4GQFA

Aeropyrum pernix peroxiredoxin q enzyme in the locally unfolded conformation
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
163
structure length
163
Chain Sequence
KGLVELGEKAPDFTLPNQDFEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKMAQLEKANAEVLAISVDSPWCLKKFKDENRLAFNLLSDYNREVIKLYNVYHEDLKGLKMVAKRAVFIVKPDGTVAYKWVTDNPLNEPDYDEVVREANKIAGELVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol peroxidase
publication title Mapping the Active Site Helix-to-Strand Conversion of CxxxxC Peroxiredoxin Q Enzymes.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 45
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gqfA00
1WPIA 1TTZA 4RQRA 2GT6A 4Z7XA 4KH7A 5ECQB 4EC0A 2KHPA 4JZQA 1O6JA 4NHWA 1SD9A 2YNXA 1TK0B 1G7EA 2VL2A 1Q98A 4K7NA 4WF5A 1M0UA 2GSQA 4LL1B 5LNKe 18GSA 1MD3A 2I4AA 3GTUA 3IAM2 2CA8A 3TRPA 5COHA 1GH2A 2HFDA 3UARA 4POBA 1R7HA 3CRUA 2A4VA 4BVXA 1JZRA 1MDIA 2NVLA 2DJ2A 2GZZA 3L78A 2LSTA 4WEYA 4LLRA 2H1GA 2O87A 1TJDA 1JZDA 1XWGA 5IPHA 4NV5A 1M2BA 1UVZA 4AGSA 3OR5A 4MF5A 5IMZA 2KLXA 2V1MA 5IMAA 3GFKA 1OYJA 3M1GA 2L4CA 4FIWA 3H93A 2CAIA 2RUEA 2LQQA 3C7MA 4ISDA 2VCZA 2H74A 2O89A 4F0BA 3FZ5A 5C00A 4DSRA 2MMAA 5IPGA 4XS6A 3QFAC 2JU5A 2NBSA 2BTOT 5DVBA 1NHYA 4KUNA 3C73A 1YF0A 1PA3A 12GSA 1HNBA 3ME8A 1EP7A 5IM9A 4EDZA 1TI1A 2WULA 2E2MA 1FVJA 2L4QA 4MF7A 3HZ4A 4ECCA 1DBYA 3C1SA 3HD5A 1F9MA 1MDJA 3IHQA 4HZ4A 1EEJA 3TJFA 4J2FA 3A5WA 1BG5A 3EU4A 3CBUA 5G2ZA 5A4WA 1XBSA 2YP6A 5J5NA 5FWGA 3G7IA 2VCQA 1GLQA 4KB3A 3GIXA 4TRXA 1EGRA 4IGJA 4ZB9A 6GSYA 3F9UA 1KNGA 1AQWA 1O8WA 2JZRA 2DLXA 2HYXA 3EU3A 3Q6OA 2FA8A 4GSNA 4BWQA 19GSA 3ERFA 4I8BA 4IELA 5IO2A 3ZFBA 2HRNA 2FWFA 2LS5A 2I3YA 1GUHA 1X9SB 2BMXA 2D2ZA 1CQGA 2JSZA 2I9HA 2WS2A 1AQVA 4WBJA 4FYBA 4MMMA 3M9JA 1T7PB 3FZ9A 3CSIA 3KTBA 1EP8A 2HI7A 5J3RA 4NAXA 3GSTA 4GCIA 2XPEA 2K8SA 4MPFA 4HS1A 2LQOA 1K0MA 3U5RE 2DBCA 3I43A 2WCIA 2LUSA 2QSIA 1B4PA 5CYYA 1GSDA 4IN0A 1QQ2A 2E2GA 2OA7A 3N9JA 1LJRA 4KDYA 8GSSA 5B8AA 3FW2A 5EPFA 2YJHA 3LORA 4PGTA 1HD2A 4N11A 3KEBA 5DBQA 1N8JA 1O8XA 4L5LA 4JE1A 3ZFLA 3RPNA 2WFCA 5G1LA 4IQ1A 4MLYA 1RW1A 5KN3A 3IK9A 2QC7A 2R6KA 3L9SA 4I5QA 2RM5A 3CSHA 4PX1A 1ZZYA 1GUMA 1SL1B 3UBLA 2E0QA 4X0XA 3WYWA 5E59A 1GNWA 3TCOA 2L5OA 1XOBA 5HR2A 2LRCA 3QAWA 1EWXA 1XWAA 3ZVJA 2G2QA 5HQPA 2H76A 3WGEA 5CNWA 3VWVA 2B6MA 4EL1A 3F4SA 4HJ2A 6GSVA 4LMWA 3PINA 3DXBA 4I2TA 2YN1A 3LYKA 2IJYA 5AIVA 4DSSB 1QUWA 2IL3A 2IN3A 3ERGA 1FOVA 5IMVA 1TK5B 1NHOA 5HFGA 1IYHA 4K8MA 2PU9C 2I81A 4MH3A 1SK1A 5ECRB 5CRHA 1QK8A 4ULXA 2C4JA 1X9MB 2B3SA 2RLIA 4HQZA 2HE3A 3W6GA 4IQAA 1MTCA 1MEKA 3NIVA 5ECSA 2OE0A 1USBA 4K1FA 2N5FA 2FY6A 2P5RA 4CHSA 1GUKA 4OFTA 3H1NA 1V58A 2GSRA 4RI6A 5AISA 4XHMA 5L71A 5D9XA 3HXSA 2CVBA 4AJ8A 1JLWA 3TOTA 3DYRA 1TP9A 3GKXA 4K0NA 1A0FA 2AUVA 3MAKA 5DCGA 3PR8A 13GSA 1O85A 1SJIA 5GZZB 4ECIA 2YV7A 2LRTA 3QD9A 5C04A 1V57A 4Q5QA 4PXOA 14GSA 3ZIVA 3KMOA 4O5RA 3UIWA 4OFNA 1FB6A 3G7YA 3P7XA 2DJ0A 3APSA 1F6MC 3GYKA 2EIQA 2VD0A 3F6DA 5ELGA 2GTUA 1K3YA 3SWLA 1FAAA 4WETA 4ZB8A 4X1UA 4IJ3A 4LL4B 4TN8A 5HR3A 4ECJA 5ECPB 4ECBA 5A5KA 2B1LA 3US3A 2VL9A 4F03A 1F3BA 3DGQA 9GSSA 2EC4A 3ISOA 3P2AA 2R3XA 2H6YA 4K6XA 1T3BA 1TRUA 1K0NA 1M7TA 1XW6A 2VD1A 4HU9A 2FHEA 2FLSA 1V2AA 3ERWA 1NSWA 5EL8A 3TKSA 1Q4JA 3RHBA 1SENA 2PMTA 4YQVA 4TR3A 4IW9A 3GHAA 1R4WA 4KNDA 2YANA 3HJOA 1YJ6A 4N0ZA 5FHIA 2M46A 1FO5A 1QMVA 5F0GA 4TR1A 3LYPA 1S3DA 4RI7A 5HFKA 2H71A 1PQNA 3TKQA 4FYCA 3H4KA 2M80A 3TKPA 5EVOA 4ZIJA 2OADA 2VLVA 3UL3A 2AHEA 2ON5A 2CQ9A 2R5GA 1YEPA 4KDUA 5HR1A 2YZHA 1A2JA 3PGTA 3ZZXA 2X64A 1TRWA 3GSSA 22GSA 4J57E 4BA7A 3GKNA 2AAWA 2H0GA 2OACA 4MZBA 3GH6A 1BQ7A 3W8SA 4NHZA 2YCDA 3HVVA 1B9XC 1G6WA 4TR4A 3BD2A 2AV4A 4PUFC 1A24A 1BAYA 2ZCTA 2I1UA 2IMFA 2V6KA 3HJMA 5H5RA 2C3QA 2OBKA 1ZGNA 3IR4A 3EVIA 3VFIA 2C3TA 4OO4A 2F3MA 1HNCA 2LNSA 2N5AA 4TXOB 2K18A 5H5SA 3ME7A 1FG4A 4LMVA 1Z5YE 4GQFA 3E9JB 4KDXA 2CAQA 4YQMA 2OKAA 4N0VA 1YY7A 3A2WA 5EY6A 5IMFA 3CRTA 1ERTA 3F6FA 1Z7RA 2VIMA 4L0UA 2H19A 2VO4A 5JWRB 3IK7A 2K6VA 4ACSA 3DVWA 5G30A 1BX9A 3D6IA 5AN1A 4K7OA 3VI5A 1QGVA 1J9BA 2MMNA 5GSSA 3HVSA 3P90A 3WT2A 2FGXA 1IYIA 3WGXA 1PD21 3LEFA 1TKDB 2HLSA 3CYNA 1ML6A 2VL2C 2HZEB 2DC5A 1XIYA 2B5YA 5IQYA 1TXXA 4EXJA 3MSZA 4HI7A 3BCKA 3HHVA 1V98A 5GAPD 2E7PA 2JSYA 1SKRB 4HJMA 3VWXA 2C0FA 2B7JA 3FHKA 4V1Ap 2H70A 5D93A 4BL7A 3W8JA 1MD4A 4NWYA 4NV2A 4GF0A 3TOUA 3LWAA 3QMXA 1Z7PA 2ZUPA 4CW9A 1EV9A 3HKRA 2CT6A 3ZITA 2IMEA 1A0RP 2X8CA 5ECKB 2R2JA 3KCMA 3DD3A 1U87A 1ERVA 5B6MA 2LEGA 2VM1A 16GSA 3QAGA 4WBRD 5B8BA 1YZXA 2JL4A 4NXIA 1A23A 3UBKA 3NZNA 2DMMA 2JADA 5INYA 1K0BA 3KJYA 1ZYQB 1OE7A 1SYXA 2YWIA 4FO5A 5DQYA 1A2LA 3WD6A 3ZRDA 1KBNA 2TIRA 1B9YC 1BJXA 1NM3A 1RK4A 4Q5RA 3LGCA 3FR6A 4KX4A 1V9WA 1S3AA 3KD0A 1V40A 1OAZA 4MJCA 2CX3A 1OE8A 4DVCA 4OFMA 5ECHB 1GSQA 2LNTA 3EMXA 2H66A 3J7Yk 1KTEA 2OJLA 1WWJA 1EOGA 2WRTA 3O6TA 2TRCP 1M99A 2X8GA 4PUAA 4GXZA 1KEBA 1TOFA 4KGIA 1EGOA 2F51A 4IJIA 4BPYA 4XTSA 3ED3A 3TJGA 3FZ4A 10GSA 3I69A 3TJBA 2HRFA 4F82A 1Z9HA 1TI3A 4MK3A 1SKWB 4YAPA 3CTFA 1H4OA 5CP1A 3D4TA 4MABA 3CXGA 5KN1A 1M2AA 4F2IA 1UN2A 1EEMA 2AB6A 2FUG2 3O3TA 4O7HA 3VK9A 5F07A 3VWWA 3IXRA 3GN3A 3TDGA 3WGDA 1PKZA 4IHUA 1VGLA 2PVOC 2IMKA 4YH2A 2GQLA 3KGKA 4N30A 2LJAA 3DMLA 3M8NA 1OC9B 3RHCA 3Q74A 4HOJA 3FY7A 4GLTA 3FZAA 2H0HA 1A8LA 4DEJA 4TXOA 1B8XA 1BYEA 3RPPA 2C8UA 4TR1B 3VLNA 4AJ6A 3GKKA 4ZL9A 4V2LA 1EOHA 5IOWA 5G1KA 3CMIA 2GZPA 1XVQA 1O81A 2C80A 5AGYA 3BBYA 1PKWA 4YAVA 3M9KA 4HDEA 2FA4A 2DSAA 1X5DA 3LJRA 2Z9SA 4AF2A 4HZ2A 4ZBAA 3D0ZA 1UA5A 4BWSA 2NDOA 3KP8A 4XRDA 5JCGA 2O8VB 3A2VA 2FD3A 4X43A 5F06A 6GSXA 1VRSD 3BJ5A 4KAEA 1PN9A 2HZEA 3ZVJD 1XW9A 1GLPA 3ZREA 4TOPA 4G19A 2YWNA 5GSTA 2MYGA 3EINA 3C1RA 3KIJA 1ZYEA 1TDIA 3E3EA 2DMLA 4WXTA 6GSWA 4IBPA 4I97A 1JHBA 2L57A 3GL3A 1EZKA 3UOMA 3LSZA 2RUFA 1AQXA 6GSSA 4XS4B 2PBJA 1M9BA 3TRXA 1A8YA 3UVTA 5ID2B 2VOCA 5LCZA 1AUCA 3CTGA 3DWVA 3ZL5A 3EWLA 3G9BA 3I9V2 1ZOFA 1GP1A 3KH7A 5IMDA 2V32A 2F9SA 4AJ7A 2LRNA 2QKEA 3ZLPA 4MF6A 1PX7A 2OE3A 2VL3A 4K2DA 5CRDA 1ERWA 5DJMA 4POLA 4F9ZA 4KW6A 5CO3A 4KSMA 5ECLB 1GSFA 4HEA2 3SBCA 1K3LA 2HNLA 1ILOA 2YPMA 1U88A 2HT9A 2IMIA 4MJEA 5ECNB 2YJ7A 2WGRA 5G5FA 2DJJA 4EDYA 1GSUA 1R5AA 2YWOA 3TGZA 2IWTA 4F0CA 5D9WA 1K0CA 4I6XA 3QFBC 3D5JA 4Q5FA 3F3RA 1X5CA 4MZCA 2NTOA 3GKMA 5DQSA 2H75A 2VCWA 1NW2A 4PNGA 1DSBA 3FKFA 4O92A 3UAPA 3U6VA 3LQ7A 1A2MA 1T1VA 1SJZA 4TW5A 1SL2B 2FNOA 2H6XA 3FEUA 1GTIA 1PL1A 2VCTA 4GQCA 2PERA 3F3QA 3ZMLA 4IS0A 1LU4A 1URMA 4ZL8A 3D21A 5KEJA 2B5EA 2H8LA 3QAVA 4G2EA 3L0HA 2HSHA 1EV4A 2X8HA 2VLUA 3GX8A 3Q18A 2PN8A 3MWHA 2EIRA 4FYUA 3QPMA 3QR6A 1W89A 2QGVA 1OC9A 2H73A 1XWCA 2PWJA 3GA4A 4EF0A 2CVDA 5D73A 1Y6EA 4TKYA 2A2RA 4QL9A 4MDCA 4PQHA 1XOAA 5JCWA 4WF4A 2YOIA 4QL7A 3QOUA 1YKAA 4MPGA 5H5QA 1SJ6A 5A4UA 2R37A 2VLTA 3L9UA 2DIZA 3EYTA 1XW5A 4GWRA 2AJQB 5IO0A 3UVHA 2L59A 4HU7A 3IE3A 4HQSA 5DALB 3D4MA 2YV9A 1X5EA 2LJKA 1AW9A 2XBIA 2TRXA 2O7KA 3EE2A 2F8AA 2RM6A 3N5OA 2WDUA 3FR3A 1HQOA 4I2UA 4K7IA 1GNEA 4PQ1A 1M2DA 4ZBBA 2A2SA 1LBKA 3IDVA 3KH9A 2P0GA 2K8VA 1JZWA 3DIEA 3KP9A 4KA0A 5J41A 1PX6A 3CSJA 3HZ8A 3V1WA 2YWMA 4WR4A 4POKA 3VPTA 1W4VA 2PUKC 2FWGA 1OKTA 3HY2A 1WIKA 3LXTA 1TW9A 1M9AA 1TK8B 4XS4A 2MMZA 4MZWA 5ID2A 1RQMA 3GUSA 4GSTA 4GTUA 1GSSA 3LXZA 2P31A 5JWQB 1YKCA 1JZOA 2KP1A 1AIUA 2F8FA 3TUEA 2GZYA 2YZUA 1TRSA 3AY8A 4JU5A 5ECOB 1H75A 1CQHA 1YDKA 4ZBDA 2VUPA 3DKSA 1YQ1A 3FK8A 20GSA 3O76A 3K8NA 2KP2A 4E8EA 2VAFA 3KMNA 2WZ9A 2LTKA 3HDCA 4J56E 2B1KA 1TU8A 1G0TA 1SYRA 3F63A 1GSYA 1YEXA 2H30A 4TR0A 4MH2A 5CREA 3EMPA 1PMTA 1UC7A 2VCVA 3FYGA 3ZTLA 2L5LA 1I9DA 3ZMKA 1O7UA 5DAKB 3TRQA 4LA1A 4IKHA 2CZ2A 3GRXA 1VF3A 5F8BA 2H1DA 1OVNA 5D8IA 2CX4A 2GQKA 1XFLA 4L8EA 1GULA 4G10A 2CZ3A 3TJJA 3HA9A 3IA1A 4EUYA 5J4UA 4E8HA 5CRWA 2JZTA 5G31A 1Z6NA 3GH9A 1AC1A 1TRVA 4OO5A 4JBBA 1GTBA 1E2YA 3VURA 4MJAA 4XCSA 1Y25A 3J7Yb 4EKZA 3LFLA 3IPZA 2AYTA 2PGTA 3R2QA 5DCHA 3FRCA 1PL2A 2XHFA 2IFQB 4YQUA 3UJ1A 4JR4A 4NPBA 2GVPA 1XPVA 4ZILA 1B4QA 1S3CA 4CDOA 2OBIA 1ABAA 1XZOA 1K0AA 3F0IA 3HCZA 1OC3A 1SK2A 1T4ZA 4RUVA 4V2NA 1SL0B 4XRAA 2VCXA 5J9CA 2B5XA 4KSOA 4OWYA 2GLRA 5D9VA 1K0OA 5ECMB 3TKRA 1ERUA 5KN2A 3G7JA 5KN0A 2V41A 4PQIA 1TU7A 3GNJA 2GDRA 3RAZA 2GT5A 3TB2A 1J0FA 4IP1A 3GX0A 3KM6A 3VWUA 4TXVA 4V1Ag 5DALA 2C0DA 2MZCA 2H01A 5E4WA 5ENUA 3NOFA 1U6TA 1T8EB 2R4VA 3LG6A 2XBQA 4ML6A 3H79A 3GL5A 3MNGA 4L0WA 1FVKA 2LKUA 1F3AA 4ML1A 1X0RA 3VI7A 2C0EA 3APOA 1ACVA 2XC2A 2GSTA 4WKWA 4GSSA 3EURA 4RQXA 3IBHA 4EO3A 1GTUA 2DIYA 4NMUA 2IIYA 4D73B 4ZL7A 1E6BA 1C72A 1GWCA 2H1BA 1X9WB 2NPBA 3IAS2 3D22A 4H86A 1ST9A 3UEMA 1K3OA 1T4YA 2B7KA 5D9TA 5GAND 2J9HA 1F2EA 1PSQA 3PH9A 2V6OA 4IP6A 4ZB6A 2GS3A 1GTAA 2OE1A 1SU9A 1GRXA 3IC4A 4MCUA 5HR0A 1HNAA 3DRNA 1K0DA 1ZMAA 3Q19A 2J23A 1WOUA 3EC3A 4G9HA 1O73A 4OCFA 4O32A 2L6DA 1SK0A 4KE3A 1HYUA 3GURA 2FCHA 2ON7A 4V2MA 2H0IA 2XPDA 1B48A 6GSUA 3QDNA 5LD0A 5IMCA 5DAKA 2CV4A 4N10A 3TJKA 3F8UA 1PGTA 2H1AA 5FT3A 2H72A 5CAXA 1Z3EA 4EVMA 1DE1A 5IOXA 3C71A 1XWBA 3GMFA 1F37A 1WRYA 2KUCA 2IMDA 1R26A 2K9FA 3KZQA 2WJUA 4EE0A 1GL8A 3GTUB 3VPQA 3S9FA 2L6CA 5B7CA 2ZNMA 1ZCPA 4MA9A 2JZSA 2G0FA 3M0FA 1JLVA 3WT1A 2IPAA 2C0GA 4JRRA 4WR5A 1YF1A 4OD7A 2GSSA 2GGTA 4Q5NA 1SD8A 4OMVA 4POMA 1ZL9A 2X99A 3L9VA 4ILFA 2DJ3A 2IFQA 2P5QA 2MBTA 4K0GA 1FHEA 4BVYA 1U3AA 4K9ZA 3I6AA 1XCCA 3F4TA 1WMJA 3C8EA 5JCUA 2LJRA 1U3IA 1MDKA 1ON4A 1XWKA 3P8WA 4QQ7A 1THXA 5F05A 1VF2A 5CRGA 4TVEA 1GSEA 5J9BA 1J08A 5ECIB 4ID0A 2EIOA 4L5OA 17GSA 4PNFA 1AAZA 3BCIA 2DJKA 3IOSA 6GSTA 5G5EA 7GSSA 5ABRA 3M3MA 3HJPA 3QCPA 3H8QA 1QFNA 2C1YA 1I5GA 2PPTA 3IV4A 2HSYA 4OCEA 5ELAA 3RDWA 4KCAA 3F4RA 3TKSE 1Z6MA 4IVFA 1VF4A 1AXDA 3MDKA 2KOKA 5D96A 1OKDA 5HFIA 5JWOB 4HUAA 2VM2A 3ZIJA 4FH8A 1OC8A 1N2AA 1JFUA 3E0UA 4PURA 2BJXA 3A2XA 4MJBA 3BOAA 1DUGA 3IRAA 3A3TA 3ZYWA 5DDLA 5DJLA 2H6ZA 4KCEA 4D73A 1T00A 1WP0A 5AIXA 1SKSB 2M72A 3HYPA 3TKSC 1WJKA 2V2GA 1BEDA 1PRXA 4XIHA 2ALBA 2MMOA 2REMA 2C3NA 1WE0A 3L4NA 3HVXA 1DE2A 3JCML 3DVXA 4JEDA 2O85A 5IIZA 2ES7A 1VF1A 4MP4A 2CVKA 1XXUA 4P3YB 1FB0A 1G7OA 2N5BA 3KTLA 1THOA 4XS1A 3UMAA 1G6YA 2MBSA 2RIIA 2LV3A 2HXKA 1XVWA 2FWEA 2PVQA 4JR6A 3DEXA 3RBTA 2JACA 11GSA 1R5PA 2HZFA 4ZXGA 3APQA 4GRFA 5B6NA 2GQMA 3GV1A 4DSSA 2FWHA 3FR9A 2DJ1A 5A4VA 4DSQA 3KXOA 1QXHA 1FW1A 2WB9A
chains in the Genus database with same CATH superfamily
1WPIA 1TTZA 4RQRA 2GT6A 4Z7XA 4KH7A 1M3JA 5ECQB 4EC0A 2KHPA 4JZQA 1O6JA 4NHWA 1SD9A 2YNXA 1TK0B 1G7EA 2VL2A 1Q98A 4K7NA 4WF5A 1M0UA 2GSQA 4X4JA 4LL1B 5LNKe 18GSA 1MD3A 2I4AA 3GTUA 3IAM2 2CA8A 3TRPA 5COHA 1GH2A 2HFDA 3UARA 4POBA 1R7HA 3CRUA 2A4VA 4BVXA 1JZRA 1MDIA 2NVLA 2DJ2A 2GZZA 3L78A 2LSTA 4WEYA 4LLRA 2H1GA 2O87A 4Z2UA 1TJDA 1JZDA 1XWGA 5IPHA 4NV5A 1M2BA 1FOHA 1UVZA 4AGSA 3OR5A 4MF5A 5IMZA 2KLXA 2V1MA 5IMAA 3GFKA 1OYJA 3M1GA 2L4CA 4FIWA 4G0IA 3H93A 2CAIA 2RUEA 2LQQA 3C7MA 4ISDA 2VCZA 2H74A 2O89A 4G0KA 4F0BA 3FZ5A 5C00A 4DSRA 2MMAA 5IPGA 4XS6A 3QFAC 2JU5A 2NBSA 2BTOT 5DVBA 1NHYA 4KUNA 3C73A 1YF0A 1PA3A 12GSA 1HNBA 3ME8A 1EP7A 4O5UA 5IM9A 4EDZA 1TI1A 2WULA 2E2MA 1FVJA 2L4QA 4MF7A 3HZ4A 4ECCA 1DBYA 4KF9A 3C1SA 3HD5A 1F9MA 1MDJA 3IHQA 4HZ4A 1EEJA 3TJFA 4J2FA 3A5WA 1BG5A 2UZ8A 3EU4A 3CBUA 5G2ZA 5A4WA 1XBSA 2YP6A 3FMWA 5J5NA 5FWGA 3G7IA 2VCQA 1GLQA 4KB3A 3GIXA 4TRXA 1EGRA 4IGJA 4ZB9A 6GSYA 3F9UA 1KNGA 1AQWA 1O8WA 2JZRA 2DLXA 2HYXA 3EU3A 3Q6OA 2FA8A 4GSNA 4BWQA 19GSA 3ERFA 4I8BA 4IELA 5IO2A 3ZFBA 2HRNA 2FWFA 2LS5A 2I3YA 1GUHA 1X9SB 2BMXA 2D2ZA 4MNNA 1CQGA 2JSZA 2I9HA 2WS2A 1AQVA 4WBJA 4FYBA 4MMMA 3M9JA 1T7PB 3FZ9A 3CSIA 3KTBA 1EP8A 2HI7A 5J3RA 4NAXA 3GSTA 4GCIA 1XG8A 2XPEA 2K8SA 4MPFA 4HS1A 2LQOA 1K0MA 3U5RE 2DBCA 3I43A 2WCIA 2LUSA 2QSIA 1B4PA 5CYYA 1GSDA 4IN0A 1QQ2A 2E2GA 2OA7A 3N9JA 1LJRA 4KDYA 8GSSA 5B8AA 3FW2A 5EPFA 2YJHA 3LORA 4PGTA 1HD2A 4N11A 3KEBA 5DBQA 1N8JA 1O8XA 4L5LA 4JE1A 3ZFLA 3RPNA 2WFCA 5G1LA 4IQ1A 4MLYA 1RW1A 5KN3A 3IK9A 2QC7A 2R6KA 3L9SA 4I5QA 2RM5A 3CSHA 4PX1A 1ZZYA 1GUMA 2X49A 1SL1B 3UBLA 2E0QA 4X0XA 3WYWA 5E59A 1GNWA 2HRAA 3TCOA 2QA2A 1S3RA 2L5OA 1XOBA 5HR2A 2LRCA 3QAWA 1EWXA 1XWAA 3ZVJA 2G2QA 5HQPA 2H76A 3WGEA 5CNWA 3VWVA 2B6MA 4EL1A 3F4SA 4HJ2A 6GSVA 4LMWA 3PINA 3DXBA 4I2TA 2YN1A 4YKGA 3LYKA 2IJYA 4G0LA 5AIVA 4DSSB 1QUWA 2IL3A 2IN3A 3ERGA 1FOVA 5IMVA 1TK5B 1NHOA 5HFGA 1IYHA 4K8MA 2PU9C 2I81A 4MH3A 1SK1A 5ECRB 5CRHA 1QK8A 4ULXA 2C4JA 1X9MB 2B3SA 2HSMA 2RLIA 4HQZA 2HE3A 3W6GA 4IQAA 1MTCA 1MEKA 3NIVA 5ECSA 2OE0A 1USBA 4K1FA 2N5FA 2FY6A 4Z2RA 2P5RA 4USSA 4CHSA 1GUKA 4OFTA 3H1NA 1V58A 2GSRA 4RI6A 5AISA 4XHMA 5L71A 5D9XA 4BL7B 3HXSA 2CVBA 4AJ8A 1JLWA 3TOTA 3DYRA 1TP9A 3GKXA 4K0NA 1A0FA 2AUVA 3MAKA 5DCGA 3PR8A 13GSA 1O85A 1SJIA 5GZZB 4ECIA 2YV7A 2LRTA 3QD9A 5C04A 1V57A 4Q5QA 4PXOA 14GSA 3ZIVA 2R0GA 3KMOA 4O5RA 3UIWA 4OFNA 4YKFA 1FB6A 3G7YA 3P7XA 2DJ0A 3APSA 1F6MC 3GYKA 2EIQA 4PTSA 2VD0A 3F6DA 5ELGA 2GTUA 1K3YA 3SWLA 1FAAA 4WETA 4ZB8A 4X1UA 4IJ3A 4LL4B 4TN8A 5HR3A 4ECJA 5ECPB 4ECBA 5A5KA 2B1LA 3US3A 2VL9A 4F03A 1F3BA 3DGQA 9GSSA 2EC4A 3ISOA 4K5RA 3P2AA 2R3XA 2H6YA 4K6XA 1T3BA 1TRUA 1K0NA 1M7TA 1XW6A 2VD1A 4HU9A 2FHEA 2FLSA 1V2AA 3ERWA 1NSWA 5EL8A 3TKSA 1Q4JA 3RHBA 1SENA 2PMTA 2HRKA 4YQVA 4TR3A 2A2PA 4IW9A 3GHAA 1R4WA 4KNDA 2YANA 3HJOA 1YJ6A 4N0ZA 5FHIA 2M46A 3A5IA 1FO5A 1QMVA 5F0GA 4TR1A 3LYPA 1S3DA 4RI7A 5HFKA 2H71A 1PQNA 3TKQA 4FYCA 3H4KA 2M80A 3TKPA 5EVOA 4ZIJA 2OADA 2VLVA 3UL3A 2AHEA 2ON5A 2CQ9A 2R5GA 1YEPA 4KDUA 5HR1A 4K5SA 2YZHA 1A2JA 3PGTA 3ZZXA 2X64A 1TRWA 3GSSA 22GSA 4J57E 4BA7A 3GKNA 2AAWA 2H0GA 2DKIA 2OACA 4MZBA 3GH6A 1BQ7A 3W8SA 3IC8A 4NHZA 2YCDA 3HVVA 1B9XC 1G6WA 4TR4A 4FQUA 3BD2A 2AV4A 4PUFC 1A24A 1BAYA 2ZCTA 2I1UA 2IMFA 2V6KA 3HJMA 5H5RA 2C3QA 2OBKA 1ZGNA 3IR4A 3EVIA 3VFIA 2C3TA 4OO4A 2F3MA 1HNCA 3IHGA 2LNSA 2N5AA 4TXOB 2K18A 5H5SA 3ME7A 1FG4A 4LMVA 1Z5YE 4GQFA 3E9JB 4KDXA 2CAQA 4YQMA 2OKAA 4N0VA 1YY7A 3A2WA 5EY6A 5IMFA 3CRTA 1ERTA 1M3IA 3F6FA 1Z7RA 2VIMA 4L0UA 2H19A 2VO4A 5JWRB 5KOXA 3IK7A 2K6VA 4ACSA 3DVWA 5G30A 1BX9A 3D6IA 5AN1A 4K7OA 3VI5A 1QGVA 1J9BA 2MMNA 5GSSA 3HVSA 3P90A 3WT2A 2FGXA 1IYIA 3WGXA 1PD21 3LEFA 1TKDB 2HLSA 3CYNA 1ML6A 2VL2C 2HZEB 2DC5A 1XIYA 2B5YA 5IQYA 1TXXA 4EXJA 3MSZA 4HI7A 3BCKA 3HHVA 1V98A 5GAPD 2E7PA 2JSYA 3LW9A 1SKRB 4HJMA 3VWXA 2C0FA 2B7JA 3FHKA 4V1Ap 2H70A 5D93A 4BL7A 3W8JA 1MD4A 4NWYA 4NV2A 4GF0A 3TOUA 3LWAA 3QMXA 1Z7PA 2ZUPA 4CW9A 1EV9A 3HKRA 3CQFA 2CT6A 3ZITA 2IMEA 1A0RP 2X8CA 5ECKB 2R2JA 3KCMA 3DD3A 1U87A 1ERVA 5B6MA 2LEGA 2VM1A 16GSA 3QAGA 4WBRD 5B8BA 1YZXA 2JL4A 4NXIA 2A4HA 1A23A 3UBKA 3NZNA 2DMMA 2JADA 5INYA 1K0BA 3KJYA 1ZYQB 1OE7A 1ZYNA 1SYXA 2YWIA 4FO5A 5DQYA 1A2LA 3R3EA 5BMUA 3WD6A 3ZRDA 1KBNA 2TIRA 1B9YC 1BJXA 1NM3A 1RK4A 4Q5RA 3LGCA 3FR6A 4KX4A 1V9WA 1S3AA 3KD0A 1V40A 1OAZA 4MJCA 2CX3A 1OE8A 4DVCA 4OFMA 5ECHB 1GSQA 2LNTA 3EMXA 2H66A 3J7Yk 1KTEA 2OJLA 1WWJA 1EOGA 2WRTA 3O6TA 2TRCP 1M99A 2X8GA 4PUAA 4GXZA 1KEBA 1TOFA 4KGIA 1EGOA 2F51A 4IJIA 4BPYA 4XTSA 3ED3A 3TJGA 3FZ4A 10GSA 3I69A 3TJBA 2HRFA 4F82A 1Z9HA 1TI3A 4MK3A 1SKWB 4YAPA 3CTFA 1H4OA 5CP1A 3D4TA 4MABA 3CXGA 5KN1A 1M2AA 4F2IA 1UN2A 1EEMA 2AB6A 2FUG2 3O3TA 4O7HA 3VK9A 5F07A 3VWWA 3IXRA 3GN3A 3TDGA 3WGDA 1PKZA 4IHUA 1VGLA 2PVOC 2IMKA 4YH2A 2GQLA 3KGKA 4N30A 2LJAA 3DMLA 3M8NA 1OC9B 3RHCA 3Q74A 4HOJA 3FY7A 4GLTA 3FZAA 4A5PA 2H0HA 1A8LA 4DEJA 4TXOA 1B8XA 1BYEA 3RPPA 2C8UA 4TR1B 3VLNA 4AJ6A 3GKKA 4ZL9A 4V2LA 1EOHA 5IOWA 5G1KA 3CMIA 2GZPA 1XVQA 1O81A 2C80A 5AGYA 3BBYA 1PKWA 4YAVA 3M9KA 4HDEA 2FA4A 2DSAA 1X5DA 3LJRA 2Z9SA 4AF2A 4HZ2A 4ZBAA 3D0ZA 1UA5A 4CY6A 4BWSA 4CY8A 2NDOA 3KP8A 4XRDA 5JCGA 2O8VB 3A2VA 2FD3A 4X43A 5F06A 6GSXA 1VRSD 3BJ5A 4KAEA 1PN9A 2HZEA 3ZVJD 1XW9A 1GLPA 3ZREA 4TOPA 4G19A 2YWNA 5GSTA 4Z2TA 2MYGA 3EINA 3C1RA 3KIJA 1ZYEA 1TDIA 3E3EA 2DMLA 4WXTA 6GSWA 4IBPA 4I97A 1JHBA 2L57A 3GL3A 4EIPA 1EZKA 3UOMA 3LSZA 2RUFA 1AQXA 6GSSA 4XS4B 2PBJA 1M9BA 3TRXA 1A8YA 3UVTA 5ID2B 2VOCA 5LCZA 1AUCA 3CTGA 3DWVA 3ZL5A 3EWLA 3G9BA 3I9V2 1ZOFA 1GP1A 3KH7A 5IMDA 2V32A 2F9SA 4AJ7A 2LRNA 2QKEA 3ZLPA 4MF6A 1PX7A 2OE3A 2VL3A 4K2DA 5CRDA 1ERWA 5DJMA 4POLA 4F9ZA 4KW6A 5CO3A 4KSMA 5ECLB 1GSFA 4HEA2 3SBCA 1K3LA 2HNLA 1ILOA 2YPMA 1U88A 2HT9A 2IMIA 4MJEA 5ECNB 2YJ7A 2WGRA 5G5FA 2DJJA 4EDYA 1GSUA 1R5AA 2YWOA 3TGZA 2IWTA 4F0CA 5D9WA 1K0CA 4I6XA 3QFBC 3D5JA 4Q5FA 3F3RA 1X5CA 4MZCA 2NTOA 3GKMA 5DQSA 2H75A 2VCWA 1NW2A 4PNGA 1DSBA 3FKFA 4O92A 3UAPA 3U6VA 3LQ7A 1A2MA 1T1VA 1SJZA 4TW5A 1SL2B 2FNOA 2H6XA 3FEUA 1GTIA 1PL1A 2VCTA 4GQCA 2PERA 3F3QA 3ZMLA 4IS0A 1LU4A 1URMA 4ZL8A 3D21A 5KEJA 2B5EA 2H8LA 3MYDA 3QAVA 4G2EA 3L0HA 2HSHA 1EV4A 2X8HA 2VLUA 3GX8A 3Q18A 2PN8A 3MWHA 2EIRA 4FYUA 3QPMA 3QR6A 1W89A 2QGVA 1OC9A 2H73A 1XWCA 2PWJA 3GA4A 4EF0A 2CVDA 5D73A 1Y6EA 4TKYA 2A2RA 4QL9A 4MDCA 4PQHA 1XOAA 5JCWA 4WF4A 2YOIA 4QL7A 3QOUA 1YKAA 4MPGA 5H5QA 1SJ6A 5A4UA 2R37A 2VLTA 3L9UA 2DIZA 3EYTA 2QA1A 1XW5A 4GWRA 2AJQB 5IO0A 3UVHA 2L59A 4HU7A 1PFOA 3IE3A 4HQSA 5DALB 5KOWA 3D4MA 2YV9A 1X5EA 2LJKA 1AW9A 2XBIA 2TRXA 2O7KA 3EE2A 2F8AA 2RM6A 3N5OA 2WDUA 3FR3A 1HQOA 4I2UA 4K7IA 1GNEA 4PQ1A 1M2DA 4ZBBA 2A2SA 1LBKA 3IDVA 3KH9A 2P0GA 2K8VA 1JZWA 3DIEA 3MIXA 3KP9A 4KA0A 5J41A 1PX6A 3CSJA 3HZ8A 3V1WA 2YWMA 4WR4A 4POKA 3VPTA 1W4VA 2PUKC 2FWGA 1OKTA 3HY2A 1WIKA 3LXTA 4EIQA 1TW9A 1M9AA 1TK8B 4XS4A 2MMZA 4MZWA 5ID2A 1RQMA 3GUSA 4GSTA 4GTUA 1GSSA 3LXZA 2P31A 5JWQB 1YKCA 1JZOA 2KP1A 4O5QA 1AIUA 2F8FA 3TUEA 2GZYA 2YZUA 1TRSA 3AY8A 4JU5A 5ECOB 1H75A 1CQHA 1YDKA 4ZBDA 2VUPA 3DKSA 1YQ1A 3FK8A 20GSA 3O76A 3K8NA 2KP2A 4E8EA 2VAFA 3KMNA 2WZ9A 2LTKA 3HDCA 3HVNA 4J56E 2B1KA 1TU8A 1G0TA 1SYRA 3F63A 1GSYA 1YEXA 2H30A 4TR0A 4MH2A 5CREA 3EMPA 1PMTA 1UC7A 2VCVA 3FYGA 3ZTLA 2L5LA 1I9DA 3ZMKA 1O7UA 5DAKB 3TRQA 4LA1A 4IKHA 2CZ2A 3GRXA 1VF3A 5F8BA 2H1DA 1OVNA 5D8IA 2CX4A 2GQKA 1XFLA 4L8EA 1GULA 4G10A 2CZ3A 3TJJA 3HA9A 3IA1A 4EUYA 5J4UA 4E8HA 5CRWA 2JZTA 5G31A 1Z6NA 3GH9A 1AC1A 1TRVA 4OO5A 4JBBA 1GTBA 1E2YA 3VURA 4MJAA 4XCSA 1Y25A 3J7Yb 4EKZA 3LFLA 3IPZA 2AYTA 2PGTA 3R2QA 5DCHA 3FRCA 1PL2A 2XHFA 2IFQB 4YQUA 3UJ1A 4JR4A 4NPBA 4BVYB 2GVPA 1XPVA 4BIKA 4ZILA 1B4QA 1S3CA 4CDOA 2OBIA 1ABAA 1XZOA 1K0AA 3F0IA 3HCZA 1OC3A 2R0CA 1SK2A 1T4ZA 4RUVA 4V2NA 1SL0B 4XRAA 2VCXA 5J9CA 2B5XA 4KSOA 4OWYA 2GLRA 5D9VA 1K0OA 5ECMB 3TKRA 1ERUA 5KN2A 3G7JA 5KN0A 2V41A 4PQIA 1TU7A 3GNJA 2GDRA 3RAZA 2GT5A 3TB2A 1J0FA 4IP1A 3GX0A 2R0PA 3KM6A 3VWUA 4TXVA 4V1Ag 5DALA 2C0DA 2MZCA 2H01A 5E4WA 5ENUA 3NOFA 1U6TA 1T8EB 2R4VA 3LG6A 2XBQA 4ML6A 3H79A 3GL5A 3MNGA 1ZYPA 4L0WA 1FVKA 2LKUA 1F3AA 4ML1A 1X0RA 3VI7A 2C0EA 3APOA 1ACVA 2XC2A 2GSTA 4WKWA 3EPTA 3EURA 4GSSA 4RQXA 3IBHA 4EO3A 1GTUA 2DIYA 4NMUA 2IIYA 4D73B 4ZL7A 1E6BA 1C72A 1GWCA 2H1BA 1X9WB 2NPBA 3IAS2 3D22A 4H86A 1ST9A 3UEMA 1K3OA 1T4YA 2B7KA 5D9TA 5GAND 2J9HA 1F2EA 1PSQA 3PH9A 2V6OA 4IP6A 4ZB6A 2GS3A 1GTAA 2OE1A 1SU9A 1GRXA 3IC4A 4MCUA 5HR0A 1HNAA 3DRNA 1K0DA 1ZMAA 3Q19A 2J23A 1WOUA 3EC3A 4G9HA 1O73A 4OCFA 4O32A 2L6DA 1SK0A 4KE3A 1HYUA 3GURA 2FCHA 2ON7A 4V2MA 2H0IA 2XPDA 1B48A 6GSUA 3QDNA 5LD0A 5IMCA 5DAKA 2CV4A 4N10A 3TJKA 3F8UA 1PGTA 2H1AA 5FT3A 2H72A 5CAXA 1Z3EA 4EVMA 1DE1A 5IOXA 3C71A 1XWBA 3GMFA 1F37A 1WRYA 2KUCA 2IMDA 1R26A 2K9FA 3KZQA 2WJUA 4EE0A 1GL8A 3GTUB 3VPQA 3S9FA 2L6CA 5B7CA 2ZNMA 1ZCPA 4MA9A 2JZSA 2G0FA 3M0FA 4BVXB 1JLVA 3WT1A 2IPAA 2C0GA 4JRRA 4WR5A 1YF1A 4OD7A 2GSSA 2GGTA 4Q5NA 1SD8A 4OMVA 4POMA 1ZL9A 2X99A 3L9VA 4ILFA 2DJ3A 2IFQA 2P5QA 2MBTA 4K0GA 1FHEA 4BVYA 1U3AA 4K9ZA 3I6AA 1XCCA 3F4TA 1WMJA 3C8EA 5JCUA 2LJRA 1U3IA 1MDKA 5BRTA 1ON4A 1XWKA 3P8WA 4QQ7A 1THXA 5F05A 1VF2A 5CRGA 4TVEA 1GSEA 5J9BA 1J08A 5ECIB 4ID0A 2EIOA 4L5OA 17GSA 4PNFA 1AAZA 3BCIA 3PPUA 2DJKA 3IOSA 6GSTA 5G5EA 7GSSA 5ABRA 2DKHA 3M3MA 3HJPA 3QCPA 3H8QA 1QFNA 2C1YA 1I5GA 2PPTA 3IV4A 2HSYA 4OCEA 5ELAA 3RDWA 4KCAA 3F4RA 3TKSE 1Z6MA 4IVFA 1VF4A 1AXDA 3MDKA 2X4AA 2KOKA 5D96A 1OKDA 5HFIA 5JWOB 4HUAA 2VM2A 3ZIJA 4FH8A 1OC8A 1N2AA 1JFUA 3E0UA 4PURA 2BJXA 3A2XA 4MJBA 3BOAA 1DUGA 3IRAA 3A3TA 3ZYWA 5DDLA 5DJLA 2H6ZA 4KCEA 4D73A 1T00A 1WP0A 5AIXA 1SKSB 2M72A 4ICYA 3HYPA 3TKSC 1WJKA 2V2GA 1BEDA 1PRXA 4XIHA 2ALBA 2MMOA 2REMA 2C3NA 1WE0A 3L4NA 3HVXA 1DE2A 3JCML 3DVXA 4JEDA 2O85A 5IIZA 2ES7A 1VF1A 4MP4A 2CVKA 1XXUA 4P3YB 1FB0A 1G7OA 2N5BA 1PN0A 3KTLA 1THOA 4XS1A 3UMAA 4HSCX 1G6YA 2MBSA 2RIIA 2LV3A 2HXKA 1XVWA 2FWEA 2PVQA 4JR6A 3DEXA 3RBTA 2JACA 11GSA 1R5PA 2HZFA 4ZXGA 3APQA 4GRFA 5B6NA 2GQMA 3GV1A 4K2XA 4DSSA 2FWHA 3FR9A 2DJ1A 5A4VA 4DSQA 3KXOA 1QXHA 1FW1A 2WB9A
chains in the Genus database with same CATH topology
1WPIA 1TTZA 4RQRA 2GT6A 4Z7XA 4KH7A 5ECQB 4EC0A 2KHPA 4JZQA 1O6JA 4NHWA 1SD9A 2YNXA 1TK0B 1G7EA 2VL2A 1Q98A 4K7NA 4WF5A 1M0UA 2GSQA 4X4JA 4LL1B 5LNKe 18GSA 1MD3A 2I4AA 3GTUA 3IAM2 2CA8A 3TRPA 5COHA 1GH2A 2HFDA 3UARA 4POBA 1R7HA 3CRUA 2A4VA 4BVXA 1JZRA 1MDIA 2NVLA 2DJ2A 2GZZA 3L78A 2LSTA 4WEYA 4LLRA 2H1GA 2O87A 4Z2UA 1TJDA 1JZDA 1XWGA 5IPHA 4NV5A 1M2BA 1FOHA 1UVZA 4AGSA 3OR5A 4MF5A 5IMZA 2KLXA 2V1MA 5IMAA 3GFKA 1OYJA 3M1GA 2L4CA 4FIWA 4G0IA 3H93A 2CAIA 2RUEA 2LQQA 3C7MA 4ISDA 2VCZA 2H74A 2O89A 4G0KA 4F0BA 3FZ5A 5C00A 4DSRA 2MMAA 5IPGA 4XS6A 3QFAC 2JU5A 2NBSA 2BTOT 5DVBA 1NHYA 4KUNA 3C73A 1YF0A 1PA3A 12GSA 1HNBA 3ME8A 1EP7A 4O5UA 5IM9A 4EDZA 1TI1A 2WULA 2E2MA 1FVJA 2L4QA 4MF7A 3HZ4A 4ECCA 1DBYA 4KF9A 3C1SA 3HD5A 1F9MA 1MDJA 3IHQA 4HZ4A 1EEJA 3TJFA 4J2FA 3A5WA 1BG5A 2UZ8A 3EU4A 3CBUA 5G2ZA 5A4WA 1XBSA 2YP6A 3FMWA 5J5NA 5FWGA 3G7IA 2VCQA 1GLQA 4KB3A 3GIXA 4TRXA 1EGRA 4IGJA 4ZB9A 6GSYA 3F9UA 1KNGA 1AQWA 1O8WA 2JZRA 2DLXA 2HYXA 3EU3A 3Q6OA 2FA8A 4GSNA 4BWQA 19GSA 3ERFA 4I8BA 4IELA 5IO2A 3ZFBA 2HRNA 2FWFA 2LS5A 2I3YA 1GUHA 1X9SB 2BMXA 2D2ZA 4MNNA 1CQGA 2JSZA 2I9HA 2WS2A 1AQVA 4WBJA 4FYBA 4MMMA 3M9JA 1T7PB 3FZ9A 3CSIA 3KTBA 1EP8A 2HI7A 5J3RA 4NAXA 3GSTA 4GCIA 2XPEA 2K8SA 4MPFA 4HS1A 2LQOA 1K0MA 3U5RE 2DBCA 3I43A 2WCIA 2LUSA 2QSIA 1B4PA 5CYYA 1GSDA 4IN0A 1QQ2A 2E2GA 2OA7A 3N9JA 1LJRA 4KDYA 8GSSA 5B8AA 3FW2A 5EPFA 2YJHA 3LORA 4PGTA 1HD2A 4N11A 3KEBA 5DBQA 1N8JA 1O8XA 4L5LA 4JE1A 3ZFLA 3RPNA 2WFCA 5G1LA 4IQ1A 4MLYA 1RW1A 5KN3A 3IK9A 2QC7A 2R6KA 3L9SA 4I5QA 2RM5A 3CSHA 4PX1A 1ZZYA 1GUMA 2X49A 1SL1B 3UBLA 2E0QA 4X0XA 3WYWA 5E59A 1GNWA 2HRAA 3TCOA 2QA2A 2L5OA 1XOBA 5HR2A 2LRCA 3QAWA 1EWXA 1XWAA 3ZVJA 2G2QA 5HQPA 2H76A 3WGEA 5CNWA 3VWVA 2B6MA 4EL1A 3F4SA 4HJ2A 6GSVA 4LMWA 3PINA 3DXBA 4I2TA 2YN1A 4YKGA 3LYKA 2IJYA 4G0LA 5AIVA 4DSSB 1QUWA 2IL3A 2IN3A 3ERGA 1FOVA 5IMVA 1TK5B 1NHOA 5HFGA 1IYHA 4K8MA 2PU9C 2I81A 4MH3A 1SK1A 5ECRB 5CRHA 1QK8A 4ULXA 2C4JA 1X9MB 2B3SA 2HSMA 2RLIA 4HQZA 2HE3A 3W6GA 4IQAA 1MTCA 1MEKA 3NIVA 5ECSA 2OE0A 1USBA 4K1FA 2N5FA 2FY6A 4Z2RA 2P5RA 4USSA 4CHSA 1GUKA 4OFTA 3H1NA 1V58A 2GSRA 4RI6A 5AISA 4XHMA 5L71A 5D9XA 4BL7B 3HXSA 2CVBA 4AJ8A 1JLWA 3TOTA 3DYRA 1TP9A 3GKXA 4K0NA 1A0FA 2AUVA 3MAKA 5DCGA 3PR8A 13GSA 1O85A 1SJIA 5GZZB 4ECIA 2YV7A 2LRTA 3QD9A 5C04A 1V57A 4Q5QA 4PXOA 14GSA 3ZIVA 2R0GA 3KMOA 4O5RA 3UIWA 4OFNA 4YKFA 1FB6A 3G7YA 3P7XA 2DJ0A 3APSA 1F6MC 3GYKA 2EIQA 4PTSA 2VD0A 3F6DA 5ELGA 2GTUA 1K3YA 3SWLA 1FAAA 4WETA 4ZB8A 4X1UA 4IJ3A 4LL4B 4TN8A 5HR3A 4ECJA 5ECPB 4ECBA 5A5KA 2B1LA 3US3A 2VL9A 4F03A 1F3BA 3DGQA 9GSSA 2EC4A 3ISOA 4K5RA 3P2AA 2R3XA 2H6YA 4K6XA 1T3BA 1TRUA 1K0NA 1M7TA 1XW6A 2VD1A 4HU9A 2FHEA 2FLSA 1V2AA 3ERWA 1NSWA 5EL8A 3TKSA 1Q4JA 3RHBA 1SENA 2PMTA 2HRKA 4YQVA 4TR3A 2A2PA 4IW9A 3GHAA 1R4WA 4KNDA 2YANA 3HJOA 1YJ6A 4N0ZA 5FHIA 2M46A 3A5IA 1FO5A 1QMVA 5F0GA 4TR1A 3LYPA 1S3DA 4RI7A 5HFKA 2H71A 1PQNA 3TKQA 4FYCA 3H4KA 2M80A 3TKPA 5EVOA 4ZIJA 2OADA 2VLVA 3UL3A 2AHEA 2ON5A 2CQ9A 2R5GA 1YEPA 4KDUA 5HR1A 4K5SA 2YZHA 1A2JA 3PGTA 3ZZXA 2X64A 1TRWA 3GSSA 22GSA 4J57E 4BA7A 3GKNA 2AAWA 2H0GA 2DKIA 2OACA 4MZBA 3GH6A 1BQ7A 3W8SA 3IC8A 4NHZA 2YCDA 3HVVA 1B9XC 1G6WA 4TR4A 4FQUA 3BD2A 2AV4A 4PUFC 1A24A 1BAYA 2ZCTA 2I1UA 2IMFA 2V6KA 3HJMA 5H5RA 2C3QA 2OBKA 1ZGNA 3IR4A 3EVIA 3VFIA 2C3TA 4OO4A 2F3MA 1HNCA 3IHGA 2LNSA 2N5AA 4TXOB 2K18A 5H5SA 3ME7A 1FG4A 4LMVA 1Z5YE 4GQFA 3E9JB 4KDXA 2CAQA 4YQMA 2OKAA 4N0VA 1YY7A 3A2WA 5EY6A 5IMFA 3CRTA 1ERTA 3F6FA 1Z7RA 2VIMA 4L0UA 2H19A 2VO4A 5JWRB 5KOXA 3IK7A 2K6VA 4ACSA 3DVWA 5G30A 1BX9A 3D6IA 5AN1A 4K7OA 3VI5A 1QGVA 1J9BA 2MMNA 5GSSA 3HVSA 3P90A 3WT2A 2FGXA 1IYIA 3WGXA 1PD21 3LEFA 1TKDB 2HLSA 3CYNA 1ML6A 2VL2C 2HZEB 2DC5A 1XIYA 2B5YA 5IQYA 1TXXA 4EXJA 3MSZA 4HI7A 3BCKA 3HHVA 1V98A 5GAPD 2E7PA 2JSYA 3LW9A 1SKRB 4HJMA 3VWXA 2C0FA 2B7JA 3FHKA 4V1Ap 2H70A 5D93A 4BL7A 3W8JA 1MD4A 4NWYA 4NV2A 4GF0A 3TOUA 3LWAA 3QMXA 1Z7PA 2ZUPA 4CW9A 1EV9A 3HKRA 2CT6A 3ZITA 2IMEA 1A0RP 2X8CA 5ECKB 2R2JA 3KCMA 3DD3A 1U87A 1ERVA 5B6MA 2LEGA 2VM1A 16GSA 3QAGA 4WBRD 5B8BA 1YZXA 2JL4A 4NXIA 2A4HA 1A23A 3UBKA 3NZNA 2DMMA 2JADA 5INYA 1K0BA 3KJYA 1ZYQB 1OE7A 1ZYNA 1SYXA 2YWIA 4FO5A 5DQYA 1A2LA 3R3EA 5BMUA 3WD6A 3ZRDA 1KBNA 2TIRA 1B9YC 1BJXA 1NM3A 1RK4A 4Q5RA 3LGCA 3FR6A 4KX4A 1V9WA 1S3AA 3KD0A 1V40A 1OAZA 4MJCA 2CX3A 1OE8A 4DVCA 4OFMA 5ECHB 1GSQA 2LNTA 3EMXA 2H66A 3J7Yk 1KTEA 2OJLA 1WWJA 1EOGA 2WRTA 3O6TA 2TRCP 1M99A 2X8GA 4PUAA 4GXZA 1KEBA 1TOFA 4KGIA 1EGOA 2F51A 4IJIA 4BPYA 4XTSA 3ED3A 3TJGA 3FZ4A 10GSA 3I69A 3TJBA 2HRFA 4F82A 1Z9HA 1TI3A 4MK3A 1SKWB 4YAPA 3CTFA 1H4OA 5CP1A 3D4TA 4MABA 3CXGA 5KN1A 1M2AA 4F2IA 1UN2A 1EEMA 2AB6A 2FUG2 3O3TA 4O7HA 3VK9A 5F07A 3VWWA 3IXRA 3GN3A 3TDGA 3WGDA 1PKZA 4IHUA 1VGLA 2PVOC 2IMKA 4YH2A 2GQLA 3KGKA 4N30A 2LJAA 3DMLA 3M8NA 1OC9B 3RHCA 3Q74A 4HOJA 3FY7A 4GLTA 3FZAA 4A5PA 2H0HA 1A8LA 4DEJA 4TXOA 1B8XA 1BYEA 3RPPA 2C8UA 4TR1B 3VLNA 4AJ6A 3GKKA 4ZL9A 4V2LA 1EOHA 5IOWA 5G1KA 3CMIA 2GZPA 1XVQA 1O81A 2C80A 5AGYA 3BBYA 1PKWA 4YAVA 3M9KA 4HDEA 2FA4A 2DSAA 1X5DA 3LJRA 2Z9SA 4AF2A 4HZ2A 4ZBAA 3D0ZA 1UA5A 4CY6A 4BWSA 4CY8A 2NDOA 3KP8A 4XRDA 5JCGA 2O8VB 3A2VA 2FD3A 4X43A 5F06A 6GSXA 1VRSD 3BJ5A 4KAEA 1PN9A 2HZEA 3ZVJD 1XW9A 1GLPA 3ZREA 4TOPA 4G19A 2YWNA 5GSTA 4Z2TA 2MYGA 3EINA 3C1RA 3KIJA 1ZYEA 1TDIA 3E3EA 2DMLA 4WXTA 6GSWA 4IBPA 4I97A 1JHBA 2L57A 3GL3A 4EIPA 1EZKA 3UOMA 3LSZA 2RUFA 1AQXA 6GSSA 4XS4B 2PBJA 1M9BA 3TRXA 1A8YA 3UVTA 5ID2B 2VOCA 5LCZA 1AUCA 3CTGA 3DWVA 3ZL5A 3EWLA 3G9BA 3I9V2 1ZOFA 1GP1A 3KH7A 5IMDA 2V32A 2F9SA 4AJ7A 2LRNA 2QKEA 3ZLPA 4MF6A 1PX7A 2OE3A 2VL3A 4K2DA 5CRDA 1ERWA 5DJMA 4POLA 4F9ZA 4KW6A 5CO3A 4KSMA 5ECLB 1GSFA 4HEA2 3SBCA 1K3LA 2HNLA 1ILOA 2YPMA 1U88A 2HT9A 2IMIA 4MJEA 5ECNB 2YJ7A 2WGRA 5G5FA 2DJJA 4EDYA 1GSUA 1R5AA 2YWOA 3TGZA 2IWTA 4F0CA 5D9WA 1K0CA 4I6XA 3QFBC 3D5JA 4Q5FA 3F3RA 1X5CA 4MZCA 2NTOA 3GKMA 5DQSA 2H75A 2VCWA 1NW2A 4PNGA 1DSBA 3FKFA 4O92A 3UAPA 3U6VA 3LQ7A 1A2MA 1T1VA 1SJZA 4TW5A 1SL2B 2FNOA 2H6XA 3FEUA 1GTIA 1PL1A 2VCTA 4GQCA 2PERA 3F3QA 3ZMLA 4IS0A 1LU4A 1URMA 4ZL8A 3D21A 5KEJA 2B5EA 2H8LA 3MYDA 3QAVA 4G2EA 3L0HA 2HSHA 1EV4A 2X8HA 2VLUA 3GX8A 3Q18A 2PN8A 3MWHA 2EIRA 4FYUA 3QPMA 3QR6A 1W89A 2QGVA 1OC9A 2H73A 1XWCA 2PWJA 3GA4A 4EF0A 2CVDA 5D73A 1Y6EA 4TKYA 2A2RA 4QL9A 4MDCA 4PQHA 1XOAA 5JCWA 4WF4A 2YOIA 4QL7A 3QOUA 1YKAA 4MPGA 5H5QA 1SJ6A 5A4UA 2R37A 2VLTA 3L9UA 2DIZA 3EYTA 2QA1A 1XW5A 4GWRA 2AJQB 5IO0A 3UVHA 2L59A 4HU7A 3IE3A 4HQSA 5DALB 5KOWA 3D4MA 2YV9A 1X5EA 2LJKA 1AW9A 2XBIA 2TRXA 2O7KA 3EE2A 2F8AA 2RM6A 3N5OA 2WDUA 3FR3A 1HQOA 4I2UA 4K7IA 1GNEA 4PQ1A 1M2DA 4ZBBA 2A2SA 1LBKA 3IDVA 3KH9A 2P0GA 2K8VA 1JZWA 3DIEA 3MIXA 3KP9A 4KA0A 5J41A 1PX6A 3CSJA 3HZ8A 3V1WA 2YWMA 4WR4A 4POKA 3VPTA 1W4VA 2PUKC 2FWGA 1OKTA 3HY2A 1WIKA 3LXTA 4EIQA 1TW9A 1M9AA 1TK8B 4XS4A 2MMZA 4MZWA 5ID2A 1RQMA 3GUSA 4GSTA 4GTUA 1GSSA 3LXZA 2P31A 5JWQB 1YKCA 1JZOA 2KP1A 4O5QA 1AIUA 2F8FA 3TUEA 2GZYA 2YZUA 1TRSA 3AY8A 4JU5A 5ECOB 1H75A 1CQHA 1YDKA 4ZBDA 2VUPA 3DKSA 1YQ1A 3FK8A 20GSA 3O76A 3K8NA 2KP2A 4E8EA 2VAFA 3KMNA 2WZ9A 2LTKA 3HDCA 4J56E 2B1KA 1TU8A 1G0TA 1SYRA 3F63A 1GSYA 1YEXA 2H30A 4TR0A 4MH2A 5CREA 3EMPA 1PMTA 1UC7A 2VCVA 3FYGA 3ZTLA 2L5LA 1I9DA 3ZMKA 1O7UA 5DAKB 3TRQA 4LA1A 4IKHA 2CZ2A 3GRXA 1VF3A 5F8BA 2H1DA 1OVNA 5D8IA 2CX4A 2GQKA 1XFLA 4L8EA 1GULA 4G10A 2CZ3A 3TJJA 3HA9A 3IA1A 4EUYA 5J4UA 4E8HA 5CRWA 2JZTA 5G31A 1Z6NA 3GH9A 1AC1A 1TRVA 4OO5A 4JBBA 1GTBA 1E2YA 3VURA 4MJAA 4XCSA 1Y25A 3J7Yb 4EKZA 3LFLA 3IPZA 2AYTA 2PGTA 3R2QA 5DCHA 3FRCA 1PL2A 2XHFA 2IFQB 4YQUA 3UJ1A 4JR4A 4NPBA 4BVYB 2GVPA 1XPVA 4ZILA 1B4QA 1S3CA 4CDOA 2OBIA 1ABAA 1XZOA 1K0AA 3F0IA 3HCZA 1OC3A 2R0CA 1SK2A 1T4ZA 4RUVA 4V2NA 1SL0B 4XRAA 2VCXA 5J9CA 2B5XA 4KSOA 4OWYA 2GLRA 5D9VA 1K0OA 5ECMB 3TKRA 1ERUA 5KN2A 3G7JA 5KN0A 2V41A 4PQIA 1TU7A 3GNJA 2GDRA 3RAZA 2GT5A 3TB2A 1J0FA 4IP1A 3GX0A 2R0PA 3KM6A 3VWUA 4TXVA 4V1Ag 5DALA 2C0DA 2MZCA 2H01A 5E4WA 5ENUA 3NOFA 1U6TA 1T8EB 2R4VA 3LG6A 2XBQA 4ML6A 3H79A 3GL5A 3MNGA 1ZYPA 4L0WA 1FVKA 2LKUA 1F3AA 4ML1A 1X0RA 3VI7A 2C0EA 3APOA 1ACVA 2XC2A 2GSTA 4WKWA 3EPTA 3EURA 4GSSA 4RQXA 3IBHA 4EO3A 1GTUA 2DIYA 4NMUA 2IIYA 4D73B 4ZL7A 1E6BA 1C72A 1GWCA 2H1BA 1X9WB 2NPBA 3IAS2 3D22A 4H86A 1ST9A 3UEMA 1K3OA 1T4YA 2B7KA 5D9TA 5GAND 2J9HA 1F2EA 1PSQA 3PH9A 2V6OA 4IP6A 4ZB6A 2GS3A 1GTAA 2OE1A 1SU9A 1GRXA 3IC4A 4MCUA 5HR0A 1HNAA 3DRNA 1K0DA 1ZMAA 3Q19A 2J23A 1WOUA 3EC3A 4G9HA 1O73A 4OCFA 4O32A 2L6DA 1SK0A 4KE3A 1HYUA 3GURA 2FCHA 2ON7A 4V2MA 2H0IA 2XPDA 1B48A 6GSUA 3QDNA 5LD0A 5IMCA 5DAKA 2CV4A 4N10A 3TJKA 3F8UA 1PGTA 2H1AA 5FT3A 2H72A 5CAXA 1Z3EA 4EVMA 1DE1A 5IOXA 3C71A 1XWBA 3GMFA 1F37A 1WRYA 2KUCA 2IMDA 1R26A 2K9FA 3KZQA 2WJUA 4EE0A 1GL8A 3GTUB 3VPQA 3S9FA 2L6CA 5B7CA 2ZNMA 1ZCPA 4MA9A 2JZSA 2G0FA 3M0FA 4BVXB 1JLVA 3WT1A 2IPAA 2C0GA 4JRRA 4WR5A 1YF1A 4OD7A 2GSSA 2GGTA 4Q5NA 1SD8A 4OMVA 4POMA 1ZL9A 2X99A 3L9VA 4ILFA 2DJ3A 2IFQA 2P5QA 2MBTA 4K0GA 1FHEA 4BVYA 1U3AA 4K9ZA 3I6AA 1XCCA 3F4TA 1WMJA 3C8EA 5JCUA 2LJRA 1U3IA 1MDKA 5BRTA 1ON4A 1XWKA 3P8WA 4QQ7A 1THXA 5F05A 1VF2A 5CRGA 4TVEA 1GSEA 5J9BA 1J08A 5ECIB 4ID0A 2EIOA 4L5OA 17GSA 4PNFA 1AAZA 3BCIA 3PPUA 2DJKA 3IOSA 6GSTA 5G5EA 7GSSA 5ABRA 2DKHA 3M3MA 3HJPA 3QCPA 3H8QA 1QFNA 2C1YA 1I5GA 2PPTA 3IV4A 2HSYA 4OCEA 5ELAA 3RDWA 4KCAA 3F4RA 3TKSE 1Z6MA 4IVFA 1VF4A 1AXDA 3MDKA 2X4AA 2KOKA 5D96A 1OKDA 5HFIA 5JWOB 4HUAA 2VM2A 3ZIJA 4FH8A 1OC8A 1N2AA 1JFUA 3E0UA 4PURA 2BJXA 3A2XA 4MJBA 3BOAA 1DUGA 3IRAA 3A3TA 3ZYWA 5DDLA 5DJLA 2H6ZA 4KCEA 4D73A 1T00A 1WP0A 5AIXA 1SKSB 2M72A 4ICYA 3HYPA 3TKSC 1WJKA 2V2GA 1BEDA 1PRXA 4XIHA 2ALBA 2MMOA 2REMA 2C3NA 1WE0A 3L4NA 3HVXA 1DE2A 3JCML 3DVXA 4JEDA 2O85A 5IIZA 2ES7A 1VF1A 4MP4A 2CVKA 1XXUA 4P3YB 1FB0A 1G7OA 2N5BA 1PN0A 3KTLA 1THOA 4XS1A 3UMAA 1G6YA 2MBSA 2RIIA 2LV3A 2HXKA 1XVWA 2FWEA 2PVQA 4JR6A 3DEXA 3RBTA 2JACA 11GSA 1R5PA 2HZFA 4ZXGA 3APQA 4GRFA 5B6NA 2GQMA 3GV1A 4K2XA 4DSSA 2FWHA 3FR9A 2DJ1A 5A4VA 4DSQA 3KXOA 1QXHA 1FW1A 2WB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPI A;  1TTZ A;  4RQR A;  2GT6 A;  4Z7X A;  4KH7 A;  5ECQ B;  4EC0 A;  2KHP A;  4JZQ A;  1O6J A;  4NHW A;  1SD9 A;  2YNX A;  1TK0 B;  1G7E A;  2VL2 A;  1Q98 A;  4K7N A;  4WF5 A;  1M0U A;  2GSQ A;  4LL1 B;  5LNK e;  18GS A;  1MD3 A;  2I4A A;  3GTU A;  3IAM 2;  2CA8 A;  3TRP A;  5COH A;  1GH2 A;  2HFD A;  3UAR A;  4POB A;  1R7H A;  3CRU A;  2A4V A;  4BVX A;  1JZR A;  1MDI A;  2NVL A;  2DJ2 A;  2GZZ A;  3L78 A;  2LST A;  4WEY A;  4LLR A;  2H1G A;  2O87 A;  1TJD A;  1JZD A;  1XWG A;  5IPH A;  4NV5 A;  1M2B A;  1UVZ A;  4AGS A;  3OR5 A;  4MF5 A;  5IMZ A;  2KLX A;  2V1M A;  5IMA A;  3GFK A;  1OYJ A;  3M1G A;  2L4C A;  4FIW A;  3H93 A;  2CAI A;  2RUE A;  2LQQ A;  3C7M A;  4ISD A;  2VCZ A;  2H74 A;  2O89 A;  4F0B A;  3FZ5 A;  5C00 A;  4DSR A;  2MMA A;  5IPG A;  4XS6 A;  3QFA C;  2JU5 A;  2NBS A;  2BTO T;  5DVB A;  1NHY A;  4KUN A;  3C73 A;  1YF0 A;  1PA3 A;  12GS A;  1HNB A;  3ME8 A;  1EP7 A;  5IM9 A;  4EDZ A;  1TI1 A;  2WUL A;  2E2M A;  1FVJ A;  2L4Q A;  4MF7 A;  3HZ4 A;  4ECC A;  1DBY A;  3C1S A;  3HD5 A;  1F9M A;  1MDJ A;  3IHQ A;  4HZ4 A;  1EEJ A;  3TJF A;  4J2F A;  3A5W A;  1BG5 A;  3EU4 A;  3CBU A;  5G2Z A;  5A4W A;  1XBS A;  2YP6 A;  5J5N A;  5FWG A;  3G7I A;  2VCQ A;  1GLQ A;  4KB3 A;  3GIX A;  4TRX A;  1EGR A;  4IGJ A;  4ZB9 A;  6GSY A;  3F9U A;  1KNG A;  1AQW A;  1O8W A;  2JZR A;  2DLX A;  2HYX A;  3EU3 A;  3Q6O A;  2FA8 A;  4GSN A;  4BWQ A;  19GS A;  3ERF A;  4I8B A;  4IEL A;  5IO2 A;  3ZFB A;  2HRN A;  2FWF A;  2LS5 A;  2I3Y A;  1GUH A;  1X9S B;  2BMX A;  2D2Z A;  1CQG A;  2JSZ A;  2I9H A;  2WS2 A;  1AQV A;  4WBJ A;  4FYB A;  4MMM A;  3M9J A;  1T7P B;  3FZ9 A;  3CSI A;  3KTB A;  1EP8 A;  2HI7 A;  5J3R A;  4NAX A;  3GST A;  4GCI A;  2XPE A;  2K8S A;  4MPF A;  4HS1 A;  2LQO A;  1K0M A;  3U5R E;  2DBC A;  3I43 A;  2WCI A;  2LUS A;  2QSI A;  1B4P A;  5CYY A;  1GSD A;  4IN0 A;  1QQ2 A;  2E2G A;  2OA7 A;  3N9J A;  1LJR A;  4KDY A;  8GSS A;  5B8A A;  3FW2 A;  5EPF A;  2YJH A;  3LOR A;  4PGT A;  1HD2 A;  4N11 A;  3KEB A;  5DBQ A;  1N8J A;  1O8X A;  4L5L A;  4JE1 A;  3ZFL A;  3RPN A;  2WFC A;  5G1L A;  4IQ1 A;  4MLY A;  1RW1 A;  5KN3 A;  3IK9 A;  2QC7 A;  2R6K A;  3L9S A;  4I5Q A;  2RM5 A;  3CSH A;  4PX1 A;  1ZZY A;  1GUM A;  1SL1 B;  3UBL A;  2E0Q A;  4X0X A;  3WYW A;  5E59 A;  1GNW A;  3TCO A;  2L5O A;  1XOB A;  5HR2 A;  2LRC A;  3QAW A;  1EWX A;  1XWA A;  3ZVJ A;  2G2Q A;  5HQP A;  2H76 A;  3WGE A;  5CNW A;  3VWV A;  2B6M A;  4EL1 A;  3F4S A;  4HJ2 A;  6GSV A;  4LMW A;  3PIN A;  3DXB A;  4I2T A;  2YN1 A;  3LYK A;  2IJY A;  5AIV A;  4DSS B;  1QUW A;  2IL3 A;  2IN3 A;  3ERG A;  1FOV A;  5IMV A;  1TK5 B;  1NHO A;  5HFG A;  1IYH A;  4K8M A;  2PU9 C;  2I81 A;  4MH3 A;  1SK1 A;  5ECR B;  5CRH A;  1QK8 A;  4ULX A;  2C4J A;  1X9M B;  2B3S A;  2RLI A;  4HQZ A;  2HE3 A;  3W6G A;  4IQA A;  1MTC A;  1MEK A;  3NIV A;  5ECS A;  2OE0 A;  1USB A;  4K1F A;  2N5F A;  2FY6 A;  2P5R A;  4CHS A;  1GUK A;  4OFT A;  3H1N A;  1V58 A;  2GSR A;  4RI6 A;  5AIS A;  4XHM A;  5L71 A;  5D9X A;  3HXS A;  2CVB A;  4AJ8 A;  1JLW A;  3TOT A;  3DYR A;  1TP9 A;  3GKX A;  4K0N A;  1A0F A;  2AUV A;  3MAK A;  5DCG A;  3PR8 A;  13GS A;  1O85 A;  1SJI A;  5GZZ B;  4ECI A;  2YV7 A;  2LRT A;  3QD9 A;  5C04 A;  1V57 A;  4Q5Q A;  4PXO A;  14GS A;  3ZIV A;  3KMO A;  4O5R A;  3UIW A;  4OFN A;  1FB6 A;  3G7Y A;  3P7X A;  2DJ0 A;  3APS A;  1F6M C;  3GYK A;  2EIQ A;  2VD0 A;  3F6D A;  5ELG A;  2GTU A;  1K3Y A;  3SWL A;  1FAA A;  4WET A;  4ZB8 A;  4X1U A;  4IJ3 A;  4LL4 B;  4TN8 A;  5HR3 A;  4ECJ A;  5ECP B;  4ECB A;  5A5K A;  2B1L A;  3US3 A;  2VL9 A;  4F03 A;  1F3B A;  3DGQ A;  9GSS A;  2EC4 A;  3ISO A;  3P2A A;  2R3X A;  2H6Y A;  4K6X A;  1T3B A;  1TRU A;  1K0N A;  1M7T A;  1XW6 A;  2VD1 A;  4HU9 A;  2FHE A;  2FLS A;  1V2A A;  3ERW A;  1NSW A;  5EL8 A;  3TKS A;  1Q4J A;  3RHB A;  1SEN A;  2PMT A;  4YQV A;  4TR3 A;  4IW9 A;  3GHA A;  1R4W A;  4KND A;  2YAN A;  3HJO A;  1YJ6 A;  4N0Z A;  5FHI A;  2M46 A;  1FO5 A;  1QMV A;  5F0G A;  4TR1 A;  3LYP A;  1S3D A;  4RI7 A;  5HFK A;  2H71 A;  1PQN A;  3TKQ A;  4FYC A;  3H4K A;  2M80 A;  3TKP A;  5EVO A;  4ZIJ A;  2OAD A;  2VLV A;  3UL3 A;  2AHE A;  2ON5 A;  2CQ9 A;  2R5G A;  1YEP A;  4KDU A;  5HR1 A;  2YZH A;  1A2J A;  3PGT A;  3ZZX A;  2X64 A;  1TRW A;  3GSS A;  22GS A;  4J57 E;  4BA7 A;  3GKN A;  2AAW A;  2H0G A;  2OAC A;  4MZB A;  3GH6 A;  1BQ7 A;  3W8S A;  4NHZ A;  2YCD A;  3HVV A;  1B9X C;  1G6W A;  4TR4 A;  3BD2 A;  2AV4 A;  4PUF C;  1A24 A;  1BAY A;  2ZCT A;  2I1U A;  2IMF A;  2V6K A;  3HJM A;  5H5R A;  2C3Q A;  2OBK A;  1ZGN A;  3IR4 A;  3EVI A;  3VFI A;  2C3T A;  4OO4 A;  2F3M A;  1HNC A;  2LNS A;  2N5A A;  4TXO B;  2K18 A;  5H5S A;  3ME7 A;  1FG4 A;  4LMV A;  1Z5Y E;  4GQF A;  3E9J B;  4KDX A;  2CAQ A;  4YQM A;  2OKA A;  4N0V A;  1YY7 A;  3A2W A;  5EY6 A;  5IMF A;  3CRT A;  1ERT A;  3F6F A;  1Z7R A;  2VIM A;  4L0U A;  2H19 A;  2VO4 A;  5JWR B;  3IK7 A;  2K6V A;  4ACS A;  3DVW A;  5G30 A;  1BX9 A;  3D6I A;  5AN1 A;  4K7O A;  3VI5 A;  1QGV A;  1J9B A;  2MMN A;  5GSS A;  3HVS A;  3P90 A;  3WT2 A;  2FGX A;  1IYI A;  3WGX A;  1PD2 1;  3LEF A;  1TKD B;  2HLS A;  3CYN A;  1ML6 A;  2VL2 C;  2HZE B;  2DC5 A;  1XIY A;  2B5Y A;  5IQY A;  1TXX A;  4EXJ A;  3MSZ A;  4HI7 A;  3BCK A;  3HHV A;  1V98 A;  5GAP D;  2E7P A;  2JSY A;  1SKR B;  4HJM A;  3VWX A;  2C0F A;  2B7J A;  3FHK A;  4V1A p;  2H70 A;  5D93 A;  4BL7 A;  3W8J A;  1MD4 A;  4NWY A;  4NV2 A;  4GF0 A;  3TOU A;  3LWA A;  3QMX A;  1Z7P A;  2ZUP A;  4CW9 A;  1EV9 A;  3HKR A;  2CT6 A;  3ZIT A;  2IME A;  1A0R P;  2X8C A;  5ECK B;  2R2J A;  3KCM A;  3DD3 A;  1U87 A;  1ERV A;  5B6M A;  2LEG A;  2VM1 A;  16GS A;  3QAG A;  4WBR D;  5B8B A;  1YZX A;  2JL4 A;  4NXI A;  1A23 A;  3UBK A;  3NZN A;  2DMM A;  2JAD A;  5INY A;  1K0B A;  3KJY A;  1ZYQ B;  1OE7 A;  1SYX A;  2YWI A;  4FO5 A;  5DQY A;  1A2L A;  3WD6 A;  3ZRD A;  1KBN A;  2TIR A;  1B9Y C;  1BJX A;  1NM3 A;  1RK4 A;  4Q5R A;  3LGC A;  3FR6 A;  4KX4 A;  1V9W A;  1S3A A;  3KD0 A;  1V40 A;  1OAZ A;  4MJC A;  2CX3 A;  1OE8 A;  4DVC A;  4OFM A;  5ECH B;  1GSQ A;  2LNT A;  3EMX A;  2H66 A;  3J7Y k;  1KTE A;  2OJL A;  1WWJ A;  1EOG A;  2WRT A;  3O6T A;  2TRC P;  1M99 A;  2X8G A;  4PUA A;  4GXZ A;  1KEB A;  1TOF A;  4KGI A;  1EGO A;  2F51 A;  4IJI A;  4BPY A;  4XTS A;  3ED3 A;  3TJG A;  3FZ4 A;  10GS A;  3I69 A;  3TJB A;  2HRF A;  4F82 A;  1Z9H A;  1TI3 A;  4MK3 A;  1SKW B;  4YAP A;  3CTF A;  1H4O A;  5CP1 A;  3D4T A;  4MAB A;  3CXG A;  5KN1 A;  1M2A A;  4F2I A;  1UN2 A;  1EEM A;  2AB6 A;  2FUG 2;  3O3T A;  4O7H A;  3VK9 A;  5F07 A;  3VWW A;  3IXR A;  3GN3 A;  3TDG A;  3WGD A;  1PKZ A;  4IHU A;  1VGL A;  2PVO C;  2IMK A;  4YH2 A;  2GQL A;  3KGK A;  4N30 A;  2LJA A;  3DML A;  3M8N A;  1OC9 B;  3RHC A;  3Q74 A;  4HOJ A;  3FY7 A;  4GLT A;  3FZA A;  2H0H A;  1A8L A;  4DEJ A;  4TXO A;  1B8X A;  1BYE A;  3RPP A;  2C8U A;  4TR1 B;  3VLN A;  4AJ6 A;  3GKK A;  4ZL9 A;  4V2L A;  1EOH A;  5IOW A;  5G1K A;  3CMI A;  2GZP A;  1XVQ A;  1O81 A;  2C80 A;  5AGY A;  3BBY A;  1PKW A;  4YAV A;  3M9K A;  4HDE A;  2FA4 A;  2DSA A;  1X5D A;  3LJR A;  2Z9S A;  4AF2 A;  4HZ2 A;  4ZBA A;  3D0Z A;  1UA5 A;  4BWS A;  2NDO A;  3KP8 A;  4XRD A;  5JCG A;  2O8V B;  3A2V A;  2FD3 A;  4X43 A;  5F06 A;  6GSX A;  1VRS D;  3BJ5 A;  4KAE A;  1PN9 A;  2HZE A;  3ZVJ D;  1XW9 A;  1GLP A;  3ZRE A;  4TOP A;  4G19 A;  2YWN A;  5GST A;  2MYG A;  3EIN A;  3C1R A;  3KIJ A;  1ZYE A;  1TDI A;  3E3E A;  2DML A;  4WXT A;  6GSW A;  4IBP A;  4I97 A;  1JHB A;  2L57 A;  3GL3 A;  1EZK A;  3UOM A;  3LSZ A;  2RUF A;  1AQX A;  6GSS A;  4XS4 B;  2PBJ A;  1M9B A;  3TRX A;  1A8Y A;  3UVT A;  5ID2 B;  2VOC A;  5LCZ A;  1AUC A;  3CTG A;  3DWV A;  3ZL5 A;  3EWL A;  3G9B A;  3I9V 2;  1ZOF A;  1GP1 A;  3KH7 A;  5IMD A;  2V32 A;  2F9S A;  4AJ7 A;  2LRN A;  2QKE A;  3ZLP A;  4MF6 A;  1PX7 A;  2OE3 A;  2VL3 A;  4K2D A;  5CRD A;  1ERW A;  5DJM A;  4POL A;  4F9Z A;  4KW6 A;  5CO3 A;  4KSM A;  5ECL B;  1GSF A;  4HEA 2;  3SBC A;  1K3L A;  2HNL A;  1ILO A;  2YPM A;  1U88 A;  2HT9 A;  2IMI A;  4MJE A;  5ECN B;  2YJ7 A;  2WGR A;  5G5F A;  2DJJ A;  4EDY A;  1GSU A;  1R5A A;  2YWO A;  3TGZ A;  2IWT A;  4F0C A;  5D9W A;  1K0C A;  4I6X A;  3QFB C;  3D5J A;  4Q5F A;  3F3R A;  1X5C A;  4MZC A;  2NTO A;  3GKM A;  5DQS A;  2H75 A;  2VCW A;  1NW2 A;  4PNG A;  1DSB A;  3FKF A;  4O92 A;  3UAP A;  3U6V A;  3LQ7 A;  1A2M A;  1T1V A;  1SJZ A;  4TW5 A;  1SL2 B;  2FNO A;  2H6X A;  3FEU A;  1GTI A;  1PL1 A;  2VCT A;  4GQC A;  2PER A;  3F3Q A;  3ZML A;  4IS0 A;  1LU4 A;  1URM A;  4ZL8 A;  3D21 A;  5KEJ A;  2B5E A;  2H8L A;  3QAV A;  4G2E A;  3L0H A;  2HSH A;  1EV4 A;  2X8H A;  2VLU A;  3GX8 A;  3Q18 A;  2PN8 A;  3MWH A;  2EIR A;  4FYU A;  3QPM A;  3QR6 A;  1W89 A;  2QGV A;  1OC9 A;  2H73 A;  1XWC A;  2PWJ A;  3GA4 A;  4EF0 A;  2CVD A;  5D73 A;  1Y6E A;  4TKY A;  2A2R A;  4QL9 A;  4MDC A;  4PQH A;  1XOA A;  5JCW A;  4WF4 A;  2YOI A;  4QL7 A;  3QOU A;  1YKA A;  4MPG A;  5H5Q A;  1SJ6 A;  5A4U A;  2R37 A;  2VLT A;  3L9U A;  2DIZ A;  3EYT A;  1XW5 A;  4GWR A;  2AJQ B;  5IO0 A;  3UVH A;  2L59 A;  4HU7 A;  3IE3 A;  4HQS A;  5DAL B;  3D4M A;  2YV9 A;  1X5E A;  2LJK A;  1AW9 A;  2XBI A;  2TRX A;  2O7K A;  3EE2 A;  2F8A A;  2RM6 A;  3N5O A;  2WDU A;  3FR3 A;  1HQO A;  4I2U A;  4K7I A;  1GNE A;  4PQ1 A;  1M2D A;  4ZBB A;  2A2S A;  1LBK A;  3IDV A;  3KH9 A;  2P0G A;  2K8V A;  1JZW A;  3DIE A;  3KP9 A;  4KA0 A;  5J41 A;  1PX6 A;  3CSJ A;  3HZ8 A;  3V1W A;  2YWM A;  4WR4 A;  4POK A;  3VPT A;  1W4V A;  2PUK C;  2FWG A;  1OKT A;  3HY2 A;  1WIK A;  3LXT A;  1TW9 A;  1M9A A;  1TK8 B;  4XS4 A;  2MMZ A;  4MZW A;  5ID2 A;  1RQM A;  3GUS A;  4GST A;  4GTU A;  1GSS A;  3LXZ A;  2P31 A;  5JWQ B;  1YKC A;  1JZO A;  2KP1 A;  1AIU A;  2F8F A;  3TUE A;  2GZY A;  2YZU A;  1TRS A;  3AY8 A;  4JU5 A;  5ECO B;  1H75 A;  1CQH A;  1YDK A;  4ZBD A;  2VUP A;  3DKS A;  1YQ1 A;  3FK8 A;  20GS A;  3O76 A;  3K8N A;  2KP2 A;  4E8E A;  2VAF A;  3KMN A;  2WZ9 A;  2LTK A;  3HDC A;  4J56 E;  2B1K A;  1TU8 A;  1G0T A;  1SYR A;  3F63 A;  1GSY A;  1YEX A;  2H30 A;  4TR0 A;  4MH2 A;  5CRE A;  3EMP A;  1PMT A;  1UC7 A;  2VCV A;  3FYG A;  3ZTL A;  2L5L A;  1I9D A;  3ZMK A;  1O7U A;  5DAK B;  3TRQ A;  4LA1 A;  4IKH A;  2CZ2 A;  3GRX A;  1VF3 A;  5F8B A;  2H1D A;  1OVN A;  5D8I A;  2CX4 A;  2GQK A;  1XFL A;  4L8E A;  1GUL A;  4G10 A;  2CZ3 A;  3TJJ A;  3HA9 A;  3IA1 A;  4EUY A;  5J4U A;  4E8H A;  5CRW A;  2JZT A;  5G31 A;  1Z6N A;  3GH9 A;  1AC1 A;  1TRV A;  4OO5 A;  4JBB A;  1GTB A;  1E2Y A;  3VUR A;  4MJA A;  4XCS A;  1Y25 A;  3J7Y b;  4EKZ A;  3LFL A;  3IPZ A;  2AYT A;  2PGT A;  3R2Q A;  5DCH A;  3FRC A;  1PL2 A;  2XHF A;  2IFQ B;  4YQU A;  3UJ1 A;  4JR4 A;  4NPB A;  2GVP A;  1XPV A;  4ZIL A;  1B4Q A;  1S3C A;  4CDO A;  2OBI A;  1ABA A;  1XZO A;  1K0A A;  3F0I A;  3HCZ A;  1OC3 A;  1SK2 A;  1T4Z A;  4RUV A;  4V2N A;  1SL0 B;  4XRA A;  2VCX A;  5J9C A;  2B5X A;  4KSO A;  4OWY A;  2GLR A;  5D9V A;  1K0O A;  5ECM B;  3TKR A;  1ERU A;  5KN2 A;  3G7J A;  5KN0 A;  2V41 A;  4PQI A;  1TU7 A;  3GNJ A;  2GDR A;  3RAZ A;  2GT5 A;  3TB2 A;  1J0F A;  4IP1 A;  3GX0 A;  3KM6 A;  3VWU A;  4TXV A;  4V1A g;  5DAL A;  2C0D A;  2MZC A;  2H01 A;  5E4W A;  5ENU A;  3NOF A;  1U6T A;  1T8E B;  2R4V A;  3LG6 A;  2XBQ A;  4ML6 A;  3H79 A;  3GL5 A;  3MNG A;  4L0W A;  1FVK A;  2LKU A;  1F3A A;  4ML1 A;  1X0R A;  3VI7 A;  2C0E A;  3APO A;  1ACV A;  2XC2 A;  2GST A;  4WKW A;  4GSS A;  3EUR A;  4RQX A;  3IBH A;  4EO3 A;  1GTU A;  2DIY A;  4NMU A;  2IIY A;  4D73 B;  4ZL7 A;  1E6B A;  1C72 A;  1GWC A;  2H1B A;  1X9W B;  2NPB A;  3IAS 2;  3D22 A;  4H86 A;  1ST9 A;  3UEM A;  1K3O A;  1T4Y A;  2B7K A;  5D9T A;  5GAN D;  2J9H A;  1F2E A;  1PSQ A;  3PH9 A;  2V6O A;  4IP6 A;  4ZB6 A;  2GS3 A;  1GTA A;  2OE1 A;  1SU9 A;  1GRX A;  3IC4 A;  4MCU A;  5HR0 A;  1HNA A;  3DRN A;  1K0D A;  1ZMA A;  3Q19 A;  2J23 A;  1WOU A;  3EC3 A;  4G9H A;  1O73 A;  4OCF A;  4O32 A;  2L6D A;  1SK0 A;  4KE3 A;  1HYU A;  3GUR A;  2FCH A;  2ON7 A;  4V2M A;  2H0I A;  2XPD A;  1B48 A;  6GSU A;  3QDN A;  5LD0 A;  5IMC A;  5DAK A;  2CV4 A;  4N10 A;  3TJK A;  3F8U A;  1PGT A;  2H1A A;  5FT3 A;  2H72 A;  5CAX A;  1Z3E A;  4EVM A;  1DE1 A;  5IOX A;  3C71 A;  1XWB A;  3GMF A;  1F37 A;  1WRY A;  2KUC A;  2IMD A;  1R26 A;  2K9F A;  3KZQ A;  2WJU A;  4EE0 A;  1GL8 A;  3GTU B;  3VPQ A;  3S9F A;  2L6C A;  5B7C A;  2ZNM A;  1ZCP A;  4MA9 A;  2JZS A;  2G0F A;  3M0F A;  1JLV A;  3WT1 A;  2IPA A;  2C0G A;  4JRR A;  4WR5 A;  1YF1 A;  4OD7 A;  2GSS A;  2GGT A;  4Q5N A;  1SD8 A;  4OMV A;  4POM A;  1ZL9 A;  2X99 A;  3L9V A;  4ILF A;  2DJ3 A;  2IFQ A;  2P5Q A;  2MBT A;  4K0G A;  1FHE A;  4BVY A;  1U3A A;  4K9Z A;  3I6A A;  1XCC A;  3F4T A;  1WMJ A;  3C8E A;  5JCU A;  2LJR A;  1U3I A;  1MDK A;  1ON4 A;  1XWK A;  3P8W A;  4QQ7 A;  1THX A;  5F05 A;  1VF2 A;  5CRG A;  4TVE A;  1GSE A;  5J9B A;  1J08 A;  5ECI B;  4ID0 A;  2EIO A;  4L5O A;  17GS A;  4PNF A;  1AAZ A;  3BCI A;  2DJK A;  3IOS A;  6GST A;  5G5E A;  7GSS A;  5ABR A;  3M3M A;  3HJP A;  3QCP A;  3H8Q A;  1QFN A;  2C1Y A;  1I5G A;  2PPT A;  3IV4 A;  2HSY A;  4OCE A;  5ELA A;  3RDW A;  4KCA A;  3F4R A;  3TKS E;  1Z6M A;  4IVF A;  1VF4 A;  1AXD A;  3MDK A;  2KOK A;  5D96 A;  1OKD A;  5HFI A;  5JWO B;  4HUA A;  2VM2 A;  3ZIJ A;  4FH8 A;  1OC8 A;  1N2A A;  1JFU A;  3E0U A;  4PUR A;  2BJX A;  3A2X A;  4MJB A;  3BOA A;  1DUG A;  3IRA A;  3A3T A;  3ZYW A;  5DDL A;  5DJL A;  2H6Z A;  4KCE A;  4D73 A;  1T00 A;  1WP0 A;  5AIX A;  1SKS B;  2M72 A;  3HYP A;  3TKS C;  1WJK A;  2V2G A;  1BED A;  1PRX A;  4XIH A;  2ALB A;  2MMO A;  2REM A;  2C3N A;  1WE0 A;  3L4N A;  3HVX A;  1DE2 A;  3JCM L;  3DVX A;  4JED A;  2O85 A;  5IIZ A;  2ES7 A;  1VF1 A;  4MP4 A;  2CVK A;  1XXU A;  4P3Y B;  1FB0 A;  1G7O A;  2N5B A;  3KTL A;  1THO A;  4XS1 A;  3UMA A;  1G6Y A;  2MBS A;  2RII A;  2LV3 A;  2HXK A;  1XVW A;  2FWE A;  2PVQ A;  4JR6 A;  3DEX A;  3RBT A;  2JAC A;  11GS A;  1R5P A;  2HZF A;  4ZXG A;  3APQ A;  4GRF A;  5B6N A;  2GQM A;  3GV1 A;  4DSS A;  2FWH A;  3FR9 A;  2DJ1 A;  5A4V A;  4DSQ A;  3KXO A;  1QXH A;  1FW1 A;  2WB9 A; 
#chains in the Genus database with same CATH topology
 1WPI A;  1TTZ A;  4RQR A;  2GT6 A;  4Z7X A;  4KH7 A;  1M3J A;  5ECQ B;  4EC0 A;  2KHP A;  4JZQ A;  1O6J A;  4NHW A;  1SD9 A;  2YNX A;  1TK0 B;  1G7E A;  2VL2 A;  1Q98 A;  4K7N A;  4WF5 A;  1M0U A;  2GSQ A;  4X4J A;  4LL1 B;  5LNK e;  18GS A;  1MD3 A;  2I4A A;  3GTU A;  3IAM 2;  2CA8 A;  3TRP A;  5COH A;  1GH2 A;  2HFD A;  3UAR A;  4POB A;  1R7H A;  3CRU A;  2A4V A;  4BVX A;  1JZR A;  1MDI A;  2NVL A;  2DJ2 A;  2GZZ A;  3L78 A;  2LST A;  4WEY A;  4LLR A;  2H1G A;  2O87 A;  4Z2U A;  1TJD A;  1JZD A;  1XWG A;  5IPH A;  4NV5 A;  1M2B A;  1FOH A;  1UVZ A;  4AGS A;  3OR5 A;  4MF5 A;  5IMZ A;  2KLX A;  2V1M A;  5IMA A;  3GFK A;  1OYJ A;  3M1G A;  2L4C A;  4FIW A;  4G0I A;  3H93 A;  2CAI A;  2RUE A;  2LQQ A;  3C7M A;  4ISD A;  2VCZ A;  2H74 A;  2O89 A;  4G0K A;  4F0B A;  3FZ5 A;  5C00 A;  4DSR A;  2MMA A;  5IPG A;  4XS6 A;  3QFA C;  2JU5 A;  2NBS A;  2BTO T;  5DVB A;  1NHY A;  4KUN A;  3C73 A;  1YF0 A;  1PA3 A;  12GS A;  1HNB A;  3ME8 A;  1EP7 A;  4O5U A;  5IM9 A;  4EDZ A;  1TI1 A;  2WUL A;  2E2M A;  1FVJ A;  2L4Q A;  4MF7 A;  3HZ4 A;  4ECC A;  1DBY A;  4KF9 A;  3C1S A;  3HD5 A;  1F9M A;  1MDJ A;  3IHQ A;  4HZ4 A;  1EEJ A;  3TJF A;  4J2F A;  3A5W A;  1BG5 A;  2UZ8 A;  3EU4 A;  3CBU A;  5G2Z A;  5A4W A;  1XBS A;  2YP6 A;  3FMW A;  5J5N A;  5FWG A;  3G7I A;  2VCQ A;  1GLQ A;  4KB3 A;  3GIX A;  4TRX A;  1EGR A;  4IGJ A;  4ZB9 A;  6GSY A;  3F9U A;  1KNG A;  1AQW A;  1O8W A;  2JZR A;  2DLX A;  2HYX A;  3EU3 A;  3Q6O A;  2FA8 A;  4GSN A;  4BWQ A;  19GS A;  3ERF A;  4I8B A;  4IEL A;  5IO2 A;  3ZFB A;  2HRN A;  2FWF A;  2LS5 A;  2I3Y A;  1GUH A;  1X9S B;  2BMX A;  2D2Z A;  4MNN A;  1CQG A;  2JSZ A;  2I9H A;  2WS2 A;  1AQV A;  4WBJ A;  4FYB A;  4MMM A;  3M9J A;  1T7P B;  3FZ9 A;  3CSI A;  3KTB A;  1EP8 A;  2HI7 A;  5J3R A;  4NAX A;  3GST A;  4GCI A;  1XG8 A;  2XPE A;  2K8S A;  4MPF A;  4HS1 A;  2LQO A;  1K0M A;  3U5R E;  2DBC A;  3I43 A;  2WCI A;  2LUS A;  2QSI A;  1B4P A;  5CYY A;  1GSD A;  4IN0 A;  1QQ2 A;  2E2G A;  2OA7 A;  3N9J A;  1LJR A;  4KDY A;  8GSS A;  5B8A A;  3FW2 A;  5EPF A;  2YJH A;  3LOR A;  4PGT A;  1HD2 A;  4N11 A;  3KEB A;  5DBQ A;  1N8J A;  1O8X A;  4L5L A;  4JE1 A;  3ZFL A;  3RPN A;  2WFC A;  5G1L A;  4IQ1 A;  4MLY A;  1RW1 A;  5KN3 A;  3IK9 A;  2QC7 A;  2R6K A;  3L9S A;  4I5Q A;  2RM5 A;  3CSH A;  4PX1 A;  1ZZY A;  1GUM A;  2X49 A;  1SL1 B;  3UBL A;  2E0Q A;  4X0X A;  3WYW A;  5E59 A;  1GNW A;  2HRA A;  3TCO A;  2QA2 A;  1S3R A;  2L5O A;  1XOB A;  5HR2 A;  2LRC A;  3QAW A;  1EWX A;  1XWA A;  3ZVJ A;  2G2Q A;  5HQP A;  2H76 A;  3WGE A;  5CNW A;  3VWV A;  2B6M A;  4EL1 A;  3F4S A;  4HJ2 A;  6GSV A;  4LMW A;  3PIN A;  3DXB A;  4I2T A;  2YN1 A;  4YKG A;  3LYK A;  2IJY A;  4G0L A;  5AIV A;  4DSS B;  1QUW A;  2IL3 A;  2IN3 A;  3ERG A;  1FOV A;  5IMV A;  1TK5 B;  1NHO A;  5HFG A;  1IYH A;  4K8M A;  2PU9 C;  2I81 A;  4MH3 A;  1SK1 A;  5ECR B;  5CRH A;  1QK8 A;  4ULX A;  2C4J A;  1X9M B;  2B3S A;  2HSM A;  2RLI A;  4HQZ A;  2HE3 A;  3W6G A;  4IQA A;  1MTC A;  1MEK A;  3NIV A;  5ECS A;  2OE0 A;  1USB A;  4K1F A;  2N5F A;  2FY6 A;  4Z2R A;  2P5R A;  4USS A;  4CHS A;  1GUK A;  4OFT A;  3H1N A;  1V58 A;  2GSR A;  4RI6 A;  5AIS A;  4XHM A;  5L71 A;  5D9X A;  4BL7 B;  3HXS A;  2CVB A;  4AJ8 A;  1JLW A;  3TOT A;  3DYR A;  1TP9 A;  3GKX A;  4K0N A;  1A0F A;  2AUV A;  3MAK A;  5DCG A;  3PR8 A;  13GS A;  1O85 A;  1SJI A;  5GZZ B;  4ECI A;  2YV7 A;  2LRT A;  3QD9 A;  5C04 A;  1V57 A;  4Q5Q A;  4PXO A;  14GS A;  3ZIV A;  2R0G A;  3KMO A;  4O5R A;  3UIW A;  4OFN A;  4YKF A;  1FB6 A;  3G7Y A;  3P7X A;  2DJ0 A;  3APS A;  1F6M C;  3GYK A;  2EIQ A;  4PTS A;  2VD0 A;  3F6D A;  5ELG A;  2GTU A;  1K3Y A;  3SWL A;  1FAA A;  4WET A;  4ZB8 A;  4X1U A;  4IJ3 A;  4LL4 B;  4TN8 A;  5HR3 A;  4ECJ A;  5ECP B;  4ECB A;  5A5K A;  2B1L A;  3US3 A;  2VL9 A;  4F03 A;  1F3B A;  3DGQ A;  9GSS A;  2EC4 A;  3ISO A;  4K5R A;  3P2A A;  2R3X A;  2H6Y A;  4K6X A;  1T3B A;  1TRU A;  1K0N A;  1M7T A;  1XW6 A;  2VD1 A;  4HU9 A;  2FHE A;  2FLS A;  1V2A A;  3ERW A;  1NSW A;  5EL8 A;  3TKS A;  1Q4J A;  3RHB A;  1SEN A;  2PMT A;  2HRK A;  4YQV A;  4TR3 A;  2A2P A;  4IW9 A;  3GHA A;  1R4W A;  4KND A;  2YAN A;  3HJO A;  1YJ6 A;  4N0Z A;  5FHI A;  2M46 A;  3A5I A;  1FO5 A;  1QMV A;  5F0G A;  4TR1 A;  3LYP A;  1S3D A;  4RI7 A;  5HFK A;  2H71 A;  1PQN A;  3TKQ A;  4FYC A;  3H4K A;  2M80 A;  3TKP A;  5EVO A;  4ZIJ A;  2OAD A;  2VLV A;  3UL3 A;  2AHE A;  2ON5 A;  2CQ9 A;  2R5G A;  1YEP A;  4KDU A;  5HR1 A;  4K5S A;  2YZH A;  1A2J A;  3PGT A;  3ZZX A;  2X64 A;  1TRW A;  3GSS A;  22GS A;  4J57 E;  4BA7 A;  3GKN A;  2AAW A;  2H0G A;  2DKI A;  2OAC A;  4MZB A;  3GH6 A;  1BQ7 A;  3W8S A;  3IC8 A;  4NHZ A;  2YCD A;  3HVV A;  1B9X C;  1G6W A;  4TR4 A;  4FQU A;  3BD2 A;  2AV4 A;  4PUF C;  1A24 A;  1BAY A;  2ZCT A;  2I1U A;  2IMF A;  2V6K A;  3HJM A;  5H5R A;  2C3Q A;  2OBK A;  1ZGN A;  3IR4 A;  3EVI A;  3VFI A;  2C3T A;  4OO4 A;  2F3M A;  1HNC A;  3IHG A;  2LNS A;  2N5A A;  4TXO B;  2K18 A;  5H5S A;  3ME7 A;  1FG4 A;  4LMV A;  1Z5Y E;  4GQF A;  3E9J B;  4KDX A;  2CAQ A;  4YQM A;  2OKA A;  4N0V A;  1YY7 A;  3A2W A;  5EY6 A;  5IMF A;  3CRT A;  1ERT A;  1M3I A;  3F6F A;  1Z7R A;  2VIM A;  4L0U A;  2H19 A;  2VO4 A;  5JWR B;  5KOX A;  3IK7 A;  2K6V A;  4ACS A;  3DVW A;  5G30 A;  1BX9 A;  3D6I A;  5AN1 A;  4K7O A;  3VI5 A;  1QGV A;  1J9B A;  2MMN A;  5GSS A;  3HVS A;  3P90 A;  3WT2 A;  2FGX A;  1IYI A;  3WGX A;  1PD2 1;  3LEF A;  1TKD B;  2HLS A;  3CYN A;  1ML6 A;  2VL2 C;  2HZE B;  2DC5 A;  1XIY A;  2B5Y A;  5IQY A;  1TXX A;  4EXJ A;  3MSZ A;  4HI7 A;  3BCK A;  3HHV A;  1V98 A;  5GAP D;  2E7P A;  2JSY A;  3LW9 A;  1SKR B;  4HJM A;  3VWX A;  2C0F A;  2B7J A;  3FHK A;  4V1A p;  2H70 A;  5D93 A;  4BL7 A;  3W8J A;  1MD4 A;  4NWY A;  4NV2 A;  4GF0 A;  3TOU A;  3LWA A;  3QMX A;  1Z7P A;  2ZUP A;  4CW9 A;  1EV9 A;  3HKR A;  3CQF A;  2CT6 A;  3ZIT A;  2IME A;  1A0R P;  2X8C A;  5ECK B;  2R2J A;  3KCM A;  3DD3 A;  1U87 A;  1ERV A;  5B6M A;  2LEG A;  2VM1 A;  16GS A;  3QAG A;  4WBR D;  5B8B A;  1YZX A;  2JL4 A;  4NXI A;  2A4H A;  1A23 A;  3UBK A;  3NZN A;  2DMM A;  2JAD A;  5INY A;  1K0B A;  3KJY A;  1ZYQ B;  1OE7 A;  1ZYN A;  1SYX A;  2YWI A;  4FO5 A;  5DQY A;  1A2L A;  3R3E A;  5BMU A;  3WD6 A;  3ZRD A;  1KBN A;  2TIR A;  1B9Y C;  1BJX A;  1NM3 A;  1RK4 A;  4Q5R A;  3LGC A;  3FR6 A;  4KX4 A;  1V9W A;  1S3A A;  3KD0 A;  1V40 A;  1OAZ A;  4MJC A;  2CX3 A;  1OE8 A;  4DVC A;  4OFM A;  5ECH B;  1GSQ A;  2LNT A;  3EMX A;  2H66 A;  3J7Y k;  1KTE A;  2OJL A;  1WWJ A;  1EOG A;  2WRT A;  3O6T A;  2TRC P;  1M99 A;  2X8G A;  4PUA A;  4GXZ A;  1KEB A;  1TOF A;  4KGI A;  1EGO A;  2F51 A;  4IJI A;  4BPY A;  4XTS A;  3ED3 A;  3TJG A;  3FZ4 A;  10GS A;  3I69 A;  3TJB A;  2HRF A;  4F82 A;  1Z9H A;  1TI3 A;  4MK3 A;  1SKW B;  4YAP A;  3CTF A;  1H4O A;  5CP1 A;  3D4T A;  4MAB A;  3CXG A;  5KN1 A;  1M2A A;  4F2I A;  1UN2 A;  1EEM A;  2AB6 A;  2FUG 2;  3O3T A;  4O7H A;  3VK9 A;  5F07 A;  3VWW A;  3IXR A;  3GN3 A;  3TDG A;  3WGD A;  1PKZ A;  4IHU A;  1VGL A;  2PVO C;  2IMK A;  4YH2 A;  2GQL A;  3KGK A;  4N30 A;  2LJA A;  3DML A;  3M8N A;  1OC9 B;  3RHC A;  3Q74 A;  4HOJ A;  3FY7 A;  4GLT A;  3FZA A;  4A5P A;  2H0H A;  1A8L A;  4DEJ A;  4TXO A;  1B8X A;  1BYE A;  3RPP A;  2C8U A;  4TR1 B;  3VLN A;  4AJ6 A;  3GKK A;  4ZL9 A;  4V2L A;  1EOH A;  5IOW A;  5G1K A;  3CMI A;  2GZP A;  1XVQ A;  1O81 A;  2C80 A;  5AGY A;  3BBY A;  1PKW A;  4YAV A;  3M9K A;  4HDE A;  2FA4 A;  2DSA A;  1X5D A;  3LJR A;  2Z9S A;  4AF2 A;  4HZ2 A;  4ZBA A;  3D0Z A;  1UA5 A;  4CY6 A;  4BWS A;  4CY8 A;  2NDO A;  3KP8 A;  4XRD A;  5JCG A;  2O8V B;  3A2V A;  2FD3 A;  4X43 A;  5F06 A;  6GSX A;  1VRS D;  3BJ5 A;  4KAE A;  1PN9 A;  2HZE A;  3ZVJ D;  1XW9 A;  1GLP A;  3ZRE A;  4TOP A;  4G19 A;  2YWN A;  5GST A;  4Z2T A;  2MYG A;  3EIN A;  3C1R A;  3KIJ A;  1ZYE A;  1TDI A;  3E3E A;  2DML A;  4WXT A;  6GSW A;  4IBP A;  4I97 A;  1JHB A;  2L57 A;  3GL3 A;  4EIP A;  1EZK A;  3UOM A;  3LSZ A;  2RUF A;  1AQX A;  6GSS A;  4XS4 B;  2PBJ A;  1M9B A;  3TRX A;  1A8Y A;  3UVT A;  5ID2 B;  2VOC A;  5LCZ A;  1AUC A;  3CTG A;  3DWV A;  3ZL5 A;  3EWL A;  3G9B A;  3I9V 2;  1ZOF A;  1GP1 A;  3KH7 A;  5IMD A;  2V32 A;  2F9S A;  4AJ7 A;  2LRN A;  2QKE A;  3ZLP A;  4MF6 A;  1PX7 A;  2OE3 A;  2VL3 A;  4K2D A;  5CRD A;  1ERW A;  5DJM A;  4POL A;  4F9Z A;  4KW6 A;  5CO3 A;  4KSM A;  5ECL B;  1GSF A;  4HEA 2;  3SBC A;  1K3L A;  2HNL A;  1ILO A;  2YPM A;  1U88 A;  2HT9 A;  2IMI A;  4MJE A;  5ECN B;  2YJ7 A;  2WGR A;  5G5F A;  2DJJ A;  4EDY A;  1GSU A;  1R5A A;  2YWO A;  3TGZ A;  2IWT A;  4F0C A;  5D9W A;  1K0C A;  4I6X A;  3QFB C;  3D5J A;  4Q5F A;  3F3R A;  1X5C A;  4MZC A;  2NTO A;  3GKM A;  5DQS A;  2H75 A;  2VCW A;  1NW2 A;  4PNG A;  1DSB A;  3FKF A;  4O92 A;  3UAP A;  3U6V A;  3LQ7 A;  1A2M A;  1T1V A;  1SJZ A;  4TW5 A;  1SL2 B;  2FNO A;  2H6X A;  3FEU A;  1GTI A;  1PL1 A;  2VCT A;  4GQC A;  2PER A;  3F3Q A;  3ZML A;  4IS0 A;  1LU4 A;  1URM A;  4ZL8 A;  3D21 A;  5KEJ A;  2B5E A;  2H8L A;  3MYD A;  3QAV A;  4G2E A;  3L0H A;  2HSH A;  1EV4 A;  2X8H A;  2VLU A;  3GX8 A;  3Q18 A;  2PN8 A;  3MWH A;  2EIR A;  4FYU A;  3QPM A;  3QR6 A;  1W89 A;  2QGV A;  1OC9 A;  2H73 A;  1XWC A;  2PWJ A;  3GA4 A;  4EF0 A;  2CVD A;  5D73 A;  1Y6E A;  4TKY A;  2A2R A;  4QL9 A;  4MDC A;  4PQH A;  1XOA A;  5JCW A;  4WF4 A;  2YOI A;  4QL7 A;  3QOU A;  1YKA A;  4MPG A;  5H5Q A;  1SJ6 A;  5A4U A;  2R37 A;  2VLT A;  3L9U A;  2DIZ A;  3EYT A;  2QA1 A;  1XW5 A;  4GWR A;  2AJQ B;  5IO0 A;  3UVH A;  2L59 A;  4HU7 A;  1PFO A;  3IE3 A;  4HQS A;  5DAL B;  5KOW A;  3D4M A;  2YV9 A;  1X5E A;  2LJK A;  1AW9 A;  2XBI A;  2TRX A;  2O7K A;  3EE2 A;  2F8A A;  2RM6 A;  3N5O A;  2WDU A;  3FR3 A;  1HQO A;  4I2U A;  4K7I A;  1GNE A;  4PQ1 A;  1M2D A;  4ZBB A;  2A2S A;  1LBK A;  3IDV A;  3KH9 A;  2P0G A;  2K8V A;  1JZW A;  3DIE A;  3MIX A;  3KP9 A;  4KA0 A;  5J41 A;  1PX6 A;  3CSJ A;  3HZ8 A;  3V1W A;  2YWM A;  4WR4 A;  4POK A;  3VPT A;  1W4V A;  2PUK C;  2FWG A;  1OKT A;  3HY2 A;  1WIK A;  3LXT A;  4EIQ A;  1TW9 A;  1M9A A;  1TK8 B;  4XS4 A;  2MMZ A;  4MZW A;  5ID2 A;  1RQM A;  3GUS A;  4GST A;  4GTU A;  1GSS A;  3LXZ A;  2P31 A;  5JWQ B;  1YKC A;  1JZO A;  2KP1 A;  4O5Q A;  1AIU A;  2F8F A;  3TUE A;  2GZY A;  2YZU A;  1TRS A;  3AY8 A;  4JU5 A;  5ECO B;  1H75 A;  1CQH A;  1YDK A;  4ZBD A;  2VUP A;  3DKS A;  1YQ1 A;  3FK8 A;  20GS A;  3O76 A;  3K8N A;  2KP2 A;  4E8E A;  2VAF A;  3KMN A;  2WZ9 A;  2LTK A;  3HDC A;  3HVN A;  4J56 E;  2B1K A;  1TU8 A;  1G0T A;  1SYR A;  3F63 A;  1GSY A;  1YEX A;  2H30 A;  4TR0 A;  4MH2 A;  5CRE A;  3EMP A;  1PMT A;  1UC7 A;  2VCV A;  3FYG A;  3ZTL A;  2L5L A;  1I9D A;  3ZMK A;  1O7U A;  5DAK B;  3TRQ A;  4LA1 A;  4IKH A;  2CZ2 A;  3GRX A;  1VF3 A;  5F8B A;  2H1D A;  1OVN A;  5D8I A;  2CX4 A;  2GQK A;  1XFL A;  4L8E A;  1GUL A;  4G10 A;  2CZ3 A;  3TJJ A;  3HA9 A;  3IA1 A;  4EUY A;  5J4U A;  4E8H A;  5CRW A;  2JZT A;  5G31 A;  1Z6N A;  3GH9 A;  1AC1 A;  1TRV A;  4OO5 A;  4JBB A;  1GTB A;  1E2Y A;  3VUR A;  4MJA A;  4XCS A;  1Y25 A;  3J7Y b;  4EKZ A;  3LFL A;  3IPZ A;  2AYT A;  2PGT A;  3R2Q A;  5DCH A;  3FRC A;  1PL2 A;  2XHF A;  2IFQ B;  4YQU A;  3UJ1 A;  4JR4 A;  4NPB A;  4BVY B;  2GVP A;  1XPV A;  4BIK A;  4ZIL A;  1B4Q A;  1S3C A;  4CDO A;  2OBI A;  1ABA A;  1XZO A;  1K0A A;  3F0I A;  3HCZ A;  1OC3 A;  2R0C A;  1SK2 A;  1T4Z A;  4RUV A;  4V2N A;  1SL0 B;  4XRA A;  2VCX A;  5J9C A;  2B5X A;  4KSO A;  4OWY A;  2GLR A;  5D9V A;  1K0O A;  5ECM B;  3TKR A;  1ERU A;  5KN2 A;  3G7J A;  5KN0 A;  2V41 A;  4PQI A;  1TU7 A;  3GNJ A;  2GDR A;  3RAZ A;  2GT5 A;  3TB2 A;  1J0F A;  4IP1 A;  3GX0 A;  2R0P A;  3KM6 A;  3VWU A;  4TXV A;  4V1A g;  5DAL A;  2C0D A;  2MZC A;  2H01 A;  5E4W A;  5ENU A;  3NOF A;  1U6T A;  1T8E B;  2R4V A;  3LG6 A;  2XBQ A;  4ML6 A;  3H79 A;  3GL5 A;  3MNG A;  1ZYP A;  4L0W A;  1FVK A;  2LKU A;  1F3A A;  4ML1 A;  1X0R A;  3VI7 A;  2C0E A;  3APO A;  1ACV A;  2XC2 A;  2GST A;  4WKW A;  3EPT A;  3EUR A;  4GSS A;  4RQX A;  3IBH A;  4EO3 A;  1GTU A;  2DIY A;  4NMU A;  2IIY A;  4D73 B;  4ZL7 A;  1E6B A;  1C72 A;  1GWC A;  2H1B A;  1X9W B;  2NPB A;  3IAS 2;  3D22 A;  4H86 A;  1ST9 A;  3UEM A;  1K3O A;  1T4Y A;  2B7K A;  5D9T A;  5GAN D;  2J9H A;  1F2E A;  1PSQ A;  3PH9 A;  2V6O A;  4IP6 A;  4ZB6 A;  2GS3 A;  1GTA A;  2OE1 A;  1SU9 A;  1GRX A;  3IC4 A;  4MCU A;  5HR0 A;  1HNA A;  3DRN A;  1K0D A;  1ZMA A;  3Q19 A;  2J23 A;  1WOU A;  3EC3 A;  4G9H A;  1O73 A;  4OCF A;  4O32 A;  2L6D A;  1SK0 A;  4KE3 A;  1HYU A;  3GUR A;  2FCH A;  2ON7 A;  4V2M A;  2H0I A;  2XPD A;  1B48 A;  6GSU A;  3QDN A;  5LD0 A;  5IMC A;  5DAK A;  2CV4 A;  4N10 A;  3TJK A;  3F8U A;  1PGT A;  2H1A A;  5FT3 A;  2H72 A;  5CAX A;  1Z3E A;  4EVM A;  1DE1 A;  5IOX A;  3C71 A;  1XWB A;  3GMF A;  1F37 A;  1WRY A;  2KUC A;  2IMD A;  1R26 A;  2K9F A;  3KZQ A;  2WJU A;  4EE0 A;  1GL8 A;  3GTU B;  3VPQ A;  3S9F A;  2L6C A;  5B7C A;  2ZNM A;  1ZCP A;  4MA9 A;  2JZS A;  2G0F A;  3M0F A;  4BVX B;  1JLV A;  3WT1 A;  2IPA A;  2C0G A;  4JRR A;  4WR5 A;  1YF1 A;  4OD7 A;  2GSS A;  2GGT A;  4Q5N A;  1SD8 A;  4OMV A;  4POM A;  1ZL9 A;  2X99 A;  3L9V A;  4ILF A;  2DJ3 A;  2IFQ A;  2P5Q A;  2MBT A;  4K0G A;  1FHE A;  4BVY A;  1U3A A;  4K9Z A;  3I6A A;  1XCC A;  3F4T A;  1WMJ A;  3C8E A;  5JCU A;  2LJR A;  1U3I A;  1MDK A;  5BRT A;  1ON4 A;  1XWK A;  3P8W A;  4QQ7 A;  1THX A;  5F05 A;  1VF2 A;  5CRG A;  4TVE A;  1GSE A;  5J9B A;  1J08 A;  5ECI B;  4ID0 A;  2EIO A;  4L5O A;  17GS A;  4PNF A;  1AAZ A;  3BCI A;  3PPU A;  2DJK A;  3IOS A;  6GST A;  5G5E A;  7GSS A;  5ABR A;  2DKH A;  3M3M A;  3HJP A;  3QCP A;  3H8Q A;  1QFN A;  2C1Y A;  1I5G A;  2PPT A;  3IV4 A;  2HSY A;  4OCE A;  5ELA A;  3RDW A;  4KCA A;  3F4R A;  3TKS E;  1Z6M A;  4IVF A;  1VF4 A;  1AXD A;  3MDK A;  2X4A A;  2KOK A;  5D96 A;  1OKD A;  5HFI A;  5JWO B;  4HUA A;  2VM2 A;  3ZIJ A;  4FH8 A;  1OC8 A;  1N2A A;  1JFU A;  3E0U A;  4PUR A;  2BJX A;  3A2X A;  4MJB A;  3BOA A;  1DUG A;  3IRA A;  3A3T A;  3ZYW A;  5DDL A;  5DJL A;  2H6Z A;  4KCE A;  4D73 A;  1T00 A;  1WP0 A;  5AIX A;  1SKS B;  2M72 A;  4ICY A;  3HYP A;  3TKS C;  1WJK A;  2V2G A;  1BED A;  1PRX A;  4XIH A;  2ALB A;  2MMO A;  2REM A;  2C3N A;  1WE0 A;  3L4N A;  3HVX A;  1DE2 A;  3JCM L;  3DVX A;  4JED A;  2O85 A;  5IIZ A;  2ES7 A;  1VF1 A;  4MP4 A;  2CVK A;  1XXU A;  4P3Y B;  1FB0 A;  1G7O A;  2N5B A;  1PN0 A;  3KTL A;  1THO A;  4XS1 A;  3UMA A;  4HSC X;  1G6Y A;  2MBS A;  2RII A;  2LV3 A;  2HXK A;  1XVW A;  2FWE A;  2PVQ A;  4JR6 A;  3DEX A;  3RBT A;  2JAC A;  11GS A;  1R5P A;  2HZF A;  4ZXG A;  3APQ A;  4GRF A;  5B6N A;  2GQM A;  3GV1 A;  4K2X A;  4DSS A;  2FWH A;  3FR9 A;  2DJ1 A;  5A4V A;  4DSQ A;  3KXO A;  1QXH A;  1FW1 A;  2WB9 A; 
#chains in the Genus database with same CATH homology
 1WPI A;  1TTZ A;  4RQR A;  2GT6 A;  4Z7X A;  4KH7 A;  5ECQ B;  4EC0 A;  2KHP A;  4JZQ A;  1O6J A;  4NHW A;  1SD9 A;  2YNX A;  1TK0 B;  1G7E A;  2VL2 A;  1Q98 A;  4K7N A;  4WF5 A;  1M0U A;  2GSQ A;  4X4J A;  4LL1 B;  5LNK e;  18GS A;  1MD3 A;  2I4A A;  3GTU A;  3IAM 2;  2CA8 A;  3TRP A;  5COH A;  1GH2 A;  2HFD A;  3UAR A;  4POB A;  1R7H A;  3CRU A;  2A4V A;  4BVX A;  1JZR A;  1MDI A;  2NVL A;  2DJ2 A;  2GZZ A;  3L78 A;  2LST A;  4WEY A;  4LLR A;  2H1G A;  2O87 A;  4Z2U A;  1TJD A;  1JZD A;  1XWG A;  5IPH A;  4NV5 A;  1M2B A;  1FOH A;  1UVZ A;  4AGS A;  3OR5 A;  4MF5 A;  5IMZ A;  2KLX A;  2V1M A;  5IMA A;  3GFK A;  1OYJ A;  3M1G A;  2L4C A;  4FIW A;  4G0I A;  3H93 A;  2CAI A;  2RUE A;  2LQQ A;  3C7M A;  4ISD A;  2VCZ A;  2H74 A;  2O89 A;  4G0K A;  4F0B A;  3FZ5 A;  5C00 A;  4DSR A;  2MMA A;  5IPG A;  4XS6 A;  3QFA C;  2JU5 A;  2NBS A;  2BTO T;  5DVB A;  1NHY A;  4KUN A;  3C73 A;  1YF0 A;  1PA3 A;  12GS A;  1HNB A;  3ME8 A;  1EP7 A;  4O5U A;  5IM9 A;  4EDZ A;  1TI1 A;  2WUL A;  2E2M A;  1FVJ A;  2L4Q A;  4MF7 A;  3HZ4 A;  4ECC A;  1DBY A;  4KF9 A;  3C1S A;  3HD5 A;  1F9M A;  1MDJ A;  3IHQ A;  4HZ4 A;  1EEJ A;  3TJF A;  4J2F A;  3A5W A;  1BG5 A;  2UZ8 A;  3EU4 A;  3CBU A;  5G2Z A;  5A4W A;  1XBS A;  2YP6 A;  3FMW A;  5J5N A;  5FWG A;  3G7I A;  2VCQ A;  1GLQ A;  4KB3 A;  3GIX A;  4TRX A;  1EGR A;  4IGJ A;  4ZB9 A;  6GSY A;  3F9U A;  1KNG A;  1AQW A;  1O8W A;  2JZR A;  2DLX A;  2HYX A;  3EU3 A;  3Q6O A;  2FA8 A;  4GSN A;  4BWQ A;  19GS A;  3ERF A;  4I8B A;  4IEL A;  5IO2 A;  3ZFB A;  2HRN A;  2FWF A;  2LS5 A;  2I3Y A;  1GUH A;  1X9S B;  2BMX A;  2D2Z A;  4MNN A;  1CQG A;  2JSZ A;  2I9H A;  2WS2 A;  1AQV A;  4WBJ A;  4FYB A;  4MMM A;  3M9J A;  1T7P B;  3FZ9 A;  3CSI A;  3KTB A;  1EP8 A;  2HI7 A;  5J3R A;  4NAX A;  3GST A;  4GCI A;  2XPE A;  2K8S A;  4MPF A;  4HS1 A;  2LQO A;  1K0M A;  3U5R E;  2DBC A;  3I43 A;  2WCI A;  2LUS A;  2QSI A;  1B4P A;  5CYY A;  1GSD A;  4IN0 A;  1QQ2 A;  2E2G A;  2OA7 A;  3N9J A;  1LJR A;  4KDY A;  8GSS A;  5B8A A;  3FW2 A;  5EPF A;  2YJH A;  3LOR A;  4PGT A;  1HD2 A;  4N11 A;  3KEB A;  5DBQ A;  1N8J A;  1O8X A;  4L5L A;  4JE1 A;  3ZFL A;  3RPN A;  2WFC A;  5G1L A;  4IQ1 A;  4MLY A;  1RW1 A;  5KN3 A;  3IK9 A;  2QC7 A;  2R6K A;  3L9S A;  4I5Q A;  2RM5 A;  3CSH A;  4PX1 A;  1ZZY A;  1GUM A;  2X49 A;  1SL1 B;  3UBL A;  2E0Q A;  4X0X A;  3WYW A;  5E59 A;  1GNW A;  2HRA A;  3TCO A;  2QA2 A;  2L5O A;  1XOB A;  5HR2 A;  2LRC A;  3QAW A;  1EWX A;  1XWA A;  3ZVJ A;  2G2Q A;  5HQP A;  2H76 A;  3WGE A;  5CNW A;  3VWV A;  2B6M A;  4EL1 A;  3F4S A;  4HJ2 A;  6GSV A;  4LMW A;  3PIN A;  3DXB A;  4I2T A;  2YN1 A;  4YKG A;  3LYK A;  2IJY A;  4G0L A;  5AIV A;  4DSS B;  1QUW A;  2IL3 A;  2IN3 A;  3ERG A;  1FOV A;  5IMV A;  1TK5 B;  1NHO A;  5HFG A;  1IYH A;  4K8M A;  2PU9 C;  2I81 A;  4MH3 A;  1SK1 A;  5ECR B;  5CRH A;  1QK8 A;  4ULX A;  2C4J A;  1X9M B;  2B3S A;  2HSM A;  2RLI A;  4HQZ A;  2HE3 A;  3W6G A;  4IQA A;  1MTC A;  1MEK A;  3NIV A;  5ECS A;  2OE0 A;  1USB A;  4K1F A;  2N5F A;  2FY6 A;  4Z2R A;  2P5R A;  4USS A;  4CHS A;  1GUK A;  4OFT A;  3H1N A;  1V58 A;  2GSR A;  4RI6 A;  5AIS A;  4XHM A;  5L71 A;  5D9X A;  4BL7 B;  3HXS A;  2CVB A;  4AJ8 A;  1JLW A;  3TOT A;  3DYR A;  1TP9 A;  3GKX A;  4K0N A;  1A0F A;  2AUV A;  3MAK A;  5DCG A;  3PR8 A;  13GS A;  1O85 A;  1SJI A;  5GZZ B;  4ECI A;  2YV7 A;  2LRT A;  3QD9 A;  5C04 A;  1V57 A;  4Q5Q A;  4PXO A;  14GS A;  3ZIV A;  2R0G A;  3KMO A;  4O5R A;  3UIW A;  4OFN A;  4YKF A;  1FB6 A;  3G7Y A;  3P7X A;  2DJ0 A;  3APS A;  1F6M C;  3GYK A;  2EIQ A;  4PTS A;  2VD0 A;  3F6D A;  5ELG A;  2GTU A;  1K3Y A;  3SWL A;  1FAA A;  4WET A;  4ZB8 A;  4X1U A;  4IJ3 A;  4LL4 B;  4TN8 A;  5HR3 A;  4ECJ A;  5ECP B;  4ECB A;  5A5K A;  2B1L A;  3US3 A;  2VL9 A;  4F03 A;  1F3B A;  3DGQ A;  9GSS A;  2EC4 A;  3ISO A;  4K5R A;  3P2A A;  2R3X A;  2H6Y A;  4K6X A;  1T3B A;  1TRU A;  1K0N A;  1M7T A;  1XW6 A;  2VD1 A;  4HU9 A;  2FHE A;  2FLS A;  1V2A A;  3ERW A;  1NSW A;  5EL8 A;  3TKS A;  1Q4J A;  3RHB A;  1SEN A;  2PMT A;  2HRK A;  4YQV A;  4TR3 A;  2A2P A;  4IW9 A;  3GHA A;  1R4W A;  4KND A;  2YAN A;  3HJO A;  1YJ6 A;  4N0Z A;  5FHI A;  2M46 A;  3A5I A;  1FO5 A;  1QMV A;  5F0G A;  4TR1 A;  3LYP A;  1S3D A;  4RI7 A;  5HFK A;  2H71 A;  1PQN A;  3TKQ A;  4FYC A;  3H4K A;  2M80 A;  3TKP A;  5EVO A;  4ZIJ A;  2OAD A;  2VLV A;  3UL3 A;  2AHE A;  2ON5 A;  2CQ9 A;  2R5G A;  1YEP A;  4KDU A;  5HR1 A;  4K5S A;  2YZH A;  1A2J A;  3PGT A;  3ZZX A;  2X64 A;  1TRW A;  3GSS A;  22GS A;  4J57 E;  4BA7 A;  3GKN A;  2AAW A;  2H0G A;  2DKI A;  2OAC A;  4MZB A;  3GH6 A;  1BQ7 A;  3W8S A;  3IC8 A;  4NHZ A;  2YCD A;  3HVV A;  1B9X C;  1G6W A;  4TR4 A;  4FQU A;  3BD2 A;  2AV4 A;  4PUF C;  1A24 A;  1BAY A;  2ZCT A;  2I1U A;  2IMF A;  2V6K A;  3HJM A;  5H5R A;  2C3Q A;  2OBK A;  1ZGN A;  3IR4 A;  3EVI A;  3VFI A;  2C3T A;  4OO4 A;  2F3M A;  1HNC A;  3IHG A;  2LNS A;  2N5A A;  4TXO B;  2K18 A;  5H5S A;  3ME7 A;  1FG4 A;  4LMV A;  1Z5Y E;  4GQF A;  3E9J B;  4KDX A;  2CAQ A;  4YQM A;  2OKA A;  4N0V A;  1YY7 A;  3A2W A;  5EY6 A;  5IMF A;  3CRT A;  1ERT A;  3F6F A;  1Z7R A;  2VIM A;  4L0U A;  2H19 A;  2VO4 A;  5JWR B;  5KOX A;  3IK7 A;  2K6V A;  4ACS A;  3DVW A;  5G30 A;  1BX9 A;  3D6I A;  5AN1 A;  4K7O A;  3VI5 A;  1QGV A;  1J9B A;  2MMN A;  5GSS A;  3HVS A;  3P90 A;  3WT2 A;  2FGX A;  1IYI A;  3WGX A;  1PD2 1;  3LEF A;  1TKD B;  2HLS A;  3CYN A;  1ML6 A;  2VL2 C;  2HZE B;  2DC5 A;  1XIY A;  2B5Y A;  5IQY A;  1TXX A;  4EXJ A;  3MSZ A;  4HI7 A;  3BCK A;  3HHV A;  1V98 A;  5GAP D;  2E7P A;  2JSY A;  3LW9 A;  1SKR B;  4HJM A;  3VWX A;  2C0F A;  2B7J A;  3FHK A;  4V1A p;  2H70 A;  5D93 A;  4BL7 A;  3W8J A;  1MD4 A;  4NWY A;  4NV2 A;  4GF0 A;  3TOU A;  3LWA A;  3QMX A;  1Z7P A;  2ZUP A;  4CW9 A;  1EV9 A;  3HKR A;  2CT6 A;  3ZIT A;  2IME A;  1A0R P;  2X8C A;  5ECK B;  2R2J A;  3KCM A;  3DD3 A;  1U87 A;  1ERV A;  5B6M A;  2LEG A;  2VM1 A;  16GS A;  3QAG A;  4WBR D;  5B8B A;  1YZX A;  2JL4 A;  4NXI A;  2A4H A;  1A23 A;  3UBK A;  3NZN A;  2DMM A;  2JAD A;  5INY A;  1K0B A;  3KJY A;  1ZYQ B;  1OE7 A;  1ZYN A;  1SYX A;  2YWI A;  4FO5 A;  5DQY A;  1A2L A;  3R3E A;  5BMU A;  3WD6 A;  3ZRD A;  1KBN A;  2TIR A;  1B9Y C;  1BJX A;  1NM3 A;  1RK4 A;  4Q5R A;  3LGC A;  3FR6 A;  4KX4 A;  1V9W A;  1S3A A;  3KD0 A;  1V40 A;  1OAZ A;  4MJC A;  2CX3 A;  1OE8 A;  4DVC A;  4OFM A;  5ECH B;  1GSQ A;  2LNT A;  3EMX A;  2H66 A;  3J7Y k;  1KTE A;  2OJL A;  1WWJ A;  1EOG A;  2WRT A;  3O6T A;  2TRC P;  1M99 A;  2X8G A;  4PUA A;  4GXZ A;  1KEB A;  1TOF A;  4KGI A;  1EGO A;  2F51 A;  4IJI A;  4BPY A;  4XTS A;  3ED3 A;  3TJG A;  3FZ4 A;  10GS A;  3I69 A;  3TJB A;  2HRF A;  4F82 A;  1Z9H A;  1TI3 A;  4MK3 A;  1SKW B;  4YAP A;  3CTF A;  1H4O A;  5CP1 A;  3D4T A;  4MAB A;  3CXG A;  5KN1 A;  1M2A A;  4F2I A;  1UN2 A;  1EEM A;  2AB6 A;  2FUG 2;  3O3T A;  4O7H A;  3VK9 A;  5F07 A;  3VWW A;  3IXR A;  3GN3 A;  3TDG A;  3WGD A;  1PKZ A;  4IHU A;  1VGL A;  2PVO C;  2IMK A;  4YH2 A;  2GQL A;  3KGK A;  4N30 A;  2LJA A;  3DML A;  3M8N A;  1OC9 B;  3RHC A;  3Q74 A;  4HOJ A;  3FY7 A;  4GLT A;  3FZA A;  4A5P A;  2H0H A;  1A8L A;  4DEJ A;  4TXO A;  1B8X A;  1BYE A;  3RPP A;  2C8U A;  4TR1 B;  3VLN A;  4AJ6 A;  3GKK A;  4ZL9 A;  4V2L A;  1EOH A;  5IOW A;  5G1K A;  3CMI A;  2GZP A;  1XVQ A;  1O81 A;  2C80 A;  5AGY A;  3BBY A;  1PKW A;  4YAV A;  3M9K A;  4HDE A;  2FA4 A;  2DSA A;  1X5D A;  3LJR A;  2Z9S A;  4AF2 A;  4HZ2 A;  4ZBA A;  3D0Z A;  1UA5 A;  4CY6 A;  4BWS A;  4CY8 A;  2NDO A;  3KP8 A;  4XRD A;  5JCG A;  2O8V B;  3A2V A;  2FD3 A;  4X43 A;  5F06 A;  6GSX A;  1VRS D;  3BJ5 A;  4KAE A;  1PN9 A;  2HZE A;  3ZVJ D;  1XW9 A;  1GLP A;  3ZRE A;  4TOP A;  4G19 A;  2YWN A;  5GST A;  4Z2T A;  2MYG A;  3EIN A;  3C1R A;  3KIJ A;  1ZYE A;  1TDI A;  3E3E A;  2DML A;  4WXT A;  6GSW A;  4IBP A;  4I97 A;  1JHB A;  2L57 A;  3GL3 A;  4EIP A;  1EZK A;  3UOM A;  3LSZ A;  2RUF A;  1AQX A;  6GSS A;  4XS4 B;  2PBJ A;  1M9B A;  3TRX A;  1A8Y A;  3UVT A;  5ID2 B;  2VOC A;  5LCZ A;  1AUC A;  3CTG A;  3DWV A;  3ZL5 A;  3EWL A;  3G9B A;  3I9V 2;  1ZOF A;  1GP1 A;  3KH7 A;  5IMD A;  2V32 A;  2F9S A;  4AJ7 A;  2LRN A;  2QKE A;  3ZLP A;  4MF6 A;  1PX7 A;  2OE3 A;  2VL3 A;  4K2D A;  5CRD A;  1ERW A;  5DJM A;  4POL A;  4F9Z A;  4KW6 A;  5CO3 A;  4KSM A;  5ECL B;  1GSF A;  4HEA 2;  3SBC A;  1K3L A;  2HNL A;  1ILO A;  2YPM A;  1U88 A;  2HT9 A;  2IMI A;  4MJE A;  5ECN B;  2YJ7 A;  2WGR A;  5G5F A;  2DJJ A;  4EDY A;  1GSU A;  1R5A A;  2YWO A;  3TGZ A;  2IWT A;  4F0C A;  5D9W A;  1K0C A;  4I6X A;  3QFB C;  3D5J A;  4Q5F A;  3F3R A;  1X5C A;  4MZC A;  2NTO A;  3GKM A;  5DQS A;  2H75 A;  2VCW A;  1NW2 A;  4PNG A;  1DSB A;  3FKF A;  4O92 A;  3UAP A;  3U6V A;  3LQ7 A;  1A2M A;  1T1V A;  1SJZ A;  4TW5 A;  1SL2 B;  2FNO A;  2H6X A;  3FEU A;  1GTI A;  1PL1 A;  2VCT A;  4GQC A;  2PER A;  3F3Q A;  3ZML A;  4IS0 A;  1LU4 A;  1URM A;  4ZL8 A;  3D21 A;  5KEJ A;  2B5E A;  2H8L A;  3MYD A;  3QAV A;  4G2E A;  3L0H A;  2HSH A;  1EV4 A;  2X8H A;  2VLU A;  3GX8 A;  3Q18 A;  2PN8 A;  3MWH A;  2EIR A;  4FYU A;  3QPM A;  3QR6 A;  1W89 A;  2QGV A;  1OC9 A;  2H73 A;  1XWC A;  2PWJ A;  3GA4 A;  4EF0 A;  2CVD A;  5D73 A;  1Y6E A;  4TKY A;  2A2R A;  4QL9 A;  4MDC A;  4PQH A;  1XOA A;  5JCW A;  4WF4 A;  2YOI A;  4QL7 A;  3QOU A;  1YKA A;  4MPG A;  5H5Q A;  1SJ6 A;  5A4U A;  2R37 A;  2VLT A;  3L9U A;  2DIZ A;  3EYT A;  2QA1 A;  1XW5 A;  4GWR A;  2AJQ B;  5IO0 A;  3UVH A;  2L59 A;  4HU7 A;  3IE3 A;  4HQS A;  5DAL B;  5KOW A;  3D4M A;  2YV9 A;  1X5E A;  2LJK A;  1AW9 A;  2XBI A;  2TRX A;  2O7K A;  3EE2 A;  2F8A A;  2RM6 A;  3N5O A;  2WDU A;  3FR3 A;  1HQO A;  4I2U A;  4K7I A;  1GNE A;  4PQ1 A;  1M2D A;  4ZBB A;  2A2S A;  1LBK A;  3IDV A;  3KH9 A;  2P0G A;  2K8V A;  1JZW A;  3DIE A;  3MIX A;  3KP9 A;  4KA0 A;  5J41 A;  1PX6 A;  3CSJ A;  3HZ8 A;  3V1W A;  2YWM A;  4WR4 A;  4POK A;  3VPT A;  1W4V A;  2PUK C;  2FWG A;  1OKT A;  3HY2 A;  1WIK A;  3LXT A;  4EIQ A;  1TW9 A;  1M9A A;  1TK8 B;  4XS4 A;  2MMZ A;  4MZW A;  5ID2 A;  1RQM A;  3GUS A;  4GST A;  4GTU A;  1GSS A;  3LXZ A;  2P31 A;  5JWQ B;  1YKC A;  1JZO A;  2KP1 A;  4O5Q A;  1AIU A;  2F8F A;  3TUE A;  2GZY A;  2YZU A;  1TRS A;  3AY8 A;  4JU5 A;  5ECO B;  1H75 A;  1CQH A;  1YDK A;  4ZBD A;  2VUP A;  3DKS A;  1YQ1 A;  3FK8 A;  20GS A;  3O76 A;  3K8N A;  2KP2 A;  4E8E A;  2VAF A;  3KMN A;  2WZ9 A;  2LTK A;  3HDC A;  4J56 E;  2B1K A;  1TU8 A;  1G0T A;  1SYR A;  3F63 A;  1GSY A;  1YEX A;  2H30 A;  4TR0 A;  4MH2 A;  5CRE A;  3EMP A;  1PMT A;  1UC7 A;  2VCV A;  3FYG A;  3ZTL A;  2L5L A;  1I9D A;  3ZMK A;  1O7U A;  5DAK B;  3TRQ A;  4LA1 A;  4IKH A;  2CZ2 A;  3GRX A;  1VF3 A;  5F8B A;  2H1D A;  1OVN A;  5D8I A;  2CX4 A;  2GQK A;  1XFL A;  4L8E A;  1GUL A;  4G10 A;  2CZ3 A;  3TJJ A;  3HA9 A;  3IA1 A;  4EUY A;  5J4U A;  4E8H A;  5CRW A;  2JZT A;  5G31 A;  1Z6N A;  3GH9 A;  1AC1 A;  1TRV A;  4OO5 A;  4JBB A;  1GTB A;  1E2Y A;  3VUR A;  4MJA A;  4XCS A;  1Y25 A;  3J7Y b;  4EKZ A;  3LFL A;  3IPZ A;  2AYT A;  2PGT A;  3R2Q A;  5DCH A;  3FRC A;  1PL2 A;  2XHF A;  2IFQ B;  4YQU A;  3UJ1 A;  4JR4 A;  4NPB A;  4BVY B;  2GVP A;  1XPV A;  4ZIL A;  1B4Q A;  1S3C A;  4CDO A;  2OBI A;  1ABA A;  1XZO A;  1K0A A;  3F0I A;  3HCZ A;  1OC3 A;  2R0C A;  1SK2 A;  1T4Z A;  4RUV A;  4V2N A;  1SL0 B;  4XRA A;  2VCX A;  5J9C A;  2B5X A;  4KSO A;  4OWY A;  2GLR A;  5D9V A;  1K0O A;  5ECM B;  3TKR A;  1ERU A;  5KN2 A;  3G7J A;  5KN0 A;  2V41 A;  4PQI A;  1TU7 A;  3GNJ A;  2GDR A;  3RAZ A;  2GT5 A;  3TB2 A;  1J0F A;  4IP1 A;  3GX0 A;  2R0P A;  3KM6 A;  3VWU A;  4TXV A;  4V1A g;  5DAL A;  2C0D A;  2MZC A;  2H01 A;  5E4W A;  5ENU A;  3NOF A;  1U6T A;  1T8E B;  2R4V A;  3LG6 A;  2XBQ A;  4ML6 A;  3H79 A;  3GL5 A;  3MNG A;  1ZYP A;  4L0W A;  1FVK A;  2LKU A;  1F3A A;  4ML1 A;  1X0R A;  3VI7 A;  2C0E A;  3APO A;  1ACV A;  2XC2 A;  2GST A;  4WKW A;  3EPT A;  3EUR A;  4GSS A;  4RQX A;  3IBH A;  4EO3 A;  1GTU A;  2DIY A;  4NMU A;  2IIY A;  4D73 B;  4ZL7 A;  1E6B A;  1C72 A;  1GWC A;  2H1B A;  1X9W B;  2NPB A;  3IAS 2;  3D22 A;  4H86 A;  1ST9 A;  3UEM A;  1K3O A;  1T4Y A;  2B7K A;  5D9T A;  5GAN D;  2J9H A;  1F2E A;  1PSQ A;  3PH9 A;  2V6O A;  4IP6 A;  4ZB6 A;  2GS3 A;  1GTA A;  2OE1 A;  1SU9 A;  1GRX A;  3IC4 A;  4MCU A;  5HR0 A;  1HNA A;  3DRN A;  1K0D A;  1ZMA A;  3Q19 A;  2J23 A;  1WOU A;  3EC3 A;  4G9H A;  1O73 A;  4OCF A;  4O32 A;  2L6D A;  1SK0 A;  4KE3 A;  1HYU A;  3GUR A;  2FCH A;  2ON7 A;  4V2M A;  2H0I A;  2XPD A;  1B48 A;  6GSU A;  3QDN A;  5LD0 A;  5IMC A;  5DAK A;  2CV4 A;  4N10 A;  3TJK A;  3F8U A;  1PGT A;  2H1A A;  5FT3 A;  2H72 A;  5CAX A;  1Z3E A;  4EVM A;  1DE1 A;  5IOX A;  3C71 A;  1XWB A;  3GMF A;  1F37 A;  1WRY A;  2KUC A;  2IMD A;  1R26 A;  2K9F A;  3KZQ A;  2WJU A;  4EE0 A;  1GL8 A;  3GTU B;  3VPQ A;  3S9F A;  2L6C A;  5B7C A;  2ZNM A;  1ZCP A;  4MA9 A;  2JZS A;  2G0F A;  3M0F A;  4BVX B;  1JLV A;  3WT1 A;  2IPA A;  2C0G A;  4JRR A;  4WR5 A;  1YF1 A;  4OD7 A;  2GSS A;  2GGT A;  4Q5N A;  1SD8 A;  4OMV A;  4POM A;  1ZL9 A;  2X99 A;  3L9V A;  4ILF A;  2DJ3 A;  2IFQ A;  2P5Q A;  2MBT A;  4K0G A;  1FHE A;  4BVY A;  1U3A A;  4K9Z A;  3I6A A;  1XCC A;  3F4T A;  1WMJ A;  3C8E A;  5JCU A;  2LJR A;  1U3I A;  1MDK A;  5BRT A;  1ON4 A;  1XWK A;  3P8W A;  4QQ7 A;  1THX A;  5F05 A;  1VF2 A;  5CRG A;  4TVE A;  1GSE A;  5J9B A;  1J08 A;  5ECI B;  4ID0 A;  2EIO A;  4L5O A;  17GS A;  4PNF A;  1AAZ A;  3BCI A;  3PPU A;  2DJK A;  3IOS A;  6GST A;  5G5E A;  7GSS A;  5ABR A;  2DKH A;  3M3M A;  3HJP A;  3QCP A;  3H8Q A;  1QFN A;  2C1Y A;  1I5G A;  2PPT A;  3IV4 A;  2HSY A;  4OCE A;  5ELA A;  3RDW A;  4KCA A;  3F4R A;  3TKS E;  1Z6M A;  4IVF A;  1VF4 A;  1AXD A;  3MDK A;  2X4A A;  2KOK A;  5D96 A;  1OKD A;  5HFI A;  5JWO B;  4HUA A;  2VM2 A;  3ZIJ A;  4FH8 A;  1OC8 A;  1N2A A;  1JFU A;  3E0U A;  4PUR A;  2BJX A;  3A2X A;  4MJB A;  3BOA A;  1DUG A;  3IRA A;  3A3T A;  3ZYW A;  5DDL A;  5DJL A;  2H6Z A;  4KCE A;  4D73 A;  1T00 A;  1WP0 A;  5AIX A;  1SKS B;  2M72 A;  4ICY A;  3HYP A;  3TKS C;  1WJK A;  2V2G A;  1BED A;  1PRX A;  4XIH A;  2ALB A;  2MMO A;  2REM A;  2C3N A;  1WE0 A;  3L4N A;  3HVX A;  1DE2 A;  3JCM L;  3DVX A;  4JED A;  2O85 A;  5IIZ A;  2ES7 A;  1VF1 A;  4MP4 A;  2CVK A;  1XXU A;  4P3Y B;  1FB0 A;  1G7O A;  2N5B A;  1PN0 A;  3KTL A;  1THO A;  4XS1 A;  3UMA A;  1G6Y A;  2MBS A;  2RII A;  2LV3 A;  2HXK A;  1XVW A;  2FWE A;  2PVQ A;  4JR6 A;  3DEX A;  3RBT A;  2JAC A;  11GS A;  1R5P A;  2HZF A;  4ZXG A;  3APQ A;  4GRF A;  5B6N A;  2GQM A;  3GV1 A;  4K2X A;  4DSS A;  2FWH A;  3FR9 A;  2DJ1 A;  5A4V A;  4DSQ A;  3KXO A;  1QXH A;  1FW1 A;  2WB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...