4GQQA

Human pancreatic alpha-amylase with bound ethyl caffeate
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Order and disorder: differential structural impacts of myricetin and ethyl caffeate on human amylase, an antidiabetic target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4gqqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4gqqA01
4GI6A 1CXHA 2BVDA 4AZCA 1CEOA 4ACYA 1HJWA 4AD1A 2ZX7A 4JCLA 2Y8KA 4L4OA 3CUFA 3WEOA 1MW2A 2YBTA 1E72M 1WZMA 3ZO9A 1L0PA 3SCNA 1E1EA 3GBEA 3LRMA 1FH9A 1W1PA 3MMWA 1SMDA 1BGGA 1M04A 3J7HA 2FGZA 5CQ1A 4ZE4A 3CZEA 4S3KA 2DIJA 1CECA 3MUIA 3MV11 4MDOA 3BAYA 3BLKA 1JDAA 2D22A 1HL9A 4YPJA 1XH1A 1OT2A 1V6XA 1WP6A 2OW7A 1ZS2A 5I77A 4UNIA 2WC7A 3WIJA 4EKJA 3PHAA 3KZSA 4BA0A 1E6ZA 4W84A 3HG5A 3WL0A 2WVTA 3WUBA 5E6ZA 3D5HA 3U5YA 3MSDA 5IHRA 2XFYA 5GNZA 2WAGA 1JFHA 4UQAA 1WDSA 4MNLA 4WJXA 2QMKA 4GINA 1I1XA 2QHAA 1VFUA 3QGVA 3CHDA 2DT3A 5DT7A 1BYCA 4MB1A 3VX0A 1O7DC 1DP0A 4UFJA 5EB8A 4HZ8A 1V08A 1B31A 1HJQA 1JFXA 3W27A 3NIYA 1CIUA 3NJ3A 3KLLA 4DUVA 1CZ1A 1E55A 1LLOA 3AS3A 2VX5A 2O92A 2WHKA 4MNJA 1QHPA 1UR2A 3K4DA 1GOIA 4ML4A 3F5JA 2E3ZA 2GJRA 3PTMA 5E0CA 1JXJA 4AWEA 1DWIM 1XRVA 1KGWA 2E8YA 3I3EA 3OLIA 3ARTA 4F9JA 4AZHA 2ZX9A 3D50A 1QOXA 2XGBA 3T2QA 5DFAA 3OZPA 3UG5A 5A6BD 1V3LA 3LPOA 4JFSA 1OB0A 4GIAA 2QF8A 3QOKA 1PAMA 2VCBA 3PZMA 4AZIA 1C90A 2WPGA 2O9RA 1RP8A 1WCGA 1B2YA 3PZNA 3W0KA 1MFVA 1QHZA 2IUZA 1V3MA 3I3DA 1QPKA 1KXHA 3IAPA 3PZQA 1TQUA 3L4TA 3K4AA 1XGZA 4D6JA 4PMYA 4PUEA 4UOQA 1GNXA 1TFVA 4FLOA 4AY1A 3ZSTA 2DIEA 4BCEA 1E6SM 1M01A 1QI2A 4TX8A 2WMIB 1QW9A 4KMQA 2F18A 3T0DA 1NWSA 3CLWA 5FCZA 1WPCA 1PEZA 1KBBA 1XH0A 1QI0A 4BF7A 1V02A 2XN1A 5AY7A 3JUGA 2Y5EA 3KE0A 4W89A 3U5UA 2VNCA 3VO0A 2BS9A 2J79A 1IZJA 1J11A 1UZ1A 1M53A 3MUZ1 4W7UA 3VD4A 1VFMA 3ALFA 3MUY1 1CXIA 1CGUA 2IGTA 4LYQA 3APGA 4UFHA 3CZLA 3AIWA 3SUVA 3MKKA 2BHYA 1U2YA 4ZFMA 1GONA 1GW1A 3WD4A 2WLYA 3WUFA 1JIBA 5ABHA 2BXZA 1UKSA 4UQEA 2BY3A 1ZBWA 3EBVA 3GZAA 2WBGA 4V28A 4QCEA 2CXGA 3GXTA 5A8QA 2ZUVA 3A4XA 3W24A 6TAAA 1XSKA 3SCPA 2GK1B 4M80A 1DHKA 1K6AA 1V3KA 5CXPA 4W86A 4ZXOA 3K8MA 4QFUA 3AZRA 5ECUA 4AMCA 4OIFA 1J0HA 2UY4A 2Y24A 1ZBKA 3TA9A 3EYPA 3BVWA 5DT5A 4ATLA 1ISXA 3A47A 3OGRA 1C8YA 4E8DA 2ZXQA 1UH2A 3CTTA 1J0YA 3W25A 3AOFA 3WUEA 2BY0A 3N04A 4LYRA 2YL5A 3KLKA 4S3JA 1UKOA 4D71A 2B31A 3PZVA 2VZUA 3VPLA 3ZSSA 4QLLA 3N15A 4JIEA 3W38A 4TVCA 4X0VA 2ESCA 5EFFA 3W53A 2D20A 1EQCA 5FL0A 4NZCA 3CZGA 1V3JA 2JEQA 4AIUA 3ZIZA 4HOWA 3AZSA 3AHYA 1E71M 1QX1A 5JUVA 1GOOA 3KL3A 4PMOA 4JCMA 1GPFA 2G3NA 1MWOA 3H53A 4TTGA 2J47A 1ZBCA 1QI4A 2Y8VA 2PI6A 3MU7A 4JAWA 1C3FA 2QV4A 4CVWA 2VRKA 3BUPA 3WDRA 4K68A 3RPMA 2HISA 1KGUA 1E6PA 2QPSA 4HA4A 1EOMA 4TTUA 5KEZA 3LX9A 2WCAA 2RGLA 1EDTA 1EXPA 1B3WA 3BUIA 1CXFA 4F79A 2CITA 4PYSA 2C8NA 3EDEA 5C8BB 1H49A 1NP0A 1WE5A 2DSKA 1OT1A 4AIOA 1HJUA 4HU0A 1CENA 2CEQA 1R86A 2A3HA 3WQ4A 1FH7A 1HNYA 3H55A 4J3VA 4RL3A 4A3YA 4AMXA 2XHYA 4W93A 5AC4A 2ZX5A 1BHGA 1O6IA 1UR0A 3WEMA 2GUYA 1D7FA 1PIGA 1OIFA 1UWRA 2VMFA 3BMVA 4AD2A 3L4XA 3DX1A 2WYSA 3GXNA 1CXEA 2UY2A 5E6YA 5D9PA 4RE3A 5KZ6A 3CZNA 1UR1A 1X1NA 3ZJ8A 2X1IA 4UQ9A 3K46A 3N12A 3WN6A 1P6WA 3POHA 1EO5A 4WKFA 2G41A 4D6IA 1H5VA 1VF8A 3TTQA 1XV8A 4JKMA 3AXIA 3HJEA 2VR4A 1C7SA 3ZJKA 2VJXA 2W92A 4N42A 2XWEA 4PCTA 4E2OA 2Y2WA 4GQQA 1CDGA 3U7BA 1W1VA 5FL1A 3BAJA 4UOJA 2WK2A 2XM1A 4OZOA 3SCQA 2C0HA 2YDRA 1MW3A 2DT0A 2PB1A 1UD5A 1GHRA 5I79A 7TAAA 4U31A 4TOQA 3M6DA 3FXYA 5M17A 1GOWA 3SCWA 1K9DA 1TCMA 1ODUA 1LG2A 3W29A 5ABFB 1NQ6A 1O7AA 3QHOA 5EFDA 4U3AA 1U33A 4ZENA 4JFUA 4CCCA 1H11A 2YA1A 3VDAA 4M29A 3EDJA 1AQ0A 3VUPA 3SCOA 3W26A 4UFKA 2D73A 3WY2A 4U5KA 5A2BA 3A4AA 2JIWA 1V3IA 2WC3A 3N17A 4V27A 1JNDA 3WY1A 3H54A 3AI0A 3GNPA 2VVSA 1E15A 2WCGA 3A4WA 2VL4A 1W1YA 2VX6A 4CD4A 2GJXA 4J27A 3AHXA 3D4YA 3WF0A 2BY1A 3NDYA 4NZFA 1ISVA 3FAWA 3TTSA 3WFZA 3VVGA 3BAWA 3UEQA 3PTQA 3CUGA 4UR9A 2ZWZA 3GXIA 1E70M 2VCCA 2X2HA 2OYKA 3ZT7A 4P8XA 4NRRA 1CGVA 1QWNA 3S5ZA 4MJ2A 4DM1A 4AW7A 1HXKA 5ABEA 4UQDA 3E1F1 1E3XA 1IV8A 5BXRA 1B3XA 4C7GA 5CG0A 3CIVA 4F8XA 4AMWA 1TVNA 4Z2JA 1US2A 5AC5A 4LQ1A 4CD7A 3LRLA 2BNJA 2PC8A 4PMUA 2D0GA 1ITCA 3EMZA 1T0OA 3S6TA 4CGTA 2EPNA 3VSVA 2YDSA 2A3CA 3WF1A 4HMCA 1GZJA 2DSZA 1N82A 5IDIA 2YA2A 4LYPA 2VZSA 2O9TA 2F7PA 4W85A 3M07A 2G3IA 3KWXA 1H41A 2DH3A 3B9DA 4E4PA 1M7XA 2OWCA 4UFIA 1KB3A 1UD3A 2CCRA 1AQMA 4QDMA 1H0IA 4XUYA 3WY3A 3ZQ9A 4W5UA 2DH2A 1Q6FA 1XHGA 1E40A 2O9OA 3S2CA 3VIIA 1HVXA 3AXXA 5ABGA 3TOPA 4FNUA 2V3EA 3CZSA 1VENA 1FHLA 3SEPA 3BVXA 1HKKA 4OOZA 4M8UA 1KTBA 2YKKA 5A6MA 2J7CA 4UTFA 1V0NA 2W63A 1EH9A 1ZU8A 1UWIA 1TG7A 1G1YA 3VGEA 1HTYA 5HNNA 4PMXA 1R8LA 4PTXA 3WQVA 4P7QA 1J9YA 3VD3A 5C71A 2YIHA 1G94A 2V38A 2OYLA 4D6HA 3KL0A 2D2OA 1UWQA 2IXVA 4H8HA 1OGGA 2VCAA 1G9HA 3VTRA 2YFOA 3N11A 4R5EA 5A6AA 2GSJA 5JBDA 4UQBA 1XSJA 2CKRA 1HP5A 4OGZA 2E9BA 5C70A 3AIEA 5AYIA 3UETA 2WVSA 1EOKA 3BAXA 2VR5A 2XFRA 1JDDA 4GPNA 3AIRA 2JF7A 5HBFA 4DUWA 3A6OA 4BQ4A 1VFOA 2WXDM 4P7OA 1W9BM 2D23A 4EAMA 4WF7A 2FH8A 1MFUA 3CMJA 3I3BA 1BVNP 3M7SA 4M24A 4MTVA 1Q6EA 5FD0A 3VINA 3HG4A 1BG4A 5BXSA 2XWDA 5E1QA 4MJ4A 3EJUA 3SCUA 2WVUA 5I3DA 1TQSA 1W2PA 1RP9A 3BSHA 3W81A 1JYVA 3NCOA 4Z2LA 3FNDA 4AD3A 4QLKA 4KGJA 3SUTA 2WW5A 1H4PA 3QHNA 3MMUA 3TV8A 3W82A 2JEPA 2WMGA 1DTUA 1OSEA 4MAZA 3WMBA 5CLWA 3BUDA 3DYPA 2EPLX 5FOOA 3G6MA 2BVYA 2WWCA 5M5DA 5A6BA 3AS1A 4UZUA 3LXAA 1GHSA 1E3ZA 1JAEA 2NSXA 5BRQA 1R46A 4OBSA 3IJ9A 1TA3B 4D6GA 4UOZA 5BXTA 1JF5A 1J0ZA 2GVYA 1MYRA 1CGTA 1K9FA 3WNOA 4B9YA 1J0IA 3GXMA 4YHEA 4IUGA 1BLIA 3A23A 4NXKA 3B9AA 4NSBA 2VZTA 3PZOA 1LL7A 4ATWA 3W6LA 4FLSA 1QNOA 3LPGA 3WEZA 2D24A 1CPUA 3GNOA 5CPSA 4PMZA 2BFGA 1UKTA 1NOUA 1QBBA 1GVIA 1Q4NX 4CD6A 3PZUA 2PWDA 2VURA 1HJSA 4CKQA 1LQ0A 4CN4A 3VILA 1B3YA 4WIWA 2V5DA 1W91A 1JYWA 2VQUA 3WNNA 2D1ZA 4B3LA 1FFQA 2WNWA 1PX8A 5LYRA 2ZUSA 5TD4A 4B3KA 2WMHA 5CGTA 3WF4A 5A1AA 2WHMA 1CNVA 3W37A 1D3CA 4MB4A 5A2AA 1VB9A 3K8LA 1W3JA 1Q6GA 4TVDA 4D1JA 3EDDA 2A3BA 3IANA 4FNQA 2C7FA 1C7TA 4UCFA 3BXWA 1NOWA 3GNRA 2XVGA 4Z2GA 4OUEA 2UY5A 1KCKA 2WVVB 3HG3A 2AMGA 3ARUA 4GZIA 2FHCA 2YL6A 4W87A 3GYCA 1JF6A 1B30A 4AZGA 8A3HA 5I6SA 2G8ZA 4GZEA 3MO4A 2XIBA 2J8GA 2WC4A 4GI9A 1B0IA 3GH4A 3WQ5A 1SFSA 1JYNA 1CGXA 2XGIA 1X6LA 4DWSC 1KR1A 2WMFA 5EBAA 3VNZA 5IHSA 2JIEA 4F9DA 2OYMA 5LA1A 1JZ6A 1JZ3A 1NARA 3RDKA 3THDA 1KCLA 1EHAA 4EK7A 3ARZA 4H2CA 1ISWA 4D6FA 5I24A 1E6QM 1ZJAA 2V5CA 4D1IA 1D2KA 3MANA 3WMSA 1HP4A 1MW0A 3EDFA 3HU7A 2PBGA 1AVAA 3T09A 3IK2A 4J7RA 2F61A 3WQWA 4YN5A 1GQKA 3GM8A 4AYGA 1GOKA 1J10A 3VIJA 2F7OA 3MS8A 2WZEA 4AEEA 1EDQA 5D4YA 3THCA 3BVUA 3WNKA 3N18A 1RPKA 2OSYA 2RGMA 1MQPA 1C93A 2PWGA 4CD5A 1G01A 5CLTA 1R75A 1UUQA 2UY3A 3CMGA 5HPCA 2ZUTA 1TMQA 2FE0A 3VX1A 2Y4SA 3AYRA 4QCFA 1W9VA 1LG1A 5DMYA 5A6JA 1TQVA 2J77A 3ZT5A 4FF5A 1UD8A 1HJXA 4UZSA 3KL5A 4W8AA 3NSMA 1KBKA 2F7QA 4NX0A 1NH6A 3CO4A 5GNYA 1OGBA 1TVPA 1ZJBA 4LX4A 5M3WA 3VGFA 2Z1SA 3AHTA 4MAVA 3VDBA 2CIPA 4JKLA 4AZBA 2J25A 3ARXA 1R47A 1CWYA 2WM0A 5A3HA 2XVKA 4DWSB 3WH5A 2VTFA 3WQ6A 3WDQA 4D6EA 3DYOA 2WMIA 1A47A 5D9OA 2WSPA 4OJYA 4W88A 1V6UA 3AIVA 4HP5A 3RIKA 3BH4A 3A22A 3A3HA 1I75A 4F66A 5D9MA 1KGXA 3EDKA 1F4AA 3WF2A 4Z2KA 1IZKA 4PEEA 1BVZA 2VRJA 1R87A 4LXFA 4TUFA 1SR0A 3MSGA 5I5RA 1H09A 1EGZA 2W61A 3VSUA 3CHFA 3ALGA 4PUDA 2BV9A 4H41A 4C7DA 3BAKA 5A8NA 1GQJA 2E4TA 2GK1A 4B15A 2ZICA 1HT6A 4BQ5A 1Y7VA 4U2YA 4FNTA 3VDHA 1VFFA 1FOBA 2J75A 1KXTA 4MADA 1MQQA 3L4YA 4AYSA 3L4ZA 2EACA 3AMLA 3NYDA 4A4AA 2VZOA 4FLRA 5E09A 3WH8A 4HMEA 1EDGA 4MNMA 4U3CA 3CZKA 1IT0A 3BVVA 3WD2A 1LL4A 1US3A 4ACZB 5A8OA 1PJ9A 4PSPA 4FLQA 2XN2A 4P7NA 1VEMA 3CBWA 1CXKA 4YHGA 2VI0A 1JYXA 4A3HA 1TQTA 4AEFA 4CCEA 3CUJA 2W5FA 2JF6A 3VIGA 2PWEA 4XZWA 4CVUA 2VX4A 3AS0A 1Q6CA 1JD9A 1LWHA 2D0FA 4W8LA 1W9DM 3GTNA 1UKQA 1BYAA 2EO7A 1R33A 1HN1A 1UWSA 1UZ4A 4PN2A 2DEPA 4UFMA 3VU2A 2EXOA 4NI3A 1J0KA 3WBEA 5BYWA 3RJXA 3LMYA 4WK9A 4J3WA 1BFNA 4ZE5A 2V3FA 7A3HA 4H8UA 1WZLA 5CPTA 1UASA 2J7BA 1FH8A 2WHJA 1JZ5A 4H8VA 3ARQA 3WNMA 3VGDA 2QPUA 1C91A 4M56A 4JFWA 2CBJA 1E6NA 4AZCB 4XZBA 3WH7A 5I2UA 2WKLA 2QMJA 4IPNB 4NRSA 2X0HA 1MVYA 4W7WA 3AZTA 3SCTA 4NZJA 3VGBA 3CZ8A 5CZKA 4U5IA 1QVBA 3VMOA 5E70A 2ZIDA 4WKAA 2XFFA 4P7RA 4DWSD 4XB3A 1E0WA 4PRWA 2YA0A 2NT1A 2VC9A 3AIQA 2X2JA 5EMYA 3BCFA 4EE9A 2BVTA 2DSWA 4JHZA 4AZ6A 2WANA 4MNKA 1H1NA 3BCDA 1Z32X 1E4IA 4HPHA 3OIHA 4HZ7A 3TTYA 3W28A 1BTCA 3A21A 9CGTA 2E0PA 2W4XA 3OZOA 3L2MA 4H04A 3UCQA 5HDRA 3QR3A 1B1YA 2YOCA 1EIBA 3O2LA 2UWFA 3LXBA 3BC9A 3LPFA 3WL1A 5BRPA 2CPUA 4CCDA 1UKPA 2BXYA 3GH5A 2ZUUA 3ARVA 1KQZA 3AS2A 3MMDA 1UOKA 1NM9A 1UD6A 1HL8A 1ZL1A 3WELA 3BAIA 1XH2A 1CLVA 2YJQA 4XX6A 3L4WA 3OA5A 2PBOA 2ZOXA 1QNRA 2YDQA 3ZOAA 1LWJA 1F4HA 3FY1A 1ZB5A 3AIUA 2BHZA 2AAAA 2TAAA 2XPKA 4MB3A 1V0LA 5LA0A 1GJWA 5JIWA 5IFTA 4UFLA 1E0VA 1YHTA 2DSUA 5JBEA 4PSRA 5BCAA 3QHMA 3BUBA 1W9UA 1ECEA 4R27A 3PBGA 3OBAA 5E9AA 3UESA 2FH6A 3WUGA 4DO6A 1BPLB 1HJVA 2FYVA 4IISA 2VQTA 5ABFA 2JE8A 6CGTA 1UWTA 4QP0A 3PZ9A 1OGSA 2WHLA 4KRTA 1GQLA 4IM4A 4RE2A 5A2CA 1RH9A 2WZHA 1BYBA 2OWXA 3WH6A 4JKKA 4MDPA 4W8BA 1QNSA 3L2LA 4W5ZA 1BF2A 1UD2A 3CGTA 1I1WA 4AD4A 1MXGA 2ZX6A 1BG9A 4H7VA 3ZR5A 1V6YA 2WZIA 2A3EA 5M03A 2IXUA 4CU8A 1W2VA 4GO9A 1HWWA 2FHBA 1X6NA 4PMDA 2VVNA 1CTNA 3EJTA 1OWQA 1DWJM 2J7HA 2PF0A 5HPOA 1OD8A 3MI6A 3D51A 5D9NA 1WDPA 1UQYA 1BYDA 3BVTA 2CBIA 3QOMA 1PIFA 1XSIA 1CGWA 2E9LA 2PWFA 5CSYA 2XM2A 4DO5A 3EJRA 4HA1A 1OM0A 1VJSA 3BGAA 3TONA 3WDHA 3ARYA 2XG9A 1VRXA 2J7FA 1JDCA 1B90A 1JI1A 4X0NA 2W91A 5LA2A 3AMDA 2CNCA 1XD0A 1XYZA 2X05A 4J3XA 1UH4A 4Z2HA 4FK9A 5AYBA 1BQCA 3ZJ7A 2VX7A 3WF3A 5D8ZA 1E0XA 3CHEA 1U30A 2XVLA 1LJYA 3A24A 3ARWA 1ISZA 3RILA 2EABA 3HMCA 2ZXBA 3WD3A 3MUAA 1WO2A 4DO4A 1JG9A 1BSIA 3WKZA 3RM9A 3RCNA 2DT1A 2YLAA 4IPLA 4JL1A 3T2OA 2GDVA 4X9YA 4CU6A 4WLCA 3L4VA 3IJ7A 4CN1A 4HOZA 2J7DA 3AMKA 4C7FA 4QLJA 3OLDA 2F1BA 1FP8A 1E6XM 4PBGA 1WZAA 2GFTA 2CKSA 2EBNA 3POCA 3PZTA 1KXQA 3SIMA 2VOTA 1HXJA 1UR9A 2ZUNA 2X2YA 1PPIA 2F2HA 1QBAA 3FHQA 3OGVA 4BZYA 3OB8A 1K9TA 2FGLA 1KQYA 1RD6A 5CJ5A 3DECA 2XVNA 4AD5A 1UR4A 1B9ZA 4CD8A 1CXLA 1XC6A 3ZM8A 1NP2A 1MXDA 1V0KA 3SCSA 2DPEA 3U7VA 1KWKA 2WLZA 3SUUA 4TX6A 1E73M 1G0CA 4ZXLA 2W66A 4PMVA 3RMEA 1HKMA 3BLPX 1UD4A 4J3SA 2EPKX 4JZ5A 1MQRA 3EMQA 2ZX8A 1XYFA 2YL9A 3PZGA 3T08A 2J7EA 2XYLA 3BUQA 4JFTA 3RO8A 1EA9C 3DX2A 1GJUA 1PS3A 5CGMA 4B9ZA 3HG2A 3T0AA 2F1AA 2CHOA 1JGIA 3N13A 1GOMA 4M1RA 2OWWA 1JNEA 1NWUA 1JZ7A 6A3HA 3G6LA 4PTMA 1R85A 4PMRA 3AROA 4D72A 1E5NA 4NF7A 1OBAA 1PZ3A 4Z2IA 3AQUA 3HN3A 1W3LA 1V6VA 4TVUA 3MV01 1SYTA 2CETA 4Q22A 1AQHA 2GJPA 3VIFA 2J74A 1E4MM 3VSTA 5A6SA 3O6AA 4J3UA 1WB0A 2BY2A 2CBVA 2YLLA 5A69A 3VOCA 2X09A 1G5AA 1TUXA 1CLXA 4JL2A 4P7LA 4UQCA 1J18A 2ZUWA 2V3DA 1JZ8A 3FAXA 2ALWA 1LL6A 1B3ZA 3FHAA 1UG6A 1ITXA 1FA2A 3A5VA 3IAQA 4L4PA 3VM5A 4HA3A 1OCQA 4KH2A 4OOUA 2VZVA 4PTVA 1DWHM 5HOSA 1HX0A 3TP4A 3ARSA 1CBGA 2EJ1A 1DWFM 3AHZA 4KGLA 2OSWA 4BQ3A 4JFVA 4CU7A 3U57A 1H0GA 4AXNA 4HOXA 1OINA 3VNYA 1TA3A 5JBFA 3VIMA 1FP9A 5DEZA 3L4UA 3DDFA 3EJPA 2OSXA 3EJQA 4AC1X 1H2JA 3WQ8A 5CSUA 3OGSA 4B16A 1HKJA 1KXVA 2WBKA 3WDIA 3UR7A 2NT0A 1MW1A 1R34A 1PZ2A 3AHVA 1E56A 4FNSA 1OD0A 3M46A 3T2PA 1S46A 3GXPA 2V3GA 2ZXAA 1UYQA 2J8FA 2X8RA 2G3MA 2ZE0A 1WAWA 1JZ2A 1H3GA 2CHNA 3WY4A 1R7OA 4DUXA 3OLEA 2BHUA 3ARPA 3T0BA 2PWHA 5E0FA 3VGGA 1R7AA 3CPUA 2W62A 3PTKA 4KWUA 1GQIA 1OIMA 3WBAA 3D52A 3AMCA 3VIHA 2VUYA 5FIPA 2CYGA 1HKIA 3ZMRA 2EADA 3VIKA 3WFLA 3GH7A 4HU8A 4HTYA 4D6DA 1BAGA 1JAKA 3AJ7A 2XTKA 1FFRA 5A8PA 1UHVA 4J3TA 3RM4A 1UQZA 3FN9A 1C8XA 2EEXA 3WNLA 1UWUA 3VKKA 5FKYA 2JFEX 1EQPA 1ODZA 3SUWA 3VD7A 3WH9A 3WDJA 4WKHA 2X2IA 4NXSA 1VIWA 2J78A 5GNXA 3VMPA 3K1DA 1L8NA 1VEPA 8CGTA 2DQXA 2WVVA 1GCYA 1QI5A 4AISA 2D0HA 1VJZA 1ZBVA 3HZ3A 1E43A 1C8QA 1EO7A 1JZ4A 3WD1A 2XSBA 3O9NA 3N9KA 2GJXB 1VBUA 3CZJA 4ATDA 1DWAM 3F4VA 1AMYA 3DDGA 1GOQA 2EQDA 4WSKA 5CPQA 4Q7NA 3B8SA 3NSXA 3LRKA 2A3AA 2VO5A 2Q8XA 4PMNA 2HVMA 3PZIA 1E5JA 1VAHA 2WSKA 1XCXA 5I23A 3NSNA 3LPPA 1ISYA 3CH9A 5IFPA 1V3HA 3AYSA 2XIIA 1E4LA 3W6MA 3WMCA 1UR8A 4BS0A 3ZT6A 3CUHA 1WKYA 3AMGA 3OLGA 2YFNA 3VM7A 1CGYA 5D8WA 3CV5A 3AXHA 4U2ZA 4GXPA 1W32A 2XN0A 2W67A 2G4FA 3DHPA 5A8MA 3WD0A 3UG4A 3F5LA 4MB5A 4Y7EA 3SURA 3GXFA 4U33A 1J12A 1JXKA 3AIBA 1EHNA 3GBDA 4GZJA 4URIA 4FMVA 2XSAA 2WMKA 1WZKA 1XD1A 2F8QA 3AFBA 2OW6A 1V02E 3GDBA 2Z1KA 4HPGA 4V2XA 2WKGA 4GQRA 5HXMA 4DM2A 5BXPA 3II1A 3F5KA 4ZEPA 4AD0A 2CBUA 4M81A 3D3AA 3WENA 3VIOA 3WNPA 1GVYA 1E6RA 1V03A 4P8UA 3B9EA 2EPOA 3VD5A 2YL8A 4W7VA 4EANA 2E9MA 3VDCA 3OG2A 4OKDA 2WCSA 5I78A 2E8ZA 4GO8A 1KTCA 2VT0A 4CN6A 3AICA 1PX3A 3W4RA 4AIEA 4PCSA 4HZ6A 4GKLA 3IJ8A 1JD7A 3VD9A 4P8WA 2EAEA 1V6WA 3CC1A 3NUKA 2GDUA 7CGTA 4AZ5A 1CYGA 5A6LA 4DWSA 1KFWA 3ZJ6A 2ZUMA 3D4ZA 1WDRA 1FHDA 2XVPA 5JIPA 1WNOA 4QAWA 4J28A 1VBRA 1TE1A 2WMJA 3VMNA 1KWGA 2D3LA 3S5YA 4LGXA 1W1TA 1V0MA 2FHFA 2ZXDA 3ARRA 3BMWA 2CERA 3SCVA 2QLYA 1XCWA 2XUCA 1K9EA 2OLHA 1WDQA 2G3JA 3UERA 5A94A 1GUVA 3CHCA 4LPCA 3SUSA 3DX0A 5I0DA 1QNPA 1NWTA 3CUIA 3K8KA 1QI3A 1HVQA 3DX3A 2NW0A 4XV0A 1W9PA 2CESA 1KR0A 3IGUA 5GPRA 1UA7A 4BQ2A 3DHUA 4FNRA 1QW8A 3DC0A 3ECQA 3NDZA 5DF0A 1NOFA 1A3HA 5GQBA 2D3NA 5A6KA 1HF6A 2J62A 5BROA 2O9PA 4KRUA 1E4NA 2YBUA 2DT2A 1TR1A 2DGAA 4MPKA 3LXCA 1GORA 1W3KA 2DDXA 3FW6A 3PN8A 5DO8A 1J0JA 1QWUA 3VIPA 3GXDA 1DWGM 2VRQA 3RM8A 1QNQA 2X0YA 4P8VA 1NWRA 2E40A 4GI8A 2DSVA 4RE4A 5F7UA 1VEOA 2EPMX 1HIZA 4ACZA 4D6CA 4FNPA 1UA3A 5BWFA 1JL8A 1TQWA 3RJYA 3WDPP 2JALA 4JHOA 4CUCA 1DEDA 4E8CA 4AZ7A 3DYMA 3EMCA 1Q6DA 4WSJA 5A95A 1E9LA 2AOSA 3TTOA 3EJSA 1PX4A 4HMDA 1PBGA 4PMQA 4PTWA 4OBRA 1W3HA 2J7GA 1E1FA 3UR8A 3SCRA 3BLBA 1TZ7A 1QHOA 1SMAA 1C92A 1J01A 2J4GA 3BSGA 1UH3A 3KEHA 2MANA 1ESWA 4N0RA 1W9XA 3ZR6A 1BGAA 1M03A 3DX4A 4TXEA 4M82A 2WWDA 2FDMA 5IXEA 2ZWYA 1SZNA 3VGHA 1JI2A 1B3VA 1LF1A 3WSUA 2F7RA 1YQ2A 3UG3A 3N1AA 2XJ7A 3AISA 2WB5A
chains in the Genus database with same CATH superfamily
4GI6A 1XF3A 4R97B 4WFFE 3F83A 3P8JA 4LSUL 3UL4A 4BM7A 4PWFA 4YOKA 4RCAA 4ONHA 3C8KA 3VRLE 5IJCC 3DGGB 3WEOA 3TU9A 4IEFA 1UM5L 5C2CA 2NY6B 1W1PA 4F7EB 3ZTCC 1M04A 2G50A 2BP8A 1H3TA 2COVD 4U0RC 1CG9B 5DFWH 4B9GA 3MUIA 3V0FA 4LAQH 4ZMLA 3HGRA 1JDAA 2EE3A 1UXWA 2P8MB 3WIJA 5EC2B 2Y2YA 4WWOA 2VRAA 4V11A 3QIWD 5FEWA 4WEMB 2ZZ5A 1OYCA 5F7BA 3C5ZB 3DFTA 1HH9B 1A5OC 3D39E 4AEIL 5HINA 5JNYB 3Q37A 3QGVA 3WO4C 1DP0A 3KEDA 3T3MF 3NGFA 1XH3B 5CPLA 3EHBB 4Y5YA 2CG9X 4GVIA 5E2VH 3FU0A 3T4AC 2FBOJ 3VFRA 4NKCA 3F5JA 4HF5H 3FFCE 4LIQH 2Z31B 1GGBH 3S37L 4WW1A 1GMIA 1TREA 4EJ1C 1KGYE 3KW7A 5D7LA 3C6LC 4HXAL 5HPMA 2YB1A 4C6LA 3W1MA 4MTMA 3KVKA 1REQA 1GZHC 4JPVL 2VCBA 5FF3A 4PW4A 3REQA 2HVKB 5E9DD 4S0SD 3CMOH 3MJ8B 4NENB 3R79A 2YGOA 3O6FB 1NBYA 2JKTM 4JFXA 3MLVH 1WOAA 4X42A 3VW3H 3F00A 3BKYH 2J8UB 3K4AA 4ZB2A 5CLYA 2IALB 4NRXA 5FCSH 2X30A 1NMCC 1N8OE 1A6ZB 2WSDA 3OBKA 4F20A 3EXTA 4NSKB 3V0AC 4ODXA 1T80A 1T1YB 2X9WA 3VO0A 4I3RL 3EZJB 3AGVA 4WK4B 2IGTA 1GKRA 4K5LA 4QUOA 3LY6A 1NINA 1PNDA 1ZE3C 1I2QA 3TWYA 1JJUA 5KBNC 1U3HC 5IB5A 3WD4A 2WLYA 3CWHA 4AQAB 2IKHA 3HJ0A 1JPSL 3A4XA 1H7RA 3IETA 2MIZA 3QJXA 1DHKA 5CXPA 1A22B 1KB5A 3GMQA 5JHDB 4JDYA 4L2YA 1T7ZA 5ESAA 5DHVB 5HQEA 4Z7WA 3AG4B 1IGCH 4NHUA 1AGEA 3OW1A 2MPVA 3W0WA 4GNKB 4QXGH 4NC1C 1R3VA 3CFDA 1ANUA 4LLVB 3APDA 4ONFL 5AZEH 1F5ZA 3GHPA 1UP3A 4OCLC 4BD4A 1LM1A 1KTDA 2K6YA 5HDOA 2REQA 4G7EA 1V3JA 3BT2L 5DWPA 3GT6A 4DJFA 2G5RA 3ZIZA 1ZLUH 1GOOA 2LLGA 1VQTA 3SYCA 4TVSa 3X3GL 3DSFH 2CA4A 1KGUA 3CH1B 1FL3A 3QI9D 4QRSB 2VFIA 1XIHA 2WCAA 2VWTA 3M0KA 3SJVB 4N2CA 3ZFHA 1OZUA 4MIMA 3DV6B 3WBWA 1E6OH 3WFBL 4GFSA 4I18A 4JTDA 1U8PA 5DSCB 5MP6H 5K9KA 1R86A 4H9XA 4MZ3A 1ZHKA 1HNYA 4J3VA 1JCNA 2EZ0D 1K3ZA 1SXSA 5A2LH 4M62H 3WQPA 2Y36L 4GRLC 3BMVA 4AD2A 3WK2A 5BS0A 1F86A 1D8WA 1PYMA 2NY4C 4KJWC 2D69A 3SD2A 4WKFA 3MUUA 4MZ8A 3EZ4A 5G5IA 4V1XA 2VR4A 3Q4DA 2VJXA 4RRPM 2GEQA 2UZ9A 3SO7A 4N42A 3BP4A 2Q3ZA 3E0GA 15C8H 1WQVT 4XQ6A 2VLRA 3QZ6A 5C86A 2NQ3A 3PBUA 5SWQA 5C0JB 3U2JA 4JAMB 5BVPH 2X1SA 1QOQA 4JHWH 1ZQ5A 3HC3L 2WZPD 4JFYA 2PCQA 3RJOA 2AHIA 1AQ0A 3OKLB 3SDYL 4PRBB 4JTHA 3RL1A 1EJXC 5JORA 3S5LA 3H23A 1XCQB 2PR4L 2K7PA 1P4BL 1AQKH 3O0LA 2XXMB 2ESVD 3FTZA 5ACZA 3S4TA 2R1WA 4Y7MA 1G7LA 3BAWA 4HT3A 1FNSL 3PY9A 4UR9A 4A6YL 3RNKB 4JZNA 2X2HA 5F6IB 3KYKL 4RFEA 1E5CA 4R97C 5BOFA 4LWWA 4C1NB 3UYRH 5IHUL 4Z2JA 4FEIA 1MCHA 1S7XB 2Z28A 4AM0A 2NY6C 4PQXA 5FKAB 4CGTA 2VDKH 1J6PA 4ZRGA 5DD0H 5F71A 2ZXGA 5F1UA 3IMBA 1GZJA 1N7ML 4D0BB 3BFOA 1EF3A 5HYSA 4AITA 3VXRD 1LE9A 3OKEB 1UZ6E 1LQSR 1DE4A 2J8OA 1NKRA 3MCMA 5LIKX 4WHTA 1I1FB 5IWLC 2NTFA 2ZCKH 4JG0H 3E0IA 2OMNA 1G9EA 4PL2A 3AG3B 3TOPA 2A77L 1FCGA 4X6CA 2WGXA 1IVLA 1WXZA 1A4JB 1U58B 3PLYA 4OI7A 1YXDA 1RUSA 4EIUA 5JO5A 3NMEA 4RV8A 3EHBC 2ZZUT 1ZWIA 2VLKD 3IDMA 4NNXA 5SWSA 4JDEA 1GAFH 4UNTA 3M5VA 1QBLH 2V38A 3CZFA 2V0AA 5E0QA 1S7QB 2VN5A 3VTRA 4BFIB 2YFOA 3S1GA 2Z31C 1QK2A 5H1WA 4LSPH 1O6TA 4UQBA 1TV7A 4DH2A 2CKRA 4N8VB 1W5PA 1IBGH 5AYIA 3UETA 4XZLX 1JDDA 2OSLB 3EFFB 4GUQA 1MJJA 3ISRA 1WUEA 3FEMA 3O6FC 1BVNP 1XF5A 3VINA 1UYWL 3FF7A 4E36A 4DP5X 1FX6A 3PJSB 1AO7B 3CDFA 3HPXA 1M2OA 5GGRY 1QUPA 3LQMA 5I8CB 3H42L 2VL5B 5CBEB 3RAJL 1OSEA 3ZDXB 1LLWA 1BECA 4LU5H 4UZUA 5EU6D 1PCSA 3QHTC 5E2TL 2F74A 2RD0A 4B9YA 4YHEA 4IUGA 4AVOA 1Q0YL 1AMXA 3ITLA 3TC6A 1T5AA 3SIZA 3NURA 4LEOB 5I03A 5KSAA 2ZF9A 1EHXA 2B59B 2ACUA 4PGDB 1Q4NX 1D5IH 5KUMA 1R3IH 4CKQA 4KPHL 1IQDB 4F80A 3LRSA 2APBA 3G5EA 1QNVA 3RDTB 1NDVA 4F8PA 1AD0A 1A6AA 3OQ8A 1ZRQA 2WSQA 1ZMYA 3FO2B 4U6YA 2SODB 2X41A 1E42A 2J20A 2EEAA 4YNYA 4TVDA 5FCUL 3O4LE 2CWRA 2I32A 4BUGA 3EJCA 2V5SA 3BAEL 4IXHA 2XVGA 3GR8A 4Z2GA 1A1OA 4FHKA 3PV7A 3RKPA 1AD9A 2LLNA 4OLUL 1DCLA 3HA0A 5I6SA 3MO4A 4ERIA 1S3HA 5ESQA 3CBKB 3SBWC 2XGIA 3OG3A 1MNNA 4DWSC 2VC6A 5AVYB 1DQWA 4WOZA 3SO3B 3NCYP 2Y5JA 3QQDA 1U8MB 4QOKE 3DUSB 3BZGA 1QSED 4KKCD 1BP3B 1ZJAA 1SJBA 5I28A 2HT2D 4PGBB 4QGCA 3MGTB 5M2FX 1KJ3L 4N9GB 2V6HA 1QEWA 4KKAD 2Q71A 3FK4A 3L3DA 2DS4A 2Q6ZA 3X3FH 3SQMA 3BCJA 3WNKA 3Q13A 4CD5A 1GCFA 5FF7A 1NUNB 1WG3A 1Q0XH 4OD2A 5IBTH 1LO0L 3QNYA 4WFHE 5GRUH 3CXDH 1HNGA 3ZT5A 4PJHF 3FU7B 1ZTMA 3CO4A 4HPOL 3GS4A 2EDKA 1J5HA 3RKDD 1YX1A 2YPLD 2XU2A 3OSVA 2V2HA 3U0TB 2DBLH 4NNCA 1E9PB 1W5OA 4PV8B 3DGDA 3G5ZA 2FATL 2WMIA 5C92A 1RZFL 1V7AA 2IQ9H 2CUAA 5BZAA 1X4XA 3AIVA 2H9GB 4BUQA 2ENYA 2PCPB 2HG5A 1FYHB 3U9PL 2OX5A 4HPXA 5MEND 1PYFA 2E6JA 2GTWA 4XC1L 1YPXA 5GZOA 1ADDA 5C7ZA 3RGTA 4LEXL 3HV8A 1WLHA 5JIMA 4ZI8A 5DS8B 2I1OA 4JJ5B 3GSOA 5IHBA 2QT6A 5I5RA 1G43A 3HS0B 1CZ8H 3NCEB 3MV9D 5EIIB 4CSPA 4CNSA 2E4TA 4AM0Q 2EDRA 2X6CA 4BQ5A 5FFGA 4B3EA 2GJ6A 2WJDA 1A80A 2VZOA 5E09A 4IBSA 3UP8A 4B2DA 5C2UB 2QDGA 1BFVL 1YNLH 2ATKA 1AZCA 2Z4TA 1LL4A 4HWZA 1OAQL 2H1PL 4PSPA 2VI0A 5ADPH 4AEFA 5EZIL 3QBUA 3DXAD 1XJBA 1W72B 3V4BA 4PRHA 2XINA 3WLNA 5T9CE 4R9HA 5JHLA 4IOFD 1OQXA 2PUZA 3LTPA 2XBZA 3KR3L 1UVQA 3T0EE 1A5CA 4JO5A 1PXGA 3RJXA 4WFGD 3SQRA 1QYGL 3OKYA 3EF7A 2EH8H 3ARQA 4MA8L 1BMGA 3Q8EA 3H9SA 3V0TA 1WT5A 3F2LA 2X0HA 3FBKA 4DI8A 5CD3B 3FGCA 1N8ZA 2OMWB 2AEIT 1HO4A 1OK8A 4TX9A 1KFGA 3QDAA 4EI6B 4OZIF 3U1SL 1X7QA 4JHZA 3P0VL 5C7XH 3V0HA 2HMID 4NVTA 4UQ3B 5BO0D 4PA8A 4TSBL 3WIFA 1Y0LA 1HTIA 5FM5O 4UTTC 3M45A 3U9IA 4AGNA 3GMOA 2FZ8A 3QDGB 3LPFA 3D39D 3VFOA 1BXBA 2XKSA 1G4RA 3VVVA 3PUEA 3ZR4A 1W1ZA 4DX3A 1ZA6A 1VPOL 4WGXA 2HTKD 1YEJL 3L3OB 3ENEA 4Y9NA 3FFCD 1QRNA 5E8PA 1TJIL 4R2GC 1JEZA 4ZS7L 1G0YR 4PSRA 1HEHC 1HHGB 3HPFA 1HJVA 2RFGA 4W4OC 1UWTA 1OGSA 5DYFA 2WBJA 4BINA 2YYTA 4KRTA 4FJYA 4NHVA 4FCHA 1YUHB 1Z69A 1FO0A 3S3SA 4JTRA 4LHUG 2DUAA 1CTNA 3BOXA 2CO6A 4ZFFB 2BVQA 4LVDA 3M6YA 3P2VA 2FT7A 3TN0A 2ICEB 3RDTC 3PUOA 3TONA 2FX8L 1DEEA 2J7FA 1MG3C 3JZ7A 1Y8BA 1A6UL 4OI8A 3L3GA 3AB0C 3HIJA 4GKSA 2GGEA 1ISZA 2VDRH 1TZAA 1RZKC 3IK4A 3QWOB 1JG9A 4UBDC 3NIGB 1LP9B 2J72A 4LALA 4WLCA 1SBBA 2QAPA 3UYPB 4XVSL 4WHBA 2J7DA 2CIKA 4QLJA 3FJ6A 1JRHI 4Q4EA 5IB1A 2MHAA 5DHYB 3E3QC 1WZAA 3TA3A 3PZTA 2UZYA 1SJEB 3T3ME 3SO3C 4WX2A 4FEZA 5LGZA 1MRCL 3BZFB 2VUKA 3QDMA 4U1SB 2FGLA 1KQYA 4LPVA 2OKMA 4M3PA 3M44A 5LKNA 2X6MA 2DPEA 4IP5A 4FN0A 4LUIA 1IBZA 4ZXLA 3ESOA 5KVEE 4I9MA 5G5DB 4EN3D 4F91B 3NPUA 3NM1A 4HSCX 4DW2L 2ADJB 4Y5VA 4X83A 2O6DA 3MKCA 4NQCD 4BQ8A 5CGMA 3ZKMD 2EDOA 3V0WL 1FWJC 1B9KA 5FECA 2JK5A 1A7NH 4UTWA 4YHIA 5CEXA 4HUWA 4PMRA 4MNQB 3V6ZA 3W1RA 1ZNNA 3JTTB 1AQHA 3VIFA 3EBAA 3VSTA 1SM3L 1MMFA 1JNLL 5J1AB 4N9CA 4C4BA 3GS0A 3Q5YA 1V8EA 1J18A 1Z5YD 3L3IB 4EUPA 3BZEA 1TU2B 3HPSA 2HS8A 3A5VA 3THML 2PC4A 3JWOL 1Q1JH 4Q8BA 5BMFL 1AS6A 1UC4A 2R9RA 2GLKA 4PTUA 4FQIH 4P57B 1JK9A 5C0EA 2X89D 2RKXA 1VFAB 1OCOB 1IGWA 3FQ4A 2QCEA 3INUH 3T8XA 5E08H 3VXSB 1H5YA 3NCCB 3WDIA 2NW2A 1KJMB 1MW1A 5IW1A 3S9YA 1D7DA 3P9MA 1M05A 4NQDE 4Y9FA 3GXPA 2XZQH 5CEZL 3UTQA 3BH8A 4GUJA 2CHNA 3F03K 2BHUA 3ARPA 4KVCL 1G6RB 2R23B 3VCRA 3BLDA 4KWUA 2CGZA 4PRDA 3CX5J 5J9PA 1VPQA 3QYNA 2XUWA 1TTIA 1U91A 5CIPA 3PR2A 4O58L 3LS5L 2ZUYA 4N3UA 2BMKB 4HTYA 3L12A 4G8IB 3LS9A 1R9FA 5A8PA 5F6HI 2XZCL 1SSDA 1KKRA 3B4UA 3HG1D 1MUJB 4X9IA 1AH0A 2J78A 5GNXA 3VACA 2O61A 4HCDA 1VEPA 4HHAA 3W7CA 5FJIA 1F6LL 3LHPH 3WD1A 3VI4A 3N9KA 4EAYA 3UFIA 2BRRL 2O5ZH 1GOQA 3RU8L 3THAA 2W9EL 4AWTA 5EMUA 4TSAH 2OPCA 3K6SB 2WSKA 1BJ1J 1TQBB 2WP3O 3NPWA 5D7KE 3GINA 1E4LA 3F6JA 4FAAB 4BS0A 4S1DD 1VGAA 2YFNA 3VM7A 2HK0A 3SJ3A 1HESA 1Z3RA 4XZIA 3MAWA 4Y2DD 4IMLB 4N7QA 3LRGA 3BJ91 1ZTXE 4BH7A 1A0QL 5KYXB 4KNQA 4CW1A 3BDKA 3HW7A 1XD1A 2NUWA 4BZ2L 1XIDA 1CLYH 4J8RB 1AGDB 4NX5A 4GW4B 1RXOB 3MGOA 3KWUA 2EPOA 4IOSA 2Y9RT 3OG2A 1QPPA 1KLYA 1LOSA 4RSVA 4BFAA 2A5UA 1IAIH 4K39A 1JN6B 1P6AB 1KV8A 4M6NL 2GDUA 1WK0A 1GYAA 2DQTL 3S3DB 3TJHD 5JIPA 4J28A 2MNUA 1GOGA 5MKGB 3WOVA 1LEIA 1PZCA 1TE1A 2WMJA 3ERPA 3G1VA 3GB6A 1T89C 8XIAA 3FQNA 4M4RA 4XAYA 3BDYL 1PLGL 2GSIB 1YNKH 5DC2A 4XV0A 1PTGA 1MFAL 2NX5B 2Y6TE 4N8PA 1XF0A 3NJFA 1QW8A 3I6SA 1AJ7H 3B7UX 4QXVA 1E8XA 1BVLB 5FYLL 4HV8A 2FDBP 5ENLA 5GQBA 4JDVB 3SY6A 4YBQC 3PWNA 3P7YA 1Z44A 3HC4H 2EDLA 3LU2A 5MEOB 3L5LA 1P4LA 2QF7A 3FRPA 1RCYA 3VXMB 1TTFA 1DWGM 3DGRA 4HK0B 1NWRA 5D5MF 4RE4A 4YLQT 4FHAA 3R8RA 3IDJB 5TIMA 1OTTC 3TWCL 2Y1AA 1KLGB 4GG6B 4KOCA 2RQEA 2OYPA 4OT7A 5DS2A 3V0UA 2AOSA 3FKKA 2ZKYA 5SX4H 2VB5A 1YDVA 3KBPA 2KZHA 1JMZA 3U2EA 3SCRA 1W3IA 1I60A 3FH5A 1DVZA 2Y89A 3O9WB 4XPAH 5FO8A 2FX9L 2WXFA 4M3KB 4LKCB 1ML1A 5F9OH 5B4MC 3P54A 4AD1A 3AM8C 3O4LD 3PWPA 3KPNA 3DHFA 2FQFA 4RX4D 1L0PA 3SQOH 2C79A 5KTLA 2QULA 3C86A 1F1AA 5DJZB 3DX8B 3S9DB 3SGJA 3S97C 3BLKA 3B6SA 3EA1A 3OKOA 4JB9H 2BSCA 5HDBB 2AGJH 1IGSA 4MLSA 2GUBA 3PHOB 4J2XA 4IPPA 3BL3A 4TUOB 3NVQA 1KYFA 3WL0A 3U9UB 1QPQA 3VXUA 2A7RA 4RA3A 2FDSA 1AZRA 3FA3A 3TH6A 2Z1PA 2Y7LA 1IAOB 5ANMB 43CAB 4DAGL 1OGAE 4OIIH 3GSVA 1UM6L 4HKXB 4AE0A 1PKLA 2J6EH 4YAQB 1P43A 4XB8A 3NZHH 4DUVA 5FO7B 1CWVA 5KVGE 3NQVA 1PWMA 3ZLHA 2QJIA 4X98A 1G0DA 2YUVA 1I3GH 2ARWA 1DWIM 1E0UA 4GWEA 2E8YA 3ELAT 3OLIA 3DTDA 5CGBA 3SDAA 3OZPA 5JW4M 2GT9B 2ZYFA 3UAJD 1H50A 2NYKA 5IHZA 4ZXBC 1V5XA 5TH2A 4AZIA 2MJWA 3V5HB 1WCGA 3V0EA 5G2HA 3S47A 3BRGC 1V3MA 4G7YH 5T1JA 3W88A 1DJHA 2X10A 2P24B 3EX3A 2YZ1A 5DD1L 5EG6C 3VWKB 2E59A 2VC2H 1NWSA 4RPPA 3N1MC 3FQ2A 1SOKA 1TTQA 1CF8L 2ZWKA 2LABA 3V4VB 4NO0A 4XRCA 1IZJA 2POZA 1J11A 1IFGA 3LBOA 3HTWA 3RX5A 5IBXA 4PH6A 2NYYD 3L48A 2OP4H 4HCRA 1NSNL 3W2NA 3JUYA 2Q8BH 5B1CA 3TBWB 2BY3A 3L23A 3QXVA 2P26A 3LDBB 3PPGA 2NCMA 1S7WB 4YSQA 3K8MA 1IGJA 1MI3A 4G43B 3CHSA 4PJ7F 3FQTB 2PUQT 4U1LA 4WGWB 3RY4A 4PIBA 3CFBB 1P1XA 5F1NA 1PF3A 4KI5C 4YQXH 2M26A 5JIQA 3H4WA 1XIWA 4ZPTA 5JR1H 3KLKA 1OSPH 3L5XH 5SV3A 4P8QA 2X4QA 3N0AA 3ZSSA 4X80L 4JYEA 3T0ED 5ADOH 1E90A 4PJHE 2CZFA 4AQ1B 2JEQA 1IC4L 4DP1X 2YD0A 5TBOA 4MDIA 3ZL4L 4HHGA 1YYCA 1CLZL 4YU1A 1RY7B 4KJPC 4BHYA 4TVPH 3WDRA 2J2ZB 4Y4HB 5CAYB 3RWGB 4TTUA 1FWGC 4L8SB 4JYDA 3KTCA 1VACA 2C13A 3PL6D 5D6DA 4D0DB 3DVGA 1OP5H 1KC5L 1IKFH 2LFEA 1YEGL 2CEQA 4ILDA 3ZKND 3NGJA 4DVRL 4G82A 2QTVA 4A3YA 2V82A 2XHYA 3ROOB 5GGUB 3RFZB 5DEGA 3SRHA 2GUYA 3N42B 3O0RL 3P6LA 5LXGH 1HHKA 3PABB 1NCGA 3EGDB 3ZJ8A 2X1IA 9XIAA 3RLHA 3TAOA 4M0XA 4Z42C 3RNQA 2PPEA 4PJ6A 3C6EA 4XWOD 2WNNA 2UY7A 3AXIA 3MRRB 5ABDE 5TAOA 4JKPH 4KZEH 3HEIB 1TELA 2DT0A 2CIIB 5EF2A 4N0FB 3G04A 3MLTA 5I6KA 1NC4A 1TCMA 4F2ME 3B56A 3M17B 1TZ8A 2H4EA 2YA1A 5I1LA 4JVWA 4LP8A 4M29A 4DEFA 5I73B 1I2RA 2V33A 3A4AA 4OQVA 4A39A 4GXWA 2IH8A 1I85C 5DUBA 2XIJA 3TZFA 4CD4A 2J66A 1MELA 3MP5A 3PGCB 2Y72A 3T6ZA 2YRBA 2BNQB 5HHOE 4BWLC 1UZHA 5HYQA 2BRQA 4Y2OB 2DL2A 4FL4B 1J79A 4NKIL 2WJZA 2QPXA 4LY4A 4OZIE 1US2A 5BZZA 3CUZA 4CJ1A 2PYEA 4C6MA 3EMZA 3KVDD 5H4ZA 3S6TA 3EKLA 2CDGB 1JWMB 5F93C 5IVZB 1S39A 3ESUF 5E6IC 1OEZW 4P46B 5FYKD 4C83B 3W2DH 5HHMB 3BQ6A 4P4KA 4MA3B 1H41A 1S7VB 5EGRA 3B0YA 4O10A 1KB3A 4UTHA 1AQMA 4XO3A 2QBWA 2YC1B 1W2KT 4FXGC 4JO4H 1EP2A 3CVIL 4IPJA 4YC2B 3CZSA 1S1PA 2Z29A 3KOZA 5CP7B 3WYZA 4PJFB 1G7MA 1H7WA 3OSKA 1A7OL 4LCCB 1EH9A 4MJIA 3EBIA 3UTZB 1MEXH 1HH6B 2VQ1A 4P7QA 3F2CA 4GQ9H 4FQQA 3VXNA 1G94A 1CB2A 5DCEA 4HS6A 1DQQA 4DKEH 2YR1A 1XR2A 4ZOEA 5G1TA 3REWA 3H7UA 3VK5A 2ILLA 3IJEA 5F97E 3C08L 2F9RA 1CDUA 4DYJA 3BT0A 3A6OA 6FABH 2ESVE 2FH8A 2W27A 3UAAA 1XEUA 2IANE 5E5MA 4TKWA 5E1QA 3RGVA 3PYCA 4QEEA 1UWEH 3W81A 1XDLA 1Z5LB 3FNDA 1DXEA 4AD3A 1RHHB 5CBAB 4P3DB 4NILA 5DO2C 4NBZB 5GSRA 2QCDA 1DBJL 2J56A 3S88L 1KRBC 1JBJA 4HFUL 1XGUA 2DQDL 3W7DA 1EEZB 4MWAA 1BJ1H 5D70H 4UT6L 3SKJL 2H41A 1BD2E 1ADQA 5FOBB 2J5LC 4HN4A 1UUOA 4NQDD 4K3EL 4ODHH 3QZWB 2DQWA 3CDZB 3IIZA 1JGUH 3SPVA 4LUYA 5HYJA 4UQ2A 3EYFB 4Y4KA 2B2XL 1NAMH 4KCUA 5JIHA 1NANI 1YUKB 1A5FH 5T8IA 3LDBC 2FB2A 3N2XA 3FLUA 4JTIA 5B1AB 4KX9A 3U48A 1HJSA 4ZX3A 3F7LA 2NX1A 1U22A 3PUUA 4O5LH 1J1OL 2XTLA 2Z91A 2D1ZA 4ZYKB 2I07A 4P5TB 4B3LA 3I6GA 2VLKE 2IC2A 1MH5A 1UM4L 4HETA 5IJVA 5CM1A 4CGUB 4MXQC 2BCKA 3VKBA 3MSYA 4F7TA 1RLBA 3IANA 1ZALA 1FA4A 3GNRA 4H8WH 4GZIA 3MCKB 1MSPA 3T05A 3P9WB 3OX8B 3F7QA 3NIDB 2ZXEB 5F7MC 4GZEA 2ICES 5EO0A 1B0IA 4FI7A 4MLJA 3ASNB 4HQQH 2N59A 1TR9A 4PS8A 3G6JA 5D7KD 3ZTJH 1CDYA 1N6QH 4PJIF 2PTXA 3RL2A 2Y7DA 1ISWA 2ETWA 3L81A 2WYHA 2CZVA 3VOJA 4AE1A 4PJEA 3Q1EA 4DPAX 3ANVA 3X14B 4L61A 1FKWA 5EU6E 4Z0XA 4L1TA 3MRBB 3NYKA 3GM8A 1OW0C 4EQ3A 2G2RB 4NZ5A 3MS8A 4YK4B 2PTTA 1RPKA 1DVFB 2H26A 4O02B 2QUNA 4Q3MA 1SO4A 1NBZA 3UBXA 5B8CB 4MJ6B 2QKSA 4JQIH 3C8HA 5DR5H 1HJXA 5FUCE 5I74B 3ZRSA 1EMTH 5GSVB 1QRQA 3HE7D 4Q8PA 1LE5B 2FPVA 3P4LA 4JKLA 4NQTA 3CHPA 4ZFGL 1CWYA 1A02N 5FGCB 4LOUD 5IUCA 2Z9TA 3QXDB 3W3OA 4GAAA 3HMXH 3BSZL 2PDIA 1UCTA 2WOBA 4NYUA 1DIEA 3QFDB 3RVVC 2PW2B 2A7BA 2Y7QA 1OCCB 1AJ2A 4OD1H 4ETQB 1MVUA 3QXTA 3KCJA 1PZAA 1AZZC 3DI0A 5I73C 4Z7NB 3NM3A 3K2UL 3ANUA 4KROB 3PG9A 3M86A 5TQ2L 5AB1A 4PUDA 3FTGB 1XXDC 2BV9A 2G97A 1QZ1A 4LPUA 4X0KA 4M6OL 3KVQA 1I9IH 4S11A 3E9UA 3GVQA 4HPJA 3G1SA 2WW8A 2X1RA 3TFKC 3L9CA 4B95C 5MF5A 4HMEA 4IKLA 4IGSA 3M5YA 2N1KA 1E4XH 4P9ML 2WY3B 3FH8A 4IL2A 3OR6A 4GSUA 3CUJA 3HFFA 5AVUB 3BVNA 1OP4A 2EUZA 4P46C 4CVUA 3F64A 5ESVA 1XZWA 4NT0A 3NJLA 4TULL 3KYOA 5JMUA 3ALWA 3ULUH 5REQA 3UJ2A 4ZE5A 4AZ8A 4E42A 5HYEA 5BUAA 4A8IA 3GMRB 4WWKC 5EORH 4IX0A 1TJPA 4YE4H 2WKLA 5BZDB 3MZTA 1J93A 4R90H 4PJ5B 2Z7YA 4LL4A 3HBGA 1BF5A 3H3KA 5LNRA 4APXB 4Y8AA 3SKUD 3HZYA 4PRWA 4L9LA 4OCMC 4ADGA 4GY0A 4MNKA 5C6WH 1M7OA 5MENE 1Z9AA 1A8ZA 3TYAA 4O2CB 4F9PA 3KHQA 5BRPA 1MVFA 1XF2B 1UKPA 1OGAD 2A74B 1EEUA 5D72L 1FC2D 4FYSA 1ED3A 2ITCB 3KRSA 1BM7A 3VCLA 3WELA 2QEZA 2JSFA 1AXTH 4EZKA 3HVNA 5D5ME 2TAAA 4OLZL 2VAAB 2F8VA 4BCZA 4EXPX 4KNSA 3BK0A 4JEGB 1BEYL 3RWFB 1WCBB 3KTXA 1E9QA 1HAWA 3ZWSA 3FN0H 4APQD 4DP9X 2Z7KA 1BEXA 4JHBA 3SR7A 1HEZA 4C56B 1ZD6A 4MD0B 6CGTA 2W0LA 2VABA 2Z24A 4MZYA 3DXAE 3O6DA 1D7BA 2HLFC 3B3IA 2P8BA 3CWNA 2ATPB 3MNWA 2XQBL 5GIRA 4NOFA 1HWWA 4U3SA 4LE8A 4KRPD 4XVUD 5E1IA 4WFGE 1QMUA 3TESA 3ULVL 3L5JA 4YIWA 1W0VA 4MKSA 4Y1AA 3WDHA 1VRXA 1JNNH 3VDGA 4P5TC 3P5YA 1F61A 5IREA 2CNCA 4J3XA 2VX7A 3QXAA 4KKLD 1YBQA 3QZNA 1LJYA 4YDKL 1YEKL 1E5ZA 1F6PA 1ES0B 3MUAA 4DO4A 5E6SB 2YLAA 1I8KB 2BOBA 1MHEA 4RMQA 3K91A 1D9KD 4PBGA 4S3FA 3EO1B 1BQHA 3P9LB 1RCXB 3IWVA 3ZTNL 1OFBA 5KTEL 3NDZE 1OP9A 5AB2A 3WTYA 3GY1A 2POTA 1CXLA 4LAOA 1H9DA 2DLIA 1T20B 2YPVH 2Y5SA 5JPMA 3P0WA 2QQNH 4ZB0A 4DZ8B 4JZ5A 1MQRA 2GHWB 1XYFA 1NQKA 1MCOL 2C1GA 2I17A 3QHFL 3VFNB 1YHPA 1XDJA 1JS4A 3QQ3B 5DMGD 2WZMA 1DVFC 1U8KB 2Z1WA 1S9VA 3GSWB 4HGMA 5BQDA 3RVWC 4I3GA 4H2HA 3UXKA 1IB5A 1EBHA 2H7WA 4ANKA 3LSCA 2EO1A 4LEFA 1FRBA 3CC5A 1FDZA 4GS7B 4Z7AA 2HFEA 2DQEH 1W8SA 4Y7OC 1LO5B 2V3DA 1JZ8A 4GKNB 2NV1A 1B3ZA 4R8WL 1T66D 1FA2A 4X7SH 1CX9A 4F8TA 4OLXH 4ROPA 4KH2A 4PLKD 4LB4A 4PBFA 3P74A 4P2AA 4FR1A 5C08B 4KK5D 2P9RA 4YL2A 2WQSA 4X50A 6XIAA 3QUXB 1DBAL 5CSSA 1MJUH 3GR4A 1AKPA 4ECNA 3QYMA 4KROC 4MQXD 4OZ4B 1WBZB 1XG3A 2PDUA 3LHAA 4PJ7E 1AIFA 3BYYA 4POCA 4OGXH 1FL6A 3CPUA 4NJIA 3QWRD 4KTGA 4GT0A 4XO5A 3GPEA 5F7EH 2P5WA 4HC1H 1HKIA 5I1CH 1S9YB 3OZKA 3Q67A 2XTKA 3FN9A 4NQCE 4GCAA 4X8JA 3J27A 3WH9A 1HSAB 1I3UA 5IKCB 1QNIA 4AENA 2DQXA 1S2WA 1GCYA 3PAJA 3D4CA 2GAZA 3HZ3A 4YR6A 4WRHA 5HHOD 4OCXL 1LMKA 3QORB 4PUUA 3H24A 3C3NA 3VC5A 1AMYA 5KYNA 2HT3D 5EZLB 3VTMA 1FH5H 5JQ6H 2Z65C 1QR1B 5CZRA 4B0MM 3IPWA 5L7XH 4S10A 3CUHA 1EGMA 3VA2C 5DMIL 4TQTA 1F1GA 3PWJB 4JM4H 3KDOA 2KQNA 4Q8UA 2ISWA 2PD9A 4HUMB 3IVSA 2EEDA 1I7UA 2ZZ7A 1ZK5A 2QNEA 3NO3A 2Z1KA 5CILL 3E2SA 2SEBA 3RUGF 1I3VA 1HCZA 2W0KA 5TTRA 4B5UA 3N3MA 4X5WA 2FQDA 3VA6A 2HYMA 1FFOA 2APWA 1H63A 3EYQD 2VDKB 5D1ZA 3LIUA 4AIEA 3AG1B 1QBML 2R69L 3K6FA 3TJLA 1AS7A 5IMMB 5I82A 1KTKE 4I9XA 3IVUA 5C3LD 3BUVA 1FHDA 3D85B 3SCMC 2J88L 3VGAC 1KELH 5BU6A 2G0WA 1R2TA 4LLUA 1ZTVA 1NCAH 3NTCL 4HS8H 2OL3L 3UTSB 1N59A 4KKBD 1MCEA 3HG1E 2J57A 2PD5A 5GPRA 3IGUA 4YHZL 1FY6A 1Z42A 2DEWX 2IAND 1T6BX 5LXXA 4NB7A 4LSBA 4MA7H 4TL5A 3MODL 1A5NC 1X96A 4C5ZA 2F38A 4AIXA 4OECA 4D7PA 3M8OH 4ENEC 4IPIA 5C7HA 5DWUL 4ORGA 4CVXB 3PN8A 5F0LB 3QUYA 2F54B 2P3EA 5CPNA 2CZDA 1E4WH 4DP4X 1BD2D 3RG6A 5C55A 1F4XL 4RQQA 3JR2A 3K6IA 3MA7B 4L9DA 4QNPF 2DLGA 3W7OA 4FYTA 1ZPUA 4LUSB 4XPHL 4MASA 3TTOA 3C5ZC 1PE1A 4XXDB 5FLUA 2A1YA 3K6OA 4KHXL 1PQZB 2XNAA 5AB0A 1BGAA 1M03A 5BU9A 1KBGH 3ECWA 4D9RE 3K1GA 3NGBB 3H2PA 1LF1A 1R3KB 1MEHA 1FV1B 4MF4A 2EH7H 4O51B 3P0XA 3O06A 1FORL 5TQLA 4MMYA 5F7DB 1SPDA 7PTDA 1E1EA 5E5RB 5D38A 5SWZD 3S7GA 1XDTT 4I0KA 2AJ3A 3LNHA 1QPRA 3G5XA 4QCIA 1T0MA 1J8SA 2VXNA 5KSUB 1P0EA 4WU5A 3TF7C 2R29H 3IFLH 3QRHA 3QMSA 2A9NL 3N44B 2QMKA 1S3KH 4TNEA 5I8EB 5DJ0A 2DJ4A 3L3JA 3WUWG 1G7HB 3GLEA 3HR5A 4C4KT 2H6PB 3L4CA 5C0DB 2X16A 5I1DA 3LLFA 5AG8A 1C16A 2QVFB 3UGEA 3LN4B 1T03L 4MYXA 3D33A 4B50A 5DK3A 1L5GB 4KJYA 2ACQA 4QGTA 4BSWA 2CMRL 3CQHA 2QDWA 2A4AA 3MKGA 2ZX9A 2INZA 5FDWA 4KK9C 1PGRB 1QQDA 3IBOA 3QUXC 2EUXA 2HTMA 3PZMA 1ECQA 2YSTA 5AW4B 1VESA 3SGZA 2FUQA 1LO2L 5F9DC 3EBGA 5EEUA 2WCPA 4QS6A 2BIOA 2ZAGA 3PZQA 1XGZA 3QJRB 5F96H 5LBGA 2M83A 2HDJA 3MN8A 3PSWA 3OKMA 3XISA 5T1LA 4G72B 3V2AR 4L4TD 4M8QB 2BOEX 3KH4A 3FO1A 1YN7B 2G75B 3NJVA 3F5WB 1G9ML 2AXHA 2VXQL 5HR7A 3DZ1A 2YBRB 2V9RA 1KB9K 3EOTH 1RUQL 1I4NA 2BHYA 1JZIA 2QSCL 1S4IA 3VAVA 4AC7C 2EIJB 4LVHB 4PJIE 1U8HA 1EJFA 5MI0B 3QORC 2HFGL 4QDPA 1IAMA 4JR9L 4M5YH 1KRMA 1M7IA 3O4OB 3EOSA 2YRZA 4W86A 3DIPA 5ECUA 3U0PA 3MRKA 1ND0A 2F6AA 5E5LA 3WHE1 2YO3A 4Q9BA 1A3XA 4L3CB 2VGGA 4WO4D 1J0YA 3VKAA 1SJHA 1ZGDA 2IG2H 3HURA 1CBVH 2K8QA 1EQCA 3JQOB 1FDJA 3AZSA 3PPHA 3KOXA 3PWUB 1OF8A 1GPFA 2AXGA 4TTGA 1H3XA 5FW6A 1H1ZA 1C3FA 4WI7A 2NY5L 1TO4A 4KEMA 1SXNA 3MO1A 3WG7B 1D5ZA 1EDTA 3TYGH 4WY7L 3CQPA 4PYSA 2C8NA 4Z7UB 1LWRA 2P49B 3FZUC 5FB8A 5KJRH 4C6QA 4Y1TA 3CO8A 4Q8NA 3NZ8B 4UDTB 1O6IA 2YJLA 2QQQA 2AI0L 2GJJA 1S5VA 4RXGA 3SZKC 5K39A 4RE3A 3CZNA 2QCNA 1CT8B 1A53A 4XXCA 1DBKH 1XLDA 4A55A 3R4DA 2Z6FA 1ZA3B 5F6IC 2OO0A 5FYJD 3X12B 3TA4D 3RTQD 4NYLA 3U7WL 2EVFA 4A3QA 2R0LL 5AYXA 3QUZA 1E2WA 3FFOA 2VM4A 2LAAA 1Q94B 3V79C 2W92A 5IVXB 3LERA 1N9PA 4LCIL 1NEZB 3B5HA 5DS1A 1BSLA 3WL9B 1D6EB 3OVQA 2C0HA 2GJZA 4L1GA 5B7ZA 4JGUA 1H8LA 4LSTH 1PYWA 3MKVA 4UQIM 1YAZA 2XOTA 4K3JH 4PVBA 4JPSA 4DF2A 1NLDH 2A73A 2JNZA 1ZUAX 4U3AA 3DNKA 4R34A 1G7IA 1GZPA 4UFKA 4EXKA 3AI0A 1K1DA 1E15A 2ICWA 2HPMA 3ETBF 3NGBC 5HA7A 3R0KA 4X61A 1IC5H 1HHJA 3VI3B 1TPFA 2YMXL 1Y0EA 3KGRA 3G08B 4M7JL 2A2IA 3D0LA 1DSYA 3BH9A 1ZLWK 2DZPA 5CN2A 4YWSA 1HCYA 3II3A 3FULA 5FKPA 4Z5RB 4U3XA 5C97A 2VGFA 4D8LA 4NAJA 1OHLA 4PR5B 3WY3A 3T8LA 4DZBB 4R7VA 1TWSA 2GUOB 2VDRB 3DSNA 2G4EA 3A12A 2PDBA 4P4RA 4U0QB 5A6MA 2J7CA 4UNKA 5GZNA 4LNRB 2NY1B 1CE6B 3LZFL 2AK1L 2ENSA 3RVUD 2A99A 3HO8A 1SDDB 2H2SD 1UWQA 4LARL 1I31A 3Q43A 4GO6B 4K15A 3Q8BA 4G1NA 5E8DH 1QW7A 4HZ1A 2HE8A 1HP5A 5C70A 2R4SH 5DZAA 4TPRH 2DJUA 3CU7A 4L37A 3WHXA 4N2MA 3J2PA 4AYEC 3WIHL 3G5WA 4WI0B 3SZ6A 4QIRA 2PDXA 1ILUA 3UTOA 1OM3H 1BG4A 1P1VA 4P07A 1Y18B 4QRUA 3FB6B 2VDQL 1BLNA 3B0UX 4GXFA 3SY0B 3KUMA 3WMBA 1RZ8B 3BP6B 3JVGC 3DYPA 1BQLL 5GJSL 5HATA 1XISA 1NCBH 2DZUA 4C6FA 1H7OA 4PJDF 3DROA 4MNGE 1HHHB 5FYKE 3LEYL 1K9FA 3QZLA 2XQ0A 4TQPA 2V17H 4N0UA 3PZOA 1E8WA 2Q7NA 4IWWA 2D24A 1L9RA 5MI0C 4FLHA 4PMZA 2R0KH 3O4OC 1S7SA 4GMTL 1EGJA 1V77A 3QXUA 3IU4H 3TZVD 1WIPA 2ZOLB 1FDYA 3VILA 4PG2C 5IF0B 4UV7L 2APSA 1QVOA 1BWMA 2GBAA 5EF0A 3L08A 3CFEB 2QQLL 1JCYA 3H85A 5J7CC 4K7YA 4G9DA 1KEGL 4JFDD 1U6AL 1W6WA 2JGYA 3V5KA 4LK4A 3UVAA 2PWVA 5C0BE 2XZ7A 3UW6A 3UTTA 3STBA 2RQ8A 5AUMB 3C2SA 4AZGA 1Q65A 3O2WL 4O2FB 3WAJA 5CINL 2NVAA 4HHMA 2C3VA 4FQCH 4CC4A 3CASA 3CSFA 3O45A 4XNZB 3IKCA 5C0GB 1E9OA 4E41B 4WY0B 3QUMH 4YZFF 1EHAA 3MUXA 2AQVA 3FT3B 3KLAA 1F8TL 4YGVA 1OE2A 4XNBA 4GISA 5CZVL 4X8CA 1KW1A 3LNMA 3GHEH 2NY2D 1Z9LA 2HPTA 1AVAA 1MCWM 3V4PH 3DARA 4XBSA 2Y7NA 3FCSA 3E0LA 4YN5A 5JXQA 1XB8A 2PCFB 4YWGH 2G5BA 3QY7A 3L21A 4LCYB 3HS0C 3UMTA 1T3FB 2Z8SA 4HBQA 4R4BA 3EH5B 3HQPA 1FYTD 2JELL 4PLNC 1VGKA 3OBEA 1V79A 3ARBA 3QJFB 4XVJL 4M1DL 3SGKA 1WV2A 4H8QA 1NH6A 1BX2B 1TVPA 3KPPA 4P2RA 2DMGA 1NCWL 2EIEA 4MAVA 3BJFA 5DXYA 4TQIA 4RAUA 2WYIA 4DQOH 4Q6KA 4P2OB 4IH3A 2FT6A 5H35B 2B7QA 4WIQA 2VC5A 4GUFA 3VKCA 5D9OA 1OOAA 4OJYA 1LDPH 2Z2AA 2EAWA 3QEHB 2GPTA 4GG8A 5I2IB 3TYFB 4PZVA 4RAHA 3T4AA 4ACTA 3FQXB 4LXFA 4HEMA 1KPUB 4ODWA 4G6MH 4Z3TA 4LL9A 3C6LA 1OP3K 1NFDA 2VJ0A 3UGXA 1HT6A 1IM9D 1TSIA 2FWUA 4M43H 4U1HB 4R3SA 3O6LL 1KXTA 3ZDYF 3VUSA 4WW2F 3L4ZA 2DTML 4U05A 4FLRA 2I16A 4H83A 4IIGA 3T7VA 4J1UA 5E1AA 3QARA 4FLQA 3BE1L 3RUGE 3IBEA 3WFDH 4HG4K 4F0SA 5D7JB 3VH8B 1OTUD 3WQOA 4KZDL 3WLKX 5CPMA 4I2XB 2VXTL 2F8IA 1OX6A 2XTJD 4TYUA 3GTVA 4PP2B 4PRIA 2RH9A 3CSPA 5GS0C 3G3DA 3N6JA 3PDOB 32C2A 1UKQA 4D9RD 3CN1A 3A9IA 3SGEI 4JM2B 2B0SL 2G3FA 3VNIA 4REQB 1WZLA 4HU3A 3LLDA 3L3OC 2V5KA 3WNMA 4A8NA 1E6NA 1EHLH 3W6YA 3B2MA 3TVMB 4NM8L 3VGBA 4MZ2A 3VAEA 2AITA 3MV8B 1S5TA 4GCXA 4ORMA 3MY9A 4DP8X 4JLRB 1S7TA 3EFOA 4L1LA 1Z3GH 4UAOB 4PD4J 4UWQB 2UWFA 3B5TA 4CCDA 2EYRA 4HH9B 3SSZA 2ICEC 2ATMA 3I6KB 3WO8A 2XWTB 4DP7X 1XH2A 3L4WA 1UP2A 1QNRA 4PJGA 4LQFH 1T5XB 4GAYB 3PUGA 3L6FB 2P42B 4DZ5A 2VLJA 4LC6A 5HANA 1OAJA 4QNPE 4LF3A 1ELSA 3LNFA 4XVTL 4R9OA 4XPTL 5DT1L 4IISA 4ZSOA 2DZSA 4RE2A 5L4JA 2VUOA 1XLCA 3AGWA 4HJJL 2AK4E 3WH6A 3P84A 2JIXB 4GA8A 3BZ4A 4CU8A 4GRLA 5DVNA 1ZT1A 4KKNA 3OMAB 3GHBH 3LY0A 1QO5A 3H4GA 3GBNH 4Y5XB 2YXMA 1RV6X 4G8FA 3MI6A 1YRRA 1P9MC 4JFHD 2F58H 1Z66A 4DOHB 3HN8A 1UQYA 3VNLA 1VH7A 4RISL 4GB9A 1CGWA 1A9BA 3P4MA 1J8HB 2O7SA 3UACA 3O3EA 3U0WH 2W91A 3HFTA 3AMDA 4ZMWA 1A5MC 1FN4A 5JDJA 4QTHB 2C15A 4EE2A 2ZT9C 4S3BA 3DGBA 1E0XA 3W00A 3S0CA 1ZV2A 2HRGA 3MRFB 1WA3A 3QJTB 3APYA 2DT1A 1BZOA 2GDVA 3LDVA 3RWHB 3II2A 4Q8WA 1N2RB 5C9WA 4PJAB 5L4MA 5IM51 4OV9A 1JPIA 4CN1A 3I85A 3RRQA 2VC2B 2VC7A 1YPZA 3QG6A 4FQXB 4JRYB 3OYXA 4XNZC 4AYID 3QT2A 3KYAA 4ERAA 5I1JH 5BW7A 4KJQC 3OGVA 1BV8A 1FO0L 1FJ1A 3IRPX 1B9ZA 1XC6A 3LHVA 4NKDA 1HINH 4EZJA 4QRRA 4CQ9A 1JWUB 3BLPX 3ZVHB 4HIPA 1GIGH 3LMZA 5EOCL 1F4YH 1KY7A 1E4JA 2NY7L 3DGGA 4PVMA 3IDUA 4WEBH 5FUOL 1Q0EA 1NDTA 1JNEA 4FIQA 3U0HA 3EYOB 3TBTB 1QSVA 1WTLA 3HN3A 1W3LA 2BK8A 4MOZA 4AX6A 2L7QA 4WAFA 3W11D 1QR7A 4EDXA 2FPTA 5IWLA 4ZPVA 4XMWA 4AV5A 2X1UA 1S7RB 3CSYA 4AF0A 4L4PA 2C3ZA 1YXYA 1JFQH 4D8OA 4JFPB 1H15B 3EIFA 1NIUA 4PBVC 3ARSA 1CBGA 2VIRB 1XH3A 2CRYA 1DWFM 4LLYA 1JTPA 4UINH 4PV9B 2DW6A 1MCDA 3DDFA 2FJFA 4CQAA 1NCUA 4OZHB 3ZDWA 2V7NB 1YN6B 3R8QA 4C60A 3MXWL 2FBJH 1K7EA 3QWQB 4LT9A 1NMAH 1TQBC 1JZ2A 5K9OA 1IT9L 2ZE3A 2Z64C 2HTLD 4I6VA 1AR1B 1J86A 4NKMA 3ZMNA 1BXVA 4OIBA 1U8QA 4HALA 1IIGA 3CIQA 3P3TA 2XN9D 3BIAX 3ULSB 3WNLA 4UM9A 3TO2B 2YWYA 2BSRB 1D5XA 5D7JC 2VYOA 2RFXB 4JVUA 4UUJA 2AJUL 4K5PA 3WQGA 4HJSA 2JKAA 4A7VA 2XWBB 3RVTD 4W9JC 3PUCA 1V55B 1OX5A 2ROYA 1JRHH 3MJMA 2WB1A 4E6MA 4Z7IA 4P2QD 2P5EE 3KRUA 1AG1O 4WSKA 4DXKA 5JW4R 3LB6D 1SO3A 4FFZH 4IYKA 1PKQB 5JOPD 1KYOK 4WI5A 3D1MC 5G4OA 3G1XA 4GSXA 3RZCA 5IY5B 5EPMB 1J1PL 3F7YA 1GVFA 3TN4A 5DMJB 3QS3A 2PKDA 4G6JH 1JV2B 1WAPA 5C2GA 2FZBA 2VR6A 4HPGA 2AEWA 1BQSA 3HBZA 4UR7A 3D3AA 1SHMA 3UABA 2NXZB 5CG7A 3B9EA 3CDCA 1OVDA 1OM9A 3F2BA 2DD8H 3C9NB 4A1RA 2EDMA 2J9YA 3HLAB 5HYFA 2QAFA 1UP0A 4FFVD 3VFSA 4M7SA 3NEEA 4XVDA 4DBUA 3SBWA 1FCCA 4DWSA 1KFWA 3GSUB 4F2UA 4UILL 2OR9H 4QRSA 2WXHA 3O6ML 4G2DA 1X44A 2YN5A 2K4WA 4LGXA 4KQ0A 4HKBA 5KVDL 2IMMA 5AKSA 4MNHB 1XCWA 4H01A 3N4AA 2NR6C 1BZ7B 1F2JA 1GUVA 4H2AA 4B91A 2NTSP 1QI3A 4H4IA 5DJXB 2ODHA 3SKMB 3O9WC 2NW0A 4X6EB 2TMDA 4FNRA 3DC0A 2EIMB 4EOWL 4G7VL 2IDUA 5G4HC 4OCSL 1YEHL 5B1KA 1Z89A 4GBXD 4L0ZA 4JPKL 1HZHL 4NUGL 4XI5C 5HYIA 1NGQL 1CQKA 5GGVH 2WTRB 3NYZA 1EBGA 3KPSE 3QYSA 1LUCB 5HHPB 3FU8A 5IQLA 3SDDA 2EPMX 2W0UA 5B21A 3KDMA 5BWFA 1R3JB 1DEDA 3UXFA 1PDZA 4Y96A 3DDMA 1N0XL 3TXVA 1EFXD 2XH2A 3GB7A 1TZ7A 4Z1YA 1FG9C 4GSDL 3L9BA 3BQUB 1U5HA 4LCWD 1RIHL 4AVFA 3KHJA 2TODA 4N9DA 3ILDA 4FQXC 3TZNA 5CLXA 4HSNA 5HI3C 1ZLPA 2X4TA 2VDNL 3HNSH 1J48A 1S9WB 2PDLA 5CLZA 3QNZB 4ZZFA 2YXOA 4EF9A 1DOSA 1XEDA 2OFJA 5G4NA 1KCBA 1NAMB 5I18L 4E5XB 2HA1A 5C0BD 3DG3A 2NY0D 1R24A 2FTYA 2YWZA 4C47A 4HIHA 1E51A 3H3BC 3AG2B 1TNMA 1O60A 1WP6A 2OW7A 4UNIA 2PF8A 4GW5B 2IAMD 2WZAA 1UZDA 4WKZB 4K7PY 3P3UA 1MQKL 3L5MA 2Y7MA 3MOAL 2J6WA 3VWKC 3QEQA 1XKYA 1VP5A 2HJFB 1VFHA 5CEYB 1SYVB 5EB8A 2HJLB 5ICXA 3ARFD 1DFBH 1JFXA 3NCYS 1BD0A 5I6MA 4ODBD 4LEEA 4PJDE 1C9SA 1YMYA 4QISA 4D9LL 4M6MH 2E3ZA 1QSFB 3GKFA 1I7RB 1KGWA 1DQJB 2IPJA 4DVOA 1OANA 2HNEA 2FEEI 2GITB 2R15A 4GIAA 4DJDA 3QOKA 1YPIA 4PJXF 2O9RA 4HZLB 3IARA 5A43C 1MCWW 4XUGA 1CCZA 1TCRB 3FQRB 3P93A 5GRJH 4L2LA 3N29A 1WCQA 3SDXA 4XCFL 2L8AA 1GNXA 3H2OA 1AR1C 1U4EA 2GOUA 2LW3A 1TKWB 2F53E 5FLVA 1GPOL 4TLSA 5SWZE 3ZZSA 4AQ1C 3O6YX 1GGCH 3W1NA 2ZCLH 2BS9A 2IPWA 4W7UA 2F19H 2P7TB 3BV7A 5CBEA 1VERA 3TR9A 2VDML 4JIQA 4IHOB 4NJJA 2ADIA 4OKVA 3AIWA 3SUVA 2DOCA 2ZSVA 3BX7C 3KPOB 5GRZA 2F84A 4Y4HC 2VDOL 4L8SC 4YZFE 1IU1A 4QCEA 4ZFZA 4JO1L 2PWUA 1CBJA 3SCPA 1H5BA 2OZ4L 2WIIA 3WXWH 4LEOA 2Y24A 1ZBKA 2B59A 1V7NH 4YSEA 3RFZC 1DVYA 3A6CL 3VFLA 4XMPL 3EH1A 1IQDA 5BRZB 3QEUA 1WAAF 2HCZX 3RDTA 1ROCA 3S34H 1XTLA 2IVFC 3PZVA 2R2HA 1UPMB 1GZ1A 2NUPA 4IFRA 2I9UA 2YLHA 3ES7A 4QKXB 3W53A 2L5HA 2FGBA 3LMJL 5JUVA 3MDWA 1XLFA 4YSUA 3MA9L 1EJ6A 1WICA 3H53A 4ELMF 1KG0A 4YUEH 2Y8VA 2Z7UA 4NIYE 4EVNA 4JQ3A 4E0RB 5LGHH 1QUNB 2QPSA 3IXAB 4GQ0A 1EXPA 1GA2A 4X7TB 1HILA 4L9YA 2QPDB 3QSTA 4FFYA 3ELFA 3MI2A 5EU7C 1OT1A 2W38A 3BPCB 5E8OB 5CU9A 3KLSA 5L8LB 5CZTA 1PMYA 5C8JA 1A4CA 1U8MA 5CWSB 2DQFA 4OWGA 1K72A 1ZT4A 4L4TE 4DCQB 2DLFL 5B38A 1PIGA 3OQEA 3ZZQA 4C6CA 5HWMA 5DJYA 4BZ1A 4X6FB 2Y1VA 2VEKA 4HA0A 5IFAH 3K46A 3N12A 5I8OL 5LNVA 4PODA 1XLBA 1CLOH 5ILTL 4FL4C 4WUIA 1BXCA 4NJ9L 2ENPA 3ZDYE 4OJCA 4QRNA 1AQDB 2EVIA 1SOSA 3H4FA 4GRWF 5FJOA 2OZTA 1ZSXA 1OLZA 5FL1A 5AOIA 2JKPA 3JTSB 4POZD 1A3WA 2DU2A 4X63A 3FTVA 3D3VA 4HD5A 2CLOA 4XN7A 7TAAA 1T99A 5LQBH 2AK4D 5ITBL 1PG7L 3UZEA 1AHKA 4P5MA 5L2KE 5IV2A 3D2UA 4Y16B 1A1NA 4OFPA 1UZ8A 4QT5B 3S35L 3QKEA 2MFNA 3EDJA 3BE7A 1YY8A 5A2BA 3FOKA 3LK6A 2PLJA 4YHPA 3DVNB 4OE7A 3GNPA 3AT0A 1QAWA 1YEEH 4YC2C 1OV8A 4G8GB 3A4WA 1W1YA 1FZKB 2DZAA 2I9TB 2FRGP 3R0MA 3TV3H 4F33A 3D4YA 3V5DB 4IG2B 4LCCC 2X4RA 5EUOA 3RQ3A 1MZYA 3APCA 2VCCA 1CGVA 4MJ2A 4OQTH 3EA2A 4YXHL 3WLOA 4M48L 4F5CA 5EIIA 3ARDA 1XDMA 1MFEH 3XIMA 5I3IA 4JDTH 4JHMA 3S42A 1GHFH 3W86A 4K2SA 2ENQA 3MRGA 2EPNA 3W87A 3H2EA 3PVFA 4K8RH 4R4FH 5HJ3A 5F0JB 3B9DA 1JGMA 5EMLA 3BKML 4IK6A 3BKCL 3LKSA 4IK7A 5FYJE 2JB6B 2O9OA 3HRZB 2ARJA 4YHKL 4OJEH 4FNUA 1FHLA 1F6FB 1OAUH 4KRLB 1XYAA 4OOZA 3JZEA 2CA3A 5C0CE 4H8WC 1ZU8A 3NVDA 3LZNA 1BRLB 3T04D 1M1XB 3GSNH 3GG0A 1PAZA 3U9WA 1TYGA 3B37A 4Z76A 5F2FA 2OQJA 3KL0A 3ZLFA 2I24N 2V6AA 1ZAJA 3N11A 5CAKA 1R2SA 1DQLL 3GMLA 4H9TA 3DFQA 4EWND 1EIXA 2OMWA 4Q4SA 5AYYA 4F0HA 4NQVB 4XHJC 2DMCA 4UQ3A 1P7HL 3HZKB 1Q13A 1FXQA 3U7YL 4ZMXA 2D23A 4WO0A 2EGZA 3I3BA 1R3QA 3M0ZA 3GZOA 4JDZB 2EDYA 1Q85A 2X4OA 2EE0A 3RY6A 3RCMA 5IHWA 3WMLA 1Z6JT 4Z8FH 2UZIH 5CZXC 3TLRA 3MMUA 5IQ9A 3TV8A 3W82A 4UDUA 1FPTL 3RWDB 4S1SH 5HY9B 3G6MA 5KS9F 3RGBA 4N2LA 2DYRB 4PAZA 2FO8A 2Q7YB 3IJ9A 2QDHA 4I9WE 5BXTA 1T89A 5GRVK 3E5PA 4U7MA 4RGNB 4ZVJA 3F7PC 3ZTDC 5EU5B 2OR7A 2R4RH