4GQQA

Human pancreatic alpha-amylase with bound ethyl caffeate
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Order and disorder: differential structural impacts of myricetin and ethyl caffeate on human amylase, an antidiabetic target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4gqqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4gqqA01
4HA4A 5D8WA 3AMDA 4HMEA 1PS3A 2WC7A 5BROA 3W53A 1TQVA 4BA0A 1EDTA 4AEFA 4KGJA 2WHLA 1NM9A 1E0XA 1L0PA 4UFKA 4AISA 1ZBKA 3OA5A 1R8LA 4ATDA 4HOWA 3IAQA 4HA3A 3A22A 3HZ3A 1MWOA 1J12A 3DYPA 3RO8A 2C8NA 4B16A 3B9EA 3OLIA 3SUWA 1GOQA 4JHZA 1M7XA 1ISWA 2G41A 3JUGA 3CTTA 3SCRA 2XM2A 2JFEX 4WJXA 1LQ0A 3BSGA 4XV0A 5CPQA 3LRMA 2WMIB 1HJUA 1B3WA 5ABEA 1SR0A 4FNQA 2VUYA 1D7FA 1N82A 3WF1A 1SYTA 3NJ3A 1VB9A 2ZX5A 3UG3A 1C8YA 3ZJ8A 3PZUA 3L2LA 4FNTA 2E9LA 3ARPA 4TTUA 4UFHA 4QCEA 1ZS2A 3G6LA 4UQCA 4B3LA 3AMCA 2XFRA 3A5VA 1UWIA 1CENA 5A95A 3DC0A 3ZT6A 1E56A 1OIFA 3GNRA 5C70A 1C92A 4RE4A 3MSGA 2D0HA 1JD7A 2XGIA 4R27A 3MO4A 1H0IA 4OUEA 4QLLA 1GQLA 4CCCA 3ARXA 1TVPA 2J79A 2PC8A 2WMFA 1CLVA 4YHGA 1KTCA 1HT6A 1LL6A 5D9PA 1UKPA 3WQ8A 2WSPA 3VO0A 2BVYA 3VDHA 1Q6FA 4CVUA 1FP8A 1X1NA 1QX1A 4DUWA 1GUVA 4J3WA 1V3JA 1PPIA 2XIBA 3LPPA 2GJPA 3W81A 1MVYA 1VEPA 2D20A 3VGGA 3AHXA 2F2HA 5EB8A 1QNQA 3HMCA 4AMWA 3U5UA 3PN8A 2YA1A 2ZOXA 4PTMA 4P7LA 3SCSA 2Z1KA 3AS1A 5AYIA 1E55A 3BCDA 5A2CA 4CN1A 1V6UA 1XGZA 4UQ9A 2D0FA 2VRQA 3MI6A 1NH6A 1GONA 2XWEA 1JAKA 1FP9A 2F8QA 1V0LA 1WZKA 1E6PA 4P7OA 1US2A 5AC4A 3PZIA 3BAKA 1CZ1A 1UA7A 2YLAA 4CKQA 5A8PA 2G3IA 1JXKA 1NP2A 1HL8A 5IDIA 2E9MA 4U5IA 4WLCA 4UOJA 3BAJA 4UR9A 2PWDA 1E4LA 1PEZA 1BHGA 3NIYA 4AD1A 1MYRA 2OWCA 2WM0A 4QDMA 3D4ZA 4UNIA 3PZOA 3BUDA 2Y8KA 4ZENA 5CSUA 3QHMA 4YHEA 4RE3A 1UH4A 2MANA 3CBWA 3BH4A 4JFSA 3VM7A 1PZ2A 2Y5EA 1BPLB 1M01A 1ZJAA 1F4AA 2DIEA 3FY1A 1LG1A 1S46A 1E4IA 3GH7A 1AQ0A 4JL1A 1JYWA 4C7GA 4E2OA 1CXIA 1QBAA 1V0NA 2J77A 1TZ7A 1TFVA 4D6GA 3ZSTA 1XYFA 1Q6GA 3HN3A 1J0ZA 4V2XA 4Z2KA 2A3BA 1PZ3A 2JALA 4JKMA 4V27A 3K46A 3AXXA 1GQIA 1E4NA 4PMZA 2DT1A 5C8BB 3F5LA 3WL1A 2G3MA 1CLXA 1GPFA 3MUZ1 5I5RA 5LA0A 1A47A 4NX0A 2QMJA 3VIFA 1GNXA 5A6LA 3LXBA 2CPUA 3KWXA 5GNXA 2VZVA 2X8RA 1WDRA 3WUFA 2WNWA 3LXCA 1V0KA 4W88A 1CXFA 2CBJA 4XZWA 1W9DM 1CEOA 5BXRA 1EA9C 1DWAM 1CXKA 3CHDA 4CD8A 4P8XA 4W87A 4Z2LA 3IJ8A 5CJ5A 3WF3A 4M82A 4AZ6A 1KXTA 4FNRA 4AIEA 1ZL1A 3SCQA 4UFJA 4J3VA 1I1WA 4DO6A 3OLEA 2OWWA 3NDYA 2X05A 1WPCA 1EIBA 1GW1A 4OZOA 3TTYA 2HVMA 5I77A 2J4GA 1VFUA 3EDDA 1UKSA 3O6AA 4D1JA 1J0IA 2QPUA 3B9AA 1QWNA 4FMVA 5HPCA 3WDRA 4FLOA 4WIWA 1VFOA 2YA2A 2G3JA 2OW7A 2XM1A 3VVGA 1M03A 4JFTA 3KEHA 1NWRA 3AISA 4IPNB 2NT0A 3VTRA 2OLHA 3W4RA 1KCLA 3ZT7A 1JYVA 1MW2A 4BCEA 1BGGA 4MNMA 1MXGA 3CLWA 3LPOA 3SUUA 5HXMA 1WE5A 4KRTA 1WNOA 2Y4SA 1J0YA 4AZCA 3VSUA 3BMVA 1QI2A 1DEDA 2BV9A 7CGTA 3EMQA 3EJRA 1E6NA 3IJ7A 2VT0A 5TD4A 1QVBA 2F18A 8CGTA 1OINA 1DWFM 4PCTA 5LA2A 3T09A 3SCNA 4HPGA 3GM8A 3RMEA 5LA1A 4PMOA 1XCWA 4D6FA 5EFDA 3CV5A 5KZ6A 1TQTA 1PIFA 4D6JA 2FHBA 1HXJA 1E1EA 2CEQA 2PF0A 4ACZB 2VX7A 3S2CA 2OYLA 4Z2HA 1VENA 4GKLA 5D4YA 3CZJA 2DH3A 3CZ8A 1ESWA 3OBAA 3WQ6A 5I23A 3E1F1 3DHPA 4CCDA 1BG4A 7A3HA 1MQRA 3G6MA 2HISA 2ESCA 5JBFA 4DO4A 5BCAA 1KGXA 1NP0A 1P6WA 1XRVA 9CGTA 1W3HA 3K8LA 2DEPA 5CQ1A 3WD2A 1JZ2A 1QHPA 2WSKA 1M53A 1CXLA 2O9RA 1V3MA 3AZSA 3CUGA 4LYQA 5CPTA 4UFLA 4C7FA 4DUVA 1XYZA 5A8OA 4KWUA 1W9UA 2DQXA 1HJVA 4GI8A 2PWGA 5E1QA 4ZXOA 3OZOA 1X6NA 1W2VA 3CMGA 1QW9A 3BXWA 1TA3B 3CZNA 2WVSA 4U2ZA 1V03A 3MUAA 4FF5A 3GXFA 2ZXQA 1NOUA 3POCA 3WIJA 3SEPA 2VL4A 3BUQA 3AOFA 1V3LA 2WVUA 5CG0A 1AMYA 2ZUTA 3WY4A 3WKZA 2IGTA 2J7FA 1JYNA 5KEZA 1XD0A 2E4TA 4JFUA 3UG4A 4LGXA 3EJUA 5HBFA 4U33A 4BQ5A 4FNSA 1MXDA 1JI1A 3EYPA 3MUY1 4LQ1A 3QOMA 3AFBA 2JEQA 3BVUA 1KXQA 4CN4A 3TOPA 5CGMA 1HIZA 2VCAA 3LMYA 5I6SA 2WC3A 1GOKA 3NUKA 3CHEA 1OGGA 3UG5A 2WB5A 4DWSB 4MAVA 3WY1A 3GXDA 1H5VA 2YL6A 3BVVA 1SFSA 1US3A 3WL0A 3U7VA 1MQPA 1VEOA 3TTQA 1UD4A 2CCRA 1QPKA 1U30A 3J7HA 3EDFA 1EO5A 4WKHA 3L4TA 4AXNA 1CDGA 1KQZA 3T0AA 2ZE0A 3THCA 2XUCA 2YDQA 1R85A 1BVNP 1FH9A 1B31A 4B3KA 1JZ4A 2ZX8A 1R46A 2JE8A 2WMJA 3HG5A 2YIHA 1QWUA 4DO5A 5GNYA 1R47A 3CUIA 2CKSA 3GXTA 2OWXA 1VFFA 3CZSA 3L4WA 1FA2A 4Z2GA 1IZJA 4FNUA 1QBBA 2UY2A 4HMCA 3PBGA 4NF7A 1E3ZA 3ARWA 1HXKA 5JUVA 2WKGA 1QI3A 1R86A 3T0BA 1OGBA 5FIPA 5IHSA 4MNLA 1BYDA 4IISA 4GQRA 4F66A 1DWIM 2YL5A 4H2CA 1JDDA 1JGIA 3ZOAA 3EJSA 5ABGA 5A1AA 3BAWA 2NW0A 1SMDA 1VBRA 4F79A 1TUXA 2YDSA 2J75A 2J7EA 1C91A 3LPFA 3A4WA 1E9LA 1D2KA 2WWCA 2FH6A 4HU8A 4M29A 1PIGA 2QHAA 3HU7A 2CERA 4K68A 2BVTA 5BXPA 3EJQA 4AEEA 3FAWA 1VJZA 2VI0A 4DWSC 3PTKA 1XH0A 5DT7A 4EAMA 1IZKA 1H11A 3DDGA 2X2HA 3KL3A 2BXZA 4P7NA 1VAHA 5DO8A 2VR4A 5ABFA 1W2PA 2WMKA 2FE0A 3ZJ7A 1G0CA 1XSJA 2FHFA 4JIEA 2DSWA 1EQPA 3DECA 2YKKA 1UKTA 1VRXA 3PZMA 5EBAA 4UFMA 4MNKA 1V3KA 4QFUA 1MW0A 2VTFA 1G94A 4JFWA 4W8LA 3A3HA 1OWQA 1CXEA 5CLTA 1R34A 4N0RA 3F5KA 2YBUA 4WK9A 4MB5A 1HVQA 2XIIA 3AS3A 1W9XA 1EOMA 3NCOA 1C8QA 1V6VA 4NZCA 3FW6A 2O9TA 3N13A 4M80A 3HJEA 5EMYA 3WENA 3H54A 1TVNA 1Y7VA 1J18A 3IANA 3WDJA 2CBUA 2ZX7A 2EPKX 4BZYA 3BAIA 2IUZA 1LL4A 1TCMA 2XN0A 5C71A 2XVNA 1QI4A 3DX0A 2W91A 2WVVA 4BS0A 4CD4A 1UH3A 1F4HA 3U57A 3IAPA 3ECQA 3GNOA 3NSNA 3ARYA 2ZICA 2WWDA 4CUCA 5E0FA 4UFIA 1JZ6A 2DDXA 4H04A 2GK1B 2V38A 3VDBA 4QAWA 4AWEA 2DGAA 1E3XA 3OLGA 4P8WA 2ZUSA 1HJXA 1K9FA 4UCFA 2W67A 3K4AA 3RCNA 3AHYA 1QI0A 2WMHA 3ARZA 1UA3A 3ARRA 2PWHA 3W24A 4AMCA 1MQQA 1UKOA 3W29A 4RL3A 2WK2A 2J74A 1OCQA 5I3DA 3VDCA 1PX4A 2D3LA 2E9BA 4OBRA 1I1XA 2GDUA 3MMWA 4AD0A 4JCLA 4M8UA 3VIMA 1LWHA 3GXNA 3SIMA 2Z1SA 2J8GA 4HU0A 4LXFA 2W5FA 4H8VA 4JFVA 1XCXA 1B9ZA 3BAXA 3MS8A 2EPMX 4HMDA 1EXPA 2EJ1A 3IK2A 1L8NA 3BVXA 1UD3A 2RGLA 1ZJBA 2BNJA 2IXVA 2UY5A 6CGTA 4W7UA 5CGTA 2XGBA 4GO9A 2C0HA 3VU2A 3CUFA 5A6SA 1B1YA 1UWQA 3AIWA 4S3JA 1R7OA 4TUFA 5BYWA 2VO5A 2CESA 1J0KA 2FHCA 3KE0A 4J28A 1UZ4A 1WCGA 3WQ5A 5M5DA 1H3GA 2E8YA 5AYBA 3VILA 4WKAA 1R87A 2J8FA 1LG2A 3GNPA 1UH2A 1Q6EA 4H8HA 1W3LA 1ZBVA 3DHUA 3DYMA 2F7RA 4QLJA 1HJQA 4FLRA 2ZUMA 5A3HA 4MPKA 3W6MA 3TP4A 4J27A 1GHRA 1PX3A 2JF7A 1K9TA 2OW6A 1QOXA 5CLWA 2G4FA 1B3VA 3SUVA 2ZWZA 1AQHA 4W7WA 1J10A 1ECEA 4CD5A 1HNYA 4W5ZA 3UEQA 5A2BA 4IPLA 1CPUA 1DTUA 1H2JA 1PX8A 3GXMA 1KR0A 2G3NA 1JYXA 1E40A 4GQQA 1ZBWA 1V3IA 4E4PA 1NOWA 4M81A 3A21A 1ITCA 5I78A 3ZR6A 1OD8A 1JI2A 3BGAA 3VOCA 2OYKA 2WHKA 5I0DA 4OGZA 3CZLA 2X2JA 2WLZA 4GXPA 4CGTA 4PMUA 3AQUA 3RM4A 3WNKA 2UWFA 4GO8A 4EK7A 1KWGA 1UYQA 4GI9A 1CBGA 4U3AA 1E4MM 3MV01 1GVYA 4AD5A 1ISYA 2J47A 2V5DA 1O7AA 1HL9A 3ZQ9A 1GJUA 1BAGA 4PN2A 4EE9A 2WMIA 4ML4A 3L4ZA 5A6BD 4FLQA 1HP4A 4GZJA 1UR0A 1RP9A 2OSYA 4YN5A 3VGEA 4BQ4A 1W9PA 4HZ8A 3SCUA 4ZFMA 5A6MA 3WDPP 2QMKA 5DEZA 3OB8A 4UTFA 2CHNA 2A3AA 3ARVA 4OBSA 3LRLA 1GZJA 1FFRA 4W89A 1W32A 2WVTA 1DWHM 4GINA 3ARQA 1CGTA 3L4UA 3WDQA 3BSHA 3ALFA 3N17A 4NRSA 3CH9A 4WSKA 1ZBCA 3ZIZA 2GDVA 5A8QA 2CHOA 1JNDA 3A4AA 1UUQA 3SCWA 4W93A 5I2UA 4AMXA 3OZPA 5E6ZA 2G8ZA 3M07A 1UD6A 3LRKA 4PTWA 3THDA 3WNLA 1E0WA 2FH8A 2VRKA 3UR7A 1W91A 3ALGA 2GJXB 4W8BA 2CKRA 5DMYA 4PMQA 4DM1A 4ZXLA 3A4XA 4GZEA 5AC5A 2QF8A 2XJ7A 1XC6A 5A6KA 4MTVA 1HWWA 3A47A 3M6DA 4H7VA 4AY1A 4AZHA 4ACYA 5JIPA 3OGSA 3ARUA 6A3HA 3VGHA 4J3TA 1OBAA 3CIVA 4UOZA 2PWEA 3BVTA 3UERA 2W66A 1G9HA 1LWJA 3WEZA 1V02E 1JDAA 2WZIA 2YL8A 1AQMA 3CUHA 1W3KA 1E15A 1KBBA 1E72M 5M03A 2DT2A 2J7DA 5A8MA 3T2QA 2BHYA 4J3UA 1LLOA 2EACA 2WC4A 1J01A 1TQSA 4AZ5A 1UHVA 3U7BA 4TOQA 3WNNA 3VKKA 1ZU8A 3TTSA 2FGZA 1WP6A 4UQBA 1KCKA 1E6SM 1OT1A 3AZTA 1A3HA 1BGAA 3D52A 3WF0A 4WKFA 4NSBA 3IGUA 2V3EA 3RJYA 1XSIA 1H0GA 2A3CA 4M56A 1BYBA 1CGUA 3VPLA 1RH9A 1WZAA 2E0PA 1UG6A 3EJPA 3O9NA 1FH8A 3AIBA 1G1YA 1JG9A 2Q8XA 4MDPA 5IFTA 1KBKA 1EQCA 3L4XA 1XV8A 3L2MA 3IJ9A 2DSUA 3S6TA 1GOMA 4HPHA 2RGMA 2O92A 3CPUA 3WH8A 1TG7A 2WBGA 4GIAA 2W63A 4HTYA 5FKYA 4WSJA 3VM5A 4J7RA 3AIQA 1E71M 3WQWA 2Y24A 3WNOA 3AHTA 3ARSA 3CO4A 1UOKA 3ZJ6A 4PTXA 3WD3A 2DPEA 3VD3A 1VBUA 3N9KA 4DWSD 2D23A 2EPNA 1BLIA 5I24A 3KL5A 3FHQA 3LPGA 1UR4A 3AHVA 3WMBA 4AC1X 1C93A 2ZIDA 2ZUVA 3GZAA 6TAAA 3WH5A 2WHJA 5I79A 5ABHA 3WUBA 1HJSA 2O9PA 2BY0A 1KWKA 3OG2A 1WZLA 4P8VA 2EBNA 3FHAA 3AHZA 4CU7A 4PMNA 2GJRA 1LF1A 2EPOA 4PEEA 2XFFA 4UQAA 5IHRA 1V02A 5A6BA 2X2YA 4AD4A 2VMFA 1C7TA 4XUYA 4PTVA 1RPKA 2V3FA 4W85A 1HVXA 4GI6A 3BLPX 3N1AA 3M46A 1JD9A 2F61A 4XX6A 1JNEA 1QHZA 4A3YA 1JZ5A 1GOWA 4P7RA 3D3AA 3WNPA 3BUBA 3MUIA 4RE2A 2VR5A 2TAAA 1B2YA 1ODUA 2BFGA 1E5NA 3SCTA 4CVWA 1E5JA 2NSXA 1WKYA 2E3ZA 3HG3A 2WAGA 1UWRA 2PI6A 2XFYA 1FOBA 1OM0A 4ATLA 3TTOA 3FN9A 4PUEA 1FHLA 4FK9A 3DYOA 3EMZA 5BRPA 4Z2IA 3H55A 2DSVA 4CD6A 1JFXA 3AYRA 4ZE5A 2Y8VA 3AIRA 4AYSA 1E6XM 4L4PA 1MW3A 2XVKA 1AVAA 1JFHA 1G5AA 1CXHA 1WB0A 5EFFA 3UCQA 2OSWA 2WCSA 1V6XA 1V6YA 1KXVA 5D8ZA 3D5HA 4PRWA 1FFQA 3DX1A 3PZNA 1UKQA 5GQBA 4D71A 2D73A 4YPJA 4S3KA 3WBAA 3MANA 1WDPA 3K8KA 3PZGA 2W62A 2VJXA 1BYAA 3WD0A 4ACZA 1PJ9A 4F8XA 3VMNA 4PSPA 1OT2A 3RPMA 4AIUA 3II1A 1LJYA 1M04A 4W8AA 2E8ZA 1XD1A 1K9DA 3SCOA 2CXGA 3AJ7A 3VD5A 3MU7A 4OJYA 1HKMA 1E43A 4XZBA 5BWFA 5BRQA 1EGZA 3AIVA 4AZGA 2QPSA 3HG2A 1TE1A 3QR3A 2A3HA 1VEMA 4KH2A 4B9ZA 3NSMA 4QP0A 3ZT5A 4TTGA 4OOZA 4CU6A 3AYSA 2VX4A 1UR8A 5M17A 1LL7A 1TA3A 3MMUA 2DT0A 3VIKA 1UR1A 2J25A 1BG9A 3W27A 3SUSA 1OD0A 1J9YA 4AZBA 2JEPA 5JBEA 1KGUA 2ZUNA 2EADA 4AD3A 2WCAA 2CNCA 3CZGA 4PSRA 4UZSA 3EDKA 2YBTA 3AXIA 4E8DA 1CGWA 1CTNA 1WDQA 2F7OA 3AMGA 1EH9A 3N11A 3VIHA 4CD7A 2VZTA 2VC9A 2VCCA 1DWJM 1JIBA 2ZUWA 1H49A 1H4PA 1V6WA 2VNCA 3RM9A 3NYDA 1GHSA 1C7SA 1MFVA 4JL2A 3OGVA 2X1IA 2V5CA 3AS0A 2WYSA 2X2IA 3W26A 4KRUA 2YJQA 2PBOA 2AAAA 1HF6A 2J7GA 2QLYA 2BY3A 1GQJA 3QHNA 4MJ4A 4DWSA 5CSYA 4Y7EA 3ZJKA 3PZTA 4HP5A 4WF7A 2WKLA 1YHTA 4TX8A 5LYRA 1B3ZA 4ZE4A 3VIJA 4PBGA 4TVDA 1QW8A 2PWFA 4W5UA 5E9AA 3AIEA 3N04A 5HNNA 1GVIA 3GXPA 2YL9A 4CCEA 1UQZA 4PMDA 3AXHA 3WDIA 4GPNA 3MMDA 1R75A 1FHDA 3VDAA 3KZSA 3W25A 1GJWA 2D0GA 4D6DA 1XH2A 1UWUA 4AYGA 1W1PA 2XN2A 3AZRA 2BY1A 3CZEA 3VGBA 2C7FA 4NI3A 2ALWA 3PZVA 1XH1A 2J7CA 3WFLA 4U2YA 5ECUA 5D9NA 2WANA 1IV8A 2VRJA 3CMJA 1HP5A 3S5YA 1W1YA 4H41A 1JZ8A 4AZIA 8A3HA 3VSTA 3A6OA 2XWDA 4M1RA 1IT0A 3PZQA 1BSIA 2O9OA 4NRRA 1KQYA 4PMXA 4Q22A 5A94A 2WLYA 1JF6A 2EABA 4W7VA 3F5JA 1SZNA 4JAWA 2WCGA 3UR8A 3DX2A 4W86A 3WQVA 2YFNA 2PBGA 1R7AA 1C8XA 1E6ZA 4MADA 2WMGA 3WN6A 2W61A 1VIWA 3WD4A 4MB4A 1UWSA 5E70A 3W82A 3RM8A 2WBKA 5AY7A 4MB3A 3FXYA 4AZCB 3MSDA 1E0VA 1KXHA 4IM4A 3ZMRA 4P8UA 3POHA 2VQUA 3VMPA 5CZKA 3WUEA 2BVDA 1MFUA 1NQ6A 1WO2A 3EBVA 2D22A 1QNOA 1CECA 2YA0A 3VD4A 5JIWA 3GDBA 5A69A 2OYMA 2VX5A 2CIPA 1O6IA 7TAAA 3K8MA 4FNPA 1W1VA 2UY4A 1TMQA 2EQDA 1B90A 3KLKA 1HN1A 3RDKA 1CGVA 1YQ2A 4IUGA 2EEXA 4M24A 4PMYA 1GOOA 2FYVA 3WY2A 3AMLA 3EMCA 1ZB5A 3VNZA 5E0CA 4BQ2A 3L4YA 3O2LA 1QI5A 4OKDA 3CGTA 4X9YA 4HOZA 2ZX9A 1QNSA 1J0HA 3PTMA 1CNVA 3WF2A 1E70M 4AZ7A 3VD7A 2BS9A 1E6QM 1QNPA 4U5KA 1NWSA 3ZO9A 1UD5A 2A3EA 1D3CA 3ZR5A 1OB0A 3L4VA 3CC1A 1UWTA 1V3HA 3T2PA 3VSVA 3WEOA 3VIGA 5GNZA 3A24A 2V3GA 4NXSA 2XVPA 1GORA 3VGDA 1UZ1A 2VX6A 2XHYA 3FNDA 1I75A 5E6YA 1BQCA 3OIHA 3PZ9A 4HOXA 3TA9A 3M7SA 3WSUA 2GK1A 4CU8A 1J0JA 4J3XA 3WEMA 4D6CA 3BCFA 1JDCA 3D4YA 2ZXAA 5HOSA 5M3WA 4B9YA 3W28A 2ZUUA 3HG4A 4R5EA 3W38A 3N12A 3APGA 2CBIA 3GH5A 1B0IA 2ZXBA 1PAMA 3GXIA 3WF4A 1DHKA 1B3XA 3BUIA 3N18A 4NZFA 3WMCA 2FGLA 1C3FA 3AICA 3DX4A 5A8NA 3LX9A 4DM2A 1OIMA 5A2AA 2UY3A 1QHOA 3BLKA 1UR2A 2YLLA 3I3BA 3T2OA 2BHUA 2EO7A 1NOFA 3WFZA 1JZ3A 4UOQA 1HJWA 3BC9A 2DH2A 4A3HA 2AMGA 5HPOA 1O7DC 4X0VA 3I3EA 1HKKA 3KLLA 4KGLA 3EDEA 3K4DA 3T08A 1UASA 3CHFA 1Q6CA 3CHCA 3VNYA 3ZSSA 1CWYA 2PB1A 1DWGM 3LXAA 5A6AA 1W3JA 3NSXA 4AW7A 3DX3A 3FAXA 3GH4A 3WDHA 2W92A 2VOTA 2DT3A 1EHAA 3WELA 2J7BA 1MW1A 1E6RA 4LYRA 3PHAA 1GOIA 3U5YA 1RP8A 3WUGA 4MNJA 2Y2WA 2BHZA 4OIFA 4PMVA 1R33A 3B9DA 5DFAA 4JCMA 3RILA 5FL0A 4NZJA 1KB3A 2DSZA 1DP0A 2GUYA 2CITA 5FOOA 2EPLX 3QOKA 4CN6A 1SMAA 1U33A 3MV11 1BTCA 1WZMA 1CIUA 3B8SA 4U31A 4MB1A 1BF2A 1RD6A 4QCFA 1JXJA 3SURA 3WH7A 4LPCA 5FL1A 1UD8A 1T0OA 4QLKA 1NARA 1HKIA 2GSJA 4JZ5A 3WH9A 3SCVA 2JIEA 4N42A 5A6JA 3WBEA 2VCBA 1EO7A 3WQ4A 4FLSA 1H1NA 1KFWA 5D9OA 1ISZA 1BFNA 4ZEPA 3EJTA 3GBEA 3A23A 3OLDA 2NT1A 2F7QA 1GQKA 3GTNA 2WZEA 3D50A 1JZ7A 2XSBA 4U3CA 2VURA 4URIA 4LYPA 4A4AA 5ABFB 1NWUA 4D6HA 1CYGA 2GFTA 2ZWYA 3AI0A 1WAWA 1G01A 1JL8A 1C90A 1ODZA 1NWTA 2YOCA 4D6IA 2D2OA 2BY2A 5DT5A 3I3DA 4TVUA 1W9VA 4MAZA 2WHMA 2OSXA 2XYLA 3TV8A 3VIIA 4MDOA 2EXOA 3AS2A 3VX0A 1Z32X 1K9EA 3RIKA 2YDRA 2JIWA 1QNRA 1KGWA 3BUPA 1E73M 2XPKA 3OGRA 3VINA 1UR9A 3WNMA 2FDMA 2X0YA 4PYSA 4JKLA 1ISXA 3CZKA 1XHGA 2X09A 1TQUA 2J7HA 2CYGA 2DIJA 4X0NA 1JF5A 3GBDA 3VIOA 3S5ZA 4BQ3A 2X0HA 1OSEA 2W4XA 1EOKA 3W6LA 3QGVA 1KR1A 4BF7A 5E09A 1H09A 2XVLA 1FH7A 2XVGA 4HZ7A 5JBDA 5D9MA 1Q6DA 2IXUA 4C7DA 5DF0A 5FCZA 3VGFA 1U2YA 2VQTA 1BYCA 4Q7NA 4E8CA 1J11A 1V08A 2AOSA 2D1ZA 1OGSA 2XTKA 3PTQA 2CETA 4AD2A 1VFMA 4EANA 2QV4A 2WVVB 1W9BM 2ZX6A 3H53A 3CUJA 4EKJA 2DSKA 5IFPA 1K6AA 3WD1A 2GJXA 3ZM8A 3GYCA 1ITXA 3SCPA 4J3SA 2ZXDA 4GZIA 4F9DA 2WPGA 1KTBA 4Z2JA 4PCSA 3K1DA 1Q4NX 3EDJA 1B3YA 1TR1A 1E1FA 2VVSA 1CGXA 3NDZA 3TONA 5BXSA 1PBGA 4W84A 3AROA 2BXYA 4TX6A 4XB3A 4HZ6A 3WMSA 4UZUA 4D6EA 3RJXA 3WH6A 1UD2A 1W1TA 5GPRA 2V3DA 4JHOA 1HKJA 2VVNA 1HTYA 3BMWA 2VZUA 3T0DA 4DUXA 2B31A 2D3NA 2F1AA 3AMKA 4PUDA 4JKKA 4ATWA 3KL0A 1EHNA 2J62A 5CXPA 5BXTA 3VUPA 5F7UA 2EAEA 5IXEA 4LX4A 4TXEA 2YFOA 4KMQA 5CPSA 2F1BA 1UQYA 1VF8A 1TQWA 2VZOA 3VIPA 4D72A 4HA1A 1EDGA 4H8UA 3F4VA 1B30A 4V28A 2JF6A 3VD9A 1JAEA 3VMOA 4D1IA 1V0MA 3MKKA 1ISVA 3N15A 1BVZA 3QHOA 2J78A 3D51A 1HX0A 4AIOA 3UESA 3BVWA 1CGYA 2CBVA 2D24A 2XSAA 4B15A 4P7QA 1VJSA 4PMRA 3BAYA 2GVYA 3W37A 2WW5A 4TVCA 4UQEA 2WZHA 3VX1A 2XG9A 3SUTA 4NXKA 1EDQA 3W0KA 2F7PA 3BLBA 2E40A 3AIUA 3WY3A 4OOUA 1WDSA 1GCYA 2XN1A 2VZSA 3ARTA 4L4OA 3DDFA 4F9JA 4MJ2A 1H41A 3UETA 5HDRA 2WXDM 1XSKA 5FD0A 1X6LA 4UQDA
chains in the Genus database with same CATH superfamily
5HMEA 3FTGA 1AO7B 1P5UA 4NN6B 1OX5A 5FF6A 2WZMA 1OCBA 4I9AA 1GXEA 2Q9OA 3KBEA 1ZK9A 3CLEH 3GMPA 5FYJD 3OA5A 3U7YH 5EO9B 4XGZA 5D70H 5M7QA 5DWPA 1S5IH 2Q76B 4JHZA 4NJAL 1M7XA 3JUGA 3MRDA 1POJA 4ZPTB 3LHZA 1W0MA 3SCRA 4EI5D 1YMHB 2ZKWA 2VUYA 4L1LA 1F3DH 5FYJU 4J3ZA 3RWJB 2CALA 1PVHA 3EO9L 3VFPB 4UQ2B 2W94A 1UM5H 3HTWA 3GGWA 3BTNA 3BRDA 1FVEB 4M6OL 4U6VL 2XGIA 3ZLGA 4OUEA 1M05B 2QADB 3PREA 5LIKX 3NZQA 2FIKA 3MHGA 2D9CA 5I6XC 4EP8C 2AQWA 1VGKB 2ZG2A 4MVBD 4HCFA 4LNRA 4BZ2A 1OX4A 1NVMA 3HE6D 3TEUA 1QX1A 3KPQA 5DJ0B 4S1SL 4Z7UE 3R0DA 1V3JA 4KDTC 3RU6A 3AHXA 3HMCA 2G5BA 1DE6A 2PO6C 3MTXA 3LQAC 4K5LA 5CINL 4Y4FD 4UILH 4MNGE 4LK4A 1F3DJ 4XP9H 4FJZA 5IW6B 4QG8A 2BO0A 5LIXX 1DN2A 3GJFK 4PRAA 1FP9A 2Y70A 3SDDC 1WZKA 3WLWD 5I1GL 1OQOA 1NTDA 1LQAA 1RPUA 3KBMA 2V5MA 4DQOL 3EOTH 2XIQA 2Y6SC 5A16A 3SPIA 4Q9QL 3NIYA 1XDTT 3D4ZA 1HGWA 3PZOA 3KPPB 2DZVA 4AVHA 3DX7A 1X1ZA 2YAHA 2MANA 4WEBL 1H3PH 3KPMA 1M01A 1DQLH 2E5BA 4UIKL 2AGJH 1JCJA 4H9XA 4WHBA 3H1ZA 2Z6JA 1PZ1A 4XXWC 1RZPA 2EVJA 3F2LA 4IM8A 1GYUA 3PAOA 3IN0A 4U6YB 3TBWB 3ZTNH 3IYLW 5DUJA 1CVRA 1QQDB 1FWGC 4GHRA 2ZYSA 4FI6A 5XINA 4LSBA 3GE7A 1R5VA 4PV1C 2YEZB 2QMJA 3HRPA 2D2CC 5GNXA 1XS2A 4PCNA 1I7ZB 3NESA 4GKNB 2CLMA 1T04A 3HE7A 5E2VH 2OO6A 4GG6F 4Y16C 4PL2A 4U6XA 4FNRA 2XFGB 1BWLA 5C54A 4OF8A 1KJ2B 1XF2B 1VFLA 4A67A 4H9VA 1BZQK 4ZK8A 4I0CC 1GW1A 3MX0A 2HVMA 3EWDA 1P4IH 3BVDB 3WXVL 4R7OA 1CE1L 2NX5D 4FADA 1A3LL 2A83B 5LBSA 3HAEA 5GSVB 4U7MA 1K4GA 2J5WA 3Q8FA 2H90A 4Q89A 1JRCA 1QFWM 2EE9A 3MC5A 1DVJA 5FA4A 2VIRA 3FFDA 2WN3A 2ZCKH 3GWQA 1QI2A 1DEDA 2ONEA 4OFCA 1T8QA 2A0NA 1HC1A 4A2DA 1HXMA 3SCNA 3TURA 2EEFA 2I9EA 2EXWD 2FHBA 1HXJA 2WXIA 1NTHA 5IFAH 4HKZB 3VA8A 1IT8A 2QW5A 1CF8H 4ZZ9A 1XBXA 3I7SA 3ETTA 1MCPH 4IQDA 5HYIA 4DO4A 4IKIA 5CQ1A 2XTJC 4HCRH 3FJ4A 3S9IA 4FN0A 3LIZA 3HG1A 1CW2A 3EOUA 1ORSA 2OB3A 2O61A 4OZHF 1TU2A 4TNGA 4G6KL 1W3NA 5IJVB 4XSMA 3CZNA 5L7XH 1QRNB 5G5DB 3PAYA 2VL4A 5I1IH 4BZ1L 4NJ9L 2BNUA 3GBNH 2JKJA 2QCHA 3EXRA 1JHLH 4ECLA 1JI1A 1YNTB 1ZLUK 2ZAHA 1ONQA 5I6SA 4LCVA 1PYMA 1VYSX 3QV6A 4XPFH 4GP4B 2VDQL 2BVOB 4O0QA 3WXWL 3ME3A 1QU4A 3UTTE 3INUL 1HCVA 4R4BA 1ZLSL 3RAJL 2YLHA 1GRWA 4Q2ZB 3IWUA 2WXKA 4MYPA 1VC4A 1FH9A 1IT9L 4NUGH 1QWUA 3K6DA 3P3SA 3GXTA 4Q6YA 4JD4A 3UC0H 5JMUA 3C2YA 2FNWA 4F0HA 3O6KH 4OVXA 2PLCA 5DRWA 2VGLM 2XV3A 1UJ3C 2Q01A 5JXEC 4RFNC 5C9KA 4MXVE 2YN5A 2N7AA 3NWRA 1FCBA 3BO8A 1JRHL 3U82B 3JV0A 3KBWA 1G9NC 5I5JA 3MJMA 4BFKA 4Q4IA 4H4IA 1IBHA 1MCCA 2BSTA 2TMDA 1OQFA 3QR2A 2XXCB 1J1XL 3TNOA 2A6IA 1B9KA 3NIFE 4ZUWA 2X1PA 3QO0A 2PPEA 3MUGB 4YS1A 2TPSA 4H9YA 2Z7KA 2MTPA 4X6CE 1QFUL 2AQRA 5CCGE 1EQPA 4GE8A 1F3TA 2ZXGA 2TRSA 2CWRA 4EJ1C 3RJQB 4FXLA 2M83A 3MOBH 3ERXA 5M95B 3SKNA 1J6OA 2GJ6E 1IBDA 2AI0L 4N0RA 3PP3K 1HVQA 3RTQB 2XIIA 4RV3A 2XNAB 3RX8A 2DWDB 3S4SB 5KYUB 5ESVB 3X1BA 4JZJB 2XDHA 5I66A 4GBXB 4ZMVA 4IRJC 4LCWD 2ATSA 4HCGA 1MRQA 1MH5A 5ETUB 1DUYB 1UH3A 2YPLE 1MJ7L 4HK3N 2R29A 2BNQD 3TFXA 1T1XB 1IB5A 2R1PA 1BGXL 3QORA 5E0FA 4HFWB 3DRQB 4G82A 3LRSA 3D18B 1NDGA 5TPWH 4J1OA 1AQFA 4QAWA 4RLIA 4IWWA 1RLCL 1NC2A 1MZHA 3V6OC 3I6KB 4Y2WA 4WV1A 4PJHF 1DZBA 3W3BA 1N26A 2IAMD 2PTXA 3W24A 4QSFA 3TAOA 3AGVA 3BSMA 4DXKA 2E5EA 3KUMA 3IJIA 1M6OB 4QKTA 4X6EA 2FMOA 2Y7NA 3RVTC 3CX5K 3KDPB 4LDLB 4FCHA 2XWTA 4LCWE 5B7ZA 1SVZA 3UBGA 3JUYA 4K2UH 1TTRA 2ARWA 1Q1PA 3O81A 5F0LB 4GVHA 1C08A 4B4FA 2BNQE 1XR8B 3IJQA 3P73A 1W3LA 4GRMB 2VDPH 1P48A 5I0YA 3UMNA 5I5MA 4FDWA 1TEYA 4O9HL 3TP4A 2CLLA 3UPBA 5DFWH 3U4AA 4Q74A 1CD1B 3TCXA 5DQJA 4E9TA 4OZFH 4TX9A 1UCTA 2MCPL 1MEWA 4ERSL 3BPOC 3FT4B 1UWYA 1H2JA 2PDJA 3L7EB 1RV6X 4PWEA 1SO6A 4M48L 1ZBWA 4J3OD 1P1ZB 2YXOA 5DYOB 2XC8A 3U9WA 4TR9A 1S5NA 3WLKX 1TETH 4K39A 1U8CA 4ELMB 1MELA 4QG6A 1EEUA 5EF3A 4H8PA 1QSEA 3P80A 3MGAA 3IMBA 5J5RA 1RHHB 3NFPA 3ZHFA 4MOZA 4QITA 4OF0A 4QTHA 5JH1A 3CFMA 1KIRB 4HS3B 3TZVA 4ZTPL 3QPXL 5KJ4A 3HS8A 4ZB5A 4LL9A 1KB5B 4KEVA 2V7HB 2B1AH 3A4AA 3KJ6H 4XTIA 1I7UB 3KGUA 1UUQA 4JRFA 4KCTA 2JQXA 3THDA 3WNLA 3MFFB 4I5BA 3VFUA 1WAPA 3O3BA 2IANA 5I9QC 3WCZA 5E0QA 3K6IA 5HYFA 3FQUB 3E74A 5AOMA 5H91A 3QUYC 1P53A 3TJXA 4PGCA 5EMUA 4JO2H 4Q6JA 3WMPA 3PHQB 2NXIA 3IF1B 5CJ8A 4BCYA 3J27A 1AQMA 3CUHA 3PL6A 1FO0A 1KBBA 2P7TB 5M03A 5G5IA 3T2QA 3S2LA 3RZCB 2P4AB 1GYAA 5TH2A 2EACA 1BQHG 1FVPA 1FAIH 1BFTA 1DJGA 5HYSA 1ZU8A 4QLRA 2FGZA 2KKQA 4YHKH 4KFZC 3THML 1N4XH 1YDNA 5F9WB 5TF1H 4WDUA 3TCLB 4Q7IA 1XSIA 2A3CA 3N0AA 1RH9A 1TZHB 3WKNA 3HJZA 2K9UA 2GDQA 2HS6A 4KY1H 4HWUA 4I2XA 5T3XL 3ERPA 4L3CB 3FNKA 3RRAA 1ADDA 1JG9A 4APXA 3GHPA 1A5NC 2GSMB 1Q9WA 1XGYL 1JRHI 3MNVA 4ISVA 3ARBD 4OE7A 5J5EA 3EF4A 2Y7QB 4WUUE 3UJFA 2WQVA 2CH8A 1RULL 3U36B 2C3VA 2B4CC 3TEYA 2YZ1A 2HBVA 4HIIA 1IBBA 3EJZD 3LPWA 4YHOL 2XIOA 2DORA 2QR6A 4DF1A 1FFTB 1DO6A 2CDEA 5I19L 1GS8A 3F03K 4KFMA 2R4RH 3WH5A 1HJSA 5FKPB 2BY0A 2C26A 2ZYIA 4WWKA 1G7HB 4CVXA 3UZVB 3FGCA 3VRLF 1FHGA 2XFFA 2A6JB 1UT9A 5IHRA 3QEHA 2ABBA 3UPRB 1W8NA 4LCSA 3TA6A 2ZSVA 3VG9C 4WY0A 3ANVA 2ORBL 4QJ3B 1V7NL 4IRZA 4RE2A 1NIUA 3WIAA 4JQXA 4D94A 2R7EB 1H60A 3LQAL 4YNYB 2F53A 3S47A 4TSCH 3DYOA 1RLBA 3IS0X 3D1MC 3VXME 3U0PA 3SOBL 2K9FB 1NZRA 3GUGA 4QQUA 2OOFA 1TRIA 1J2BA 1AG1O 4NQVA 3DU0A 4KC3B 2WCSA 2KDGA 1RJYB 3BYYA 4UWQB 2E7LA 4D71A 4NZ1A 1N64L 5AYXA 1FNHA 1G1OA 1NIFA 1RJZA 3Q1SL 2ETWA 2Y1AA 3WLLA 4AIUA 3SJVA 1KLUA 1LJYA 3FVMA 3MBEC 1N0XH 2PYEA 3MNWB 4WFED 3W1QA 2I25N 5GJTL 4OJYA 4QAIA 4MX7B 4MA7L 3WNJA 4BH8A 3UWUA 1KOAA 3QHFH 4IBTA 4MD0B 5ILTL 3P4MA 4MTMA 3WIHH 3C6LD 3UJTL 3AM8A 2EVFA 3RKDD 3AYSA 1TA3A 1R5WA 1KFEA 3SUSA 4FMKA 2JEPA 1KGUA 4NUPA 3KPRE 4GFIA 3B34A 4HHPA 1W0WA 4M7JH 4K9EL 5SWQA 1LD9A 1EH9A 4M03A 2VCCA 4Z7IA 2OI9C 3F5WB 2Z1XA 1TPC1 1KEGH 1R6WA 1ZAJA 1TVHB 1MJJA 4PVNA 1A9EB 1PNDA 1H7OA 3EAUA 2QQ6A 5DJDA 3TJHC 4WFEE 3EWUA 1UJPA 3HC2A 4BWTA 1KIUA 1AP2A 1A9BA 4PGBA 5F3FA 3GLAA 5AVUB 3WSQL 4B9GA 4BCXA 5MP6L 3B2UD 3SW6A 2ADJA 3JT2A 4TTDC 5EMJA 1QATA 2E27H 2VRAA 3ILDA 3JV4A 4AQ1A 2C7FA 3NQAA 4HIHB 4J3OH 2ACUA 2UX7A 3PPGA 1JV5A 4X4YA 3H6OA 4P3DA 3UBXB 4PWFA 3LD5A 3CXDL 1SQ7A 3O41B 1WDDA 4PWIA 2G9HB 3DI3B 3BUYA 3P3TA 3CT7A 3P8JA 5K5YA 1W1B1 3VXRD 4P3WA 1EJXC 3MROA 3CN4A 4HJJL 1A7PL 1RLDA 1MCNA 4XNMA 2R2CA 3AREA 4MMZA 1EHLH 1TE6A 2WBKA 4YR6A 2NUYA 4GW5A 2QTVA 3EBVA 3CWOX 1ZTMA 3FA5A 1BZ7B 1KULA 2ISDA 3LKOA 4K55A 5BXFB 2HS8A 3BEWB 3PABA 1FA4A 2UY4A 4X5WB 5B39A 2FR4B 1KLZA 2DL2A 4IUGA 2OLSA 3ARDC 3O8XC 1F6KA 4PJ9A 3B0UX 1ZB5A 4G8GA 3L4YA 2WXQA 3MA9H 3HAEG 2ZX9A 3FCGA 3HA1A 1GVSA 2IQ9H 3NFNB 3O4LA 3TBSA 4KUZL 4EQ2A 2VDLL 3T4YB 2VW7A 1MUMA 2P50A 1UWTA 3VXRE 3RPKA 2GOKA 1TJ2A 3VIGA 4EZKA 2GBUA 1IAMA 1JGLH 4R9XA 3MRGB 4FL4C 3DRTA 3T0CA 1R9ZA 3LA4A 4U1IB 1NDTA 4HJ0C 2WLNA 2HQAA 2YAQA 2GJNA 1KCSH 1TWIA 3ETSA 2XX0A 1TMCB 1ZRQA 2MTAA 3W38A 2EPHA 2AQNA 1OVZA 4NQEB 4M4PA 4Y90A 1B3XA 3N18A 4NL1A 3LX9A 3AZUA 3QZBA 2PUZA 1ASPA 3I3BA 2BHUA 4XNXL 3J07A 1OFEA 1A53A 4GGBA 2XJLA 4FX7A 3C2RA 1VYPX 5K9OB 3FT1A 3KBPA 5D1ZB 3T08A 1G9NL 2IEPA 3W9DB 3Q01A 2NY2B 3LXAA 2Z92B 5DZOA 4H8WH 3AWOA 4OIAA 3N5AA 3G0UA 4L80A 4KTEL 3EFOA 3SQMA 1JP5A 3U5YA 2Y2WA 1A5OC 1OIOA 4PMVA 3EAKA 4ZQNA 3HMJG 4ZW7A 4HS8L 4O54A 3V0WH 5CG7A 4BIKA 5IBXA 4JFZH 4OV4A 2BVPA 1CIUA 1UB6B 5FL1A 1UD8A 1NARA 3EXJA 3LN5B 2I9TB 5IVOA 3QS3A 3DVNB 1FH5H 4LRTA 4TUJB 3TR2A 1EJOL 2JSFA 1ZE3H 3Q8BA 4U3CA 4RGNC 1XGRB 1SXAA 1XL9A 3I9AA 3S9DB 3HVNA 3WO4C 2BY2A 1QR4A 1Z2KA 4BEUA 1XGUA 4WEMB 5EZLA 3RIKA 2FBRA 1QNRA 4UCGA 3MGOA 5L2KD 5EUOB 2VWEC 1I3GH 1KB9J 4JRLA 5I8KL 1XLLA 4PRPD 5CEXB 2XIDA 1SF5A 4LF3A 3L45A 3W6LA 5C9XA 5XIMA 1FWBC 1G6RH 1KRBC 3WUWA 1FLRL 4ELMF 2P76A 3DVFA 4LSDA 4U1NA 3GJFA 3QK0A 1W9BM 3H53A 3U0TA 1RUKH 4G1EA 2YCKX 3QNYB 1XQ4A 1YEDB 4XP6L 4MQ7B 1GT8A 1NAKL 2KI6A 3NDZA 4HZ6A 3NACL 3WH6A 1OWRM 1EWEA 2XG5A 4RQQA 5CSZB 1MDAA 3AMKA 2ZE3A 5HJ3A 5DO2C 5F7EL 4UM9A 2IWGA 1D7BA 4PRPE 2HN7B 4MQSB 5E4EB 2ZZ6A 4EOWH 3T4AA 3N9GL 4G9FD 2JJTA 5D6DC 1HAWA 4HA1A 4N8PA 1JHKL 3WYRA 3F4VA 2IQ0A 2PEVA 4EI6B 3V7AG 5I15H 3NFUA 1X96A 4ZTOL 1WSST 2R23B 1WYIA 5CP3A 1VS1A 1BW8A 4OD1H 5J06A 4JFDA 4HH8A 3FTWA 5DURB 1ZJIA 2PCYA 3L9BA 4DPQA 3B37A 5KUMA 3S88L 5LHFA 2AL2A 4RNRB 3DKLA 1WCBA 1CFNA 4ANVA 3FBKA 4DYJA 4G9FE 5CAKA 1EZVY 4IP7A 3L3IA 3HPLB 4P59L 4UDTB 4YPGA 1ISWA 3CTTA 4HALA 3H21A 1HQRB 3NCJH 5I1EH 2NY3B 3OZ9L 3AWGA 1HL4A 5F6IC 4ZX6A 4L9YA 3VI4B 1C8YA 1DXIA 3KCWA 3QDHA 5I73B 4K3DL 2NUTA 4JDTL 2A9ML 4QCEA 3QQ9D 3KAAA 1UC6A 4PJDA 5I82A 4FX8A 2EIJB 3RITA 1PG7H 1G4PA 2XLLA 2VLKB 5LSMA 5EZJB 2Z35A 2WXPA 2YZ5A 2J8UB 4NQDD 4WVRA 3CWGA 1WX0A 1LL6A 5IVXE 1MLCA 3SDAB 4XAWH 3TJLA 4NUQA 3VB9A 3PR2A 5F93C 1RXOB 3GMOB 1YEFL 4DUWA 3UIYA 4Q8QA 2EXSA 1ES0A 1W3TA 1YYLH 1WEJH 3X3FL 2FDBP 3WFBL 3QSTA 4HUCA 3TO4C 3W1RA 3BCDA 1AI1L 2VRQA 3BE7A 3NDYE 4WHDA 3M4HA 1V0LA 4DF9A 4D7PA 3WKPA 3KWVA 4JDYA 2NZIA 3BLEA 5AAPA 2E9MA 2X89D 3A12A 1QO3A 1DFBH 3V4PB 1U8IA 3LKPA 2YGNA 3OF6D 1B9BA 5CSUA 1A6PA 4XODA 1NBZB 2WXHA 4NQDE 4YHEA 1VFHA 4AYFA 4YUEH 3GHTA 3MRQB 2A9NH 4EACA 4MKMA 4AITA 3DHDA 3EKGA 4HT3A 1UMYA 3ZSTA 3H2CA 1SRDA 3PFUA 2K45A 5BUAA 4P2RA 4X98A 2NYYC 3MDJA 1TJIH 3OKLA 1QTSA 2DQTL 1MCWM 5AHIA 3VI3B 2DT1A 4FMFA 1P9MC 1CK0L 5HYSG 3O2DH 4DZBA 2C71A 3NP4A 5DT1H 3SQBA 2H9AA 1RR2A 4LOCA 2X8RA 1I9RL 4XZWA 4NASA 2DTMH 1G1KA 1SQMA 3O45A 3ITLA 5L6YH 4FQHB 2FQFA 4L4VB 4B9JA 1OFPA 3SCQA 2WQSA 1QO5A 5IFHL 4XAYA 5CJOH 4K2SA 3N6JA 5AYQA 4L8CB 1LO0L 2P8CA 3C6EA 2ZRUA 3LLFA 3H0TB 4DETA 2VL5B 4YDIH 2A38A 1XZ0A 1M03A 1ICTA 1IE5A 4B5TA 4QNPF 4B7IA 1JYVA 1WICA 1R6VA 4O14A 2NY0B 5J3HD 3R2GA 3TA3B 2DB8A 5HXMA 3ROOA 1U3JA 2W27A 4TM9A 3EJRA 4AHQA 3MTRA 4I7ZC 3VKCA 3D25B 1AGBB 1BA9A 2VE6A 1DXFA 4E2VA 4NWUH 2Z26A 3P9LA 1ZMYA 4G6FB 1MF2H 3DXAA 3KWUA 5DJ8B 4EVZA 1EZWA 4PJXE 3MLTA 1QPNA 2YGYA 3E1F1 1GQNA 5BRZB 1MQRA 4KHXL 3O11A 1S4IA 3FT9A 1XRVA 4G8EB 4C6IA 2GGGA 1F2JA 1U2HA 2WINB 2DLHA 2MWCA 2J8HA 4UTAH 2B1HL 3IVKA 5CUSH 4W81A 4OLEA 3UF9A 4FQLL 4LYQA 2QVMA 3QZEA 5ALBL 4CRPA 1YYML 3W7EA 4MFDA 4UT9H 1WFMA 4UQ3B 4GH3A 2WVSA 1Y6KR 1NOUA 4JHBA 3T44A 5AKTA 2GUOA 3B06A 4RW3A 5TAOA 2WVUA 5FV2A 2IGTA 5KEZA 5H94A 4NNAA 3BKCL 2NSQA 4LSSL 1NU5A 1RY8A 1KXVC 2VC7A 5EC2B 4QRUA 1UT2A 2W0LA 3ZE1B 3DPBB 3KS5A 3STCA 3SCMA 3X11B 5F7NC 2QGHA 3F64A 4WHTB 2YC1A 4RBPK 5B1KA 1BD2E 5CFAA 3VCLB 3RWIB 4XVUC 4XN8A 1ZSHA 1H8OA 4FZ8L 2OMWA 3ATFA 3TTQA 2E47A 3EDFA 5GZOC 1NDYA 2ZE0A 4OGYH 2DQWA 2W38A 3QFEA 2JE8A 1S9VB 1SUXA 4YCPA 3YPIA 2PP9A 4MS8D 5AW5B 1PL3A 4B92A 3SSGA 1QSFA 1DBKL 4PVBA 3QPKA 3PJUA 2CKBA 1JPMA 1UGKA 3VKJA 2R0LL 2JIXD 3FU8A 2PXYD 4DVBA 4Y1TA 1AJ0A 3P6LA 4FS9A 1PEWA 4R4NC 2QF7A 4JO1H 3NVDA 5IOBA 3HU7A 2X4RB 4G6ML 4HJFA 2PS2A 4BE5A 3QJOA 1LLZA 3IETB 3SGKC 1KIPA 3WD5H 2CLZB 2OPJA 2QJIA 1EFXA 2W1NA 1O9VA 2I9LB 4M6NL 2RBLA 1HILA 1E9OB 2FVNA 4TUOA 5HANA 1XR9A 4NNCA 1W2PA 4JFFD 3Q6GL 4JFEA 1I2QA 2BVEA 1FCGA 2FHFA 3TYUA 5HWNA 4L5ZA 2UV3A 2QR0B 1IWBA 4XC1L 3L4CA 1Q0EA 3EJYC 2IKJA 1QLEL 1WXYA 5D33A 4JFWA 5C0NC 3PUDA 3BPLC 1KRAC 3F5KA 1XUZA 1I9IH 1AG0A 3URBA 2J6EA 4A04A 4UM8A 1FV1A 3TW6A 2E9WA 5LCVL 5F1UA 3BAIA 2XVNA 2JKTM 5EOTA 3MLRH 1SYVB 3WE6B 5EUOF 4XBPA 1RJQA 1QEXA 4GISA 3STPA 4XN1A 4RW5A 4JFFE 5B39G 1E3XA 3MRPB 4OCWL 1KM1A 1YEEH 4P8WA 1OE2A 3TN0D 1FNGA 4XAGA 2YD5A 2BDNH 4CC4A 1HXYA 4Q4QA 1A6AB 2YOAA 3AHYA 5CNHA 1LE5B 4I89A 1UA3A 3PTDA 3MZGB 1UKOA 1BOGA 2WK2A 3ZVHA 4OD3H 3TIEA 3FYIB 6TIMA 3AACA 4U1JA 3VG0L 4OBRA 4JCLA 1LWHA 5AVRB 3MKVA 2W5FA 1CFQB 5AD0A 4S3DA 4Y4HD 5J56B 4A8IA 4LVHC 4HMDA 1F8TL 1ID5I 2HPIA 4PP2B 1CLKA 4QS5A 4AQAB 3BEVB 4RJEA 5I76B 2BVQA 4S2SB 1EEYA 4GNKB 1UB5A 3OMNB 2PZNA 1R87A 3ZE2B 2YX0A 4Y19D 1FDLL 5F1NA 4EI0A 2R39A 4L6DA 4MPKA 3NURA 1O60A 5FOBA 4LSVL 2PFHA 1K9TA 1PZDA 1WGVA 1VERA 3OO2A 1G6CA 3SUVA 3V0JA 4DAIA 3V0FA 5T5NF 4W7WA 4L6OA 3Q6FA 5HP5A 1BEYH 1DTUA 4WNQA 5ITFA 5F7BA 4XZMX 1LRTA 2G3NA 3TFBA 1JYXA 2BIIA 2VGBA 1KJVB 5I1LA 2BZ7A 1MFAH 1VZGA 3DX9B 3TBVA 3RDTC 3STLB 4ANXA 3AY4A 5IJDC 4PCFA 2COQA 1ADQL 1UQSA 1TYGA 1HHHB 4IMLB 4GXPA 5LB1A 4GI9A 1CBGA 3BD3A 3PUUA 2PPGA 1BAGA 5DRXA 5CIPA 3BG5A 5INDB 4TKWA 3RPTA 1YSOA 5HHNA 1RERA 1DWHM 3ULVL 1WIUA 1CGTA 3L4UA 4M7LH 4CMHB 3DIFB 1ZBCA 2GDVA 2CHOA 3QZ6A 4CC1A 3BGGA 3AAZB 4LTSA 4IBQA 3GO2A 2RTTA 1E0WA 3Q43A 2Y7EA 2H8PB 4H8NA 3VI4F 5FKAB 2G3XA 5DMYA 4YHYC 3W2UA 5GGQL 1K7FA 4OH2A 4A38A 3B40A 1F5WA 2AF2A 5JIPA 3OGSA 3ZGIA 4Q8UA 1HIML 3BJTA 1ETB1 2WZIA 1MAJA 2ENSA 5C2BL 3BP5B 3LZQA 3LKRB 1BVWA 1O7VA 2H8XA 5T1LD 4YL9A 2M26A 1YO4A 2HE8A 3WUWG 3U7BA 4TOQA 5E9DD 2QKIB 3BP7A 1L9SA 4FQCH 4EIUA 1BGAA 3R4IA 4AENA 4EDWL 4LEQA 1DL7L 3ARGD 5J12C 2V68A 4MBRA 3QJFA 5LG6A 1PDKB 2OPCA 5HTSA 3O9NA 3C2VA 5LKNA 2VC2H 1FWWA 5C0BB 2X12A 1NGXB 4DT2A 1CLZL 3L5XL 1SEBB 3L3KB 1LORA 3A13A 3DURA 4O58H 3DUHA 2D7TL 4POZD 4XG1A 2Q3AA 3S6TA 4Y5VA 4ZMTA 4PW3A 4QF1A 1SNRA 4H9UA 1O4UA 5F4XA 3WNOA 4RSYA 4B5UA 3GS7A 2GT9A 2I26N 4ZMPA 2NW2A 1NOLA 5AQ0A 4QHNB 3S36H 4YLWA 2QCDA 2IQAA 3ABSA 2E68A 5BJTA 2X7VA 5HGBB 4R0LB 3HGRA 2OFJA 4LLUB 1BQLH 4ZRGA 3NFSL 5BVJA 5GRWA 4XUYA 2BINA 4LHQB 2QVNA 2BSBA 3ZUCA 5A43C 5T5FH 2BOCB 6XIMA 3D9AL 1CD0A 1JNEA 4A3YA 3TBYA 1KUMA 1IGYA 2GIMA 3WNPA 1JR1A 1NANI 5I3IA 3DNKA 2ZCLL 5JIDA 4Z3EA 4N7QA 1KJ3H 2BFGA 1T4WA 5IMLA 5B21A 2ZXCA 3T0ED 2W9DH 5BS0A 2CHDA 5DCEA 4NHCL 4PJAB 4HS6A 5IK3B 1YNKL 2O5YH 5IHLB 1DVFA 5GGSA 2J9YA 3DG3A 4IHBA 5KZCD 3KDOA 4B5NA 1SVDA 1KGCD 1I1YA 1CICA 2BSSA 3TN3A 1W0YT 4H13C 4QRRA 1CXHA 5PTDA 3IDIB 3W7IA 4HUNB 1ALDA 1FFQA 1YHPA 1IGWA 2D73A 2HWZL 2NY4D 5I75C 5HHOE 3QDJE 1BYAA 3HTLX 5J5DA 2QKSA 1MWAL 1NSNL 2ZSWB 2ED9A 5C0DA 4HCDA 3QS2A 3VD5A 1ZCRA 4Y1AD 2R56H 4XD5A 2R15A 4NQCB 3MLXH 1M57B 2Q02A 5J8OA 3T0EE 3PQYD 2A3HA 3MQTA 2P53A 3NSMA 3FVDA 5AAMC 1C5DB 1FBIL 3ZZLA 4CU6A 1AIZA 3HVDA 1UR8A 4MBOA 3MWCA 2JI2A 3ZVVA 4IOFC 2W07B 5FO8B 5JBEA 2WOBA 2ILLA 2EADA 2YD4A 1VIZA 3EDKA 2APWA 1MFDH 5G1YA 4R96A 3D30A 3UGXA 5MEPA 5CD5D 3MRLB 5K7JA 4NS0A 4HCIA 3VYNA 3HHMA 1NKRA 3L1OL 3E2HB 3PWNA 2F58L 4Z7VE 4WFHD 3K2UL 1F3EA 2WKLA 3U9PH 4UTCA 5EF0A 5E5LA 4Y1AE 4NAMA 1XPYA 1BAWA 2NNAA 4TRPH 1VGEL 3PWPA 4DOHE 3ZWTA 1PWMA 3PQYE 1TJ0A 5GGRB 1R75A 4DB7A 1Q7QA 3W1XA 4PFMA 2H0EA 3H6JA 3F7YA 1W1PA 4AZ8B 3ZE1F 4C83A 1BYPA 1YLVA 3WTWA 5DEJA 4CVZB 3QSRA 2FLMA 2JGYA 3PBWA 1DEEB 3VSTA 1KFJA 3ITTA 1GTEA 3MJ8A 1BSIA 5AOJA 2I07A 2NQLA 4N0YH 3ISYA 2XIMA 3NA8A 4ZXBD 4JY6A 4WFHE 2CGRL 2F7FA 5FR3A 4D8PA 3FQWB 4WK4B 3O6FC 3VMPA 1JPGB 4HIXH 4WZHA 3UZXA 2D22A 4ZFOB 1AH4A 2K8MA 3F05A 1U8QB 1U2CA 5DRZA 3ALPA 2A77H 1H8SA 3CVHL 3BHBB 1UMLA 5LZLA 1RZ8A 3QHZL 4O2FA 1O68A 1GKQA 3SE4C 3W87A 3IXTB 2EEXA 1GOOA 1GS7A 4RDQF 5FB8A 2YPKA 4QTIH 2SFPA 1CT8B 15C8H 3BANA 1I4FB 4LCRA 3R79A 3M17B 4ETYA 4F9PA 4PBVC 2EDEA 4NC2B 3V95A 4KQ0A 3IDJA 4IXXA 4L8DA 4FXKC 1FFNA 3OX8B 5IWLA 3IWVA 4YJ5A 4HLZH 3CL8A 4HBCL 3HZVB 4E41B 4ATTA 2Z93B 3EA2A 2GSIA 1U5HA 4TUKL 3HPJB 4LLMA 1TKKA 4PBWD 3PPHA 3P40A 4RK8A 4FB7A 4LSTH 1MHPL 4K9EC 4TNEA 3B2PA 2J9XA 4KK6D 4GRLD 3CUPB 4L18A 1X8FA 3IEAA 1KBVA 4PB0H 3BUIA 3EH4B 1T4KA 2H1PH 3H3PH 4GMEA 3T6ZA 1I8KB 4X4KA 1D5BA 2YW4A 3GBLA 3ZGHA 4ERAA 2ZNWA 3GB6A 4G5ZH 5EEZA 4MJID 3KLLA 1G9EA 2ZZ2A 4UTTA 3DGGB 3M16A 3P11H 5D5ME 3NN8B 2DT3A 2EGZA 1EHAA 4JX5A 1A4BA 5DQ9B 4QR7A 1RP8A 4M5SA 4NKOA 4AGLA 1WA0X 4ZSOA 3M44A 4MCMA 2B08A 3MV11 1BTCA 4M1CD 2DVTA 4MB1A 5LJYH 1BZDA 3NVTA 2GCYA 4JTHA 4PV8B 3I84A 5EEXA 4JZ5A 4N42A 1Z42A 4NRZA 1CFBA 1BFNA 3VOHA 3EA3A 4P4KB 1GQKA 3ZE2F 1BYNA 5G2IA 5GS2D 3SGGA 1XEUA 3UTTD 2CR6A 4MJIE 4K7PH 1J93A 3RIFK 4X0KA 4QPEA 1TEGA 3ICJA 4KFPA 2L7JA 4PI0A 4NNXA 1X9RA 1KLYA 2YDRA 1U3HB 4Q58C 4Q4EA 2RHEA 5BVPL 1KGWA 3OG6B 1TCDA 3PLYA 4IBZA 4Y9OA 4F2TA 2X4OA 2X0HA 4WKXA 2F6UA 1KR1A 2OL3H 3KYKH 4XMTA 4Q32A 4MM1A 1LP9B 2XVLA 1FH7A 1T21B 2J21A 2CBOA 1DQUA 4LGSB 4Y2DA 2Z91A 2O4MA 3WU1A 3RFZA 4NC1C 5M94B 4MSSA 5F70A 4J3SA 2ZXDA 4M8VA 4F2FA 2ZOUA 1EPVA 5AC6A 2E5DA 3BH8A 3L1GA 5D4JA 3SBPA 3KW8A 3KXFA 5GJPA 1ED3A 2B3RA 5CZXD 3AROA 1UD2A 4Z0XB 4U49A 3H42L 3BMWA 2PZ0A 1B3JA 32C2B 2G75A 2Q8ZA 5DBTA 3LKQB 5CZJA 2OJEA 4TXEA 4JDVA 2GJ6D 1JZGA 4MZ2A 4M6AA 1CB7B 2RH9A 2FT7A 4MNQA 4HD9A 3VMOA 4ZQKB 3W76A 1D9KA 3PWJA 3RGVA 5T1MA 4Y4KB 3E0WA 1VJSA 4Z7AA 4HU3A 4AXKA 4TLKA 1FLTX 1TCRB 3RG6A 6ALDA 1W0VB 2G95A 1EXUB 1OARH 3URAA 2YPLD 5IMOA 4L3ED 3K1GA 4OTXH 1LBMA 4LSUH 1YRRA 3HQNA 1NINA 3ARTA 4NN5B 2EDKA 5IHHA 5G55A 3GB7A 1PXGA 2EDQA 3FSWA 2NDGA 3NYKA 4LUTB 4F7MB 1QYGL 2OJPA 1KJMA 4HZLA 4NQSB 2YPIA 3QR1A 2Q71A 1FZKA 4NZUL 3GSOB 3LEPA 4ATDA 1Q8AA 3ZL4H 3W6YA 3QV7A 1MWOA 4HSAC 3DYPA 3RO8A 2Y5JA 2AJYL 3VB8A 2G41A 4LBSA 5K9DA 2YSWA 3RVUD 3VC6A 3MRCA 2ZQKA 4W9IC 2YHGA 4OQTA 1OF6A 2FX7L 2ZX5A 3OAUH 1OCWH 1XIMA 3TJPA 4XWGL 3GLDA 4PUWA 1Y1UA 3K71B 4MY9A 4L3EE 3UO8B 1LDPL 2H3BA 5GGVH 1HHIA 5AL0A 3QLDA 4IL0A 2APTA 3S98A 3RKPA 5JXAH 1YPFA 3SY8A 3ASOB 3IUDA 1AFVL 1C12A 1W5MA 5GVJA 3MSGA 4YNGA 5I74B 3SDYL 1K2DA 4NYLB 5CEYB 1TVPA 4ZNEE 1HWGB 3WFHA 1AY1L 1KTCA 3B2VL 2FIQA 2ZOKA 4H83A 3QIBD 4S1SH 4J3BA 4P05A 1W5PA 1YTEA 5CJXA 1WLHA 4CW1A 2IBZY 4JHVA 1A1MB 4EDXA 1KYDA 1PKQE 1GUVA 1F3JB 4HKPA 2GABA 3QIUA 4R53A 3U2OA 1S9WB 3E8UL 7REQA 5C07D 4PE8A 4PJAF 5HJGA 4R26L 3PWUB 3W0WD 3VZYA 3MPCA 5I1GH 2XH4A 1I8AA 2OXGB 4PH8A 1IF2A 4FHAA 3PZIA 3TGXA 3L16A 1VADA 1UA7A 4WO4A 3FH8A 2UV8G 4IQLA 1NP2A 4PR5B 4LKXA 5IDIA 4AUUA 1N8ZB 3DX6B 3RMJA 4JO3H 1MI5B 4MS6A 4WEBH 5FJOA 1DLFH 2Y8KA 1WBXB 2LLGA 5JOFA 5FGCE 2F5AL 4Z0SA 1QA9A 3FDWA 3QUXC 1Q8MA 1TQCB 1WIOA 3MA7B 1S46A 1CLOL 1E4IA 1U4FA 5CMAA 5FPIA 1M2VB 4MSWB 4N8VB 4NO0A 2A74A 4GUPB 4AY8A 3K6OA 1W16A 4N2KA 5C07E 4OD2A 1PZ3A 2JALA 3W0WE 3VWKA 1E4NA 3NZ1A 1SM3L 2XH2A 4H25B 3QXVA 5I1DA 3QC6X 3ZKMD 1BQKA 2HZHA 2VZVA 2R1YB 5HPMB 5H6HA 3EOOA 2O5ZL 2CBJA 4X6BA 1Y65A 1VKXA 5BQ7B 4B60A 2PRMA 5CHNB 5J0BA 3I7QA 2XTSA 3LS5L 5IB3B 2RCSL 2OWWA 1EIBA 1JCMP 3WXVH 5EMLA 3HB3D 5DZLA 1MREL 2KS0A 5I0VA 3WBXA 3CMFA 4ICNA 5GS2H 3TBCA 3B9AA 2QGYA 2F2KA 3SDXE 3LHWA 4WI7A 2P3ZA 1F4WL 1AR1C 2INEA 1DN0A 2E75C 3UY8A 4WUUD 1VPQA 2V2HA 5B8CA 4DP5X 5DZVA 2R9HC 2XHNA 1GMEA 1AH0A 4TNVK 3SPJA 1WE5A 2VXNA 5DK0B 2BV9A 1R3YA 5KETA 3LNFA 5C1MB 1NDVA 2OJZL 5TE7L 3GM8A 3MCKA 4K7PY 1K02A 1JQXA 3P3YA 2VX7A 4Z2HA 5HI4D 3MSRA 3UYPB 1SY6L 3DHPA 3M0VA 4J8RA 2PWVA 2ZA1A 4MMXC 3H56A 2YBGA 1EX1A 1WFOA 2C19A 5CGYD 4I48B 5DR5L 1X44A 3VXSA 3D85A 3U6XS 3FYOA 1H5BA 1X39A 3HC0A 1HJVA 5E8OA 3OZOA 5JHBA 3C8HA 2PTVA 3PFQA 4DEPC 3G04B 1S2TA 2XRAH 3COOA 3WIJA 3VXMD 4L8SC 3JVGA 1CDCA 2E4TA 4HGWA 5AW8B 3PPCA 5KYWB 4LEFA 1TELA 4CN4A 2M8XA 2UZYA 5H37H 4ZMNA 2VDQH 1ULVA 1BEXA 2X70B 1JWUA 4DWSB 2XGZA 3BIKA 5DA4A 4AHPA 5SWZD 2V8ZA 4EOUA 4WK2B 3F85A 4JGMA 3DVGB 3IFLL 1Y6MR 5MEQB 1OWWA 4JHUA 3VFSB 2Y25A 4AEHL 3SN4A 3L4WA 4KROB 5HDWA 5JUVA 1JWMA 2NZLA 5FIPA 4LWWA 4FIRA 4YSDA 3ZDXE 3KPRD 3LKSB 5H2BA 4P2QD 4JY4B 3ZOAA 2E7BA 3ATEA 2FO8A 3TU6A 4NQQA 6FABH 2J75A 4NAJA 4ODWB 5FAGA 2WBJB 4LLYA 3CDGB 3GINA 4XXCC 1W54A 4D9LL 4DGYL 4FQIL 4HWZA 5SWZE 4HPYH 4IDLA 5KYYA 4EAMA 4IBLT 1NLDL 3WBDA 5JA9A 2FE0A 3DFYA 3SI9A 3F84A 5FESA 2DQCL 3KPLB 3GHEL 2JXMA 4O1AA 1J9QA 1ZXKA 2EDFA 2DSWA 3W1UA 1HYSD 3PIQA 1GOHA 3S3SA 2NVAA 1Z8AA 3JWDH 3NXFA 3PZMA 43CAA 3GXUB 1GJPA 1G94A 4JAMB 3F6JA 4L8BA 4JQ3A 1X5HA 2Y6SD 2R8SL 1BLNA 4HN4A 3C75A 2VXSL 4P2QE 2QZ5A 3SR7A 2Z28A 5GGVY 1IMHC 3QIWB 3GLCA 5CILL 3X14A 1J18A 1KCZA 2MKLC 3I02A 1NAML 3WDJA 5C71A 4HF5L 1L2UA 5KG9A 1BKSA 3EB3A 5AHNA 3MHUA 1A5KC 1R3LA 4RRPM 4HK3J 1OP3K 3UAEA 1PZBA 3IGAA 2B8OT 4UFIA 5JW3H 1JZ6A 8FABA 4XC3L 2JH2A 5DY2A 2WW8A 5C97A 3OLGA 1LP9F 4EBQH 3CAKA 1YNTF 1S5HA 2DLFH 3ARZA 2WMHA 4HUWB 4YHML 2ZCGA 3KOYA 4RIRA 1KCRL 3S37X 2VEGA 4ONHA 3QCTH 1Z3RA 1RY0A 3TXZA 3N9RA 2E9IA 1OABA 2BZCA 2HPMA 2A99A 1FN4B 4K7VA 4N2EA 1UG9A 3ALWA 4ZB0A 2HKFL 4YSAA 4ES4A 5M2FX 2IPKB 2XGBA 5CGTA 5ICYB 3W1NA 1Z9AA 5IV2A 2XY1A 5BYWA 4MWAB 1PYFA 2FHCA 5IR1A 1QWGA 1X7FA 2OOGA 3HR5A 2NTFA 2P5EA 3H3BC 4MASA 4P2OB 2F7RA 3RYMA 3SZ8A 1GPOH 4U1KB 4M93B 4QX4A 4JICA 3CT2A 3H2QA 2MCPH 2CPCA 4ERSH 1T5WA 2G4FA 3H70A 1T2XA 1AQHA 3V4VB 1A50A 2EYTA 1NOAA 4LB3A 4X99A 3II2A 4G7EA 1SXNA 3QE5A 4X8JB 4ADSA 1NOWA 5E94A 3A21A 1B4JH 3CZLA 1HJBC 3WNKA 1X38A 4FLHA 4YMZA 4D0BA 1S7VA 3FCUB 1O7AA 4NI8A 3MHZA 2BASA 3DENA 4P46C 4XXDA 4PN2A 5AB2A 4FLQA 1GGUA 4LW7A 3B3DA 1T1YB 3T6XA 4NM4L 2AQ3A 1O5XA 3LRLA 1EAOA 2CU9A 3O2WH 3OMAB 1HWHB 2EXYD 2BM3A 3WZ0E 1ETJA 4POCA 1YX1A 1W72A 3QQ4B 4NUMA 5DD3L 1OEPA 3TLRA 4DXVA 3DMMC 3SGZA 3WJLC 3ATYA 3CPRA 1DBMH 4C4KO 2CKRA 4PUNA 3VGAC 1UFGA 2YKLL 3H7RA 2E1DA 2Z31B 3FO9A 1SZEA 2XPYA 2NQJA 4F92B 3QRGL 3APCA 1B5TA 6A3HA 3VGHA 4KPHL 1L9QA 3E6FB 1TV7A 4I18A 4K71B 2DMGA 3Q3GA 4OAWA 3UJRA 3GBMH 3GNML 1A4KB 3UWQA 2XTJE 1U36A 1LLOA 4KAQH 1J01A 1DVYA 4KK9C 1JVNA 1H15A 2VC6A 4IEFA 1RAMA 2FBOJ 3BKML 3D52A 4PJ7A 4L1SA 3SBQA 5C09A 5IB5B 3EOLA 5FDWA 4FYRA 3RTLA 3VPLA 2Z7YA 3H4GA 2DLTA 4DI8A 2H9GB 2P26A 4DJDC 2DMKA 3QDGD 1KV8A 1OFBA 4J2PA 5CPLA 2BP8B 1JK8B 2A85A 4K3JL 1E2ZA 3HFYA 4KJWC 1RJPA 3WQWA 4YHOH 1T41A 1FG9C 4H7CA 3UQNA 4IK6A 2R1WB 4DNLA 4HPXA 5D7LD 5FUCE 3HOJA 4E6MA 3MCLL 4HJGB 3BSZA 3H2NA 1C93A 4ES8A 3U2SB 2W60A 4KNSA 3C6SB 4FG2A 3QVAA 4PEEA 4O4YL 4GXFA 2AXHA 1LRQA 4UMBA 1FNSL 2ORBH 5C0AB 2EJAA 3K74B 4QOKD 1V7NH 2F61A 4DZ8A 3QDGE 1Z5LA 4GXWA 2Y7FA 4NO2A 4CMMA 3W1LA 5BO1H 2HX9A 1CCWB 1MG3C 3SCTA 4R88A 3ULVC 4HKBB 5FW6A 4FQQA 1OM0A 3PHSA 4XO9A 3KXQA 2V69A 3SOBH 3TEXA 5D7LE 1JFXA 3WN5C 1P84J 4L4PA 4F3FA 2XVKA 2BP3A 2AV7B 4JQVC 4XVJH 1TJGH 4RCAA 3SKOB 5FYKL 3LCXA 4PRWA 3Q1SH 3R7MA 4WI5A 3WBAA 2P8MB 3WD0A 1OD9A 1EZLA 4ACZA 4PSPA 1JXFA 4PB4A 5AKQA 1IEWA 4X6FB 4MG4A 2BXVA 1M04A 4M3JA 4A2GA 3MJYA 4QOKE 1Z0MA 2WIIB 4MA7H 3ZTJH 4DF0A 3VFMB 1VBGA 3MU7A 1FG2B 3KPNB 3WO8A 5E08L 3FFCD 4FOKA 1NCOA 4H88H 1JUFB 3T9PA 3ZT5A 2VABA 5M17A 4PQXA 1E6JH 3MMUA 2NMSA 3O7UA 1BG9A 5FGRA 1J9YA 3WLTA 4ZS7L 5ADOH 3JUZA 5AYUL 1UJQA 2PTYA 4GUFA 2ZUWA 4JDZB 3V6OE 4UDUA 2BFVL 3MNZA 5JHDA 3OQRA 2EF9A 2PU1A 1J88A 4KZ0A 4QYOB 1RFDH 2WYSA 3AU2A 3W26A 3TYGL 4A2MA 5F7MC 1RQEA 1N5YL 4N2MA 3MV9D 2ADFH 3PANA 3S8HA 3WSQH 3FFCE 1QW8A 1GVIA 1XGQB 1F76A 3UMTA 3GSMA 4M5ZL 5JDSB 3W25A 1RZFL 2PSNA 2WLHA 2ZC8A 1R3IL 1UWUA 2BOFX 1J9TA 1HDMA 3Q8CA 4O11A 1JN6A 1GSKA 2FPYA 2FATL 1XH1A 2J7CA 1IWAA 2WANA 3RO6A 4GACA 2EIKB 4O2CB 5E8DH 3DJ9A 8A3HA 4O02H 5B3SB 3GIVB 4P2CG 5J4MA 2VEPA 2OMUA 3K2MC 2IV9A 1A7PH 3OKDB 3F5JA 3N3TA 4JAWA 5JHLH 2QDWA 4Z7WA 4WOQA 5D9SB 2WMGA 1VIWA 4UI2A 1US0A 3MV9E 3FXYA 1ZHBB 2VQ4A 3DESA 1BXXA 1SMOA 4WW1B 1MFUA 1NQ6A 3EKLA 1CECA 3S2JA 1F6AB 5JIWA 2DD8L 5C6WH 3W7LA 4NPYA 1ZLVK 3PP4L 1H8LA 1I1AA 3B1TA 3O9WD 4I3RL 3LY6A 2YCLB 1FYTE 1H51A 2PE4A 4DN4H 4PJ5B 5HAOA 1O75A 3RVVC 4Z1DA 4L56A 3CGTA 3C60B 3NG5A 1CNVA 4FJYA 1NCTA 3D07A 2XN9D 3KPSB 3BIAX 5IROA 4FOUA 5JPNB 4GSRA 3P0VH 3FU7A 2L5HA 4XKYB 1BZEA 2WZAA 2AEQH 2L7QA 3PDOA 5D2WA 1MPAH 3CQFA 3GDLA 4BA8A 1QFWH 1K6QH 4LL1A 2PUQT 3D09A 2FTPA 2GK1A 1EO8H 1JRBA 1OF8A 1Z9PA 1HSBA 3KDNA 2A1WH 3SDCC 4I77L 4FXGA 1BXNA 4WY7H 5C0RL 3NRQA 1RZGB 4JJ5B 3WMCA 2FGLA 3C5SA 5ESQA 3MJ9A 1D5IL 1RURH 3ARFA 2OZ4A 2IH9A 3V7PA 4CSTA 4FGMA 3U25A 4CBPA 1IAIM 2XN9E 2R69A 3I3EA 5IMMA 4XO8A 1XMWA 4PTUB 3UDWA 2EE0A 4ZO9A 3EDEA 1S7TA 1KXQE 4NU7A 1GY1A 2YMXH 3FAXA 4KTEH 3WELA 2UWEA 4LYRA 3RWHB 3OXRA 4QHRA 4NP4H 4GRWB 3CFKA 4OIFA 4HS8H 4WXZA 5DFAA 1FTXA 4PLKD 4IU2A 3CNKA 5BU9A 2DI8A 5AZ0A 3HI1B 2HNEA 4U1LA 4LP8A 2BW5A 4G7FA 4MA1C 3O6LH 1JXJA 5EWIH 4EWJA 3PJSA 2ADYA 4TU1A 2JIEA 1DQDL 3FU6A 2PODA 3PAVA 2FYYA 1ISZA 3U6RA 1TQJA 3PSWA 2F7QA 1KV3A 3FCSA 4V1DD 1BD2D 5FHBH 4HXAH 4GQGA 1H9DA 4A4AA 1EGJA 5E8PA 2GFTA 1FORH 2F8VA 2NY1C 2VN7A 3QQ1A 4WU7B 5DT5A 4L4TA 2Z27A 3TIDB 2ZZ7A 4OZIE 4F1SA 1MUJB 2PWUA 3O0RH 4I7UA 1RMFL 1YIXA 3BP4B 3OWEA 3W2DL 5GS3A 4OLZL 1ZV5A 3EYQD 3QGVA 4QXIA 5D7JC 4TS6A 2JB5L 2CA3A 4H1LA 4FQXB 5FM5O 5F9OL 4HA0A 4HHMA 1U2YA 1BYCA 4Q7NA 2QQLH 2ZJSH 4K3HA 4I9JA 1M1XA 4V1YA 3TYBA 2YXVA 4GZ7A 4KI5C 3UADA 4EKJA 5TGBB 2PMZA 4IJCA 3GYCA 4XP6H 3V5DB 4V1DE 4F9DA 1B3YA 2VVSA 4O15A 4JX4A 4LP5A 3IJEA 2E3VA 3QUZB 5C9WA 1LE9B 3BX7C 4UZUA 4KKAC 5DCCA 5KVFL 3FCBA 2E6PA 1TTPA 2ICES 2RALA 5DDHB 3B5HA 1RUMH 1W1A1 2HRPH 2FJHB 2IBGA 1R24B 4PJFA 4B5ZA 3REVB 4H4NA 5CPMA 3MBXH 4MAYB 4G7VH 4KX8A 5CPSA 4FQ1H 3N4FA 4MGXA 1VF8A 4BINA 2IKIA 5K39B 4OLYL 2JNZA 1NDMA 1QK0A 4GFTB 4FQPA 4HWEL 1NEUA 4U1HA 3HS9A 3H7UA 2OMYB 4IQEA 2BSED 3BVWA 5F2MA 5B1JC 3MUUA 1AYRA 3CO8A 3GG1A 3LTYA 3ULUC 2XG9A 2IBBA 3GKWL 4DGVH 1OK8A 4OM0L 3NQBA 4U3SA 2O4EA 2XN1A 3GQFA 4ZD3H 4KRPD 4JREB 3QI9A 4RISH 5CU9A 3N2OA 1M6UA 5D8WA 3N42B 2VQ1B 3VD1A 1ZHNB 2SEBB 1L0PA 4UFKA 2JCCA 4AISA 3DKHA 3V5OA 3LRGA 1AJ7H 1FFPB 1C9WA 4QNWA 3WAJA 3KLAB 2YZRA 2WO3B 3W7GA 3P4OA 4LSRL 1RJRA 3PJTA 2OTWA 3ARDD 4XV0A 3G6JE 3LRMA 2FSEA 2CG9X 3NJ3A 5FEBA 1GTNA 2BBFA 4PGZA 2BW4A 5F88A 3C2OA 4OZGA 1O6TA 4DJED 1RBOB 3OKEB 2F54A 9XIMA 3ARXA 1WC7B 4ADJA 2PC8A 1UENA 3VA6A 1GTFA 2FD6L 3WTSA 4HUUB 3BESR 3TV3L 1YEFH 4PMFA 4ZO6A 2H2SC 1AXTL 1JNNH 4POYA 5I30H 3HBGA 2XIBA 2GJPA 3ABOA 4XNQA 3X3FH 4X4XA 3C5ZB 2I56A 1KLGB 2Z1KA 12E8L 1XWVA 2J6WA 3VW3H 2P46B 1SW3A 1HL5A 2XU9A 1GONA 5EU6B 1GIGH 1BSLA 2QPXA 4LAZA 1LO5B 1ZOXA 2PLMA 2RGSA 4A7VA 4ZFGL 2J8OA 2B4CH 4B7LA 4AYEC 4JTRA 1R0AL 3D3VA 1QSVA 2VH5L 2OWCA 1I4NA 4KUCF 3IMRA 4ANKA 3MHFA 4MXWL 1CLYL 1E4HA 1DVZA 3BH4A 2Y07H 4JFSA 5F0MB 4WWID 5F8RC 1OGAB 1G84A 2NWRA 1ZNNA 2H6OA 1R3WA 3QEUA 1QBAA 3N06B 1KBGL 1RZ7H 2J88L 2B0SL 2FWOB 3QA3B 1J0ZA 1JNLL 1GJIA 2P43B 4NWTH 3K46A 4PJGE 3F5LA 1CLXA 1CYWA 3DIDA 2E4FA 1FFOA 3KOXA 2E9GA 4LE8A 4RGND 2FLRT 4B97A 1UZ8A 2X7WA 5CC6A 1CXFA 5HHQB 4JDEA 4QCIA 4CD8A 1LHZA 3JTSA 3BUTA 4Z2LA 4TQIA 4NKIL 1UYWL 4YHNA 4OJDH 5FYLD 5HGAA 1S9YB 2DJXA 4LNCA 1GGBL 2MNRA 3HRZC 5IFJB 1LO0H 5HHME 1VFUA 4MDJA 3O6AA 5K9KA 2INZA 4LPTA 3W86A 4JHAL 2PYFB 4FE9A 1IQWL 3TWAA 1E4WH 5LXXA 5L2JB 3OJDA 1QLFB 2NT0A 3W4RA 3BWSA 1C5BH 4X6DA 2K7QA 1FNAA 4UB0L 1S7QA 3WS6C 3UJIL 4AK1A 2J8UF 3DX8B 3VSUA 2WD0A 4RGNE 5C2XA 1ZCOA 1EEZB 1F00I 3IGSA 5KYNA 1XFCA 1NQKA 1T1WA 1Y07A 3N25A 3L17A 4DGIL 2AK4D 3PF2A 4KHXH 5FYLE 3QWNA 5DO2D 2VWEE 4G6AD 4IBYA 1F6FB 5KSUB 5BOOA 3LU2A 3LS4L 3QG6A 4I0PA 1GG0A 2CCLA 1HE7A 1VACA 1P5VB 2HFGL 1P7KB 2XZQL 4MD5B 4MZ1A 4KWUA 4JTUA 3DETC 3WE1A 4DBDA 3FB5A 2WUBH 1NCWL 2WZ6A 3LCLA 3GK0A 2AJSH 3CQHA 5I6PA 5H8MA 3SEPA 3BUQA 5LKYA 3RVXD 4LSSH 1FWNA 5FF7A 3D2UA 5DHVA 1A6TB 3BPNB 3GYEA 1SEQL 4OI9A 4F9LC 3JBG7 2VUOA 1UXSB 4M19A 2VCAA 2AK4E 4C1NB 3H4WA 4IGBA 1UPMB 5KSBA 1LM8V 5HHOD 2PP7A 3QDJD 4MJZA 1OGGA 5DMIH 5ANME 4HYWA 2HLAB 3VI3F 5ICZA 1YJDC 3TWCH 5DD5H 1UD4A 1OZUA 1S8DA 4NO5A 1JPFB 1IIKA 1HEJC 3B5GA 4G59C 1DVTA 4XBGB 2KQNA 1R85A 4B3KA 1JZ4A 4L9LC 5I1KH 3MLVL 3WX7A 5DK2A 1QWHA 4XP4L 4RDVA 3I75A 1U8JA 5E56A 4ORGB 3LM7A 3T0BA 1H6UA 5E4AA 4F66A 4PVLA 1JGIA 1QPOA 3PNWA 5FUOL 4RWYL 1GYWA 3N2BA 1TUXA 1OAXH 3G1VA 5FW8A 1D2KA 3NCYP 3OVUB 1PSKL 4OHQA 4L29B 4CL7A 3RUGB 5IESH 2WLLB 3OIXA 5IBTH 4CKVX 1O6SB 3BN9D 2VI0A 4KQ4L 4AVIA 2ROYA 4GRWF 1CR9H 1ZT1B 2X4SA 5KWYC 5ABFA 3KLSA 4LVAA 1T83C 1Q94A 2TRHA 3TO4D 4XC1H 5HJBA 2FQIA 1INDH