 A;  1SU9 A;  3J7Y b;  3ZFL A;  2FCH A;  3TKS A;  4BPY A;  4L8E A;  5AIV A;  4OCE A;  3E9J B;  1FB0 A;  5A4V A;  2OE0 A;  4EVM A;  2R6K A;  3UBK A;  3GL5 A;  3TJG A;  4Z2R A;  4MNN A;  2B5Y A;  4EO3 A;  2H0G A;  1X5C A;  2H6Y A;  1XOA A;  3US3 A;  5J5N A;  4OFN A;  5D8I A;  3F63 A;  2CAQ A;  4RI7 A;  3D5J A;  3MWH A;  2H1D A;  2R4V A;  1TP9 A;  2GQM A;  2PWJ A;  5D73 A;  2C3N A;  2GSQ A;  1TI1 A;  4KB3 A;  1G0T A;  1FOH A;  4RUV A;  2E7P A;  3RHC A;  4NV2 A;  1OC9 A;  2LRN A;  2HSH A;  4H86 A;  1GSQ A;  1IYI A;  1QUW A;  4Q5N A;  1B4Q A;  4YQU A;  3R2Q A;  2AV4 A;  3L4N A;  4BA7 A;  3PPU A;  1OVN A;  3KP9 A;  1ERV A;  1F3A A;  5ECS A;  2C8U A;  3KP8 A;  1SK1 A;  5JWQ B;  1DE2 A;  4KCA A;  4V2N A;  1B8X A;  4G2E A;  2H66 A;  3M1G A;  1E6B A;  4IS0 A;  3TGZ A;  3G7J A;  1UC7 A;  3UAR A;  4ECB A;  2C3T A;  6GSW A;  2H1G A;  4TR1 A;  3ZMK A;  1Z6M A;  2FUG 2;  4HJ2 A;  5C04 A;  4IBP A;  4GWR A;  2H19 A;  9GSS A;  1TJD A;  3M9K A;  1QMV A;  4MZW A;  2V32 A;  1V58 A;  1XPV A;  1TTZ A;  3GTU B;  4GXZ A;  5GSS A;  3GUS A;  4JU5 A;  5D93 A;  1PMT A;  4CY8 A;  4IQ1 A;  2H70 A;  4KDX A;  1QGV A;  2LEG A;  1H75 A;  1XW9 A;  2PVO C;  1PFO A;  2DJ1 A;  4KW6 A;  1S3D A;  3APQ A;  2MZC A;  5ENU A;  3KH9 A;  4OFM A;  5DAL A;  2H73 A;  2MMZ A;  4KAE A;  2B7J A;  3IAM 2;  3GKM A;  4RQX A;  2B5X A;  4MLY A;  2B1L A;  2WDU A;  3AY8 A;  2HSY A;  4L0U A;  3GMF A;  5CRE A;  1WMJ A;  4BWS A;  1YJ6 A;  2FLS A;  2VAF A;  1I5G A;  5ECO B;  3GN3 A;  1S3C A;  2VL9 A;  2DML A;  1AQW A;  1GNW A;  1ABA A;  1EV9 A;  1K3L A;  4EL1 A;  5HFG A;  3GKK A;  3GX8 A;  3QOU A;  2P5Q A;  1OAZ A;  2KP2 A;  2XPD A;  3VK9 A;  4WR4 A;  5IMZ A;  3KZQ A;  5COH A;  1KNG A;  2V6O A;  2C0F A;  5DVB A;  1GTA A;  3BCI A;  1PL2 A;  3EPT A;  1TK0 B;  3CMI A;  2PN8 A;  4LL1 B;  5G31 A;  4HSC X;  3FYG A;  2MBS A;  1SD8 A;  2IWT A;  2F51 A;  3A3T A;  3BOA A;  5JCU A;  5J41 A;  1V2A A;  2JL4 A;  3LFL A;  3DVW A;  1XOB A;  5ECP B;  2CVD A;  3EMX A;  3C1S A;  5DQY A;  2QC7 A;  3ZL5 A;  1PGT A;  3G7Y A;  1J0F A;  1OC9 B;  1X0R A;  1O7U A;  4KDU A;  2L59 A;  1HNA A;  3EVI A;  2O89 A;  3UVT A;  1AC1 A;  1TI3 A;  1ERU A;  3RBT A;  4CW9 A;  2LV3 A;  3QPM A;  2H30 A;  3EC3 A;  4XRA A;  3MIX A;  5KN2 A;  2X99 A;  2DLX A;  2V41 A;  2OA7 A;  4N30 A;  2G2Q A; 
#chains in the Genus database with same CATH homology
 1GSY A;  3F3R A;  5CRD A;  2G0F A;  2VD1 A;  1SL0 B;  4LA1 A;  2YAN A;  1KTE A;  5D9V A;  1ON4 A;  1KBN A;  4HQS A;  3M9J A;  4L5O A;  3G7I A;  2K18 A;  1PQN A;  5IOW A;  1MDI A;  2RM5 A;  1MEK A;  3IDV A;  5FWG A;  2V6K A;  3HHV A;  3A2V A;  5D96 A;  4K5R A;  4TR1 B;  3A2W A;  5ECR B;  4JR6 A;  1RW1 A;  2YJ7 A;  4X43 A;  3L0H A;  1XWG A;  5JCG A;  1GUK A;  2C0G A;  2VCQ A;  2QKE A;  4RQR A;  1NHO A;  4YQM A;  4IJ3 A;  4WKW A;  3LW9 A;  3DYR A;  1XVQ A;  2M80 A;  4ECC A;  3EU4 A;  1QK8 A;  4BL7 B;  2N5F A;  4Z7X A;  1G7E A;  1MDK A;  1VF4 A;  3CXG A;  5DAL B;  2GQL A;  6GSV A;  5ELA A;  1O8W A;  3W6G A;  2RM6 A;  2LUS A;  13GS A;  1ZYN A;  3DRN A;  4ID0 A;  3ZIV A;  3GSS A;  2B7K A;  2YCD A;  4GCI A;  4ZBA A;  2WRT A;  4JZQ A;  2RUE A;  1XXU A;  5E4W A;  1TXX A;  2LQQ A;  2PER A;  2IJY A;  2HSM A;  4V1A p;  4DSS B;  4NHZ A;  4ULX A;  3P2A A;  4F0C A;  2HZF A;  4K9Z A;  2OE3 A;  4EE0 A;  1XWK A;  1Q4J A;  2I9H A;  1AAZ A;  3P7X A;  2MMN A;  2I81 A;  3UVH A;  3MNG A;  4F82 A;  3DGQ A;  4GQC A;  1TU8 A;  3L9S A;  4MK3 A;  5G5F A;  3FRC A;  2CX4 A;  2AB6 A;  4XHM A;  5ECH B;  5F8B A;  1A0R P;  3HXS A;  5KOX A;  2KLX A;  3CSI A;  3TCO A;  3VLN A;  4IVF A;  4ZB8 A;  1THX A;  5J9B A;  2GDR A;  3TKS C;  4MAB A;  1XWA A;  5B6M A;  1M2B A;  4FIW A;  3W8S A;  2HLS A;  1K0N A;  4TR4 A;  5BMU A;  5HR0 A;  1GP1 A;  1VF3 A;  2BMX A;  3LOR A;  3HVX A;  3TJB A;  1TDI A;  3H93 A;  4QL9 A;  5B8B A;  3LSZ A;  4ML6 A;  1TRW A;  4TKY A;  3IOS A;  4AF2 A;  1T4Z A;  1EOH A;  5AN1 A;  5HR2 A;  5HR1 A;  2WFC A;  4OMV A;  3RDW A;  1T1V A;  3HJM A;  4IN0 A;  3VWX A;  2CV4 A;  3QR6 A;  3Q6O A;  3WGD A;  1GSF A;  1VF2 A;  1M0U A;  3KXO A;  1DE1 A;  2JZT A;  19GS A;  3ZZX A;  3C71 A;  3GST A;  1PA3 A;  5IO2 A;  1WPI A;  3HKR A;  3ME7 A;  4FH8 A;  5IM9 A;  5AIX A;  2HZE A;  1K0O A;  1RK4 A;  2YZH A;  5KN0 A;  3UAP A;  4KSM A;  3FY7 A;  3G9B A;  4HJM A;  1YDK A;  1AQX A;  1PSQ A;  4TN8 A;  3I6A A;  4HU7 A;  4MA9 A;  3TKS E;  2DJJ A;  1R4W A;  1R5P A;  1JZO A;  2IME A;  4RI6 A;  4POK A;  3M8N A;  2H8L A;  3K8N A;  3GX0 A;  4KND A;  3HCZ A;  1UVZ A;  5DCG A;  2LRT A;  2IL3 A;  4TR3 A;  3PR8 A;  4IKH A;  5DBQ A;  1OYJ A;  3KEB A;  5IOX A;  3GH9 A;  1B9Y C;  1X9W B;  2YP6 A;  1F9M A;  2QA2 A;  3HDC A;  1TKD B;  3HA9 A;  1K0D A;  5IPH A;  4IGJ A;  4POB A;  1R7H A;  1YF0 A;  3WT2 A;  2B6M A;  1B9X C;  2YJH A;  1CQG A;  1F6M C;  4XS4 B;  1A0F A;  4L0W A;  2MMA A;  1MDJ A;  1ERW A;  1M7T A;  4IP6 A;  3ZVJ A;  1Z3E A;  3LEF A;  3O3T A;  4I2T A;  3DIE A;  2FA4 A;  2H1B A;  4ZBB A;  3F4R A;  1JHB A;  1IYH A;  3WT1 A;  3KH7 A;  4KE3 A;  2HRN A;  1ZYE A;  2MMO A;  4FO5 A;  1HQO A;  4K5S A;  5D9W A;  1XIY A;  1Z5Y E;  4MPG A;  4FYU A;  3KIJ A;  5D9T A;  4BWQ A;  1O81 A;  2QSI A;  2C1Y A;  2N5B A;  1JZW A;  1ZCP A;  3FK8 A;  3IHG A;  3S9F A;  1RQM A;  4AGS A;  3H8Q A;  4MF6 A;  1T8E B;  4OCF A;  2E2M A;  3GKN A;  2GT6 A;  3CBU A;  4O5Q A;  2LRC A;  1OE7 A;  2PGT A;  1PD2 1;  5KN1 A;  4A5P A;  1NHY A;  4IHU A;  5EY6 A;  4GSN A;  3VI7 A;  1QQ2 A;  3TJJ A;  4O92 A;  3Q19 A;  3TOU A;  1BG5 A;  2H0I A;  1ILO A;  2IFQ A;  1BED A;  3UMA A;  1DSB A;  3IA1 A;  11GS A;  6GST A;  5GZZ B;  1K3Y A;  4EUY A;  4WR5 A;  2EIR A;  2LQO A;  1FOV A;  1M9B A;  2F9S A;  2GSS A;  16GS A;  2O85 A;  2I4A A;  2L5L A;  1AXD A;  4YH2 A;  5C00 A;  2EIQ A;  1LJR A;  2TRC P;  5IMF A;  4JE1 A;  2VCV A;  14GS A;  4ICY A;  3HY2 A;  3VWV A;  4E8H A;  3H4K A;  3PIN A;  4TXO B;  2OBK A;  3O6T A;  3KTL A;  1U6T A;  5JWO B;  2OBI A;  4I8B A;  17GS A;  5AGY A;  1G7O A;  4WET A;  3UL3 A;  1GTU A;  3HJO A;  4F9Z A;  3F4S A;  4ECJ A;  2IMD A;  3TB2 A;  2GSR A;  1XVW A;  1Z7P A;  1GSU A;  3UEM A;  4XIH A;  1SKR B;  3IXR A;  3FR9 A;  2ZNM A;  3I43 A;  2DKI A;  1Z6N A;  2IMI A;  1A23 A;  2P0G A;  2LNT A;  2RII A;  4K0G A;  1FAA A;  3MYD A;  5F07 A;  3IAS 2;  2A2R A;  2R0G A;  1A8Y A;  3KMN A;  1USB A;  1WWJ A;  1K0B A;  4YQV A;  5L71 A;  5DAK B;  4IP1 A;  4MH3 A;  3GRX A;  4TXV A;  3L9U A;  1GUM A;  2LTK A;  3A2X A;  4GQF A;  1WE0 A;  2X49 A;  2A2S A;  2KUC A;  1XZO A;  2FGX A;  1Y25 A;  1YZX A;  1WJK A;  2JAC A;  4GF0 A;  2XHF A;  3QCP A;  3C8E A;  2K9F A;  5B6N A;  3DVX A;  3WGE A;  2L5O A;  4AJ7 A;  5HR3 A;  3TKR A;  4N0Z A;  1GLQ A;  2FWG A;  2QA1 A;  1I9D A;  2PMT A;  2VCW A;  4TW5 A;  3VPT A;  2GVP A;  4QQ7 A;  4EKZ A;  3F0I A;  2I3Y A;  1GUH A;  1UN2 A;  5CRG A;  1FO5 A;  2VL2 C;  5ECL B;  1PX6 A;  2FWH A;  4QL7 A;  4OWY A;  2YPM A;  1T3B A;  1N2A A;  2O8V B;  4OFT A;  5DJL A;  3A5W A;  1X5E A;  1G6Y A;  2H75 A;  5IO0 A;  4KGI A;  2VD0 A;  1PX7 A;  1H4O A;  4XRD A;  3J7Y k;  1F2E A;  3RPP A;  3UOM A;  4X4J A;  4LMV A;  3FMW A;  3TRX A;  4PX1 A;  1OC3 A;  4JED A;  3WGX A;  2JZR A;  1O85 A;  2HYX A;  5EPF A;  2OAD A;  2IFQ B;  1B48 A;  4JRR A;  4TOP A;  2ON5 A;  3KTB A;  3P8W A;  2ES7 A;  3KD0 A;  3DD3 A;  4DVC A;  3EE2 A;  4D73 A;  2NTO A;  3GL3 A;  2X64 A;  4TR0 A;  1SK2 A;  2VOC A;  3HYP A;  3LGC A;  3MAK A;  1A8L A;  1SJI A;  3L9V A;  3EUR A;  2VCT A;  1QFN A;  2WZ9 A;  4ZBD A;  1Y6E A;  3FEU A;  2X8G A;  1M2D A;  2N5A A;  5JCW A;  2X8H A;  1KEB A;  3QFB C;  3IR4 A;  4Q5R A;  1EWX A;  10GS A;  5CNW A;  2CX3 A;  2R5G A;  3A5I A;  5FT3 A;  1WP0 A;  2O7K A;  2AHE A;  1W89 A;  1K0M A;  4KX4 A;  5ECN B;  2VM2 A;  1OKT A;  3L78 A;  4MDC A;  1YF1 A;  2R37 A;  4I5Q A;  1FW1 A;  4NHW A;  3GHA A;  4IEL A;  4HUA A;  3U5R E;  3LQ7 A;  1T4Y A;  2NPB A;  2K8V A;  5IMD A;  1PKW A;  1X9S B;  1VGL A;  3HVS A;  2H6X A;  5G2Z A;  4F03 A;  2UZ8 A;  4V2L A;  3M0F A;  1HNB A;  3BCK A;  5IQY A;  2GTU A;  3RHB A;  5A4W A;  4LL4 B;  8GSS A;  2HXK A;  4OO5 A;  4X0X A;  2TRX A;  2OE1 A;  3ZVJ D;  3ERG A;  2R0P A;  2CT6 A;  1GRX A;  3F6D A;  4BVY A;  1PKZ A;  5KN3 A;  3LYK A;  1TRS A;  2R3X A;  3LXT A;  1BX9 A;  4IW9 A;  1AUC A;  1TRU A;  2GGT A;  5GST A;  3Q74 A;  4MH2 A;  1ML6 A;  4PUR A;  4PXO A;  3TKP A;  3F3Q A;  3LWA A;  1V9W A;  1YKA A;  5ECK B;  1WRY A;  5HQP A;  4L5L A;  4O32 A;  2PBJ A;  5IMC A;  2DMM A;  1R26 A;  2YV7 A;  5J3R A;  3ZYW A;  6GSS A;  5CAX A;  1SK0 A;  4PQI A;  2HRF A;  4PUF C;  4AJ8 A;  20GS A;  2H01 A;  2IMF A;  2KOK A;  4J2F A;  2P5R A;  4WBR D;  1S3A A;  2H6Z A;  2LKU A;  4MCU A;  1TK5 B;  4XS6 A;  4CHS A;  1UA5 A;  5H5Q A;  3IRA A;  4K6X A;  4N11 A;  4K7N A;  5H5S A;  2J23 A;  3KGK A;  4MP4 A;  1SD9 A;  1U3I A;  4G10 A;  3QD9 A;  2HRA A;  5F0G A;  4D73 B;  1BAY A;  2E0Q A;  4O5R A;  2L4C A;  1T7P B;  2YWM A;  1XCC A;  4FQU A;  6GSU A;  3APO A;  1ZZY A;  4EF0 A;  1MD3 A;  3CTF A;  3EMP A;  5H5R A;  2EIO A;  4EDY A;  3TOT A;  5B7C A;  5CYY A;  4FYC A;  2Z9S A;  2XBI A;  3FZ9 A;  1M2A A;  1EEJ A;  2VLV A;  5B8A A;  2PU9 C;  3R3E A;  3EWL A;  4TVE A;  1EGR A;  4V2M A;  1URM A;  4GST A;  5A4U A;  1AW9 A;  3Q18 A;  1V57 A;  1FB6 A;  4J56 E;  2GZZ A;  2CAI A;  5GAP D;  3IC8 A;  3D0Z A;  2C80 A;  3V1W A;  3E3E A;  1ZMA A;  2A2P A;  2HNL A;  1NW2 A;  3BJ5 A;  1GSD A;  4Q5F A;  3GTU A;  4TRX A;  2MBT A;  2OAC A;  4HZ4 A;  4WF4 A;  2DSA A;  1N8J A;  4HI7 A;  3DML A;  5ABR A;  3FZ4 A;  4MF5 A;  1K3O A;  4HZ2 A;  2C3Q A;  2WUL A;  2B1K A;  3KMO A;  3VUR A;  5GAN D;  4BVY B;  2OJL A;  2DC5 A;  1GUL A;  2JU5 A;  2H71 A;  1JFU A;  1HD2 A;  5KOW A;  1NM3 A;  4K7I A;  2M72 A;  2R0C A;  2X8C A;  4EIQ A;  4KDY A;  3ME8 A;  18GS A;  3EU3 A;  3C7M A;  5D9X A;  3ZRD A;  4ML1 A;  2IPA A;  3FR6 A;  1THO A;  4BVX A;  3QAV A;  2DIZ A;  4F0B A;  4MF7 A;  4PNG A;  4PNF A;  2LJA A;  4KA0 A;  2H72 A;  2LS5 A;  5J9C A;  1SYR A;  3M3M A;  3KJY A;  2GLR A;  2XBQ A;  2KP1 A;  1ZYP A;  4YAV A;  5ECI B;  1O6J A;  2L6C A;  4HEA 2;  4CDO A;  2GT5 A;  3ZLP A;  3SWL A;  5EL8 A;  2CVK A;  1SJZ A;  2REM A;  4PUA A;  5JWR B;  1EV4 A;  4KUN A;  2YNX A;  2F3M A;  5J4U A;  1FVK A;  2EC4 A;  3E0U A;  2C0D A;  1YEX A;  2CA8 A;  3CTG A;  4HQZ A;  2KHP A;  1J08 A;  3I69 A;  3ZML A;  2HFD A;  4MJC A;  1ZGN A;  3N9J A;  3JCM L;  2VCX A;  4PQ1 A;  1R5A A;  4MJE A;  2ZCT A;  2LST A;  3CRU A;  2LJK A;  5ID2 A;  4G19 A;  1YY7 A;  2AAW A;  5A5K A;  1DBY A;  2FD3 A;  3D4T A;  1F3B A;  5DDL A;  2HZE B;  5LNK e;  3U6V A;  1E2Y A;  1T00 A;  1YEP A;  4HOJ A;  2WJU A;  1ST9 A;  22GS A;  3UBL A;  4USS A;  2FWE A;  4XTS A;  2YOI A;  2P31 A;  2VL3 A;  3ERW A;  3O76 A;  4YKF A;  1TRV A;  3FKF A;  5ELG A;  1U87 A;  2E2G A;  3TRP A;  3QMX A;  5HFK A;  1TU7 A;  2B3S A;  1F37 A;  3MDK A;  5LD0 A;  5IMA A;  2OKA A;  3GFK A;  4O5U A;  3HZ4 A;  1GSE A;  1SKW B;  3HZ8 A;  2M46 A;  1VRS D;  2FY6 A;  2H76 A;  1FG4 A;  4MPF A;  3F8U A;  4I97 A;  1ZOF A;  2NDO A;  4AJ6 A;  1PL1 A;  3SBC A;  4MZC A;  1JZR A;  3EYT A;  1O73 A;  4BL7 A;  4PGT A;  3BBY A;  4POL A;  4I2U A;  3HJP A;  3N5O A;  1YQ1 A;  5EVO A;  4HDE A;  1BJX A;  3ISO A;  3ZIJ A;  4MJA A;  4MZB A;  1JLW A;  1LU4 A;  1BYE A;  2DJ0 A;  1X5D A;  1PN0 A;  3P90 A;  3QAW A;  4DSQ A;  4GLT A;  4ACS A;  5LCZ A;  2DJK A;  1FVJ A;  3DEX A;  3RPN A;  3QDN A;  3VWW A;  1MD4 A;  4DSS A;  3IC4 A;  3FHK A;  3ERF A;  4BVX B;  1Z9H A;  2X4A A;  4ZXG A;  4EXJ A;  2YWI A;  3IV4 A;  3NIV A;  1A24 A;  3CYN A;  4KSO A;  4K2X A;  3GNJ A;  5DQS A;  3DKS A;  1GLP A;  2GS3 A;  4LLR A;  1ACV A;  2F8A A;  3PGT A;  4HS1 A;  1SYX A;  5HFI A;  1GTB A;  2LJR A;  3NZN A;  1SEN A;  3D21 A;  4G0K A;  4YKG A;  2PVQ A;  3CSH A;  2YZU A;  4ZL7 A;  1GL8 A;  4ZIL A;  3WD6 A;  3F6F A;  4EDZ A;  2PPT A;  3GA4 A;  2BTO T;  1VF1 A;  5G1L A;  1XW6 A;  2K8S A;  3F9U A;  2HE3 A;  2YV9 A;  1WOU A;  1ZL9 A;  2LNS A;  2QGV A;  1BQ7 A;  2ALB A;  1OC8 A;  2ON7 A;  2BJX A;  1TW9 A;  3LJR A;  4CY6 A;  3APS A;  2A4V A;  3IPZ A;  5G1K A;  2CZ2 A;  4K1F A;  3H79 A;  1A2M A;  5ID2 B;  3FW2 A;  5DJM A;  3ZRE A;  4F2I A;  1B4P A;  3HVV A;  2FWF A;  2CQ9 A;  5DCH A;  2RUF A;  4NXI A;  1DUG A;  3PH9 A;  3GIX A;  1EEM A;  2IIY A;  1M9A A;  3KCM A;  3IK7 A;  3OR5 A;  3QFA C;  1TOF A;  4GSS A;  1A2L A;  1EP8 A;  2B5E A;  1XBS A;  2GZP A;  1CQH A;  2PUK C;  2YWN A;  2VLU A;  4E8E A;  4DEJ A;  3GYK A;  2WB9 A;  4NAX A;  4YAP A;  2C0E A;  3EIN A;  1HYU A;  1HNC A;  2V1M A;  4WEY A;  3GKX A;  3IE3 A;  1V98 A;  3D22 A;  3FR3 A;  2MYG A;  2A4H A;  4KCE A;  4KH7 A;  2VM1 A;  1ZYQ B;  5F05 A;  2XC2 A;  4NMU A;  1LBK A;  2VO4 A;  4G9H A;  3DXB A;  2HT9 A;  5BRT A;  1SKS B;  1MTC A;  2DBC A;  2L6D A;  2VUP A;  1OKD A;  3LYP A;  2IMK A;  2I1U A;  5AIS A;  3ZIT A;  2O87 A;  2R2J A;  4NPB A;  4ZL8 A;  3C73 A;  4MMM A;  5CRH A;  3ZTL A;  1Q98 A;  1XW5 A;  5ECM B;  3QAG A;  2NBS A;  2JSZ A;  1K0A A;  2YWO A;  4JR4 A;  5G5E A;  4XCS A;  4XS4 A;  5E59 A;  3UIW A;  2L4Q A;  2FNO A;  1JLV A;  4ECI A;  2GZY A;  4K0N A;  1GSS A;  3LXZ A;  2HI7 A;  5CP1 A;  5FHI A;  1SJ6 A;  2VL2 A;  2K6V A;  5IMV A;  5F06 A;  4FYB A;  1AQV A;  1X9M B;  1PN9 A;  4KF9 A;  2H74 A;  3DWV A;  2H1A A;  6GSX A;  1OE8 A;  3VPQ A;  3IBH A;  1GNE A;  3VFI A;  4GRF A;  5KEJ A;  2DJ3 A;  4MJB A;  4J57 E;  2FA8 A;  4XS1 A;  3CRT A;  1G6W A;  3I9V 2;  4PTS A;  2VLT A;  2RLI A;  5CO3 A;  2AUV A;  3KM6 A;  3GV1 A;  2NVL A;  3IK9 A;  4N0V A;  2ZUP A;  1Z7R A;  2VCZ A;  1GTI A;  4PQH A;  1W4V A;  3F4T A;  4HU9 A;  1NSW A;  1C72 A;  1J9B A;  1FHE A;  4ZB9 A;  4WBJ A;  1GH2 A;  1PRX A;  5CRW A;  3C1R A;  2TIR A;  3D4M A;  1EZK A;  7GSS A;  4I6X A;  1EP7 A;  4WXT A;  2CZ3 A;  2IN3 A;  4G0L A;  3VI5 A;  1O8X A;  2D2Z A;  3D6I A;  3W8J A;  4O7H A;  3IHQ A;  2WCI A;  6GSY A;  3H1N A;  5IIZ A;  2XPE A;  1A2J A;  4GTU A;  2GQK A;  4IJI A;  2AYT A;  3GUR A;  4ZL9 A;  2JZS A;  3FZ5 A;  1SL1 B;  3GH6 A;  4N10 A;  5IPG A;  4ISD A;  4EIP A;  4K8M A;  3RAZ A;  4EC0 A;  3WYW A;  1TK8 B;  4TXO A;  3TRQ A;  4Z2T A;  3UJ1 A;  1XWC A;  4NWY A;  1K0C A;  3VWU A;  2DIY A;  3CSJ A;  5INY A;  4JBB A;  3ED3 A;  2H0H A;  4X1U A;  4K7O A;  2WS2 A;  5G30 A;  1XFL A;  2HRK A;  3TJF A;  2JAD A;  2V2G A;  5ECQ B;  3TDG A;  3TKQ A;  1XWB A;  1M99 A;  3MSZ A;  1U88 A;  12GS A;  4ZB6 A;  4ILF A;  1U3A A;  4K2D A;  3BD2 A;  4IQA A;  4NV5 A;  3LG6 A;  4WF5 A;  2GST A;  3NOF A;  3HD5 A;  2JSY A;  4P3Y B;  2F8F A;  1GWC A;  2DKH A;  2J9H A;  2L57 A;  2VIM A;  3FZA A;  1WIK A;  4Z2U A;  1ERT A;  2C4J A;  5DAK A;  4G0I A;  4DSR A;  2YN1 A;  4OO4 A;  2CVB A;  3TUE A;  1EGO A;  4OD7 A;  1EOG A;  1QXH A;  1AIU A;  1YKC A;  4Q5Q A;  4POM A;  4ZIJ A;  3TJK A;  1SL2 B;  1JZD A;  3ZFB A;  4V1A g;  4LMW A;  2FHE A;  2AJQ B;  2DJ2 A;  2WGR A;  1V40 A;  1SU9 A;  3J7Y b;  3ZFL A;  2FCH A;  3TKS A;  4BPY A;  4L8E A;  5AIV A;  4OCE A;  3E9J B;  1FB0 A;  5A4V A;  2OE0 A;  4EVM A;  2R6K A;  3UBK A;  3GL5 A;  3TJG A;  4Z2R A;  4MNN A;  2B5Y A;  4EO3 A;  2H0G A;  1X5C A;  2H6Y A;  1XOA A;  3US3 A;  5J5N A;  4OFN A;  5D8I A;  3F63 A;  2CAQ A;  4RI7 A;  3D5J A;  3MWH A;  2H1D A;  2R4V A;  1TP9 A;  2GQM A;  2PWJ A;  5D73 A;  2C3N A;  2GSQ A;  1TI1 A;  4KB3 A;  1G0T A;  1FOH A;  4RUV A;  2E7P A;  3RHC A;  4NV2 A;  1OC9 A;  2LRN A;  2HSH A;  4H86 A;  1GSQ A;  1IYI A;  1QUW A;  4Q5N A;  1B4Q A;  4YQU A;  3R2Q A;  2AV4 A;  3L4N A;  4BA7 A;  3PPU A;  1OVN A;  3KP9 A;  1ERV A;  1F3A A;  5ECS A;  2C8U A;  3KP8 A;  1SK1 A;  5JWQ B;  1DE2 A;  4KCA A;  4V2N A;  1B8X A;  4G2E A;  2H66 A;  3M1G A;  1E6B A;  4IS0 A;  3TGZ A;  3G7J A;  1UC7 A;  3UAR A;  4ECB A;  2C3T A;  6GSW A;  2H1G A;  4TR1 A;  3ZMK A;  1Z6M A;  2FUG 2;  4HJ2 A;  5C04 A;  4IBP A;  4GWR A;  2H19 A;  9GSS A;  1TJD A;  3M9K A;  1QMV A;  4MZW A;  2V32 A;  1V58 A;  1XPV A;  1TTZ A;  3GTU B;  4GXZ A;  5GSS A;  3GUS A;  4JU5 A;  5D93 A;  1PMT A;  4CY8 A;  4IQ1 A;  2H70 A;  4KDX A;  1QGV A;  2LEG A;  1H75 A;  1XW9 A;  2PVO C;  2DJ1 A;  4KW6 A;  1S3D A;  3APQ A;  2MZC A;  5ENU A;  3KH9 A;  4OFM A;  5DAL A;  2H73 A;  2MMZ A;  4KAE A;  2B7J A;  3IAM 2;  3GKM A;  4RQX A;  2B5X A;  4MLY A;  2B1L A;  2WDU A;  3AY8 A;  2HSY A;  4L0U A;  3GMF A;  5CRE A;  1WMJ A;  4BWS A;  1YJ6 A;  2FLS A;  2VAF A;  1I5G A;  5ECO B;  3GN3 A;  1S3C A;  2VL9 A;  2DML A;  1AQW A;  1GNW A;  1ABA A;  1EV9 A;  1K3L A;  4EL1 A;  5HFG A;  3GKK A;  3GX8 A;  3QOU A;  2P5Q A;  1OAZ A;  2KP2 A;  2XPD A;  3VK9 A;  4WR4 A;  5IMZ A;  3KZQ A;  5COH A;  1KNG A;  2V6O A;  2C0F A;  5DVB A;  1GTA A;  3BCI A;  1PL2 A;  3EPT A;  1TK0 B;  3CMI A;  2PN8 A;  4LL1 B;  5G31 A;  3FYG A;  2MBS A;  1SD8 A;  2IWT A;  2F51 A;  3A3T A;  3BOA A;  5JCU A;  5J41 A;  1V2A A;  2JL4 A;  3LFL A;  3DVW A;  1XOB A;  5ECP B;  2CVD A;  3EMX A;  3C1S A;  5DQY A;  2QC7 A;  3ZL5 A;  1PGT A;  3G7Y A;  1J0F A;  1OC9 B;  1X0R A;  1O7U A;  4KDU A;  2L59 A;  1HNA A;  3EVI A;  2O89 A;  3UVT A;  1AC1 A;  1TI3 A;  1ERU A;  3RBT A;  4CW9 A;  2LV3 A;  3QPM A;  2H30 A;  3EC3 A;  4XRA A;  3MIX A;  5KN2 A;  2X99 A;  2DLX A;  2V41 A;  2OA7 A;  4N30 A;  2G2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...