4GQQA

Human pancreatic alpha-amylase with bound ethyl caffeate
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Order and disorder: differential structural impacts of myricetin and ethyl caffeate on human amylase, an antidiabetic target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4gqqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4gqqA01
4H8HA 1OB0A 1M01A 1E6SM 4M8UA 3BUDA 4W8BA 3ZJ8A 2VCBA 3SCPA 2PB1A 3W38A 2VVNA 1TQWA 2XIBA 3S6TA 5C70A 1XCXA 1UZ4A 4A3HA 2D0FA 1WP6A 4ML4A 1ZB5A 4MNLA 4UFKA 1GZJA 3BAWA 3GXMA 1CNVA 4FNPA 3TTQA 3CTTA 2BHUA 4QAWA 2GJPA 4NX0A 2AMGA 4W89A 2VCCA 1Q6GA 1OGGA 3VGDA 3SCOA 2JIWA 3UR7A 1RH9A 2Y8KA 3OBAA 3VDHA 4Z2HA 4PCTA 3PZVA 3AXXA 3L4WA 2VCAA 2YBTA 1Q4NX 2VL4A 1J9YA 1QNRA 4AD1A 1JZ2A 2ZUSA 3HU7A 2CEQA 1MW2A 3HZ3A 1JNDA 1LQ0A 4BCEA 2F7PA 4CUCA 1BYDA 2BXYA 1JYNA 1B3ZA 2GJXA 2WMHA 1KTCA 3FAWA 1XRVA 2TAAA 4P7OA 2WM0A 2WVTA 2HVMA 3BUPA 2A3AA 1JG9A 1B0IA 2DSZA 5DFAA 1V0KA 1W32A 4GI8A 4ATDA 3VIMA 4HA3A 4UNIA 1MW1A 4JL1A 3KE0A 1X6LA 2Y24A 4ACZA 2PWHA 1E0XA 2FDMA 3A4AA 4JZ5A 3VSVA 1BGGA 3N9KA 1E71M 1J0KA 5A95A 1CGWA 4LQ1A 2WVVB 2DT0A 2E40A 5E09A 1JFXA 3EMZA 3A23A 1HP4A 2A3EA 4DUWA 3WH8A 4H8VA 3WBAA 1EQPA 2CBIA 1ZS2A 1MQPA 1V3JA 3MMWA 3D3AA 1TFVA 3VUPA 1PZ2A 1NARA 1NWTA 5ECUA 1H11A 4W7WA 4H04A 4B9YA 4A4AA 1G94A 3G6MA 4EE9A 4GO9A 3WH7A 1WZAA 1UH3A 3VNYA 3N17A 2DSKA 1UUQA 3BSGA 1W9BM 2WHLA 1JF6A 5ABFB 1CPUA 3SUTA 3SUSA 1ISYA 3ARWA 2WVSA 2F7OA 1QI0A 4PMQA 3EDFA 3L4VA 2X2JA 2WMKA 3WD1A 3AMGA 3WQ6A 3K8MA 1QW9A 3BUIA 3OZOA 4WKHA 3T2PA 1JIBA 2EPOA 4UFLA 1CGVA 1UWIA 4GZEA 2WHJA 1B31A 5HDRA 2QMJA 1KWKA 5BYWA 4W84A 5A2BA 3ECQA 2CETA 2PI6A 2UY2A 2WMIB 2WK2A 4FLSA 4U31A 2OYKA 1OWQA 3J7HA 1KR0A 1VENA 4OBRA 3W82A 1KFWA 3OLIA 1TQTA 3T0BA 4AY1A 2E8ZA 2WZHA 4FNTA 4BQ3A 4FLRA 2JE8A 5DEZA 1DHKA 1E40A 3BAKA 1B3VA 4IUGA 3POHA 4EKJA 1UWRA 1J0ZA 5CJ5A 1E15A 4P7QA 5DT5A 4UQEA 3KWXA 2OSYA 1YQ2A 4Y7EA 3NSXA 2XIIA 1J0IA 4HPHA 2D3NA 3ZT6A 4ATLA 4M80A 1EOMA 5BXRA 5E0FA 2O9OA 1KGUA 1JGIA 2WSPA 3AMDA 2VO5A 2ZXQA 4CVWA 1WNOA 5I23A 2EAEA 4U3AA 1ODUA 3ARPA 3WD2A 2B31A 3ZOAA 1GQLA 1K6AA 1MXGA 3BH4A 2CESA 1HJWA 5GPRA 3UETA 2C7FA 3CC1A 1KR1A 4Z2JA 3VGGA 4JFVA 4W85A 5I0DA 2W62A 1UKTA 4FLQA 4AYGA 1Z32X 3MUZ1 4HOWA 1BF2A 4OGZA 1DWGM 5LYRA 1GNXA 3K4DA 4U5KA 3AS3A 4UFIA 1MXDA 2CHNA 2VC9A 3WNPA 2BV9A 5E6YA 3OIHA 1UWTA 1CZ1A 3MSGA 2BNJA 1UA3A 2WC3A 2O9PA 1NP0A 1ZBWA 3HG4A 2VI0A 5IXEA 1BGAA 1H0GA 3EJSA 1O6IA 1MW3A 1WZMA 3THDA 3W6LA 1JXKA 1WPCA 4AD2A 2ZOXA 4RE3A 4FNUA 4UOZA 2J77A 3CUFA 1EDGA 2J7DA 2Y2WA 2XFFA 3VO0A 1VIWA 3L2LA 4M56A 4QCFA 4AIEA 3DX4A 4J27A 1BQCA 3AZSA 3A4WA 3EDEA 4AZBA 2WHMA 5DO8A 5A2CA 1BVZA 4PTVA 5CGMA 4CD4A 1TZ7A 5BWFA 1WE5A 2ESCA 1C91A 3PZMA 2VJXA 2DH2A 4QDMA 1BYAA 1TVPA 3ZSTA 1KGWA 1QOXA 5CQ1A 2O9RA 3CZJA 2QLYA 1J18A 4JCMA 3AMCA 4S3JA 2V5CA 3WSUA 4KRTA 4PMRA 3DX1A 1UZ1A 2W66A 4MDPA 5JIPA 1LL6A 4HTYA 1VFOA 5FOOA 3OGRA 5M5DA 2VUYA 2J78A 4U3CA 5CSYA 2D2OA 2Z1KA 3NSNA 1CLVA 5A6SA 3DX0A 4AZ6A 1WZKA 3VM7A 3EJQA 4HZ6A 4GI9A 5D9NA 4C7DA 3D52A 4QFUA 4XZWA 3GH7A 3CUJA 2EPKX 2EJ1A 3GXTA 2DGAA 3OB8A 4UOJA 2OLHA 2WYSA 3SCRA 3WMCA 3VSUA 4B3LA 3B9EA 1JZ8A 1KCLA 5A8MA 2XPKA 4PMOA 2D3LA 2Z1SA 4FNQA 4W87A 1EGZA 3AYSA 4PMNA 4HU8A 4CCEA 3WDPP 2CBJA 3CZGA 3AIUA 1UKQA 3IJ9A 1O7AA 1H4PA 3PZTA 3AROA 2YOCA 2FHFA 3PZOA 3UG5A 3PTKA 1NOUA 3VMOA 3W24A 1XV8A 1B9ZA 5A6LA 3ALGA 3PBGA 3SURA 3B9AA 3MO4A 4BA0A 1VB9A 2GK1A 4OJYA 2WMIA 2NT0A 3LPGA 5M03A 1R86A 2CNCA 1R7OA 1UR0A 2X05A 3W4RA 3DHUA 3WMBA 2J7BA 1V3MA 4W88A 1KCKA 1HJUA 2WMFA 4WIWA 3DC0A 3M7SA 4AZGA 1UD2A 1FFQA 1VEPA 1EXPA 1IZKA 3K8LA 1HF6A 4FLOA 4LYPA 2DH3A 2IGTA 1VFFA 3WH6A 1TA3A 1MFVA 3OG2A 4A3YA 4CCCA 5ABEA 4CD6A 1US3A 4TUFA 4URIA 1E9LA 3IJ8A 2F7QA 3MKKA 1WDQA 4MNKA 5FD0A 4W8LA 5D8ZA 1EQCA 4Z2GA 3VGBA 2VX7A 3BGAA 3ZQ9A 2E9MA 3NDZA 3EMQA 3O9NA 3GZAA 4UFHA 1UKOA 1K9FA 4W8AA 1PJ9A 4DO4A 1WAWA 3WIJA 1GOIA 1QI5A 3TTYA 3QGVA 1C93A 3VVGA 3BUQA 1XYFA 3BSHA 1B3YA 3T0DA 5E1QA 3OGVA 3WQ4A 3U7VA 3HG3A 5I24A 2BY3A 4PTWA 5CZKA 4CCDA 4AXNA 2YBUA 3MV01 1I1WA 1ZJAA 1V3LA 3WELA 3QHNA 2D1ZA 4P8UA 2BVYA 2E9LA 1DWJM 3FHAA 4PMDA 2VURA 2JALA 1CECA 2PWFA 3TV8A 4CN4A 5D9PA 4UFMA 2WW5A 3GM8A 2G41A 4U2YA 1QBAA 3SIMA 4UR9A 2PBOA 1MVYA 3D5HA 4TX6A 1R34A 1UD5A 1F4HA 2IXVA 5FIPA 1DP0A 3AHTA 7CGTA 4JL2A 3LRKA 1UOKA 3TONA 1E4MM 1FH8A 1PX4A 4KH2A 4ZXOA 3GH4A 1H5VA 2QPUA 2J47A 1BVNP 2J7GA 5GNXA 2QF8A 2EXOA 1OT2A 5I2UA 1G5AA 1TR1A 4WK9A 3BC9A 3F5JA 5A8OA 1SZNA 1WO2A 1VJSA 2CYGA 4AMCA 4J3SA 2OWXA 2EPMX 2J4GA 4J3UA 3W53A 4PTXA 4YPJA 3WQWA 2XFRA 3ZT7A 1X1NA 3BMWA 3AIVA 1CIUA 3LRLA 3VIKA 4HZ7A 3BXWA 3N18A 2YDSA 2V5DA 1C7SA 1LL7A 4CD5A 4F66A 3L4UA 4FF5A 3ZMRA 5BXSA 3GDBA 3AXHA 1OD8A 3WDRA 2ZICA 5CG0A 4PBGA 1TQUA 3WENA 1UR2A 1SFSA 3SCQA 1EO7A 1J11A 5D4YA 4MJ4A 5EMYA 1NWUA 2F18A 3U5YA 5BXPA 1NQ6A 3S5ZA 2CCRA 3MV11 2YDQA 2VT0A 3ARVA 1UH2A 4MNJA 1GOOA 1JNEA 1K9TA 2DSUA 4PMVA 4UCFA 3ARTA 2PWGA 2YA2A 2F7RA 4QLKA 4OUEA 1E72M 4HMEA 1QW8A 3ARRA 1E6ZA 1V6VA 1W3KA 3DDFA 1IT0A 4CU7A 5A8QA 1W9XA 1Q6EA 4YN5A 2XSAA 1V03A 4J3TA 3NYDA 3LMYA 4JKMA 2ZUUA 1U2YA 1ISWA 4U33A 1F4AA 3VIJA 1V6UA 1UASA 3UR8A 1CDGA 2D24A 4GZJA 3VGHA 4B9ZA 1R75A 2UY4A 4LYQA 2YLLA 5AYIA 2WWDA 2OW7A 1ISVA 4AEEA 3VOCA 5BCAA 1OGBA 3WFZA 4OIFA 5CLWA 4J28A 1GOQA 2XM1A 1IV8A 3UEQA 3ZJ7A 4Q7NA 4PMXA 1GVYA 1AQ0A 2JF7A 1HP5A 1FP9A 1R85A 3AI0A 4NF7A 1CGYA 1KXVA 3RDKA 3WEOA 1PBGA 4BQ5A 4GPNA 4RE2A 4N0RA 3L4ZA 1JI2A 4L4OA 1LL4A 4UQ9A 3PN8A 3FN9A 5FCZA 2X8RA 1LJYA 2FGZA 3AHZA 1JZ7A 3NDYA 5JBFA 4W7VA 4V2XA 2FHBA 4NZCA 3WKZA 3CH9A 1SYTA 1EO5A 4ZFMA 3WNLA 4GQQA 3N13A 4PSPA 3F5KA 1C8QA 1OD0A 2CXGA 4DWSA 4LXFA 4P7NA 2XVLA 5GNZA 4BQ2A 1JZ4A 3WF2A 3W27A 4BZYA 2GSJA 1W1TA 3WY2A 4CU8A 1PIFA 4M1RA 2VRKA 1WB0A 1W9PA 3AS0A 4F9DA 5C8BB 4RL3A 3K46A 1J10A 1CXLA 3AICA 3B9DA 3MU7A 2VR5A 2BXZA 2CBVA 1CGXA 5JUVA 2DT2A 2WZIA 2EADA 3ARZA 2ZX6A 4AZHA 1MQRA 4AW7A 5HXMA 1N82A 3AZTA 1C90A 4JKLA 1KBKA 1E4NA 4W93A 3SCNA 2G3IA 1GHRA 3QOMA 3PHAA 5C71A 4U5IA 3A24A 3DX3A 3M6DA 2YJQA 3WMSA 1GQJA 1XH0A 3KLKA 1GCYA 1SMDA 5IDIA 4Q22A 3VIPA 3RM8A 5A2AA 3VD3A 1KWGA 2X2IA 1B1YA 1FH9A 2O92A 4WLCA 2YLAA 5AYBA 4XUYA 1UWUA 3MANA 1KGXA 3IJ7A 1QI2A 1JD7A 4ZE5A 2XGIA 1JAKA 3I3BA 1FFRA 1NP2A 1A3HA 3L4YA 1TUXA 2X1IA 4ACYA 4TVCA 2WC7A 3GXIA 1VBRA 3AHVA 3VKKA 3POCA 3WY4A 4J3VA 1EHAA 3VD7A 1CXIA 3APGA 4MJ2A 1UWSA 2OWCA 4AD3A 1QHPA 3EJUA 2DSWA 1QI3A 2G3MA 2PBGA 3O6AA 1W1YA 2WNWA 2GDVA 1RD6A 4X9YA 3BVWA 2D20A 1QHZA 2J74A 2V38A 1CYGA 4M82A 3A47A 2DPEA 1EOKA 1GORA 2VZOA 4MB5A 4GZIA 5D9OA 3VDAA 1DWAM 1E55A 3WNMA 1GHSA 1VRXA 5D8WA 2ZWYA 4NSBA 3LXAA 2XWEA 1XGZA 3TP4A 4AYSA 3UG3A 3KL3A 2J79A 4CD8A 1U33A 3A22A 2QPSA 4TTGA 2GJRA 2EPNA 1QWNA 4TX8A 3ARUA 2WBKA 2XYLA 1E6NA 1XHGA 2OWWA 4NXKA 4W5ZA 4UOQA 2VX4A 3CMJA 3THCA 4JFUA 1HVQA 3A4XA 2WKGA 2VZTA 2VRQA 3N04A 3KZSA 4WJXA 3GXPA 1LWHA 3BAIA 1FH7A 3RCNA 3RILA 3D4ZA 3KL5A 4PMZA 4PTMA 1O7DC 3CZLA 2XUCA 3AZRA 3ZSSA 4NZFA 1JI1A 3FNDA 4PUEA 3FAXA 4FNSA 5AY7A 1G9HA 2CKSA 2AAAA 3IAQA 2WB5A 1UQYA 2Y4SA 4E2OA 2JEQA 3BVTA 1W3HA 1JAEA 4AIOA 1GW1A 3A5VA 4AWEA 3N12A 3EJRA 3MMDA 2VMFA 3BLKA 1W9DM 2ZXDA 2DEPA 3AIEA 2WLZA 4FMVA 4AZCB 3VDBA 2J8GA 4K68A 1GJUA 5D9MA 3WDJA 1V02E 2J7CA 2WVVA 1V6YA 4ZE4A 4J3WA 4TTUA 2D73A 2D0GA 1ZU8A 3LPFA 4QP0A 4BS0A 2VQUA 3FY1A 1W3LA 4HA4A 2OSXA 3W28A 1JXJA 1V3IA 2GFTA 3CZSA 4MB3A 3EDJA 3PZIA 5EFDA 5A6BA 3CUIA 1DWHM 2XVPA 3WUBA 2D0HA 3DDGA 3DYMA 4P7LA 1GUVA 2W67A 2VX5A 3PZQA 4YHGA 4TXEA 3MS8A 2CIPA 3NIYA 1YHTA 2OYLA 3W0KA 3GXNA 2D22A 1UR8A 4X0NA 1GVIA 5ABFA 3LRMA 1CBGA 3OA5A 1M7XA 1KXTA 4AMWA 2BHYA 1ITXA 2ZX5A 3IGUA 1UR1A 3PZUA 3KL0A 1QWUA 4PYSA 1TVNA 2BS9A 3WEMA 2ZUNA 3VD4A 2WBGA 1UD3A 4L4PA 2J7HA 3DECA 1HL9A 3M07A 4R27A 1CGUA 1JDDA 4HP5A 3GNRA 1ZJBA 2V3DA 5FL0A 1QBBA 3W81A 2ZUMA 1UYQA 4HOXA 3N15A 3AIQA 2GJXB 3ZT5A 1FA2A 2Q8XA 2FE0A 3VD5A 1A47A 3ZM8A 3WD4A 1ZBKA 3CHCA 4BF7A 5HBFA 2UY3A 1K9EA 2ZXAA 1E70M 3AIBA 4FNRA 2JIEA 5DMYA 3SCUA 2WCAA 3WH5A 4IM4A 3BMVA 3HG2A 5E6ZA 2VRJA 3WNKA 2WMJA 4TVUA 3VDCA 4ACZB 1SR0A 3AHXA 1DTUA 1AQMA 4CVUA 1P6WA 3QR3A 4AIUA 3BAJA 4P8WA 2YL8A 2BFGA 2PWEA 3ZR6A 4U2ZA 4UZSA 4HMDA 3F5LA 4MPKA 3ZO9A 1CTNA 4AZIA 1HNYA 2OSWA 4TVDA 1PIGA 1W1PA 3TOPA 2UWFA 4E8CA 2DIEA 1UD6A 1RP9A 3NCOA 2OW6A 3RIKA 2NW0A 3WF3A 2WCGA 1E43A 3CZEA 4JHZA 3FHQA 2ZXBA 2J8FA 2G4FA 1OIFA 1BPLB 2Y5EA 2YA0A 4NRRA 2PWDA 1RP8A 3AIRA 1H09A 1R87A 4HZ8A 4MTVA 1ISXA 3BLBA 3GXDA 3A3HA 1PX3A 3WD3A 4XZBA 5A8PA 1EH9A 4D1JA 4AZ5A 1ZBCA 1FOBA 2W91A 4CKQA 2VR4A 5HNNA 1B3WA 2VQTA 4IPLA 3BUBA 2FGLA 2XTKA 1KXHA 1EIBA 3B8SA 4AD0A 1V3KA 2X0HA 4H8UA 1QI4A 1Y7VA 3VX0A 3AOFA 2YFNA 2A3CA 3A6OA 1GQIA 3WDIA 4NRSA 2ZE0A 1C8XA 2AOSA 3VNZA 3IANA 3SCVA 5AC5A 2F2HA 2GUYA 1HJQA 4Z2IA 2V3FA 2J7FA 3T2OA 3LPOA 2V3GA 3AQUA 1NOWA 3ZIZA 1EA9C 4H2CA 2W61A 1Q6CA 5ABHA 5E0CA 1TCMA 3W29A 3IAPA 4QCEA 4D6IA 4P8XA 3VIOA 2E4TA 1EHNA 1L8NA 4DM2A 1CEOA 1FHDA 3EJTA 2F1AA 3CHDA 4P7RA 3DHPA 4C7FA 1BG4A 3RMEA 4AZ7A 3OZPA 1E6XM 5CSUA 2F61A 4AZCA 1D3CA 2BVDA 3M46A 2C8NA 3HG5A 3GBEA 1KBBA 3W26A 1J0HA 1VJZA 3VIFA 1XSIA 4W5UA 2ZX7A 1OCQA 2Y8VA 1R47A 4W86A 3N1AA 1OIMA 5A69A 1HT6A 4YHEA 2WXDM 3AMLA 4MB1A 5IHRA 3WQVA 2BY2A 4UQBA 5A1AA 3CO4A 1WDSA 1I75A 5JBDA 2X0YA 3U7BA 5I3DA 2YFOA 2XN0A 3ZJKA 1W9UA 4B3KA 2WWCA 3S5YA 1E0WA 2WLYA 5M17A 3RM4A 3OLEA 1BLIA 3JUGA 2W5FA 3MUIA 3WL0A 2VNCA 4PCSA 8A3HA 5KZ6A 1CGTA 1LWJA 1T0OA 3RJYA 4C7GA 1LLOA 1E4LA 2A3HA 4NZJA 1HWWA 1V3HA 3MUAA 1W2VA 2EBNA 1HN1A 5LA1A 4XX6A 2FH6A 3WD0A 1PEZA 1V6WA 3WDHA 5IHSA 3RO8A 3WEZA 4EANA 4Z2KA 3T0AA 4ZENA 1NWSA 2YL5A 2MANA 2QV4A 1HIZA 2A3BA 1JZ6A 3W37A 4E8DA 7A3HA 1ECEA 5E9AA 1QNSA 3PTQA 2YDRA 2XJ7A 5JIWA 1E4IA 3CZ8A 3D50A 2X2YA 3FXYA 1UG6A 2CERA 3AS1A 1HXJA 1AVAA 2XHYA 1B3XA 3MI6A 9CGTA 2WHKA 5I79A 5I78A 1CXFA 5HOSA 1MQQA 3K4AA 3QOKA 4FK9A 5A6AA 4PMUA 1J0YA 1KXQA 3D51A 2NSXA 3II1A 2F8QA 4D6DA 3GH5A 1E6RA 1SMAA 2WVUA 2C0HA 3AISA 1HKJA 3NUKA 1NM9A 1VFMA 1JD9A 1KB3A 4MDOA 2GVYA 4DO6A 4DO5A 4Z2LA 2DSVA 3GBDA 4AISA 4E4PA 5LA0A 3VD9A 3UERA 4GQRA 1JZ5A 3CIVA 3VSTA 3QHMA 4UTFA 4F8XA 2DIJA 1HXKA 1JYXA 1HJSA 1ITCA 3WDQA 2WCSA 4UFJA 4UQCA 2VVSA 1FP8A 1G01A 2BVTA 2RGLA 1LG1A 6A3HA 3VIHA 4M81A 3BCFA 3VIIA 2E9BA 1R7AA 3CHFA 1G1YA 3WQ5A 4XB3A 1PS3A 3U57A 4QLLA 1WCGA 1Q6DA 1OGSA 3CUGA 3SUVA 1GOMA 3L4TA 3MSDA 3EMCA 3AMKA 1R33A 2ALWA 3H55A 1B30A 4EK7A 3WF1A 1CWYA 1HVXA 1QHOA 2ZUWA 3KLLA 2F1BA 3TTOA 2JFEX 3DYPA 3OGSA 3W6MA 3IK2A 2VZSA 4CN6A 3WF4A 4PRWA 2V3EA 4GO8A 4LYRA 1W2PA 2VOTA 2IXUA 2ZX9A 1HL8A 4LGXA 1GOWA 1C92A 5BROA 1PZ3A 4JFSA 1UA7A 3WNNA 2XVNA 1ISZA 2YIHA 2GK1B 3H53A 2G3JA 3L4XA 4ATWA 3I3DA 2EACA 3SUUA 2XVKA 4OBSA 5CPSA 4V28A 4M24A 1G0CA 3AYRA 3VIGA 3EYPA 4V27A 1CLXA 2W92A 1MFUA 1ODZA 3WY3A 2XSBA 2DQXA 1JF5A 4TOQA 1AMYA 2CPUA 2FH8A 4IISA 2XWDA 1E73M 2JF6A 2EABA 3N11A 1UHVA 4AMXA 4KGLA 1TE1A 1GJWA 5IFPA 1E1EA 3AFBA 3ALFA 1TA3B 3L2MA 3VGFA 1JDCA 1EDTA 4D72A 4WSKA 3WUGA 3VU2A 1V0LA 4N42A 4NXSA 2WAGA 3HJEA 5A94A 3FW6A 1XD0A 4S3KA 4HOZA 1AQHA 2OYMA 5IFTA 1C3FA 2J75A 1KQYA 4DWSC 3G6LA 3CLWA 2XM2A 1E3XA 8CGTA 2XGBA 1D2KA 1D7FA 2HISA 3ARXA 1R8LA 4MB4A 3EDDA 3BLPX 5I5RA 3F4VA 1BTCA 5TD4A 2XN2A 4DM1A 1XH2A 2YA1A 1QNPA 3I3EA 3VTRA 1VF8A 5A6MA 1CXEA 1JL8A 3BCDA 4R5EA 4W7UA 4MADA 1MYRA 5KEZA 5FKYA 1BYBA 3CZNA 4CU6A 1E5JA 4KRUA 1KTBA 2EEXA 3MUY1 4PN2A 3PTMA 4RE4A 1DWFM 3WY1A 4H7VA 4P8VA 4AEFA 3RM9A 4UQDA 3A21A 1H0IA 2NT1A 4D6JA 4JHOA 5CXPA 5BRQA 1U30A 1LG2A 4XV0A 1W3JA 1CXHA 2PF0A 3VINA 3HMCA 1E0VA 1DWIM 2J7EA 3WUFA 1DEDA 1MWOA 1BFNA 1HKKA 1VBUA 5EB8A 3CBWA 4D6GA 1J12A 3T08A 1E1FA 1OSEA 1RPKA 1BHGA 3TA9A 1WZLA 6CGTA 1M03A 1XSJA 3WF0A 3OLGA 4HMCA 1I1XA 1W1VA 4JCLA 4DWSD 3CUHA 1UD4A 1Q6FA 1XSKA 2CITA 3UESA 2ZUTA 1GPFA 4JAWA 4QLJA 3BAXA 4EAMA 4OOZA 3GNPA 5A8NA 3ARQA 2WC4A 3D4YA 4GKLA 1BSIA 3HN3A 1OINA 4F9JA 3ARSA 1HKMA 1HJVA 2WSKA 1WDPA 2X2HA 3WFLA 3SCSA 1XYZA 4GXPA 1UQZA 3DX2A 1CENA 4J7RA 3TTSA 4IPNB 1HJXA 4D6EA 3K8KA 1PPIA 1V0MA 3SCTA 3W25A 2FYVA 3VGEA 1C7TA 2CHOA 7TAAA 1WKYA 3PZNA 4PSRA 3O2LA 4X0VA 1HTYA 3QHOA 3EBVA 4ZEPA 3WQ8A 3NSMA 3KEHA 1VAHA 5CPQA 3ZJ6A 1E3ZA 4KWUA 2X09A 3SEPA 5BRPA 5HPCA 1VEMA 1J01A 1B2YA 4PEEA 2PC8A 5HPOA 1QPKA 4JFWA 3AXIA 2QHAA 4F79A 2WPGA 2DT1A 5EFFA 1OT1A 4DUVA 4MAZA 4B16A 3LPPA 2J25A 5BXTA 2VTFA 4JIEA 4WF7A 1V0NA 1HKIA 1NOFA 2XFYA 2IUZA 1ZBVA 5GNYA 1UD8A 5A6KA 2EQDA 2BY1A 1PX8A 5JBEA 4AD5A 5F7UA 1H41A 1TMQA 2CKRA 5I6SA 1UR9A 3RJXA 1J0JA 2BY0A 1BAGA 2VZVA 1XCWA 2DDXA 2W63A 1R46A 1UKPA 3LXCA 3LX9A 1XD1A 2EPLX 3AHYA 4D6CA 4M29A 3AIWA 3E1F1 1E5NA 3ARYA 4OZOA 2ZUVA 4MAVA 1JDAA 1S46A 2CBUA 5A6JA 1H1NA 4PUDA 1FHLA 1CXKA 2FHCA 3H54A 3S2CA 1ZL1A 2XG9A 2E8YA 4GINA 2J62A 3AS2A 4WKFA 2G8ZA 4D1IA 3WUEA 4HU0A 4WKAA 1ESWA 1C8YA 4UQAA 1X6NA 3K1DA 4B15A 3PZ9A 4AD4A 1GONA 5CGTA 2WMGA 3VMPA 1W9VA 1UH4A 2ZWZA 1HX0A 2VZUA 1B90A 2W4XA 3BAYA 3CPUA 4KGJA 2DT3A 4OOUA 3VILA 4BQ4A 1JYVA 3LXBA 3VX1A 2VX6A 4DWSB 4LX4A 1QNQA 1NWRA 5CPTA 4UZUA 4ZXLA 4H41A 1TG7A 2WZEA 5AC4A 4PMYA 1MW0A 3WBEA 1H3GA 3RPMA 3CMGA 1BYCA 1V6XA 4GI6A 5LA2A 1V08A 4WSJA 2JEPA 2O9TA 1H2JA 2D23A 1VFUA 1QNOA 2UY5A 4GIAA 5A3HA 2ZX8A 2XN1A 1E6QM 1KQZA 3WL1A 4D6HA 2QMKA 3T2QA 4HA1A 3GYCA 1JFHA 3CGTA 1XH1A 2E0PA 5DF0A 1UR4A 3UG4A 3VMNA 1IZJA 1NH6A 2YL6A 3CHEA 5EBAA 3SCWA 4AC1X 2WANA 3EJPA 3WH9A 3AJ7A 4D6FA 4MNMA 3CV5A 4JKKA 1E56A 5E70A 2WKLA 1QX1A 5CLTA 3NJ3A 1L0PA 1M53A 1BG9A 3BVXA 3VM5A 1US2A 1M04A 3CZKA 3OLDA 4LPCA 2GDUA 5DT7A 4J3XA 4KMQA 1OM0A 2RGMA 4NI3A 5GQBA 2G3NA 2ZIDA 4CGTA 1TQSA 1XC6A 1E6PA 2YKKA 1EDQA 4DUXA 2XVGA 3ZR5A 1UWQA 4CD7A 3VPLA 3UCQA 1GQKA 4D71A 6TAAA 3SUWA 5A6BD 1W91A 1JZ3A 4HPGA 1LF1A 1GOKA 1WDRA 1H49A 1JYWA 3EDKA 1K9DA 3MMUA 3PZGA 2EO7A 3WNOA 5I77A 3BVUA 4CN1A 3GNOA 5FL1A 1QVBA 3GTNA 1UKSA 3T09A 3U5UA 3GXFA 2YL9A 2BHZA 4OKDA 1TQVA 1PAMA 3BVVA 3DYOA 4JFTA 1OBAA 3WN6A 5ABGA 1VEOA 5M3WA 1V02A 2E3ZA
chains in the Genus database with same CATH superfamily
1CMOA 3TNNB 4EI0A 1ASQA 2DW6A 3G8RA 4PGBB 1WYJA 2HKAA 4LAMA 4EIBA 4LVNC 4KKBD 1DIOA 4WHTB 1IUZA 4X5WA 2PP1A 4PJBB 3QORB 1JNNH 3LSOA 2JB6B 4I18B 2DMGA 1PL9A 1NKRA 2ZTKA 5EORL 3KTCA 2WJZA 3UR7A 5DHYA 1ZV2A 3INUL 3L1GA 3SJVE 3R25A 3T04D 1XF4A 1ELSA 2C71A 2BP1A 4BCEA 3V3WA 4ABVA 3ETSA 4WW1A 5EBLB 2WMHA 1KTCA 4P7OA 4GS7B 3IJDA 4ZZFA 3FH7A 3JWNH 5AW6B 4GI8A 3O4OB 1UACH 4JKNA 4JL1A 2W07A 1LQAA 3GI8H 1IGWA 5AOLA 4WR3A 4PS7A 1BF6A 4BH8A 1G87A 4GJ1A 1KCUL 2DWDA 4JNZA 1N7KA 3LKOA 1TXKA 3EEZA 3EYUH 3IXAA 2CBIA 3QI9D 5KTEH 1MQPA 5I73C 1ACZA 3C5SA 5F7MC 5ECUA 2OR7A 4GYPC 4K71C 1XH3B 3CUPB 1F8MA 1S5HB 1YLBB 1DSWA 2WVSA 4UB0L 3ITVA 1KXTB 2VN5A 4OD3L 2BTMA 2A4ZA 2ZRYA 3BGMB 2KDYA 1CT8B 2IQ9L 1LT7A 3PWIA 5IJBC 2IGFH 2PGRA 4F7MB 2WK2A 4U31A 4HS6A 4NILA 4AJVA 2Y22A 1TTGA 3UZZA 3UZEC 4IUGA 1FNSL 2JMRA 1Q7QA 3EBAA 3KGTA 3GNXA 4G1KA 4YAQA 2NQCA 2D3NA 1AODA 4LEOA 1QRNA 4NI6A 1GK8A 2I9LB 4M5ZH 4KRPD 3RZCC 1US0A 4PB3A 2EYSA 3WFCL 1A7QL 5FOBB 3FQRA 1HJWA 3UETA 3GU2A 1UXSA 3RU8H 3VGGA 1JPFB 1UKTA 3KLQA 3E6HB 4NT6B 3SKNB 3QHZL 3S3JA 5EOQL 4PJIF 3SKMB 4DVBB 4B3VA 3MROB 1G7LA 5CM1A 3PGCA 3FT4A 3MUHL 1S7QB 5ECVA 3FQUB 1CGSL 3WFEH 3L48A 2ZCHH 3ZE1F 5FB8A 1BGAA 5FW8A 4XTDA 4A7UA 4JQIL 3PPCA 2HQAA 3OG6B 4PJFA 3T71A 2WQWA 2J77A 5JHMA 3HLAB 2ZNWA 2J7DA 2BWIA 4NZTH 4NN6C 5E8EB 2Y0FA 1T04B 1CF1A 1R5VB 1A4AA 2XA3A 4PGLA 4YYFA 3RCMA 2NY6C 1JRHH 4A8RA 4EQ2A 2FZ3A 4CD4A 2OQHA 1A7NL 5E6SB 1P1XA 3PL6A 1MFBH 4MFEA 3S6DA 2XV3A 3MRHA 1FCUA 3AMCA 4IT1A 3NJMA 4M8QA 1RJYB 4WTXA 3DI3B 3W7KA 2DQIL 1Q90A 1O5DT 2B1HL 3TN0B 1FFNA 1RU9L 3L1EA 3X1BA 4D9PA 3EGDA 4KO9A 3QIBC 2C16A 1MRCH 3MJ7B 3CBKB 1S9WA 2V7NB 4YCPA 2Q3ZA 2E86A 1JZ8A 4GUHA 3B2VL 3E9AA 4PMOA 5GISL 2CBJA 4Y9AA 1XLJA 5KOMC 2YC1A 1MRFL 3T1FB 3PZTA 3UJRA 2OB3A 4F8QA 4E5TA 1ZK5A 3BUYB 5HHMD 2FD6L 1B9ZA 4WX2A 3ALGA 3LCLA 1L9SA 4MD0A 2HKHL 1XGRA 3FQXA 4FX8A 5M03A 1LEKB 4B7IA 1Q9OB 3VFLA 3BE1L 3STZB 1OB1B 5B8CA 4G80A 4G7YL 3SE8L 1F6YA 1E27A 4B5UA 3QAQA 2NDGA 1U8LB 1WDQA 2OK0H 3TMQA 2JJSC 4J2PA 1J2BA 2P8BA 4M1GH 2EUZA 5C9JB 1TREA 4DO4A 3TXVA 1B3YA 2EE0A 4CCDA 1DQQB 5CGYC 5L88L 2AL2B 4FL4C 5HYFA 2VURA 1L3WA 2JALA 2PTUA 1P0NA 3SY0A 1REIA 1KYOK 2YBRB 2DZWA 5G2IA 2VLME 4UR9A 3U6WA 4DF1A 1ZXQA 2VERA 5DVNA 3KYOA 4HWBL 4B2DD 3C5ZA 1WBHA 4M1DH 3H21A 3I9PA 1XYCA 2ARJQ 3AREB 2YD1A 4IBZA 4BIKA 2MEJB 4FNLL 2MSPA 3ABXA 4DLFA 3QUKB 5EUOE 4WVRA 3ZYOA 3IT8D 1T99A 1KB9K 2EPMX 4L9DA 3CIAA 1U91B 5IOKA 1LEIB 4OCRL 4OU3A 2O61A 3ZT7A 5FGBC 1Q2SA 3SGKA 4X80H 2R1YB 2B77A 1HQRB 4ZTOL 1JNJA 1FAKT 3L54A 4FF5A 5HWMA 3GDBA 2HVNA 2I5YH 4XO6A 2ZCLL 3T07A 3WENA 5EMYA 4K7FA 2PP9A 3WYRA 3S5ZA 2YGOA 1EGJA 1JP5A 2RD0A 1ICTA 1VERA 1AQDA 4BFFA 2YPVA 4MZRA 3OEXA 2ZG3A 2FJHA 3WK2A 4ZB5A 4U33A 3GS4A 4QRPB 4TQ8A 3IGSA 5FF4A 1UCBH 5AKQA 3W83A 1TYEB 3TURA 1AJ2A 5AYIA 1FL5B 3EOTL 5D6CB 2R0LH 5CLWA 2BW5A 2P8PA 3ZVIA 3DBNA 2XRAH 4TSCH 2ZOTA 5T26A 1OX4A 1IEHA 3FK4A 3SE9H 2OX4A 2CLLA 5F9JB 4JTSA 4LBUA 4FZEH 4DGIH 1DVXA 2X6CA 4X6BA 4RLIA 3S7GA 1LDPL 1K8YA 2X4PB 1EO5A 4ZFMA 4NKOB 5HMFA 5DRCA 4GG6B 3KRSA 1OD0A 2YARA 4P23C 1CVSC 4F15C 3CT2A 2NOYA 4BZYA 4FABL 1PLGH 1LJMA 3NZRA 1W9PA 4C5ZA 3VYPA 5H37A 2QBWA 3FYYA 1CGXA 4G3YH 5E2WH 3D0VA 4MMZA 3TYFA 3QCVL 1XSOA 1RMFL 1M3JA 3INOA 1CL7L 5J8LA 3KLKA 1Q5MA 4WLCA 3AC0A 1PKYA 3MQTA 1M6JA 5IW1A 1JD7A 5DMKA 3H2OA 4P3CL 5IG7B 4GRLC 4BZ2A 1F4YL 3DFOA 2J5LC 1QFUH 1WWWX 1JV5B 3VFMA 3JWOL 4DYJA 1SJVA 1QHZA 1NLDL 1IBGH 2V38A 3X13A 4M82A 3CDFA 2MHAA 2XN9B 3X3FH 4ANXA 4O9HL 4MB5A 4KIRA 5I26A 2C4XA 3DKLA 4XGZB 4OIBA 2BHFA 4PJXF 4NJKA 1SGKA 3C2AL 2GJRA 1ZHKB 4UT7H 3WTXA 2DW5A 2FTAA 5CWSA 4YJZL 2ACRA 1DZBA 2WKGA 5HGAA 3DETC 2VZTA 4KZDL 2HP4A 4GSQA 1U3JA 1N26A 3FQNA 2HSAA 2XUCA 4CC4A 5EBWB 4JVUA 5AY7A 2DMCA 3QDGE 1IGTB 1GW1A 2WWOA 1A6WL 5KYXA 1KN2L 1Z9SA 1IL1A 3D69A 3MCLL 4E5XG 3PJXA 4AZCB 2APFA 2IEPA 4AHQA 3MN8A 1FYTB 4XMPL 3QIWD 4XNXL 2Z2BA 1YZZA 1T6VN 4MKTA 1DANT 2VQUA 2NY2D 1QPRA 4QRRE 4NSKA 2C9AA 4AM0Q 4MF4A 2X0VA 5F9OH 1FIGL 2XVPA 3VYLA 1TTIA 3NOEA 3PZQA 1HG3A 2CMRH 2C4FU 3NIYA 3QIUA 3KS5A 4GRWF 3UZVA 1NUFA 1S7UA 2ITFA 5B3JF 4TTDC 4TS6A 3E74A 1GCFA 2ALRA 4QGCA 1FN4A 1KTDB 3URQA 2RFXB 5IJKC 3EW3B 1TQCC 1IIHA 1HILB 3GSUA 4JPGA 1ITXA 3Q05A 4GT0A 4LAOA 1OCRB 3GSMA 4FQPA 2ZUNA 1G5GA 4GO6B 3KYMB 4XMKL 1FWDC 1HL9A 5AW8B 3URNA 3QUXC 2V3DA 2Q8BL 3RIAF 2YX0A 2WZPD 1XO8A 2VKWA 4HAGA 3ZS4A 3H1ZA 3CHCA 3GS0A 4XVSL 5ALCL 4FD0A 1PKQA 4JCWA 3O2DA 4Y4FD 4YSTA 4OZHF 3HHRB 3HPLA 3MLVH 1P6WA 3WEXA 3PDOB 4UZSA 4MPKA 2DJXA 4IMLA 1GZGA 2BCKA 2G75A 2V2XA 5HATA 5D33A 1HQTA 1J93A 4R90L 2LFEA 3NCOA 1AHWB 3QO0A 3CASA 3IUIA 1FAIL 4V1DA 4MAYD 2YA0A 2ON3A 2OZ0A 1VRDA 1LTDA 1SO6A 4TULL 4DJDD 4WW2B 5CJOH 1GYLA 2RKXA 2JKJA 3KFTA 4QD2E 3LENA 4TVPH 1UBSA 1Q6OA 2FECL 4QTHA 4B3ZA 2VXUL 1QI4A 3VOHA 2DRUA 3MV8E 4QWWD 1MVUB 2A73B 3M9YA 4PBWD 3SE4A 5D5MA 4H2CA 2W61A 3MJ9A 2R1MA 1Q6CA 5J7CC 2HV5A 2O5ZL 1JPIA 3IAPA 4QCEA 1QKZH 3MRKB 1UUOA 4GXUN 2I1OA 3IGAB 3OQ3B 4JTRA 3KCLA 5F0PB 4ZS6D 4KVNH 3EOAB 2BVDA 3UY7A 1A6TB 2X10A 1SEBA 3BESR 2ZVIA 4W5UA 4W86A 2LU7A 5L4IA 4DVRL 2DIBA 3ARFB 3RB5A 5K9QG 1I75A 3VB9A 1B0RB 3PWGA 4B3KA 1TUFA 3NM1A 1E0WA 1ACYH 3HR6A 3MLSH 4NM4H 1DQML 1IJ9A 5D6DA 3MA9H 3EOOA 4ZD3H 4OM0L 3UCRA 3QRGL 2ZZ7A 4TNEA 1V3HA 4ODVL 1RK0B 3G6JE 4XKYA 3W2UA 2WO5A 4FDWA 1IBDA 5EZLA 1GKEA 3KVLA 3D25B 1QLEL 3X1FA 4KAQL 1P1ZB 3BAEL 4KDTA 5CP7B 3BCJA 4U1GC 4Y8AA 3PTQA 1QU4A 1D5XB 4MQXC 1OAKL 3BSZA 5AHFA 2Q7YB 3W7QA 4EDWL 4IICA 1BAFL 3II1A 2NV1A 1GT8A 5FFGA 2YYUA 1CG9B 2WVUA 1EB3A 1GW9A 3O3BA 3TOYA 2XU9A 3RY6C 4XBPB 2QKIB 1EJSC 2OKTA 5FYJD 5FM5M 3M17B 2Y5SA 2ODIA 2WXFA 4L0YA 4LNRB 2H45A 1IKNA 5C2XA 1ZLSH 1JZ5A 4Q52A 4DSYA 2QVFB 3UTSD 2YGNA 2EDRA 5I3GA 3NEOA 2YUXA 3NQVA 4AVNA 1CCWB 5AVSB 3BCFA 4F57H 2SEBB 2OULB 4HQQL 4LZKA 1HQ4B 4JY4B 4QHUB 4HFWB 3BOLA 1ZHLA 5L2KA 2JFEX 2A38A 4GRWH 4QLWA 4I5UA 2QSVA 2IGLA 3V5DB 3G9AB 5HUOA 3V8CA 2NVDA 2ZOWA 3DV4B 3GSQA 3VRIA 2H2PC 1J5OL 1LL1A 4BZ2L 3H53A 2QQNL 3V36A 3DOHA 2PW1B 3P4MA 3MO7A 4PJGF 4EI5B 4REQA 4NQEE 3FTUA 4M7LH 4BH7B 2VLJE 1O5RA 4L1HA 3K30A 2CPUA 4B27A 1UATA 2IDUA 3CXFA 4E41D 3BLIA 3ZDZE 3N11A 2V5LA 3OWEA 5GS1C 3N06B 4U6HB 3RVVD 4UWMA 3VU2A 4OFVA 4WEVX 4OVUA 5IB1B 3E0GA 2YN5A 1VBGA 5G2WA 2OYMA 3AYVA 5BUAA 3W1TA 2JB5L 2WTRA 1Z7JA 1SXBA 3OVQA 3QFWA 2X42A 3EDDA 3NPXA 2QDEA 4QXTB 2XN2A 1XH2A 3FA3A 5BOEA 3OV6A 4XPBH 3I3EA 3GKZA 1MG3C 1TO5A 3DO3A 2PO6A 4OD2A 5T8GA 3ZQWA 3E2HC 3MUY1 2JELL 3P9LA 3MQIA 1GYCA 1NGWB 4F33A 4ZFQA 4HHLA 3GMLB 3QW3A 4Y7MA 4W6YB 3BH8B 4HVBA 3VFOB 4AXWB 1DEDA 5HR7A 2X7LA 3DG7A 1AZNA 4K3EH 2IDTA 2OPJA 3CK5A 5AVQB 3D9AH 4XCEA 3EFOB 2D8KA 1M03A 4OLEA 1DORA 1XSJA 4DW2L 3H4FA 3T0EB 3P84A 4YJ5A 3HI6H 4FYTA 2DQWA 5HNTA 5E4EC 1HYRC 4JFYA 3MRQA 1KB5B 2BSLA 2IFFH 2OR8A 2PYFA 4AAJA 4XBSA 5A16B 3EGJA 3O6CA 4B9JA 1T89A 1MCWW 1MCQA 4NYUA 3GU1A 3HBLA 5DBUA 2X88A 3P77B 5IJCC 3TWCH 2A9AA 1I1FA 4GXMA 1YDPA 3HQ1A 1DUYA 2ZAIA 5CPQA 2OOFA 5BRPA 5HPCA 1H9DA 2PC8A 4IOSA 4KPHL 4N9BA 5SWQA 4ES9A 4P5TB 1TTUA 2VEFA 2PDBA 3S0CA 5GJSL 1EJTC 1TPDA 5CCKH 4PLKC 2XNAA 1PVHA 5EMLA 5H8UA 3WBXA 1ZV9A 5DGRA 5I07A 1AY1H 2QGEA 4OGXL 5D4JA 2ADIB 3AHYA 4M29A 3AIWA 1UOZA 5ES4B 1PKOA 3M45A 3M5YA 2E1WA 3PFUA 3E49A 4MAVA 3EOYG 2PRMA 2W8CA 5I5MA 4C5YA 1I7UB 5CIPH 3PQYD 2G8ZA 2PP3A 3DMMA 4WKAA 2Z93A 4Y5VC 4HUNB 4CNTA 2FO4A 3R79A 2V9QA 1YC7A 4KTEL 4C1KA 3ZKND 3JZUA 2FTYA 1P43A 4GYBA 3NZHL 2AEPL 1BD2E 5I71B 1IXOA 3QDJE 3UG8A 3EG9B 3V35A 5CGBA 2VDHA 1VDGA 4X98A 4ZK8A 4WFHD 1IEBA 4FYQA 3MJ9L 5E8NB 4NNXB 3V0AC 3DROB 2HKFL 4NX5A 3L5AA 3W23A 1JK9B 3RWCB 3VM5A 1SFTA 3Q43A 4LEQA 3WSQH 4Y88A 1YX1A 4I5RA 2G3NA 2IALA 3TJXA 4LOFA 3GEWB 2K1MA 3VPLA 1GH7A 3CHXA 4HCRA 1N64H 2BMKA 4HPGA 3JTTA 1HZYA 1WDRA 4RWYH 4DAGL 4G9FE 3WNOA 4CN1A 5T3ZL 4Y5YB 1NOAA 4UNTA 1UKSA 3U5UA 1R3IL 3QZBA 3DVNB 4PJFF 4MIMA 2QADC 3NJXA 2FZNA 4CC0A 3FQRB 4S3FA 5T1KD 4NL1A 4DP8X 3P7YA 1KYUA 4N2NA 3RAJL 5LKNA 1O94A 2NY5C 2XIBA 3BUVA 4OV4A 3ZDXB 3HG0A 1U8NA 1CLCA 3KR3H 5JIQA 1ITUA 5JZ7D 2DYRB 1ZTMA 3CTTA 3EWUA 4HK3J 2VCCA 3UYIA 35C8L 4M6MH 3OAWA 4P5KA 4Z2HA 1IMHC 3VDHA 3KM1A 2NYYC 3VYOA 4F0LA 3BSZL 2A83B 2QCEA 5BV7H 4HIIB 4XD4A 2GJXA 3U7WL 1S7TB 1HGWA 4GI4A 5JHLL 1DVFD 4F37K 3OKNB 2Z6FA 4I9AA 3D85D 1RUSA 4PW4A 2A2QT 5E9DA 4LBEA 3K81A 3OTTA 4X9FA 1AGBA 3CL7A 2PWHA 3MRHB 3MRBA 1PKNA 3UJTH 3F84A 4QO1B 3AQYA 4FC3E 1BEYH 3MOBL 3HB3C 3UVIA 1JGLH 2QVNA 2F8OA 4XCYA 1FH5L 4QYAA 1E5YA 2DDQL 4H8VA 3HE6B 1EQPA 3MMWA 3J07A 3O7UA 1GJIA 3B4YA 1H11A 1M71B 3DX9B 4MKMA 4DKEL 1OE1A 4N5UA 4LSDA 3W7GA 4IRSA 2PMZA 3FO0L 4UAOC 2E6QA 2EDOA 3LEYH 2FPTA 4WNQA 4NQUA 3T4AB 1A0QH 3S4TA 3PE9A 4CBZA 2R2CA 1ISYA 3UY8A 3S0PA 5H37G 1BDYA 3F00A 3LS4L 4PMQA 1QOQA 3WD1A 1DQXA 1XINA 4WKHA 4WVXA 3DO4A 3CN0A 3E6EA 2HRLA 4W9KC 2JK5A 3QAZC 2CETA 4JO2H 5HR6A 2CZVA 2YD4A 5J4MA 2C1OA 2J1WA 1KNOB 3BAKA 2GG1A 3TJEL 4UZGA 1RZKC 4PGEA 3ARDD 2WNZA 1HCFX 5DT5A 4IU2A 5MF5A 1TX2A 8TIMA 4GEJA 2PTZA 3VCNA 1X3DA 3ZT6A 4FP8H 4TQTA 3CWHA 3GVGA 5DQ9B 2IAMD 2JI3A 2P50A 3I10A 2F2KA 5GZOA 1QBML 3MBDA 4X6DA 2A9MH 3N29A 2JKPA 1JZDC 2WTPA 4QHMB 4JFOA 8XIAA 3SBQA 2ABBA 1INEL 5JOFA 4GAGL 1AGDA 2D7TL 1KCBA 1G7PA 3A9IA 3IEAA 2BNRE 4OIIL 2XJKA 1LYQA 3R6IA 3WNPA 4JUSA 2HLAB 5LGXA 5E94A 3ZLHA 1EYEA 3EOUA 2ZOUA 1NP0A 1WIUA 3HG4A 5D93B 5K59F 3W3OA 3W6LA 1C29A 2NY3C 2BIHA 3S8WA 3QUMA 4UOZA 3W5NA 1GVOA 1WV2A 1YRRA 1VFBB 2VQ1A 1LBLA 3ZE2B 3DJZA 3N41F 1TVHA 4AX7A 4HX1B 3EWZA 1RIUL 3PY9A 4FQXB 4IKKA 4S3JA 4M6OH 1UCTA 4OFCA 4JLRA 4XZMX 3VFGL 1LEGA 4DPQA 3VWJA 4FHAA 1HK6A 1KV8A 4MG4A 3TNOA 4HS8H 1S5VA 1IM3B 4ZFZB 4O5LH 2ZKHL 1J9QA 1QSFD 4WU7A 2EC9U 3TO2A 3MUUA 5IMMA 5KVDE 3I75A 4NRXB 2Z9TA 3BLDA 3JXAA 4RDYA 2DVXA 2D3LA 3MRFB 4W87A 4PTDA 2JKLA 2TYSA 2BODX 5C0CB 4KMTL 4QOKB 4HJ1A 1LO3L 1LLAA 1X5XA 1I2RA 3H8NA 2VABB 5KVGL 3D1MC 1S78C 5D2LE 3WMBA 2Z34A 4G42B 3IKKA 1GC1C 1P4IL 3U9WA 4WIWA 1NF0A 5F6HJ 4ZUWA 3ZZQA 5KSWA 4XBJA 2CALA 2VH5L 4HNTA 1SFHA 4JAMA 2DM7A 1US3A 1FNGA 1TIMA 1U3HC 1OIOA 3N44B 3V0VA 4TLTA 5EU4A 3CHRA 5SX4H 2E6JA 4KNTA 3F62A 4NWUL 1THFD 5CLXA 1WAWA 1QI5A 3OWRA 1DFBL 4EOWH 2G9HA 1ZJAA 1V3LA 4JJHA 1R3VA 3L7EA 4GMTH 3MI2A 2JLLA 1KO0A 5CU5A 4ZR8A 2QUTA 4FS0A 4KK6C 5SX5K 3LMJL 2K8MA 3GG8A 3QEQD 1JCTA 1TZHB 4CNPA 5M2FX 1FORL 3CB3A 3FOMB 2DZUA 2GVLA 1UD5A 5KVEE 3AHTA 1A65A 2EXOA 2XYCA 2IH3A 4DCQA 3CN3A 1HYSC 3C6LC 2E7FA 1XF2B 1JXGA 5JR1H 4X6CB 5L0QC 3CUXA 2QCDA 4ZS7L 2JJWA 5CCZA 4U6YA 3WMPA 4JFEE 1MNUL 3U2SB 4NFDA 3QFDA 3VFMB 1IEWA 1X5LA 5JO5A 2X4NB 1S9VA 1TNMA 1FL6B 3RUGF 2E7DA 1XWYA 2DLHA 4JN6A 4ZTPL 1RUKH 3D8MA 3JV4A 4ZL1A 1RVGA 4PBGA 1IC1A 3S48A 1SFSA 3LZFL 1AW1A 3EJYC 2FB4H 3V0UA 3K6SA 1GJPA 4H0GA 2YA2A 5IUSA 3D0LB 4RJEA 4YDKH 2W9MA 4X4KA 4PB0L 4CU7A 2GC4C 5A2FA 1AW5A 3VXPA 1TPUA 1K7XA 3ZVHA 1BZDA 3WLBA 4FX5A 1B0GB 3L0GA 5IEKA 2R94A 3NCFB 1Z9NA 1YEKL 4MDIB 4NKMA 4PGDA 3U4FA 4WUUA 3UXFA 5FESA 4LF3A 4DGVL 3L7FB 4HJSA 1MCPH 3FFDA 2P24A 3T2NH 5IFHH 3LEVL 5TDPA 4YTSA 4W6WB 1J6PA 1V8EA 2E7LC 2VELA 5E8PB 2R59A 1NCBL 5F1IA 2R1NA 1UZ6F 1QFEA 2IIJA 1ES0B 3H85A 1EGJH 4Z0SA 3MO1B 3P80A 1PCSA 3VWKB 4PRAB 2ADAA 3MV7A 2EDJA 2RJHA 2XWTB 3BUTA 2YPVH 3TN0C 4GG6E 3B9OA 3O45A 2GLKA 4NZCA 4FXKC 4FG4A 2HJKB 4KROC 2CJUL 5CN3A 1QUMA 3L0NA 3PS6A 1D5IH 3T0WA 5I1JH 4GAYB 1LLWA 1FBAA 4Y2OB 1M9SA 3JQOB 1X5HA 3AS0A 1IC5H 1PO9A 2ZAGA 4PJDA 5CAHA 2VUKA 3C0QA 1IM9A 4NO5A 4YFLI 3GI9H 1N55A 1C90A 4JKLA 3L3HA 4OZHA 3IIVA 4QKTA 1I82A 3HA0A 3LGDA 1LP9A 5FKAB 4XPAH 5HYJA 5L9DL 5F2LA 3S1GA 1GQJA 4HPXA 3MBEA 4HK5A 2EYRB 1CU4H 3LZNA 3N42F 4WI8A 4AWJC 4E38A 1MWAL 1KCSL 1KGIA 1FFRA 2DYSB 2X1IA 3QUZD 4XBGA 5FX3A 3GQFA 3HPLB 2KX9A 5H37H 3Q2NA 2PCPB 3FB8A 3NQIA 3IKCB 3Q6GL 2WUBL 3O4LD 2G75B 3ZJAA 4IL0A 4HQVA 3NDZE 2Z31A 1AZBA 3CDZA 3KVQA 2ZZ4A 3CWOX 1Z69A 5D5MF 3W86A 5D9OA 3Q8CA 1ZANL 5C9ZA 4JHWH 1G67A 4I5BB 3TP4A 4PIBA 2O6FA 3NO3A 3UG3A 1NSNH 2PDHA 3KNBA 5CD5C 12E8H 3UAJD 4ODSL 3GKAA 2F6UA 1I3RA 4GYKA 4JFUA 1FGVL 2XX1A 1NCOA 5CN1A 4H7CA 3BAIA 3AREC 1NFIB 1LMIA 2Y36L 3SQSA 2ORBH 3RCNA 4UM9A 2Z29A 1ILUA 2CLVB 4PTMA 4ZVJA 2X1WL 5C0DA 2VB5A 4PUEA 1A6ZB 5G5IA 5HQMA 3OGCA 3AGVA 2O56A 1LROA 4K8HA 2ADYA 1YJDH 3MRCB 1CYWA 4KNUA 1JTOA 1H63A 1NDYA 5EN2A 4JQIA 3MMDA 2O4EA 3MYOA 1DJXA 3BPNB 3UACA 4FMVA 1ZA6B 5FF7A 1F58L 1Z5HA 1M1XA 4AX6A 4R2GB 4TTUA 4WEUD 1S7SB 1EJWC 1ZLWH 3L8QA 1U8JA 1R6WA 1W3LA 3KWVA 1RLDA 3VA6A 5A6BA 4B97A 2FL5B 3JRKA 2GL5A 4PJHB 1KTRL 5IGXH 3DDGA 1LO2L 2OMUA 2Q86A 1V93A 1CK0H 3LXUX 4QIRA 3O11A 1XGTB 4XRCA 1CBGA 3OA5A 4KKLC 4XKYB 1W0VB 2VL5A 5DWPA 2BHYA 4DN3L 1AD0B 3LV6A 3W81A 1CICB 2JIXB 2MKLC 3B6SA 2BLFA 1MRDH 3PWNA 4DYKA 4PJ5E 3Q58A 3KJ6H 1IFRA 2AJ3B 1QA9A 4NAFB 1M4KA 4PRPD 4PYGA 1V79A 2YW4A 4E0RA 2B16A 4XHQA 4YDVA 5KYUA 2X4OB 3SECA 5I1IH 1AUSL 4YHML 4LLQB 4JYEA 5AYUL 2OQJA 4KUCD 3QULB 5D72L 1RJRA 1CE1L 5DTFB 4Q33A 3WJWA 2DIEA 5MEQA 1DQLH 5JHBA 4F8PA 1F6AA 4NDMA 3M1OA 1JCJA 3H9SA 3LG3A 2WZMA 3NAVA 4K7PX 5I30L 3DJ9A 1UP2A 4ZOEA 2VLKE 4UU9A 5E4OA 1VFLA 2OX5B 4F27A 2QGYA 3O2DH 4L9LB 5F3HB 1W54A 3IDXH 3CU2A 2QFPA 4RXFA 1KXHA 1N3NA 1FWXA 4AD0A 5JPNA 1DIKA 4G5ZH 3VRIB 1TMLA 3WDIA 5DSCA 2ZE0A 4UMAA 4NWTL 4NLHA 1ORQB 3GMPA 2J7FA 1UWGH 4HULB 4HK7A 3UW6A 2DLIA 5EU6B 4WXYA 2EYTA 1T66D 1A2YA 2V5TA 3SGJA 4L8BB 2A4AA 4IIFA 5H4ZA 1AQKH 5AVHA 4EZKA 2EDYA 1E6XM 4AZ8A 2X2UA 5T9BG 3BWAB 1ZLUH 4L3EA 2ATKA 5IIEB 3KTXA 4DJFD 1E4WL 4MB1A 1HKWA 2BY2A 2TSAA 4IEFB 3CO4A 1AHKA 4WY0F 2B3IA 4GY0A 3TTEA 2J43A 3LKPB 4RX4A 1BYPA 5JXEC 2NNAA 2WLYA 1BLIA 2VITA 3WL0A 3V4PL 4PCSA 4R7LA 3OHMB 5E2VL 1ML0A 3MB9A 3UDWA 4KKRA 5F89A 4EANA 4Z2KA 1R3JB 3MP4A 3LH8A 4Y16C 1HIZA 1YEFL 1G9MC 4MLSA 2UZXA 3QSRA 5HVHB 1HXJA 3CPLA 2MUCA 3GSVA 4ONGH 4HKXA 4X4YB 1WAUA 1LUCA 1OALA 5GRJH 1KXQA 3WJYA 1II4E 4A39A 2A5UA 2E46A 1RURH 5FJPA 3S2AA 5EZJB 4DO6A 1J8HE 3QNZA 3O6FC 1A8JH 1MUJB 4NERA 3D46A 1M1SA 2JKIS 2NY1D 2DIJA 5E08L 4Y1AE 2HRPH 4J3OC 4LSTH 4NNAA 3RFRA 3HC3L 1GG0A 3HQPA 2NXYC 1HIMH 1DUYB 3WQ5A 5D70L 2VUNA 1Q6DA 3HE7A 3ULVD 3VQMA 4AQAA 4KFMA 5TBOA 1TRIA 1SLVA 2W1NA 5F9AC 1G7MA 3CMOL 3A3YB 1SEQL 3QRBA 4MNGB 4JRLA 3I65A 3U4BL 4J3ZA 1I1AD 1U6AH 3X1EA 5C7XL 2X3AA 5T1LA 3TT1L 1RY0A 5F44A 2EZ0D 1GOWA 2HS8A 1TO4A 3ICJA 1UA7A 5DUBA 3T8XB 3FVMA 2C34A 1U58B 1EWEA 3ARGB 4KK8C 3P0VH 1OAJA 4P2RA 3OJDA 1B2WH 4NP4L 4F0SA 3IPBA 1CLYH 4LBRA 1IWPA 4BE5A 5LGJA 4JRYE 2HWGA 4WSKA 4PVLA 3KPLB 4G6FD 1AHWC 2LLGA 2RIKA 4QY8A 3GFYA 3X14A 4Y9NA 3G6LA 2XM2A 8CGTA 3H6AA 2QR0A 1AL8A 2IV9A 3P2BA 3BVNA 4I3GA 4OGQC 4UTBH 5FLUA 4DFHA 2EH8H 2KKQA 1U22A 2YA1A 1OAZH 2WZAA 1TVBB 5CINL 1OOAA 2ARWA 2H47C 3C2FA 3B1TA 1BMWA 4X60A 5DLML 4KIEA 2XIOA 3IXTA 2ED8A 5FYKE 2Z8WC 3VXSA 1VACA 1QO3A 3KXFA 4Z5RA 1W3JA 3RTLA 4J1UA 2PDFA 2OMTA 2F5AL 1HKKA 1H6UA 3U4KA 4OGYL 4O10A 4H13C 3E0LA 3O0FA 4JE4B 1ZT4B 4LDEB 2DYPB 4TSBL 1L9MA 1LWRA 2HMCA 4PJIB 5AQ0A 5EDSA 4PJEA 4A2RA 2JQXA 4LSPH 5C08D 3GNPA 3FTZA 5D1ZB 1NFPA 2ITDB 4LU5L 3HUJA 2CRZA 2KQMA 3BDYL 3WFLA 3ZE1B 1K72A 2O7SA 4J7RA 1O6VA 4D6EA 1NCDL 4EAEA 4APQB 4KJWC 3PZNA 3O2LA 1G1OA 5DWUL 4NQXA 1RUAH 4C1NA 1VEMA 4AWTA 4JDZA 4KJPD 1AD1A 3VRJB 3LS5L 1G9NH 1QPKA 4LPYA 5DD1L 3AXIA 4H26A 5KSAC 4FXGB 1TV5A 3NPSB 1KIUA 3HAEG 4WF7A 1ID5I 1Q0YH 3BGFC 2WBJC 5GNYA 1VA9A 3VNLA 2Z4QB 5JBEA 4YO0B 1UENA 3GB6A 3HGSA 4BEIA 4AHPA 1OSZB 3H0TB 2JQMA 2VXVL 1BAGA 1UJ3B 4YNGA 1T8XA 4NCC2 2EPLX 4UMGA 1XZ0A 3TEUA 2UWEF 1XIWC 4M7SA 3LKRB 3R0NA 4GINA 1D6VL 1XXFC 4AV5A 4MWAE 5ICZA 1VADA 3OZ9H 2DV6A 2P5WA 4ADIA 1AYRA 2W4XA 4FF7A 4NBYB 2MNJB 5HVWA 3LXBA 4DWSB 4I7VA 3EX3A 1L9NA 1JRHI 3ML8A 2X89A 4K2UH 3F58L 4M8VA 4UQIM 3IIPA 5FF6A 4C59B 2QHRL 4IBTA 4Q14A 4ZUSB 3OHXA 3B0PA 3N25A 2IH1A 5EMMA 1KKOA 4X6DF 5K9JH 4UR7A 2VC2H 3HG1B 2GY7B 3NOIA 1NCWL 1ANUA 2YLHA 4AC1X 3WH9A 1B6UA 5E70A 4NGHH 2C1OB 3WS6C 3MGTA 3OLDA 4WEMB 3V5OA 3SDCA 1JZJA 4ZUVA 5DT7A 4PGEB 3ET9F 4WO0A 1XC6A 4PH8A 3PAJA 3TL5A 1GQKA 4IU2B 3GG1A 3MBFA 5F7WC 4ZFGH 4MSWB 1J9SA 1R5IB 5I77A 3GNOA 4LRNL 4O14A 4K38A 4S3GA 2XZCH 3IU4H 2W9DH 4JGUA 2H8PA 3OAYH 5XIAA 3HNSL 3WN6A 2F0CA 3C08H 3C8HA 1YEYA 1M01A 4FTVA 2H3KA 2OGJA 4ZFOB 2A4EA 3L9YA 1TYJA 2Y6TE 4HIEA 4WI7A 3TNMA 4JG1L 4LDLB 1ZTVA 1G7PB 4PBFA 2G5RA 3FMGL 2IDSA 4L8DB 4JQVC 3Q1SL 2J27A 4QAWA 2P8LB 1P6CA 4HCRH 1RHCA 3PZVA 2DQDH 2BS8A 2P3EA 4MXVE 3EOLA 2AJUL 5TE4L 3HZ3A 3QUMB 4WI0B 5GGVL 3OVUB 4IGBB 5ITFA 2PP0A 4GUOA 3QB7C 1PF3A 4L65A 3GO1L 2VFHA 4JRFA 3D6GA 2YXOA 3C86A 4WO4D 4I3RH 1W6WA 2REQB 1YUHA 1DJHA 3L9RA 1T1WB 1FLTX 2RMNA 3FSVA 1QWGA 1T22A 3AWGA 3T9WA 2LU5A 3L08A 1NCAL 3MREB 3P54A 4US5D 2AI0H 1VBJA 3NSDA 5FGCE 5D96B 4AQZA 1ZOXA 4MJIA 4H9MA 1EWDA 2FGWL 4N9OB 1MCCA 1M7UA 3SBRA 1RQBA 1ADQH 5DJ8B 1NWTA 4L1BA 1RZMA 1EXUB 4EE9A 4WHCA 1IGJB 4UIOA 4EF9A 1TU2B 4XCFH 4CJ0A 2IANA 1YMME 5C2BL 1QI0A 1C08B 5CEZD 4O15A 4PRDA 3II3A 4QHKI 4BHYA 3L3DA 1JIBA 1FG2B 1R3KB 1U9KA 1S2UA 4OD1L 2YEZA 1KW1A 3RPDA 2BVEA 4KQ4H 2E7BA 4G5AA 1H19A 3VZYA 4GFIA 2ALAA 1AOHA 2JE8A 1DUZB 1BQLL 4R7WA 1YEGH 4E8GA 4QJ1A 2CO6A 3DTUB 1UWRA 5CJ5A 2GWNA 1IE5A 3NSXA 2DICA 2ICWA 3DXAB 5BXRA 5D1ZI 5FGSA 6FABL 2HZGA 2YO3A 5FO2A 2DJLA 5JYLA 4PUNA 3W87A 5J11C 1EMTH 2VLRA 4MWAC 2B31A 4AMAA 4YZFE 2CESA 3KPNB 2Y7GA 3O6MH 2NMSA 4Z2JA 4W85A 3RFZB 4I8YA 1QTPA 4DHLA 4NG3A 4PREB 4F7CB 5CZTA 3NMEA 3QE5A 43C9A 5BZXA 1EUAA 2IBBA 3IWVA 2NR6A 1A4JA 4XN1A 2J5WA 1OP5H 3ME3A 2FX7L 1CD1A 4P59L 2YPLA 5IXEA 2H3NA 3EJSA 1O6IA 2P5EB 2CAKA 4M1BA 1O60A 3RUGA 2VAAA 4XZUA 3RGVC 2C26A 2IH3B 2HT2C 2CZ5A 2Y2WA 3NSFA 4QXWA 3QYCA 2J56A 1F3RB 4LVHB 3EAKA 5AW2B 4AQ8A 2W94A 2YN3A 1T5WB 1GS6X 2D69A 3DVGA 3VE9A 2AXWA 3QWOB 2OJZH 4E42A 5BWFA 3VFPA 1JCVA 5FAGA 4QDMA 1CD9B 1LQ2A 4UBDD 2W0FB 4PJXB 2BNUB 2XIJA 3B1UA 1F97A 3JV4B 1SUJA 5I6NA 4J4PD 1A1MA 1OAQH 5AB0A 2I60H 2WJ5A 3QUMH 4ZW5A 1BTMA 4PC8A 1GS7A 1HEZB 3ARBA 3D39A 4D7PA 3L17A 3TF4A 2OLHA 1PUDA 2NY0B 1KCLA 1VQTA 2XPKA 2ASHA 2XPGA 2OGYA 4MOZA 3CZUB 3QH3B 4PB4A 1QK2A 3H7RA 1C12A 3NESA 3QQDB 1H4PA 5DHXB 4ISVB 4NKMB 2YOCA 3FUJA 3TZNA 1TMCB 2BP0A 3FFDB 2P24B 2GTWB 5IT2L 3V9EA 4AYFB 1OF2B 5D1QD 2X53A 4KEVA 1F6FB 3QBUA 5EO0B 2DQ6A 3FN0L 3C2OA 3EYVB 5CZXC 4PJDF 3LV3B 3M8OH 1CFSB 1JMXA 5E99H 1TETL 2R24A 1UD2A 3W74A 1XIGA 4GRWB 1OKEA 1XLAA 5FJJA 3AUOA 1TPVA 3O45B 1LP9F 3CAQA 2I5IA 4R7NA 1E6OL 3QHFL 2PCFB 3QQNA 2VGFA 2ACUA 4IZGA 2R15A 3NN8A 4D0CA 3WIJA 5AW3B 1GOIA 1C93A 5HD8D 3GUTA 3BSHA 4EN3B 3P73B 2OO0A 2BY3A 4R84A 3LCHA 4TV6A 1I1WA 1V7AA 3VI4B 2GW5A 4WQOA 1Z2KA 3WJXA 2YZ1A 1QFWM 2AEQL 3MMEB 4OZHB 3R43A 4WCJA 4DY1A 2QIWA 1XLIA 1O7DE 1OM9A 5KVFL 2P8CA 5ID1B 1PZAA 3UTTD 2AKRA 4NUJB 4WK9A 3TC9A 1OEZW 2ALDA 1BOGA 1AXTL 4KRZA 3K74B 5E6IC 3QMTA 4WGHA 3T0TA 2AJYH 3WQWA 5C9XA 2R27A 2WPBA 2Y7FA 4K94H 4HGKC 3OTRA 5BXSA 5KBNC 4S0SD 4HG4K 4PP2B 3T8QA 1X8CA 1FZOB 2H32A 1BZQK 1QZNA 2HT3C 1XG4A 5CO1A 4BWLA 1VH7A 1JNEA 1K9TA 5KN5A 4UCFA 3ARTA 3VXRA 5JH2A 4DELA 2CK0L 2MWCA 1W3KA 3DDFA 4I5XA 1J8SA 4PV1C 5J3HD 4FJYA 4DAFA 1RL1A 3UXKA 4NY2A 3QPXH 2YYTA 1UASA 2PXYA 1CDGA 4UM9B 4TUJB 1I8MB 3QNYB 2OS7A 4LYQA 5C0DB 5MERA 1VZHA 3EYSH 4G43A 1ETB1 5AG8A 4AVFA 1DJNA 3HFTA 4YBHA 5EKYA 1V7YA 3TFKC 3MV9E 4GBXB 4U1MA 3CXHK 5BRZE 4E5XB 4FQXC 4GRMA 4O13A 3LB0A 4GG9A 3JTSA 3RDKA 5FO7A 4POZC 4RE2A 3DUSB 1A5AA 4FFWD 4XCNA 5JHLA 2XZAL 3RTQA 2GHWB 1NKOA 5DXXA 3NRQA 1WK0A 1KCRL 4FQJL 5F9DC 3LN4B 4LXFA 2Q86B 2WWNA 1TTPA 3STLB 4LLDA 1CWVA 3TW9A 5C8BB 3INUH 4Y9FA 1CXLA 3GJEB 1YMHA 2VR5A 4K8GA 2CBVA 2VN6A 5CIPB 2VL5B 5GRZA 2FVMA 1O0VA 4RK8A 4AZHA 4ODWB 1MHHB 4X9IA 4JO4L 1BZ8A 4AW7A 5HXMA 1CLZL 1KBKA 3W2DL 4W93A 1E4NA 4KI1A 2DZAA 3BW3A 2KYIA 2YCEA 2XWZA 3U0TA 4HPOL 2HVKA 1XKJA 3RM8A 3P2VA 1KY6A 3IGLA 3PK7A 4RAVA 3NZGA 1QA9B 3HHMA 3MANA 2VGIA 5BMWA 5KOVC 4P2OD 5GRYA 1QR7A 3OVRA 1PTGA 4YDNA 4WV1A 1UWXK 5KYUB 3VCRA 1KCUH 5BUPA 3FO1A 4P5SA 2VYOA 3APFA 1XDTT 3LERA 4FOUA 3TZVA 3KDNA 4L37B 4LLUA 4DI9A 2I9EA 3HQOA 1XWVA 5EUKA 3LNMA 3TIDA 2ZCZA 2DPEA 2BOGX 3BDBA 4IMCA 3WNMA 3A13A 1ZDSA 1DVZA 4OV6F 1QP1A 1JPST 5FO8B 5HMDA 4UB0H 3B9KC 4GUPB 4OD3H 3KL3A 1NBQA 4TTGA 2P80D 3FQYA 3CAKA 4ORGB 4PJGB 5ELIA 2WWMC 5LDUA 2WBKA 4Y8FA 2IQ9H 1EFXB 4O19A 4NXKA 5HHPA 4JPKL 4YEEA 1N3NB 3CJJA 3HI5L 1WCBA 1LWHA 5T3XD 5E5CA 4URTB 5E8DL 4GUGA 1WD9A 5K1VA 2UZ9A 1O7DC 2EIBA 1J7VR 4N2CA 5AUMB 1IX2A 1WA3A 1FNSH 3IAQA 2RQEA 3TVMD 2PTTB 4WY0A 2GYSA 1W6LA 1CC3A 1ME8A 4KCWA 1OTTD 3WFCH 4QRTB 4LOVA 1A7QH 4ADSA 5EFIB 2KLTA 5BV7B 1RZJL 2A9CA 2WCPA 3D33A 5TPWL 3JWNE 3TA3C 5EPMA 1BG1A 4QP0A 1XI3A 5IVXA 2OSXA 3QHZH 1F56A 1AG1O 5EOQH 5FHAL 2LLEA 1M6UA 5EFDA 3SDAA 2PR9A 2NNAB 2VP8A 2Q8AL 2VX5A 3VOFA 1Y0EA 1L7IL 1CGSH 4ZRGA 4X5WB 4OHQA 2D22A 1MCFA 2DZXA 3LSOB 3P74A 1R4XA 3N91A 4R0LC 4YC2C 2J21A 1E0UA 4JQIH 5DHYB 4ADUA 1MHEA 2QDDA 4L23A 1XF4B 1N4XL 2AXFA 4GFSA 2EO9A 4ZTYA 1MCNA 1L9TA 4D94A 4RBPH 4M5TA 4WW1B 1FA2A 2XKSA 3B5HA 1A7NH 4RMTA 1YXCA 3QJVB 1ZBKA 4XPFL 1HUVA 2VW6A 2ZXAA 1CDHA 4ALAC 3DHFA 2W07B 2VRJA 4V11A 2DQIH 3AHXA 1U1JA 4Y2DC 2Z25A 4O2EA 4NJHA 3NJVA 3GK8L 2B1HH 1RU9H 4BH8B 3IUDA 4YPGA 2DWDB 4AZIA 1UXMA 1HNYA 4IWWA 3CX2A 3LKOB 2UWFA 1OGAE 3MYPA 3IXAB 1RP9A 3FRUA 1Y6KR 4IQEA 1AO7D 3C5SB 4ADJA 3L2IA 3KWUA 3RG6A 4OLWL 2EXWD 4JFDA 1BPLB 5DJXA 1RP8A 1JPGA 2KS0A 1MRFH 1WUEA 1D9KD 3G5XA 4OZ4A 1AKPA 2FD6H 2NWSA 1ZPUA 3LQLA 4H9YA 3FPYA 2HKHH 4H8UA 3ZDWA 2XWBA 1A4LA 3BE1H 2ZRVA 2PP7A 4ANWA 1PYWA 2W79A 2LTQC 4HS6B 1HJQA 1YE4A 2VMEA 4G7YH 4LK4A 3ZIZA 1TYRA 2HA1A 3SE8H 4RISL 1L2QA 1IGML 3VNIA 4GIEA 3EJTA 4P7RA 3RMEA 4YAQB 1V54B 3BVDB 3M46A 1KACB 4M4PA 4LEOB 1QRNB 2X1PA 4TIMA 3VIFA 1E8YA 3S47A 2EYSB 2OM5A 5A69A 4K7PL 2GY5A 1AG0A 2NX5D 3SDOA 5L88H 1UXSB 2CR6A 3L3GA 4XHJD 4PJBE 1JCMP 3VW3L 1UW9A 1YYLL 1W9UA 1SZGA 1KD0A 2E9WA 4JTAA 4PJEF 5CHNA 2W5FA 3QYNA 1VPOL 1CDUA 3D6NA 1CGTA 2BFVL 1LWJA 1G7LB 3MX0A 3PGCB 3FT4B 4HWBH 4Q6YA 3HUJF 4MZ8A 2FH6A 5FB8B 1XIEA 5DRWA 4Z5RB 4F80A 1Z5LA 4FNLH 4IPPA 4ANUA 2WQDA 4PJFB 1PVNA 3ITGA 3EJZD 3H2MA 1EVTC 4A63A 5HJGA 5G1TA 4NC0B 4OCRH 3HBPA 5ABTA 3V55A 4TNWF 3I50L 4HJFA 4ZTOH 5E24E 1VS1A 2FZ3B 1HKJA 3PL6B 5ETUA 4LVDA 2ZCLH 3RIFF 3IRDA 3JVFC 4CNSA 2C9QA 3JWNC 4M8QB 4ICXA 2DKUA 4NO2A 5BUGA 4KVCL 3W9ZA 5KJ7E 1NEYA 4UFJA 4G8FA 1FFNB 2ZA2A 1P0DA 1QHQA 1I0BA 2HEJA 3VIIA 1I9RL 4GQBA 3KDOA 3EGDB 4IMKA 1O1HA 2FLMA 1S9WB 1B30A 3IAGC 5MEND 2UWEA 1ACCA 1GKQA 2YC1B 4YUEL 5I76A 1WFJA 3P0YL 4MVBD 1SOQA 3RI5K 4O53A 1KOAA 4ZW3A 2ENPA 4MD0B 3WNNA 5FWQA 2YIHA 1XGRB 3FQXB 4Q8WA 3I3DA 1KCVL 4QRSA 2V5SA 3NRFA 4LL9A 3P6LA 3L12A 3AUVA 2WXHA 5B8CB 2E56A 4G80B 3O3RA 2P42B 1LDPH 1E27B 1MWAA 5ICZB 2FT6A 3FQ1A 2VDLL 5K9QI 1G7VA 4GP5B 4RMRA 3GVVA 5CKAA 1Z44A 4Z7UA 1DVUA 3CLWA 1D2KA 1MELA 4O16A 1FDLL 3WKQA 4N90E 5AZ0A 4MB4A 1BTCA 1XL9A 2VN7A 5K9DA 3VTRA 3QCVH 1JCLA 4P04A 4FF9A 2B14A 1RMFH 5BS0D 1ML1A 3OHXB 1CL7H 3SY0B 4PN2A 5F0LB 2WJ7A 4JTHA 4KV5E 3RM9A 4HH9A 4HLEA 4BK8A 2NT1A 3ZGIA 1T7VA 4ZT1A 2E5CA 4MYWB 3KYOB 3C5ZB 3FYPA 3R4DA 1BFNA 1ZVSA 1XYMA 3OXRA 2YXWA 1F4YH 4PG9A 2V82A 3OLGA 1YKWA 4Y89A 3O41A 3JWOH 4LKXA 3TT3L 2BJML 4LCSA 2ZUYA 2O61B 1NLDH 3ZW3A 1OARL 1OINA 2J6VA 1JVLA 4W9LC 1AXSA 4IJBA 2WKOA 3MUCA 5IQ9A 1SYVA 3PWVA 3K8KA 4K7FB 3HIZA 2Y3NA 3C2AH 3Q4DA 3QORC 1RH8A 4LTSA 4I18C 2X09A 4I7ZC 4GC4A 1H7WA 4IK7A 4KXBA 4KZDH 3N3EA 1YEJL 4EIVA 1FHVA 2ZYFA 2QIIA 1AQDB 1WOAA 2E27L 4K4KA 4DUVA 4PMEA 1EPXA 3N41B 2FJHB 3HAEA 5BXTA 2VDML 4IQLA 2EE3A 1I8UA 4ZOAA 1K1DA 3RLSA 3RY4A 3GHUA 1JRBA 3AXKA 2PODA 4GS7C 4XAZA 3SY6A 1MRQA 1A6WH 4ZXBD 1KN2H 3IMTA 4H2AA 3MCLH 4ZMYA 4CAGA 2P8PB 3N1FC 4TV3A 1LO4L 3O4OC 4S1DC 4NPYA 5GRVK 1OX4B 1CL7I 2DJMA 4XMPH 4XNXH 3D0AA 5AVZB 3RJDA 1FHLA 3HS8A 4N8CL 1BQRA 4UNLA 2OCCB 3RWDA 1J8RA 1FIGH 4MNQA 4X6BB 2WQPA 2WUCH 4A7VA 4GXFA 3FB7A 4P5MA 4UT6A 1P4LA 3ITTA 4YXLL 2ROXA 4NS0A 4DJED 4FJZA 2NSQA 4GJJA 4EWJA 1ADSA 3P2TA 3QCUL 4FI4A 4XTIA 2IANB 2F6AA 4AQEA 1RR2A 3S98A 4XMKH 1JUKA 5GGTA 2GDQA 3CQPA 3D0VB 4MMZB 2Q8BH 3TYFB 1M65A 4WJ5A 4Z3TA 4PM1A 1FV1A 5DF0A 5KSUA 4RIRA 2VLLA 1P5BA 5U7SA 4XVSH 2KLRA 4JGJA 2H1PL 3CZKA 1DBBL 2FQGA 1EP1A 1WKFA 2HX8A 5IW1B 3GNNA 2IG2L 5DMKB 3GK0A 3UCQA 4D71A 4LLYA 6TAAA 1UOVA 2ICWB 1UADC 3BEVA 4PWKA 3S5OA 3WQDA 2FQIA 5F4XA 3BQVA 4OKDA 4R90H 3DYOA 4JM2D 2X70A 4PL1A 1V02A 2E3ZA 4H8HA 4PLJD 5F8RC 1ONQA 3FO2A 3X13B 1FAIH 4HH8A 1DJZA 2MHAB 2VVNA 2DY2A 4XODA 1F8IA 3W22A 4M6AA 3NZ1A 1KGCE 1J9TA 2YAHA 4NX0A 1HGYA 1DL7L 4ZW6A 5HMSA 4ODHL 4HPYL 2VXUH 3W7OA 5CWSB 1TPH1 4QRPE 2H3NB 4FQ1L 1Q0XL 3L4WA 5HGAB 5AWNL 2ZUSA 2XLLA 5D7HA 1JNDA 5SX4I 1LQ0A 3QH2A 1H3UA 3V4PA 5JHDA 3WQGA 3FQNB 4LNCA 2O5ZH 3LNPA 5J5RA 3PC0A 1QYGL 5DMJB 1HKVA 2E75C 5KYXB 1Z9SB 1IL1B 3D69B 1E0XA 1KJ3L 3NPVA 3RNKA 3P3SA 1MZRA 4DVRH 1LE5A 4WDWA 4AKPA 1N0XL 2IFGA 3EMZA 3QXDA 5AAMA 2RH9A 5L4JA 4LV9A 4LDOB 5J06A 3VFUA 4NSKB 1BFTA 4NQCD 1TFVA 1DQMH 3D39B 4OM0H 4TMPA 4XN7A 2EG8A 1RJPA 4ODVH 4XMXA 4R97B 5DD6A 4FXGC 3UYRL 4O54A 1BFVL 5E1IA 3QIUB 4C6FA 3UZVB 5HVGB 1S7UB 4H88L 1QLEH 4KAQH 4KDVA 3BAEH 1K2DA 1FN4B 4TF4A 3WQ6A 4Q2ZA 2Y62A 3GSUB 4JHAL 1UWIA 3UA4A 3UWQA 1OAKH 4WEBL 1PKLA 2QMJA 5BYWA 5IW3A 3KLHD 5DD3L 4Y9EA 3VACA 4EDWH 1VENA 1BAFH 3DKHA 2NXIA 2GTQA 3W1XA 3SIZA 4FLRA 4F0MA 3N85L 4U6TA 3DXAE 5C0AA 2UY6A 4TVPE 4RZKA 4GHRA 5JMOC 1PKQB 1KM5A 4M80A 3ZPDA 3UOAB 1KJ2A 2OJPA 3WEXB 2YR3A 2XN9E 4IMLB 1L6WA 2BCKB 4HQQH 3V0JA 1E9ZB 2V2XB 1TPXB 1ZENA 1IGFL 1MH5A 3QO0B 2BK8A 3EHBB 2QELA 3N42B 3WLOA 3ROOA 1LRNA 4EKXA 4V1DB 1H60A 2ITEA 2EEFA 2HT4D 3BW2A 5A2IH 1T5AA 1F05A 4WWID 2H0FA 2EC8A 1X5YA 3S5LA 4O18A 1J5OH 1MCKA 4BZ2H 1NY1A 2VFDA 2QQNH 4QTHB 2Y9RT 4YSOA 1POKA 5HI3C 3KOFA 4N2AA 4ELMA 4I6VA 3LNIA 4M56A 4QCFA 1TZGL 2DP3A 5GZNC 1NGPL 2LU3A 5D5MB 3DX7A 1BJ1H 1HXYA 4PS4L 2VYRE 3PWLA 1FYTE 5C8JA 4MJHA 2QLYA 2XZZA 2JB5H 3DBPA 1SEBB 2XTSA 2EVIA 2BRRL 2Z1KA 5LCVL 1H0DA 1ETZA 5C54A 3D52A 3O9WD 3CUJA 2JELH 5L8JB 4Y4HD 3D2UA 4HNLA 4KWSA 4UTUA 4C58B 3UYCA 4Q4RA 1SLXA 3QKEA 5EZLB 3RGTA 1DVJA 4KUZL 4DW2H 2FT7A 1AJZA 3CX5J 3KPOA 4PRRA 3LTSA 3CQHA 4U1MB 1KCKA 4L8SA 3GDKA 4GRMB 3VSQA 1J9CT 1ZLVK 4UT6L 3O3BB 5M7QA 1TA3A 4JS7A 3E7JA 1SXNA 2EF9A 1MI5D 3BXNA 2DKMA 2AXJA 5IBLC 5FJTA 4ES4A 3L3IA 3GZAA 5HA7A 2W0PA 3LHAA 1PJ9A 2CDGA 3VI4E 2FMNA 2D2HA 3UTZA 4K3DL 2K9FB 5GGTL 4KPHH 5E1QA 3U7VA 4A67A 1H7XA 5AKRA 3O07A 2C9XA 1QSED 2H9AA 3K7UA 3MDWA 3CQQA 2PWFA 3TU9A 1ZHLB 4CN4A 4H25A 4MA7L 5GJSH 3KW8A 5L2KB 3GM8A 4U2YA 2BIMA 2HVKB 3CLEL 3CFCL 4KH2A 2B8OT 4OGXH 3GSQB 1OT2A 1YPFA 3OP2A 1XIDA 3Q6FA 4JBSA 4EP8C 2B4CL 3E12A 3P4MB 2J4GA 4REQB 3DFHA 3W53A 4J8RA 2XV6B 4LKCA 5FEXA 1WXZA 1A5UA 1S1RA 3MXVH 4ROQA 4KTEH 3SKUD 3AXHA 5IQOA 5CG0A 3CM4A 2QQ6A 4PJ8A 3NZHH 2AEPH 1KEGL 3DFSA 5LB1A 2WTRB 1W5PA 3LLDA 3LM7A 4L4MA 2PPDA 3LIUA 2DJSA 5FLVA 1M7IA 3QDMA 2R23A 3EGXA 5DVMA 3OAUL 5SWSA 5A8QA 1AIFA 5HHPB 4FO4A 1CQYA 2PO6B 1N5YL 3MJ9H 4OD2B 5HJDA 4M93B 2ZUUA 3V0GA 2HKFH 5SWZA 1LTXA 3P9LB 1U5JA 4F33B 5IVXF 4YX2H 4W9FC 4G8TA 3TYEA 1R75A 4A29A 4LVHC 3G5WA 2DMKA 2OW7A 5DHVA 3QCTL 2X7LB 1IC7L 2OA9A 2XKNA 2H32H 1P4CA 4DAGH 4W9ZA 4XCEB 4L1WA 4WY0B 5T3ZH 2XWXA 1FP9A 3KOXA 1R3IH 4Q8UA