4GQQA

Human pancreatic alpha-amylase with bound ethyl caffeate
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Order and disorder: differential structural impacts of myricetin and ethyl caffeate on human amylase, an antidiabetic target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 173
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4gqqA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4gqqA01
3BSHA 1GZJA 3CGTA 3VIKA 1E1EA 4HTYA 2D0FA 3CZ8A 1KWKA 3DECA 4JIEA 1UHVA 2J62A 1JIBA 2V38A 1KCKA 2XYLA 1QPKA 4B9YA 2ZE0A 1PZ2A 3N15A 1UH2A 5M03A 2V3GA 3VUPA 3BSGA 1QOXA 4HU8A 3EMQA 1TVNA 1XCWA 1KBKA 1LL4A 4CU7A 4U33A 2W67A 3W26A 5DEZA 1QHPA 3NIYA 1KR0A 3WY4A 4W93A 3AIWA 4W87A 5ABFA 1FHDA 1G0CA 3RILA 2WHJA 4CD5A 3GTNA 1VEPA 3SUSA 4AD0A 3AS1A 3FAWA 4D6IA 1QI0A 4P7OA 5A8MA 3A47A 1DWIM 1FA2A 2VURA 3WELA 4AZBA 3I3EA 1KQYA 1HP4A 4UQDA 3M07A 3FY1A 4CUCA 3SEPA 4JKMA 3ZJKA 1UH3A 1UG6A 4TTGA 1UQYA 2WMHA 2X1IA 4PMQA 3WDHA 3BUDA 3QGVA 5HXMA 3BUQA 4HZ6A 1QBAA 2VC9A 3VGDA 2X8RA 1C8YA 1TA3B 1WDPA 4MPKA 3UG3A 4AD4A 1AMYA 2DPEA 2WVTA 2IXVA 1B0IA 3WQ8A 1VEOA 1WPCA 3VIGA 1JYVA 1GJWA 1MW1A 1ZJAA 4KRUA 2GSJA 3IAQA 1T0OA 3W0KA 2Y8VA 3LRMA 1CXLA 1V6VA 2EPKX 5A3HA 4AYSA 3K4AA 2WC3A 4C7FA 3ZM8A 2CBJA 1US2A 2Y8KA 4BQ4A 4MDPA 4ZFMA 1MXGA 5I0DA 4NZCA 2OWXA 1JZ5A 1R34A 1IZJA 5A6LA 4LYRA 2O9RA 1DEDA 3KL3A 1XRVA 4NSBA 1EH9A 4OKDA 1QI5A 4KH2A 4PTXA 2D24A 1TQWA 1LWJA 3DC0A 2CIPA 3D4ZA 4BQ5A 1E6NA 4LXFA 1UWQA 4CKQA 4EANA 6CGTA 5A6SA 5JIWA 3EJRA 3ALFA 3WDRA 2E0PA 4UFJA 2ZWZA 1TA3A 4KRTA 2BHYA 2E9LA 2WXDM 1GOQA 2A3CA 1KB3A 3VU2A 1J10A 3W81A 3VNYA 2WLZA 4J3TA 4KGLA 3BMWA 2CERA 1UD6A 1JD9A 3K1DA 4UQAA 4PMXA 4B9ZA 1JGIA 3OBAA 2X0HA 2VR5A 2HISA 1R47A 2QMJA 2YFNA 1C8QA 1V6UA 1O7DC 1EA9C 2ZX6A 1UKTA 1LL6A 3AROA 1JAEA 1NP2A 1B3VA 3MSDA 2JIWA 3VIFA 5JUVA 4TOQA 3VPLA 4TX8A 3WD1A 4OUEA 4GXPA 1W91A 4FNSA 3CO4A 3CMGA 4UCFA 4OGZA 3CMJA 1XD0A 3MS8A 3ARQA 8CGTA 2BVTA 4W84A 4CCCA 4NF7A 3WEZA 3AS3A 4DWSA 2FYVA 1WP6A 1BAGA 1HF6A 1JYNA 3DX4A 3RO8A 2VO5A 4NRRA 2EBNA 2CETA 4FK9A 1UWRA 4E8DA 5I6SA 3MMDA 2XGIA 4AD2A 5D8ZA 2EABA 1XH0A 1OBAA 3G6MA 4AZIA 1E15A 5IHSA 4Z2HA 4LQ1A 5E9AA 2V3EA 3ZIZA 3WDJA 1HJVA 3T2PA 4BQ2A 1TQUA 5GNYA 2VMFA 2Q8XA 3CZEA 3A5VA 2XN0A 4S3KA 1BGAA 3RM9A 2PI6A 2VX4A 3FN9A 2ZXQA 4P8VA 4MTVA 3AHZA 4FLQA 1E4IA 1S46A 1KR1A 2QMKA 3QHOA 1VEMA 2PBGA 3MV11 2DT1A 3K4DA 3WF2A 1D3CA 4IUGA 4QLLA 5DO8A 1JNDA 2EADA 4GI6A 2A3AA 2JEQA 4HMDA 4WSJA 1ZS2A 2D3NA 2IXUA 2VRJA 2DSUA 1GJUA 3MMWA 4NX0A 4V27A 1OGSA 1BTCA 1CXEA 1WDSA 1BYCA 1UD4A 2J7HA 2YDSA 3PZVA 3VKKA 5ABFB 1GOIA 3WKZA 4TVUA 2FHFA 1HJSA 1GNXA 2J47A 4PMRA 3SCWA 2WVSA 1CLXA 5FL0A 4MNLA 4GQRA 3GM8A 1W9XA 1E4LA 2J7CA 4FMVA 3AMCA 1W9PA 1UR1A 1WDRA 1C93A 4MB5A 2G8ZA 3BVWA 2ZUSA 1W1VA 4DM1A 4CN6A 3AXHA 2V5CA 3E1F1 3SUWA 5A69A 2ZOXA 1OM0A 3M7SA 4HMEA 5EMYA 2UWFA 3VMOA 1XCXA 1NOFA 4NZJA 1EHNA 2QLYA 4CU8A 3SIMA 4M82A 1UA3A 2V5DA 3GNRA 4D71A 3F5JA 4ZXOA 3AZRA 2YA2A 3WD2A 4U3AA 4LX4A 2JFEX 4M29A 2XUCA 1CXHA 3F4VA 3VDAA 2XTKA 2OLHA 4TX6A 2UY3A 1X6NA 4N0RA 4Z2GA 3AHVA 4OJYA 1E3ZA 1GQLA 3LRKA 3PZGA 4UFLA 1W3LA 4PUEA 1EQPA 1RP8A 5A1AA 4QCFA 3GH4A 1OT2A 4GQQA 3ZOAA 1JZ7A 2WMJA 4IISA 1HKKA 3EDFA 1V03A 4KGJA 4JKKA 2WNWA 2XM2A 3GBDA 2FGLA 3ZR5A 5I78A 4TTUA 3L4VA 2WKGA 4UFIA 3EDKA 3PZNA 3HZ3A 4FNRA 1EDTA 3WF3A 4PSPA 2WZHA 2WMIB 3BVTA 3D5HA 1XC6A 1XD1A 2ZUNA 4YHGA 4M56A 1HJWA 2X2YA 1UWTA 5HPOA 3AIBA 4WJXA 4Y7EA 2CESA 4HMCA 4Q22A 2XWDA 4UNIA 4M1RA 4BQ3A 1ECEA 2DEPA 1GQKA 5A6MA 4E8CA 5AY7A 3UCQA 5HPCA 1HX0A 1MQPA 2X09A 5D4YA 4DUXA 2O9OA 5F7UA 1UKSA 3G6LA 5CG0A 3D50A 4UQEA 1KFWA 2FHBA 2XIBA 4D72A 1MQQA 1HXKA 1JDDA 2VRQA 1C7SA 1E6RA 4AC1X 5ECUA 1OGGA 4UQBA 1PJ9A 1H09A 3AIVA 1E5JA 5BYWA 4DO4A 4R5EA 3KZSA 1Q4NX 3VGGA 2BV9A 1US3A 1VJZA 3DX0A 3WF4A 4F9JA 1TMQA 3AJ7A 4BA0A 1TUXA 4HZ8A 3SCVA 2CBIA 3FAXA 2EPMX 3OIHA 3L4XA 2AOSA 2YLAA 1IT0A 1VFUA 4C7GA 3ARWA 5C8BB 3NSNA 3BVUA 3GYCA 4CD4A 1H0GA 5FD0A 1VFOA 2VT0A 4GZIA 4HA4A 5BWFA 3AI0A 3ZT5A 2O92A 2J8GA 3BC9A 5D9OA 3N12A 1GQJA 3SCTA 1M01A 1V6WA 3WQVA 4J7RA 2GUYA 3VGBA 5A2BA 2Y4SA 1QNRA 3HJEA 4ACYA 2ZUUA 1G01A 1UKQA 2VCBA 2BY2A 3PZIA 3MO4A 5D9NA 3PTMA 2WSPA 1GOMA 3LXCA 3BUIA 3QR3A 1E6SM 4UFMA 3A24A 2F7QA 4MB4A 1OT1A 3VILA 1PAMA 1HP5A 2ZUTA 2G4FA 3WFZA 5A2AA 4D6DA 3PZQA 4P7QA 1HJQA 4D1JA 4AEEA 2G3JA 2ALWA 2C8NA 2DQXA 2VZUA 4TVDA 1LG2A 2DIEA 4URIA 2Z1KA 2ZUMA 4L4PA 4W7VA 2VX5A 2W62A 2BHZA 1E6XM 1WZAA 4J3XA 3WEMA 2GJXB 3TONA 1XHGA 2OYLA 3AIQA 2YL9A 1EOMA 4QCEA 1MFUA 1OGBA 4J3SA 1ODZA 4P8XA 3AS0A 1QX1A 4P8WA 1H2JA 1J0YA 3CUGA 4AW7A 1B90A 5A2CA 2VL4A 3HU7A 3VDBA 4JZ5A 1B2YA 4XB3A 3RIKA 1Q6EA 3VIIA 1BVZA 2UY4A 3WIJA 2VX7A 1H11A 3II1A 3UETA 1UR9A 2J4GA 4MDOA 1K9DA 4AIEA 4W8LA 2XSAA 1JZ2A 2J77A 2X0YA 3BAIA 3MUAA 4W85A 1G5AA 2E3ZA 5CPSA 4JFSA 1CNVA 4RE3A 3BLBA 3FHAA 2XFRA 1ISWA 2DT2A 3CUJA 4R27A 3T2OA 2WCSA 3BUBA 1GW1A 4TXEA 3WUEA 3NSXA 3DYOA 1NM9A 3ARSA 5M17A 1K9EA 1TQTA 3SUVA 2DDXA 3I3DA 1CGUA 2G3IA 2BNJA 2MANA 3VD4A 3WUFA 2D22A 3APGA 2F61A 3WEOA 3ZJ7A 1MVYA 4CGTA 1ZBCA 1CGTA 4CVUA 1W1YA 1W2PA 3ARZA 3PN8A 1BG9A 3HG4A 2BVDA 3ZJ6A 3VMNA 5HNNA 1J01A 5BCAA 1UD8A 1UD2A 1E6QM 4BF7A 4CD7A 5BXRA 2C0HA 2D0HA 5ABGA 4AY1A 5D8WA 1B1YA 2GK1B 1LQ0A 1TVPA 1I1XA 4AD5A 3W6LA 4AZCA 3EDDA 3VGHA 4XUYA 5CQ1A 3N18A 4Z2JA 2EXOA 4GINA 3ZQ9A 4YN5A 1M53A 3U7VA 4NRSA 5DF0A 1HKMA 4AZ6A 1EDQA 1ZJBA 5LYRA 2WVVA 5A94A 3A6OA 2RGLA 4Z2LA 4FLSA 3FHQA 3CUIA 1E71M 3AZSA 1B3YA 2VZTA 2ZX7A 2ESCA 3HG3A 1BGGA 4RE2A 3EBVA 4IPNB 4PMNA 3LXBA 5A95A 1VAHA 4X0VA 1PEZA 1JYWA 3W24A 3DHUA 3EDJA 1BG4A 3WH8A 4OIFA 4MADA 1C91A 2OSYA 3WUGA 3L2MA 3WD0A 3AYRA 4GPNA 3MI6A 3ARRA 1IZKA 4J27A 1UR4A 3TTYA 1C92A 1AQHA 1XSJA 4GZEA 1NWTA 4HA3A 3A4AA 1HN1A 1NP0A 2YJQA 2VZOA 2ZXBA 1XGZA 3W25A 2XVGA 1NOWA 1E4NA 5HBFA 4PMUA 3A3HA 2WLYA 4PTWA 2YIHA 4ZE5A 1CTNA 4TUFA 1SR0A 3CUHA 2UY2A 2XFYA 4UR9A 3AFBA 2ZX8A 4E4PA 1G94A 3VNZA 2OWCA 3NCOA 1CWYA 1L0PA 1B31A 3AISA 1UWUA 3K8MA 2XN2A 1UQZA 2XVNA 4MJ2A 2WW5A 3GXDA 1TCMA 2CCRA 5D9PA 4H41A 3PZMA 5E70A 1NOUA 3CH9A 4AZHA 1R85A 3AXIA 2J8FA 3KEHA 4HPHA 3T2QA 1EXPA 3HMCA 1WAWA 1DWAM 1QHZA 2OYMA 2EQDA 4UQCA 4HP5A 2NT0A 3M6DA 2Z1SA 2F8QA 1JZ4A 3AICA 3WY3A 5I24A 1W1PA 3GZAA 5CGTA 3MSGA 3WQ5A 3S5ZA 2ZWYA 2GDUA 3BCDA 3N1AA 2G3NA 2G41A 1JDCA 5EFDA 1A3HA 1QW8A 3WNPA 3PZUA 4UTFA 1FH8A 1GVIA 2W5FA 3M46A 4D6FA 8A3HA 1HL9A 4N42A 1BF2A 5TD4A 3AIUA 3VD9A 2W61A 1LJYA 2JIEA 5AYIA 1W32A 2J7GA 3ARYA 2WVUA 2CITA 3KLKA 4MJ4A 2A3BA 3UESA 4V28A 4ZXLA 2FH6A 2WZIA 1B3ZA 1E40A 1BPLB 4AZ7A 4F79A 4DO5A 2WHKA 5BXSA 2WC7A 1RP9A 1R7OA 3VIOA 1CIUA 2BHUA 1HKIA 1P6WA 4EK7A 2DT0A 4HOZA 3BMVA 2VQTA 3AYSA 2DH2A 2X2HA 3WMSA 2VCCA 2WANA 7CGTA 5BRQA 2XFFA 4PTMA 4PTVA 4UFKA 4IM4A 1VBUA 3W82A 3WFLA 4H04A 3IJ7A 3CLWA 1J0IA 1HIZA 5E6YA 1CBGA 4ZE4A 4WSKA 3CZNA 4AXNA 3CZGA 1E0XA 4HOWA 1OIMA 4D6EA 4PRWA 5A8OA 5A6BA 4H8VA 5A6KA 2VQUA 2Y24A 1AQ0A 3ZT6A 1U2YA 4FF5A 1AQMA 1CZ1A 3DYMA 4JKLA 3D51A 2V3FA 1EDGA 4UOJA 1JDAA 3MUZ1 3N11A 1V0KA 1KXQA 3WQ6A 3ARXA 3GH5A 4JHOA 3W53A 2GDVA 4ML4A 5DFAA 1V3HA 2VR4A 4B3KA 1V08A 4B16A 3WY2A 3SCSA 1SMDA 3TTQA 1J12A 1VIWA 2BS9A 4H2CA 3BAYA 3CZSA 1BYBA 1JXJA 1HVXA 2F2HA 1V3KA 1EO5A 1E9LA 1R8LA 3KL0A 1HL8A 3CV5A 2YA0A 2CYGA 1R86A 1ISZA 2ZXDA 1GVYA 4A4AA 2WMGA 2WHMA 5D9MA 3WNOA 3OGRA 3QHMA 3D3AA 5M3WA 1CXKA 1O7AA 1V3IA 1JZ3A 3BLKA 1C3FA 3TTSA 2DSWA 2ZUVA 4J3UA 1NH6A 4WKFA 2E40A 2XPKA 3U7BA 4QP0A 2XSBA 3GXIA 1PX8A 1KTCA 1W9VA 5BXTA 2XGBA 3RMEA 4ACZA 3TTOA 4MNMA 1R46A 2CHOA 4M24A 4E2OA 1M04A 1FH7A 3HN3A 2WYSA 1DWFM 1J0ZA 4FLOA 1H49A 1BYAA 1OD0A 2PWFA 1WZMA 3IGUA 1E43A 3ZO9A 2J7EA 7A3HA 3ARUA 2EJ1A 5E1QA 3RM4A 1GORA 1UZ1A 3N04A 4LGXA 4AYGA 3NSMA 3WBAA 1QW9A 5C70A 1SZNA 2WK2A 1XYZA 4D6CA 2D3LA 5C71A 1UZ4A 6TAAA 3AIEA 4WF7A 4CN1A 4W88A 5A6BD 3U5YA 3FW6A 1EOKA 3KWXA 2NW0A 3F5KA 3L4UA 2D20A 4CN4A 2PWHA 4NI3A 1QNQA 3OGVA 1M03A 4EAMA 4A3YA 1VFMA 3VGEA 1W9DM 5CZKA 4CU6A 1MW2A 1ESWA 2E9BA 3BH4A 1JZ6A 3AZTA 5FCZA 2PC8A 3QOKA 2YLLA 2EACA 2WSKA 4ZEPA 3VOCA 4GI9A 3LPFA 2EEXA 4NXKA 4U31A 3NDYA 1KBBA 2GJPA 3MKKA 1WKYA 2BVYA 2EPNA 3AHYA 4JHZA 2FH8A 1E0VA 1E6ZA 2BY1A 1OB0A 3SCOA 1M7XA 2DGAA 1U30A 1WO2A 2DIJA 2DSVA 2YDRA 3FXYA 3OGSA 4U5IA 2YA1A 3A23A 3GXFA 1GPFA 4JFWA 2FE0A 1I1WA 2V3DA 2C7FA 3WQWA 3PHAA 3WMBA 5GPRA 2OSWA 2WCAA 3RPMA 3W6MA 3T09A 3WQ4A 1ZL1A 2F7RA 1E6PA 2YBUA 4HOXA 3TP4A 4CD8A 1PIGA 2A3HA 1A47A 3DYPA 1Q6CA 1IV8A 2VOTA 1W1TA 3PBGA 2D2OA 1F4AA 3H55A 1WNOA 1OIFA 4ACZB 2WCGA 1K9TA 3WD3A 3S2CA 5I3DA 3O2LA 5IDIA 4HZ7A 3CUFA 5I79A 4OBRA 4U3CA 3W29A 1E55A 4AEFA 1QI3A 1SFSA 2E8YA 1ZBWA 3AIRA 1AVAA 2OSXA 2WMFA 3BXWA 4WLCA 1V6YA 1UYQA 3WDQA 3DDFA 4C7DA 3UR7A 3WENA 1HTYA 3ZMRA 4J3WA 1CGVA 1QBBA 2X05A 5KEZA 2XM1A 4M80A 4KWUA 3WBEA 1G9HA 4XV0A 3GXPA 3HG2A 3UR8A 1FH9A 2XJ7A 1DWGM 1BYDA 3IK2A 1RPKA 3MANA 3EJQA 5BXPA 3W4RA 3WL0A 1GONA 3BVVA 1TQSA 1J0JA 1GHSA 2QF8A 4ATWA 1GCYA 1MQRA 1JFHA 1N82A 2WZEA 3UG4A 3IANA 1MW0A 4WKAA 2YL6A 4F66A 4PUDA 4GKLA 2WAGA 3IJ8A 4LYPA 2VZVA 1ODUA 4BS0A 3LXAA 3AQUA 4GIAA 3POHA 3ECQA 3AXXA 3SCQA 3UG5A 1ZBVA 4PMDA 1EO7A 3OLDA 1E73M 4RL3A 2EPLX 2YL5A 4LYQA 4CVWA 4ATDA 2XVPA 1KXHA 1MXDA 3A4XA 2BFGA 3KL5A 1RH9A 3VSVA 4PCSA 3H53A 3WNNA 3NDZA 1MWOA 4NZFA 4WKHA 2PF0A 5LA1A 4DUVA 3SCPA 3W27A 3GH7A 2WPGA 3D4YA 4V2XA 4MB3A 1BFNA 3K46A 3EYPA 1TR1A 1UKOA 2PWDA 5E0FA 3SURA 2XVKA 3LRLA 3ZT7A 1O6IA 1FFQA 5A6JA 2G3MA 4AD3A 3GBEA 2CXGA 1PX4A 2VI0A 1TZ7A 4F8XA 1OCQA 5E09A 1J18A 1PBGA 4LPCA 1EHAA 2XWEA 1JYXA 3MU7A 1V02A 3EMZA 1UR0A 3TV8A 5BROA 1B30A 3MV01 4PCTA 1V6XA 2VNCA 4UFHA 1UD5A 4X0NA 4X9YA 3N17A 4OOZA 4FNTA 3TOPA 2PBOA 1JXKA 3T0BA 3GDBA 4U2YA 2O9TA 1HVQA 1CGXA 3OG2A 3O9NA 4K68A 2J25A 3WNMA 2AMGA 3JUGA 4UQ9A 1HJXA 3QHNA 3L4YA 3OLEA 3I3BA 5BRPA 1UASA 1LLOA 3VIJA 1UWSA 5E6ZA 2ZICA 3OLGA 4L4OA 5CPTA 5IFPA 3K8KA 1LWHA 1NQ6A 4PYSA 4AMXA 4FLRA 1J0KA 3DHPA 3EJSA 2F18A 3WUBA 1JNEA 2YFOA 3WF1A 3WD4A 4UZSA 2WM0A 3CZKA 5IXEA 3VVGA 4M8UA 1CXIA 1B3XA 2EPOA 3J7HA 1ITXA 1JI1A 3CZLA 4JL1A 2GJRA 2F7OA 4JCLA 1JG9A 2ZX5A 1MW3A 1U33A 1H4PA 3VDCA 4D1IA 1HWWA 5FIPA 1FOBA 3T0AA 1ISXA 3W37A 4OZOA 2YDQA 2NT1A 4MAZA 3VSUA 3OZOA 1JL8A 3KLLA 4KMQA 2NSXA 4CCEA 2JE8A 4UZUA 5KZ6A 2WBGA 1LF1A 2XVLA 1DTUA 1KXTA 3L4ZA 1UD3A 4FNQA 4QLJA 1J9YA 2VRKA 2XN1A 3EJTA 2JF7A 4CD6A 1E4MM 3VTRA 4DWSD 1E70M 2BY3A 3WN6A 4TVCA 1JZ8A 1KGXA 5JIPA 3GXTA 3VO0A 1TFVA 3WDIA 1CYGA 1B9ZA 1W9UA 1XYFA 3OZPA 3CHDA 3ZSSA 3LPPA 3NJ3A 1D2KA 1LG1A 4W89A 2XIIA 1BLIA 1YHTA 4H8UA 1TQVA 4P7RA 1C90A 3CC1A 4BZYA 5CSUA 2YOCA 1VBRA 2VX6A 3N9KA 3DX3A 3UEQA 4YPJA 2OWWA 3ZJ8A 1DP0A 1GQIA 3GXMA 4B15A 3ZR6A 3VIMA 1UA7A 1CDGA 1HNYA 4JL2A 3ARVA 2VVNA 2W4XA 3OB8A 4D6HA 1F4HA 3KE0A 4FNPA 1H1NA 5LA2A 2BY0A 2Y2WA 3PZ9A 3WH9A 2VZSA 3AMLA 1JD7A 2D23A 3PTKA 1E5NA 2QPUA 3S6TA 4HPGA 4AD1A 1W3HA 4FNUA 4AIOA 3EJUA 1QNOA 3WMCA 2CKRA 3WL1A 1XSKA 2VTFA 3ARPA 2W92A 1PZ3A 2J79A 1KQZA 2TAAA 2PWGA 2JF6A 3IAPA 2VUYA 1WB0A 2IUZA 5AC5A 4JFUA 4D6JA 5GNZA 2CKSA 2QPSA 2VVSA 2BXYA 3VGFA 3VIPA 4MNJA 2A3EA 3WDPP 4PMYA 1CPUA 4J3VA 1QNPA 4QDMA 3U57A 2D73A 3MUY1 1UH4A 3CIVA 4Z2IA 1H5VA 1FHLA 5HDRA 1EIBA 2D1ZA 1ZBKA 4W8AA 3GXNA 4MAVA 3WF0A 3VSTA 1CGYA 3CHEA 5AYBA 5IHRA 3DX2A 3FNDA 3AOFA 2VJXA 3VDHA 4AMWA 1UUQA 1WZLA 3CHFA 3CZJA 3CHCA 1ZB5A 5EFFA 5A8PA 2O9PA 1E1FA 1ISVA 1V0MA 3VIHA 1UOKA 3L4WA 4AMCA 2YBTA 1VF8A 3WNKA 3PZOA 4W86A 1PIFA 4XX6A 1R87A 4GO8A 1H0IA 4JCMA 3BVXA 2PB1A 4Z2KA 5IFTA 2DH3A 2JEPA 3MUIA 5DT5A 3D52A 5FL1A 3WH6A 5CLTA 2WVVB 5CXPA 1QHOA 1D7FA 1GHRA 1HJUA 1HKJA 1VB9A 4MB1A 4UOQA 1OD8A 2Y5EA 1K9FA 3N13A 2WBKA 3WY1A 4RE4A 4BCEA 4AZCB 2WWCA 5CJ5A 5ABHA 5FKYA 1JF5A 2DSZA 2OW6A 4YHEA 4A3HA 1K6AA 3SUTA 5EB8A 1B3WA 3BAWA 1W3JA 5A6AA 4JFTA 1ZU8A 1R75A 3AS2A 5GQBA 1NWUA 4W5UA 5EBAA 1Y7VA 2J7BA 1XH2A 2J7FA 4J28A 4W8BA 1KGUA 1FFRA 3AHXA 1HT6A 3A4WA 2YL8A 1FP8A 4AISA 2E4TA 1GOWA 1KWGA 3POCA 2VCAA 3BAJA 2ZXAA 1MYRA 3RM8A 2OW7A 4AIUA 1E56A 1L8NA 1BSIA 1W3KA 2WMKA 5CSYA 4ZENA 4PN2A 2AAAA 3SCNA 4CCDA 4PMZA 7TAAA 1CEOA 5M5DA 1WDQA 2E8ZA 2J7DA 1WCGA 1V0NA 4QFUA 3CBWA 3WSUA 1CLVA 1EQCA 5JBDA 3DDGA 4Q7NA 1GUVA 5JBEA 2GVYA 3O6AA 4GO9A 1H3GA 2FGZA 3OA5A 1BVNP 5CLWA 1EGZA 2WWDA 1YQ2A 1XV8A 3F5LA 1R33A 3BGAA 4PMOA 1E3XA 1LL7A 3W38A 3GNOA 1JI2A 1E72M 1NARA 4GZJA 4DO6A 1RD6A 1VENA 1V0LA 4B3LA 3ARTA 3T08A 2ZUWA 2UY5A 1WZKA 3AMGA 5DT7A 3DX1A 4M81A 4EKJA 5DMYA 1WE5A 4WK9A 1KGWA 3THCA 2XG9A 1MFVA 2GFTA 1TG7A 3BAXA 1QWUA 1V3LA 1Z32X 2X2IA 3RJXA 2GJXA 3SUUA 2W63A 4XZWA 3L2LA 3S5YA 4QAWA 2F1AA 3W28A 1CGWA 4HU0A 3UERA 3NYDA 3VM7A 3CPUA 3QOMA 4AWEA 6A3HA 1SYTA 2EAEA 1ITCA 2W91A 3VM5A 3CTTA 1J0HA 3MMUA 2HVMA 3BLPX 1OINA 2CEQA 3PZTA 4AZGA 1GOKA 4H7VA 3HG5A 1UR8A 3AMDA 1QWNA 2CBUA 4UOZA 2WKLA 1TE1A 3L4TA 2WMIA 1SMAA 3VD7A 2CHNA 1XH1A 5I23A 3BCFA 1JAKA 4EE9A 1X1NA 4PBGA 2BXZA 3B9AA 2DT3A 4AZ5A 2OYKA 4WIWA 2F1BA 1C8XA 4OOUA 4D6GA 2ZIDA 4W7WA 3TA9A 2D0GA 3K8LA 3LPGA 1Q6FA 3ALGA 1Q6GA 4P7NA 4H8HA 4DWSB 1W2VA 2RGMA 1NWRA 2B31A 4JFVA 4DWSC 1QVBA 5A8NA 1CECA 2XHYA 4U5KA 1R7AA 5CGMA 1QI4A 2GK1A 5A8QA 2X2JA 4MNKA 1V02E 3VX0A 5LA0A 3NUKA 4GI8A 4U2ZA 3LMYA 1C7TA 4S3JA 2QV4A 4PSRA 1XSIA 1VRXA 3RJYA 1VFFA 2E9MA 1PPIA 1OSEA 1DHKA 3A21A 4DUWA 3VD3A 1PS3A 1UKPA 3B9DA 3OLIA 1JF6A 2F7PA 1KCLA 5GNXA 2CPUA 3VX1A 5I77A 2CNCA 4IPLA 4XZBA 3EDEA 2JALA 4ATLA 1FP9A 1KTBA 1PX3A 1E0WA 2J74A 2WHLA 4PEEA 3BUPA 4JAWA 1UR2A 1ISYA 3ZSTA 1CENA 3WH7A 3B9EA 1KXVA 2FHCA 2J75A 3IJ9A 5JBFA 2FDMA 3B8SA 4P7LA 1VJSA 2PWEA 1J11A 3SCRA 3AMKA 2J78A 4DM2A 2WB5A 2YKKA 3VMPA 1QI2A 1X6LA 5CPQA 4NXSA 1BHGA 3WH5A 5AC4A 1DWJM 3A22A 3WNLA 1UWIA 3THDA 1DWHM 4QLKA 2DSKA 2WC4A 1G1YA 5I2UA 1V3MA 3EJPA 1W9BM 3U5UA 5FOOA 1NWSA 1V3JA 5I5RA 1Q6DA 3H54A 3RCNA 3LPOA 1BQCA 3PTQA 3BAKA 4P8UA 3LX9A 2W66A 3T0DA 9CGTA 1H41A 4OBSA 1OWQA 1GOOA 1CXFA 4PMVA 3GNPA 2EO7A 3EMCA 5ABEA 3RDKA 5E0CA 3AHTA 4HA1A 2IGTA 2QHAA 4F9DA 1JFXA 4W7UA 1HXJA 2CBVA 2ZX9A 1QNSA 3SCUA 3VINA 1I75A 3VD5A 5HOSA 4W5ZA
chains in the Genus database with same CATH superfamily
3BSHA 3UXIA 1N0XL 4DP8X 4WCJA 3VNIA 1KB9J 4P5KB 1E1EA 4FXLA 2O61B 3FN0L 3AAMA 4S1QL 1UHVA 4HH8A 1I8LA 4OM0H 5EZJB 3K72A 1JIBA 1I9IH 1R6WA 2K4AA 3QQ9D 4FTVB 2YR1A 1Y18B 4YDJB 2ROXA 1KCKA 1T1XB 3FCBA 1IGTB 3L6FB 1M6UA 3LZQA 4Y2DC 4KNQA 2C91A 1AI1H 1NOAA 4DOHE 4M43L 5C0JB 4QHNA 5I17B 3BV4A 4LOEA 1IGWA 3Q45A 4PR5B 3QEQA 3TNMA 3QFEA 5AVZB 1UH2A 3SE4C 1JGUL 4M1RA 5C7VA 3PANA 3RHWK 5JIDA 5J5DA 2X4TA 1GGIL 2EF9A 3SDDC 4KTDL 2JGQA 3PWPB 3BSGA 4JVWA 5F21B 2BGNE 1USQA 5FUOL 4GIOA 4GYPA 2DQFB 4WWKC 3JT2A 5GS2D 4URKA 3EMQA 4Y4FC 1A5OC 1YN6A 4NT6A 2ZNWA 2EIDA 1EMTL 4M00A 2FVLA 3P5YA 5C6MA 2DUZA 3LQZB 3S4SG 3LSOA 4U33A 1LD9A 3T44A 4PLNC 3OIXA 3GJFK 4Q6IA 3T05A 4OECA 1KR0A 4WDXA 3WQOA 1TETH 2ZRVA 3BZ5A 4LBEB 4GXVL 3G6DH 3FQYA 4W87A 4BIKA 3OAYK 2NXYC 4PGEB 2CRIA 4B9IA 2R0ZH 3DFSA 4M5SA 3V0DA 1HKLH 1NLBL 5LN8A 5JR1L 3RILA 2JH2A 3ARFC 2YRZA 4GNKB 3HTWA 5ECGA 3ZTNL 2E7DA 3HRZC 2OLDA 5IQNA 4GY7A 2A1YA 4CD5A 4LLVB 1R5VB 1JRHI 4NUQA 3Q8AA 3GTNA 1P6AB 2X4TB 4OCNC 1NC2D 2V5KA 1MUCA 2Z0BA 5FWQA 3M86A 1QNIA 3FAWA 3QPZA 1MQ8A 4KO6A 4QHNB 2P8CA 4G6JH 5GJTH 5SWZE 2O6CA 1AE6H 4LUJA 4P7OA 3MCLH 3AY2A 1DWIM 3TA3D 5IF0B 3T0EB 1FA2A 3WELA 4R4ND 1PMYA 3ECBA 3UL4A 4X2UA 1JJKA 4UQDA 5HVWA 4AXWB 1Y5VA 3FY1A 4YTTA 4JKMA 1CFVL 4JN1L 3ZJKA 4P5KA 5EIQA 5CBEB 4TTGA 4N68A 4ASTA 3AREB 1N5AB 2E5DA 2X1IA 4PMQA 4TPRH 5T9CE 2PDLA 3BUDA 4OIIL 5FLVA 1QMUA 3VXUE 3BUQA 5G5DB 2FX8H 4HZ6A 5C86A 4PUMA 1QBAA 4MAYA 4MMXB 1EANA 4G9DA 3GR7A 3L13A 2FBOJ 1ADSA 1Q65A 3EWBX 1OW0C 4TUKH 1C8YA 1TA3B 4FKKA 1Y65A 4NLHA 3D06A 4XO6A 4AD4A 1ORSA 5BV7H 3F5WA 3T1FB 1T83A 1RIHH 4GAGH 1AMYA 3HTLX 4MY8A 5DD0H 2FB2A 1SBSH 4Z7OE 1UM6L 4M7LL 1RLWA 4NZDA 2C9QA 4PJHE 1JEZA 1LWIA 2PWVA 2VLLA 2BNQE 3WQ8A 4R0LB 1WPCA 5F7YC 2C9VA 3VIGA 3VFVB 1SFJA 2NXYB 3QM3A 5SX5H 3TCLB 1MI3A 3GC3A 1ZJAA 4KRUA 3UWZA 2GSJA 4BFEA 4WGVB 4NQSA 2A7PA 3HRZB 2YPVA 4L0PB 3RKDD 1ECQA 4QXTB 1CXLA 1NCWL 2BVOA 3IKCA 3E8UH 1AHWC 4IBZA 3S1XA 3V3WA 1CB4A 2I7SA 3ROLA 1FHVA 2A6LA 4S3EA 1EFXA 2YBRB 2FJGB 1ZHKA 5J89A 3ONBA 4KIEA 4TUJA 4C7FA 3EYUL 5D1ZC 3GMMB 3RGVD 5E4OA 4Z5RB 1US2A 3E02A 5FF3A 4MDPA 4LAUA 1TRIA 5A5WA 3FO2A 1OM3H 1XZ0A 1IARB 2DYSB 3V9FA 1FLTX 1JV2B 3T3MF 2PODA 4JHMA 4YTRA 1DANT 7TIMA 4U1SB 1JZ5A 4HWZB 4XNZC 3GMRB 1I9RL 1R34A 1XT5A 1IZJA 2P49B 1MCOL 3IVKB 2B3IA 5F89B 4EPDC 4KK6C 1KCUH 1L9SA 1TOXA 3LKSB 5KWYC 2ODIA 1XX1A 2O9RA 2Y07L 1SUHA 2EXWD 1J6OA 4N2AA 1OLLA 5DX7A 1UURA 3ZKMC 1QI5A 2ZADA 2RR3A 4P9HL 4KH2A 1N7KA 3V5OA 1CF8H 5C9XA 5SWZB 2OJEA 4TLSA 2XISA 4PTXA 3SZ8A 4WEBL 3TA4D 3U6RB 3JQOB 3B2PA 1BA9A 2HEJA 4G9PA 1P7TA 4LXFA 5EU6A 4GX8A 2IPTL 2NY1C 4EANA 1AIZA 2NYKA 3EJRA 2DMHA 2EDRA 5GHWH 3ALFA 4KHTH 4JTUA 3WZ0E 3E2HB 4GKTA 2ZWZA 3U2OA 1MN4A 1PY4A 2D7NA 3QRLA 3QEQD 4WAFA 1TMLA 1NKRA 4DQOL 2YD2A 3ITGA 4R0LC 1AFSA 1SY6L 4U1IA 1FFOA 4BI6A 3P40A 4N0YL 5D93C 4W9EC 4L5FL 4QKXB 3AZUA 2YUWA 4QEGA 2OTDA 1MZYA 2APSA 2V2HA 4GFIA 3HB3B 3W81A 1HZKA 3AU1B 3KJ4C 5EUKB 3WMLA 4U0RB 3CU2A 4J3TA 1FVDB 5CBBA 1IGIL 4Y5VC 1HO1A 2ZZ1A 3SN1A 1JD9A 3PPSA 4X9IA 2NXYD 2EDNA 4UQAA 5IOPA 3V6OA 3O2DA 4YQXH 4B9ZA 4Z8FH 4KWVA 2AHIA 2O5NA 2VLRE 2VR5A 3EYFA 4P2YA 3D69A 4POZC 2FNBA 5BXFA 3EWYA 3S9IA 4AIXA 2YFNA 5L4JA 3CH1A 1FO0A 1I45A 1V6UA 2CLKA 1UKTA 1Y1UA 2H1XA 4FYSA 3GPSA 4E38A 3MP3A 5JR1H 4ZGYA 1S7XB 2AW2A 2G5RA 4PP2B 3X14B 4R7OA 4AHQA 1PO9A 1OALA 1X98A 1YEYA 5EA0L 4YHYB 2R6OA 1TF4A 2ZOTA 1FPTL 3RGTA 5JUVA 4RDQF 1HNFA 3IGAA 3MA9H 2E5CA 3Q58A 3H7LA 1CDIA 2YLHA 3GNXA 1G1KA 1ZHLB 3VFTB 4YCOA 5DHEA 3LZ3A 5ESVB 3F05A 2R1PA 2ORBL 3WD1A 4R7VA 4ZTPH 2D7PA 3CMGA 1YMYA 1RLBA 1C12A 1QBMH 4ODUB 4Z7VE 3RZCA 1FKWA 2XV6B 3CMJA 1IBDA 2NY1B 3DMMC 3OAWA 5DS2A 4MY1A 1EEZB 2REQA 4G80A 1FNGA 3ARGA 4PJBF 5EIIA 3MHGA 5D32A 3J27A 4W84A 3QQ9C 1DQLH 3EKZA 2E6JA 4Y2DB 3UP1A 4CCCA 3U0HA 2ISWA 4DZ5A 1RJRA 1Y0EA 1JGVH 3BKCL 4DJFC 5EZIH 4N02A 2FLMA 3OTRA 4Z42C 3FQ4A 1Q7ZA 3TSDA 1JYNA 1HF6A 3SPGA 3EX1A 2VO5A 4EF8A 3E3QC 4MJ6B 1I2RA 3GMRA 4AGQA 2HMID 1K7EA 3DV4A 4OUOA 4GP8B 1UWRA 3HFFA 2N3JA 3RURA 4XBSA 3TW7A 4Z5RA 3FSVA 3O0RH 3KVDD 4XMUA 3VFSA 4B60A 4LPWA 2G9HB 4UU9A 2LU7A 1SR9A 4LKCA 5FF6A 1TJIH 4F8OA 2AGTA 4IP4A 2J6XA 1E15A 4J3OF 5EWIH 3DGRA 3FX4A 2OQHA 3MTWA 1H9VA 4KPHL 1BXNA 2AJSL 1PY0A 3LSCA 3ABOA 1NGXA 3G5ZA 4HC1A 1P84J 4RQQB 3A4JA 2V5RA 2MCMA 3TASA 3VFVA 4WTQA 2PA6A 4Q32A 3INPA 3IIPA 1TQUA 2OQLA 4B3ZA 3NJKA 3PQYB 1SOKA 2LU3A 2Q8XA 1FGNH 1A0DA 1X9QA 3A5VA 5DZOA 1EX5A 2V17H 4D9QE 5HGGS 2DY3A 3SKUD 1JGEB 5D7SL 4AM0Q 4M7KH 4Z3TA 5I9QC 2FPYA 3TYZA 3WD4A 4WV1C 3NPZB 3TM6A 3Q01A 2ZXQA 3CU1A 1H7WA 4HK3N 1OAUL 2DQJL 5JYLA 4MMXA 4P8VA 1KLYA 2EINB 2QSTA 4RDYA 4XISA 4F3HA 3H2PA 5JXEA 1C5DB 4MTVA 5AB2A 3KBSA 4WY0A 5E5CA 1NGXB 3G5ZB 4RQQA 4HETA 5JPMA 1ZWIB 2R1YB 2BJMH 2YDAA 1VEMA 3MV11 2ZOLB 4Y9OA 3NYKA 1EHKB 2DT1A 3HQNA 4LYKA 3A6BL 3MQIA 1NSJA 4QLLA 4LKCB 5DO8A 3EYQC 5FF6B 4A2MA 3UCDA 5IWLA 4Y9NA 4LHUB 5MHSE 4GX9A 2EADA 1MLCA 4ZUTB 1HE7A 1E65A 3L1OH 2GW5A 5LGYA 4BY3A 3HAEB 1TTUA 5EU6D 5BW6A 2IXUA 2J4WL 4H88L 3H12A 4Z3JA 2VRJA 1QBLH 1MNUL 3DV4B 4EXPX 5CZSA 2GBTA 4LGPB 4L3CB 1OAZL 2R0LH 4MDJB 3NQGA 3QY8A 1EEYA 3O3EB 3MMWA 1XCTA 3DRQB 2M26A 3G9VA 4XN9A 1NMBL 1WDSA 4M6QA 3TH3T 5M95B 1EAQA 2XWZA 3W2DL 1BYCA 5KVMC 4MZIA 4YXHH 2J7HA 3PZVA 5FSDC 3S9YA 3VNDA 4NZUL 2Q87A 4RXGA 5I8EA 1NFDA 3LCIA 4TVUA 4X4KA 4YSPA 3HKZA 4G80B 1M71A 1FXQA 3U0WL 4ALDA 1FNHA 3CASA 2NX9A 2VDPL 3ZDYB 4BGDA 4QE1A 1CZ8H 3B9KC 4EI5A 1FWTA 4GQRA 5JHLL 3ZE2F 3ANYA 2BVEA 1LO4L 1W9XA 4MA1C 5HI3C 3TEUA 1J5SA 2XIDA 1AZZC 3L3KA 2GY7B 3H42L 3AMCA 3FULA 3LQLA 1K72A 2EDWA 3F83A 3S97C 1UR1A 2G50A 4JO2H 4QRPB 2ABAA 4MWAC 3W9EA 1QZNA 4IGBD 2F54A 4GAFB 4MKSA 2X4SB 3H9YA 3RL1A 2EVIA 2ESVE 2G8ZA 4QT5B 1KTRL 3ZGIA 1P48A 2NY3D 1MY5A 2P5ED 3MLRH 4X5WA 4LOVA 1S7XA 5FHBH 1W1VA 3GBML 4PR5A 3TNMB 2H3NB 2JK5B 3ET9F 1ICPA 4I9MA 1UM5H 1R2RA 3VG9C 2X10A 2V5CA 1Q7MA 3SGEH 1QSEB 3BPLC 1FZMB 1Y18A 4X4YA 5I1LA 1U0QA 4JO4L 5GXBB 3I74A 5KN5B 5EMYA 1H63A 4LOCA 2V33A 4CKVX 1XCXA 3GSOB 4YWGL 2Y69B 3TV3L 4DESA 3U2SA 2OR9H 5AOJA 1XGQA 4NRZB 3EXTA 1WS8A 4GRWF 4YHZL 3QCUH 4IOIA 2HWZL 3TQKA 4HPOH 3CN3A 3GK8L 4U6HB 3G1DA 5KSVA 3NOEA 1VYSX 4HK0A 1E5BA 4M82A 3GDKA 2R1XA 2PCPB 3JS3A 1VD6A 3NFNB 3ULSB 2E7BA 5E00A 5BMFH 2JFEX 3P93A 2WO3B 4F7MA 2NY7H 5EU6B 2MCAA 4HAGA 1NIBA 5IMMB 3KJ4B 2JJSA 2ZKXA 3TT3H 5I1GH 1GG1A 3GRBA 1IBGH 4DF9A 1HINL 1I4FA 1TFPA 3OM3B 1BW8A 4PJAB 4Z2GA 1FDJA 5AHFA 3ME0A 1DSFH 3Q5TA 3PZGA 4FQXC 3SPVB 2NUTA 4UFLA 1YPZB 3V7MA 3TNOA 2ZCGA 2YCLA 3F2CA 1NCDH 4QCFA 4YX2L 3TJEL 2GK2A 3KYMA 5E8DH 2H5UA 4JFXB 4I9TA 4EI5D 4LCYB 1PZ1A 3CDZB 2XV2A 3RWCA 2AK4D 3R4RA 3SB0A 3B6SA 4A2SA 2WMJA 1OJXA 4A3RA 3EDFA 4PGJA 1ZLWH 4JKKA 3NPSB 2IBGA 2XV3A 4KVCL 4BFJA 1CI5A 1KNWA 3MJMA 5FJIA 4O9HL 3ZHDA 5CZVH 3MJ9A 3VKAA 5F1NB 5KYYB 3VC5A 1HZHL 3T55A 4NHUA 2PCXA 4BK5C 2QHLA 1DQQA 2E6AA 2FB3A 4UFIA 4JN1H 4WTZA 2GK0A 3GE7A 3LLFA 3ROLB 2BDNH 5LNVA 3RX3A 3W1PA 5JXED 1UWGH 3O6FB 3UOAB 4MJIA 4D9LL 4OUUA 5EEZA 4NQSB 3D5HA 1YMMD 1XC6A 2IOOA 5IVXA 4TL4A 5IB1B 1OP3H 4D9LH 1H7NA 5HPOA 1HJWA 1PCWA 3VNMA 1TEYA 5IDZA 2I57A 4Y7EA 5TQ2L 2Z1XA 4JPQA 5JPNC 2XG5A 4S3AA 1SXAA 5HJ3B 1LDCA 4KT2A 3UQNA 5D1XC 1IQWH 1LDPH 5TQ2H 1K1DA 2DJ4A 5EIIG 1KM2A 5HK4A 1M05A 1ECEA 1R0AL 3PG2A 8FABB 2C14A 5AY7A 1WFOA 5D7HA 3SGKA 1EP2A 1AE6L 4XD4A 5D38A 1MG3C 5HPCA 1HX0A 1HTIA 5F6HI 5KANI 1DL7L 4TQTA 2PYEB 2D9CA 5G5DA 1BWKA 4DUXA 4BHYA 2BIQA 3W1RA 3P9MB 2G96A 5DURB 1JHLH 5F7UA 4JGDA 1BOGB 3TN5A 1EZUA 2J56A 1X5IA 3MRKA 4WO4B 3PPHA 5D4HA 1M1BA 2CO7A 2XIBA 4R5TA 1MCWM 5KG9B 4DY1A 2JELL 3MVTA 4Y16B 2Y9RT 1JDDA 4AC1X 1IBGL 2MH4A 3QPEA 1K4GA 2NOYA 1TELA 4G9FE 3H1ZA 4ETYA 4PBXA 3DVFA 4AC4A 4QG8A 3WQDA 4RA0C 2G30A 2EC9T 4NAJA 4C83B 1RULL 2WQUA 4KI5C 5DLCA 1YXCA 1DEEA 5CCKL 4Q0XH 1P0DA 3TE9A 3VXNB 4HUWB 2B81A 2ZVRA 3EYUH 4W1TA 4CNSA 4L9LB 1PG7H 4XZNX 3F58L 3WF4A 1TZGL 3DX0A 4XGZB 5DO2D 4N2BA 1TX2A 3PWPD 3PUGA 4F2FA 4BA0A 5K9KA 1ZTMA 3VB8A 1TUXA 2OZ4L 2Z8WC 4QY8B 3S4SA 2Y62A 4MASA 4HZ8A 4HSHA 2Z24A 3SCVA 4K94C 1FG2B 1A9BA 4MWFB 3TT1L 4I0CC 1L6FA 5C3TA 3QEZA 5E4AA 3CV6A 3WIHL 4NJAL 1S7SA 5C54A 5C9JA 2WTPA 3D2TA 4HSQA 5KJ4A 4HUXA 5FF0A 3DOSA 3HQPA 1VFUA 4AEHL 5IG7A 1U95A 3AUJA 1LD9B 3LSOB 4BGLA 3TROA 4JLRB 3V0GA 3DKLA 4H5SB 2R23A 5DYOA 3BVUA 1TJ1A 4XO8A 1WAUA 2DPKA 3BPCA 2VT0A 2OAAA 3TF4A 4WUUE 3FB6B 4ODXA 1NIAA 3BSZH 5HGBB 5T1LA 2AL2B 3OO2A 3QH3B 4Z0XB 4NQCA 5IT2L 3FOLA 3FDKA 4P05A 3BC9A 5H4ZA 1ZLSL 3LGDA 3CQPA 2LTQC 2YWZA 3ES7A 4UMGA 4M6AA 5G2NA 4ZG1A 5KVEL 1A9EA 3KXFD 2H1PH 3TN6A 3MKVA 1JPGB 2YRBA 3BP7A 2Y4SA 2ZCZA 4M8QA 1SM3H 5F72S 5C0JA 1DQUA 4ACYA 4NZTL 2V8MA 3FU7A 3QXWA 1YQVL 4O5LH 4XO9A 2Y72A 3FT3A 5SWZD 5FB8B 3TS8A 3BZ4A 1HKVA 4HC1H 1SVDA 2JJVA 2G75B 4J6IA 1GOMA 5LDSA 4HBQA 1QRNB 4AXWA 3IVTA 5DYFA 3GUWA 4LASH 3BGGA 4LHUD 5KBLA 1SJAA 1LJMA 1G9NH 1B3IA 3N1GC 4UFMA 1IL1A 2XQYK 2F7QA 4FQ2H 3JV0A 3KPSE 4PGDB 4MA1B 3VW3H 1EC9A 4P49A 1BJ1J 3GO1H 4I7VA 1P0BA 4LVNB 5F44A 1Z3NA 2HJFA 4KY1H 1C8VA 1HAWA 4LH8A 4D6DA 4MWAB 4BD4A 2QAFA 3VSQA 3L5LA 4M48L 3O2DH 4I77L 4IIHA 1AD0A 4HK5A 2F7FA 3RWJA 4ZFZA 4DP7X 3EB2A 3N1QC 3US1A 4PJ9C 2G3JA 5JDJA 2ALWA 1C08A 4XXCC 3KD4A 2VOMA 3AXMA 2E74C 4XCNB 1CQYA 1HJBC 5GRXG 1Z5HA 2VZUA 1S5MA 3UCRA 2QDGA 1YEIL 1X7FA 2ZUMA 1QATA 4O18A 3RFZB 2VX5A 4HKBA 5B7EA 3VWJB 4KZDH 3PQYD 2KLSA 5IP4A 2GJXB 3PDOA 4MWAE 1FZOA 2K45A 4MSWA 2H7WA 1J1OH 3WHXA 4QCEA 1OGBA 3ARDC 2ZRUA 4Y0GA 2P5EE 3IDMA 4KTDH 4A38A 1DPMA 2WOYA 4RA3A 2I9LA 4F3FB 1FZKB 3JYCA 4U1KB 3C5SB 2Z8SA 2G4EA 4KO5A 4QRUA 2Z91A 3VXUD 4EO5A 1F76A 1Z44A 2ZKYA 4KNUA 3B8IA 4HN4A 4MZYA 5KYUA 3UYCA 3CUGA 1DQDH 2JCCE 3QG7H 4WI0B 5A2CA 3GDCA 1CFSB 2VL4A 5JW5A 2V7HA 5BQ7A 3R06A 2Q20A 3QA3B 4HPYH 1SYVA 1B2YA 4JZ5A 3PWGA 2UZYB 1WKEA 1MJUL 2OMNA 4LEXH 3PUUA 4X4XA 2Y7QA 3L3OB 4OVVA 4KRPC 3WIJA 4CC1A 1I7UA 5C0CB 4DGYH 2IPJA 4JTAA 1MHPL 1YLVA 3APYA 1YMHB 1KPVB 4PRIE 1ZLVK 3ARED 2EXYC 3SBRA 1U3YA 1CW2A 4NAEA 1TREA 1WKDA 4PRHE 2H8XA 2VDGA 3UAEA 4PJGA 1GYNA 3VCNA 3I9GL 2HVBA 1E50A 2UUDK 3B4YA 1HQRA 4JE0A 4I7UA 1ZZMA 2ESVD 1SFTA 4N0FA 4WO0A 3FFSA 3FBQA 2UXVA 3FNKA 4GFTB 4G5DA 4JD4A 5IBXA 5A7EA 4MQ7A 4UBDD 4WTWA 4RE3A 4MCZB 5KVEH 1NAMH 3BLBA 4C4KT 4YS1A 1LO0H 3SQBA 3RB7A 4L6HA 2CHXA 4DEUA 4AE0A 3W7RA 5CJMA 5DQPA 2CIIA 5EN2B 4UB0H 1YJDL 3HURA 4A8LA 3WUEA 1S9WB 3NSXA 4L4LA 4NP7A 2C3VB 4HQQH 4LS1A 4Q4KA 3TVAA 2IKHA 2DZEA 3ARSA 5C9ZA 4UOW1 3KRUA 3PWUA 2KZWA 1OTSC 3BWZA 5HHME 1ADDA 1RAKA 2PCQA 3Q67A 3HC3H 4XAFA 3Q2WA 2KLRA 1X96A 1JWSA 2DDXA 3MJ7A 4JDBA 5G2IA 4GMSL 1EJ6A 1F4WH 2ZWNA 3AU2A 5EY5A 1C5CL 3F7LA 3IVSA 1E4XL 3L3GA 1MQKL 2QVKA 2AGJH 3OKNA 3SIKA 1N8WA 2E67A 4FP1A 5FXCH 3W85A 4ES4A 3NL3A 1YYAA 1MVYA 4LIQL 2CLRB 3Q8BA 3STFA 1A6ZA 4F8LA 1NKGA 1EEXA 4CGTA 3DGDA 2FTAA 3O3BB 4PTDA 5L4IA 1ZBCA 3STLB 4KK8C 2V0TA 3RJOA 4AFYA 2GYIA 2J27A 4EEEA 1BG9A 5DMGC 1FGVH 2MTPA 4MCMA 4D9PA 4X63A 3VOFA 3L1EA 3KLDA 2BP0B 3N44B 5GRJH 4YSUA 3B8VA 3ORWA 3DUSA 1JCTA 3S42A 1ILSA 5MKGB 1HINH 4GKOA 1YMME 3EOTH 3N2JA 4YWIA 4L5FE 3M6YA 5PTDA 2EUWA 4ZTPL 2VDOH 3LVTA 5HGDA 4LLQB 4CD7A 3N2BA 2WZ6A 3DSFH 3UIYA 4GRWB 4LS2A 3QWOA 3EYVA 3HUJE 4JAMB 3RU8X 2A9NH 4MJHA 3I7RA 2OXNA 4PS4L 4O02L 1B1YA 4GJJA 3WLLA 4XMXA 4LUIA 3T07A 5MENE 3BW9A 2UYLB 3KRZA 2HKFH 4HV8B 3ZQXA 4AD5A 3B4UA 1UA6H 3KCWA 3ASNB 1CI3M 3MLUL 4LC8A 4Y4HC 2QSCH 3MDJA 4BYHA 3C3NA 4JO1L 4G6AD 5H8PA 1DBBL 3UBGA 1DVTA 2XN9B 2DJLA 3GHSA 4E5XA 3W84A 3EPMA 2VLKB 2FX9L 4YXLL 1UQSB 3C2EA 1MRFH 2A6DB 2NWRA 2D4FA 2APWA 1KYFA 4U3XA 1EDQA 3SKMB 5LGJA 4L9LC 5ITFB 1HOCA 4WTXA 5HBBA 3KBFA 2G5WA 4Z1AA 2W0PA 1T7LA 3AZSA 4KAQH 4X99A 5F3HB 1KSRA 2ESCA 4JFDB 4DW2H 5AFDA 5ANHA 4H25A 5CU9A 1BGGA 4WEBH 3IN0A 1IBFA 1T5AA 2B7OA 3IDJA 1YNLL 3LXBA 4IOFC 5BZZA 1TV7A 4YBHA 4HEME 1F6AB 1PEZA 4PJ8C 4H1LG 1NWOA 5DFVC 5CIPB 1NEZG 4BEQA 3X3FH 3EGSA 3GGWB 4LFYA 2HLAB 5IW3A 2HNEA 25C8L 3MNVB 3WH8A 2R83A 3ID7A 4M7SA 3P2TA 3W01A 1I1AB 4XVOA 3C2YA 4QHRA 2OSYA 3MV7A 1ETZA 1UPMB 5LNRA 2WAQA 2JK2A 5FACA 1EGJH 3IMRA 3L7EA 1M2VB 4N0UE 2Z1PA 2ADJB 3UXLA 3OHXB 4DNMA 2YR3A 4IHOB 1QSFE 4J27A 3ZW3A 5HMSA 4ODTL 3VNJA 1XG4A 4GBXA 2QCNA 4GVHA 1T7WA 1XB8A 1TETL 4U6VL 1H15B 1C92A 4PL2A 4N85A 2QQQA 3H3PL 3IDXL 3UTSA 5ALCL 1RY8A 1WBJA 3ZGHA 3MCNA 4P04A 5KSAA 2APBA 4KXBA 1KT2A 2MQCA 3A6BH 3A4AA 3HPLB 1HN1A 3BZEB 3DSFL 5FW6A 3US0A 4URTB 1S3KH 2BWIA 4HNTA 4N2CA 4QRRA 1F74A 5CSZA 4XXWC 3BSMA 3HUJB 1TTGA 2KPWA 2R51A 3O3DA 4MDIB 4UMAA 3MGAA 4PWFA 1KM3A 3TJPA 1ZE3H 3GSNA 2D2GA 3M7SA 3M0IA 3LCYA 2WLYA 2COQA 4F33B 4GHRA 2DYPB 2P8MB 3MXVH 4ONHA 1NCWH 2YIHA 3WO8A 1ZAGA 4RGMC 4TULL 3FJLA 1FDZA 4M3PA 3BUYA 4JY4A 3DBXB 4TUFA 4E4FA 1XTMA 4ELME 2FQEA 2UY2A 1KFAH 1KPUA 4BKLA 3CUHA 3AFBA 3MRIA 3BT2L 2J1ZA 5JH2A 4GG9A 5AZEH 4A7SA 3NCOA 4LDEB 3REVB 2OMYB 3LZPA 5L2KA 1B31A 1N59A 4A7QA 5HATA 4QNEA 5IIEA 1A5BA 3CMFA 1KM5A 1XIDA 1XCQA 5LCVL 5I66A 1V54B 1H1YA 1UWEH 3M5VA 5IW1A 3N43B 3FFCB 5I3KA 4CMHC 4JFYB 5D9PA 4P4KB 3H4FA 1JZIA 1D6EA 2KZKA 5IUCA 2LT9A 3H0TB 4RDQG 4BFRA 5JHLA 1YNPA 4C91A 5ICUA 4XZIA 1AP2B 4XCYA 1RHFA 2DY2A 3ITLA 1WZ1H 4PREB 3KPRE 1E9QB 4HIHA 4DJEA 4L8DB 1NTHA 4RCXA 2CPCA 4OLVH 3CC5A 1Q90A 2FPVA 5BMWA 4JFOB 1R6VA 2OJZL 5MEPA 5TQLA 4KKAC 4KKCD 3T2QA 1YRKA 4HGKC 3MXWH 1RURH 3GZKA 5KSUB 3HMCA 4PM1A 2QV5A 1A53A 2XU2A 3QUKB 4ICNA 4FIQA 2E77A 1QPQA 1RZMA 5AALA 4LVHC 2EDMA 3IFNL 3WK2A 5A2FA 1MFDH 1R3LB 2OYMA 3FQXB 1P1XA 1QHZA 4UQCA 4HP5A 4GFXA 3LG3A 2J7LA 4UDTB 4OI9A 1G9MH 2F8QA 3VOGA 2UY7A 4WDIA 4GOAA 3ILPA 3D2UA 1KCVH 1XG3A 1IAII 3W71A 2ENYA 3IU3A 2A9DA 4RFNC 5CGTA 3DV6B 2CZFA 3WQ5A 1QFWH 3ZTDC 1RCOB 1IBYA 4XNXL 2HE8A 3EA3A 5K9QG 1ZFJA 4HCRL 3QG6A 4S0TD 4HNCA 3TXZA 5FUCE 3I7QA 4P2VA 2XYCA 3D39E 4K4KA 2G3NA 1WCQA 3RWFB 2IQ9H 1MCWW 3V0WH 3HC0B 4DAGH 5CF3A 1AZRA 4P5RA 4KKLD 4Q6YA 3WNPA 1A49A 3KDNA 3OAZH 1FH8A 2WLLA 3PZUA 4JO3H 5E9DB 4B9GA 2V2WA 3LIZA 2BSSB 3KWVA 8A3HA 2ITDB 1U3HB 2Z4GA 3B97A 4KKBC 3OA3A 1L6SA 3BLDA 4NDMA 4J3OG 1U8OB 1PTGA 3D46A 3HBZA 5J13B 5JVLA 3DWTA 2OR7A 4OV4A 2G2NA 3ARFB 5BO0D 1E7VA 3OJ2C 5E2WL 2IPWA 4NO2B 4XCCH 2QTEA 1LJYA 4C6PA 3MBEC 5EEVA 4IBVA 1DVZA 3RWDA 2J7GA 1P5UA 1HE8A 4PMEA 1E42A 1CG9B 4MRBA 2NQZA 2A3BA 4RJEA 1BVKB 1OSZB 1ML0A 2FH6A 2X4QA 4J4PC 5EU7C 5TDOB 1SUXA 3CEPA 1J8HD 5E94B 4M7TA 4AZ7A 3CJJA 1MKFA 4PWEA 4AOFA 3CBKB 3DX8A 1BZOA 1CLYL 4ZX5A 5B7MA 2PPCA 4JQXC 3C9NA 4PB4A 4EK7A 1P6WA 2B08A 3QZWB 1F9CA 1YKWA 2DT0A 2ZF9A 4M6UA 5I3HA 1AS8A 1HHJA 1T5WA 4PRIB 4X6DF 5DRIA 3FN0H 3G9AB 5TF1L 3UT0A 5DD6B 4MA3B 4Y5XC 3MV8A 2V2TB 2NXHA 2ZC8A 3Q8EA 4OLUL 2O4EA 5CEYB 4IQEA 1RU9L 4KDWA 4PTMA 5BOJA 2ZQ0A 4PTVA 4U6XB 4IM4A 4FYTA 5LNUA 4GQBA 4XTIA 4S2CA 4JFZL 4NWUL 1QA9B 3CZFA 3LQAC 3QN3A 2J6EL 4PG2C 3UZQB 4ORZC 4G9FB 4QCIA 3W39B 5J7CC 3CUPB 1T8QA 1ZP4A 5B39G 4PJDE 3CZGA 3MACL 2H2PD 5DD1L 1KXVC 5F0PB 1JWMA 4R26H 2FECI 4PLJD 5HWMA 2P8LA 3DETC 4OZHE 4DZAA 3M1OA 1K3UA 5IT2H 2VM3A 2OA9A 4UTWC 4KMTL 1V5XA 4H8QA 3VFPA 5A6KA 2VQUA 1ZVSB 3WFCH 3EA2A 2BW5A 4S1DD 5BS0A 5IFHH 2QCEA 2Z26A 3G1FA 2C3ZA 2Z28A 4Y19D 4KK5D 3HZVA 3SQOH 1ZKAA 1X7QA 2BX7A 2EAWA 4HF5L 1YO4A 3D51A 4ZTOH 5FDWB 1R19A 4ODVH 1U8NB 4JGNA 3P4NB 3SCMB 1SSGA 5CZXC 4I0PA 1L2UA 4ZB2A 2DB8A 3KPTA 4LEQA 1NC4A 2J6VA 1YHPA 3NEEA 5A3ID 5F88B 3TWYA 1N6UA 4XTDA 4H0LC 1KXQA 4LFHG 3PFMA 4X9SA 3E8UL 3ZQWA 3CXDH 4HX1B 3W53A 2O56A 1W1ZA 2LLLA 2ARJB 2C9RA 2IALA 4ZQKB 1LEIB 2WNQA 3FONB 4ML4A 4WGXA 2VIRB 2FB4L 3LZFH 1K2DB 2DQCL 2VR4A 4WJ5B 4F57L 4B3KA 1YNKL 1WT5A 4OU3A 3E96A 3OF6D 3F58H 3TYAA 4GNJA 1YY9C 1H3PH 1K4CA 1ZT1A 2ATPB 2BMKA 2G4JA 1J12A 2Z0IA 5D03A 4Q0XL 3PWVA 4KI5D 2PGRA 4H2CA 1NKOA 2BH0A 3PGDA 1P9MC 3V5HA 4O2CB 4C5YA 2FFCA 3BAYA 3C60A 3CZSA 3O6LH 5L8JB 3IV3A 4PVNA 3O0FA 2O5ZH 4KTEH 2WY3B 4XVSL 4YHLH 5ETUA 1BYBA 2OTWB 1X9UA 5G4OA 1G9EA 5FX3A 3OZ9H 2X7LA 2BLFA 5DK2A 1AA1B 2FIKA 4O1FA 5D1ZI 2XFXA 1KA9F 1E9LA 1PZ5A 1WV7T 3NZ8B 2Z7KA 2RTTA 3N91A 1RXLA 5IHZA 1HL8A 4F92B 3KUMA 3CFKB 2HKAA 4RMUA 1T8XA 2CYGA 2RGSA 1ISZA 2ZXDA 1NMCC 2CLLA 1IFHH 3LS5H 3CVCA 1NGPL 2CMRL 3JVGC 3PAYA 4I87A 3LA4A 4Y8FA 1UC4A 4DPCX 1L7TH 1LQSR 1EO8H 3NQCA 3CHPA 5ID0B 3LKOB 3NCFB 3W83A 3RVWC 2W88A 5DS8A 2OT0A 3UTPD 1DQTA 7PCYA 5HMEA 3H9SE 4QXIA 2AQ2A 5DJCB 4CLMA 3PAJA 2YW4A 3AQDA 3E8VA 2P5NA 2XPZA 3KPOB 4JQIH 4DEPC 2QHRL 3PU7A 3LCLA 2EO9A 1A6AB 4AHOA 3VXSE 2E9WA 2DSWA 1XBXA 5JXAL 3EOBA 1T4KA 4XAKD 2I5YL 4Q9RL 3CVBA 2OB3A 5I18H 3GK0A 3UJJH 1MF2H 2XPKA 1U8QB 3QCVH 1TCRA 5DEJA 2XSBA 3GXIA 4P2QD 3OG2A 3MMEA 2Z34A 5CJQL 5KTEH 4WEMB 3VWKB 2B5IB 1CLZH 1P1ZA 3GSWB 3FQTA 1J9RA 1FL3A 2BCKA 2DLFH 4MD5A 4APQC 1F05A 2Y7GA 4GIRA 2G0KA 2XGBA 1SOSA 2ZJSL 1HILA 4XX1E 3C52A 3TVMD 4MNMA 1R46A 4BH8B 4OF0A 3WTYA 3VG0L 2BWQA 2EZ0D 1KYAA 1O5RA 3KBWA 1L6XA 4JPIB 5DMIH 3T3PF 4PE8A 1CL7H 4G8IB 5IQMA 3NG3A 1WF5A 2NY6D 3G04B 4Y9AA 1NCAH 1J0ZA 1H49A 3R7QA 4WJG3 5LBSH 1R3JB 4PP1C 3NG5A 1OX4B 1H5BA 4WUUA 2WXIA 4HQQL 2MOVA 3IGUA 1E43A 3MLYH 1G7LA 2D7TL 5H37A 5GSRB 4ODSH 4OZHF 1GORA 4JM2D 4RWYH 3M45A 4LQFH 3ESVF 4QIRA 4N90D 4ANXA 3G22A 3FUJA 1QMLA 3V35A 3NSMA 1Y6KR 1E8XA 1YUHB 1SZNA 2WK2A 2YSTA 3FU3A 2ZJSH 3NIGE 4Y5YA 3M0LA 2WJ7A 3RUGB 1INEH 4JB9H 1TX0A 3KBEA 1CMOA 2HVJA 2JIXB 1RZ8B 2Y22A 4EBQL 5INDB 5LLIC 2CAKA 5IB2B 1OOWA 2AXGB 2OZ0A 4HCRA 1U8LA 1BM3L 1QD0A 2FJHB 4NS0A 2O6PA 2XACC 4P4KD 4RRPA 4XN5A 4WF7A 1MFNA 4UINH 1BJ1H 4M1GH 1U83A 2WOQA 3LIUA 4US6A 5T26A 3VXUB 4C6CA 3LBOA 2J1KA 5HHOE 2EXSA 4EDXB 5A6BD 3FW6A 1B9BA 2WNZA 4LOUD 4O02B 4WU5A 5AAMA 3WYRA 4WWKB 2B7NA 3L23A 3BEWA 4UQ3A 2PWHA 4JQVA 1L9OA 4OM0L 3TN0C 3KPQA 4EAMA 4EIZC 1P5VA 3KS0J 4LOUC 2VYOA 4M7JH 3JBG7 3P77B 4WK0B 3CFTA 5CZKA 1AUSL 1MW2A 1ZV2A 2I85A 3KDPB 3P0YH 4PB0H 1OP3K 3SE6A 3CAFA 4HJ1A 3IMBA 2DWDB 3ULAB 1RBLA 3E0GA 1X4ZA 3QVAA 1TUFA 5FCZA 4H1LA 1W37A 1JZGA 4PBEA 2BSEA 2VR8A 2WSKA 4WW2F 4IIDA 4F80A 3FUEA 2ICWB 3IFOA 4GI9A 2BTMA 4KNSA 5DT1H 4NXKA 2I56A 4N5EC 5D2NA 3DTXB 3MP4A 1GGCH 4MWAD 3TJ4A 1R3KB 3CIAA 1EJ8A 4R96B 4DERA 2NW2B 2V9UA 3EO1A 5CPOA 3PAVA 1F56A 1PLGL 3QC5X 2EPNA 3FTZA 2Z29A 4CNNA 4DBDA 1E0VA 3RXZA 1VCFA 5GGTL 2ZPKH 2HJPA 4O1CA 2IQ9L 3NIFF 1OB0A 3RDTD 4UTAH 2VFEA 1M7XA 2DGAA 1W5NA 4M48H 1WO2A 5BZXA 1ZGLM 2DSVA 4R7JA 3AU6A 2AEQL 2OZNA 4IRSC 4POUB 4IKKA 2YDRA 3NRQA 3RWIA 1N0LB 4KVNH 3RYMA 3N9SA 2A5HA 4GUPB 1PCSA 2BOFX 2TRSA 3NQBA 4IGMA 2PURA 5BU6A 2J55A 2ABBA 5ERWA 5DCDA 4YZFE 1AQDB 3GXFA 3FRPA 3ULUD 3QZ6A 3WS3B 5CH9A 1I1WA 5K4XA 1I8JA 4F40A 4OIAA 4WW2B 2TSAA 4KWWA 1D5MA 4F1SA 2OSWA 1AY1H 1Q0YH 3WV0A 1DIEA 5ANMB 2WCAA 5DFWH 2CCWA 4PVMA 1ZL1A 3RGVB 3Q0HA 4RNHA 1CE1H 3IDGB 4PJFE 5LAXA 2FD6H 3NQMA 1V5JA 3GD6A 3GVGA 4L1XA 2FECL 5D7KE 2VR7A 3GINA 3TP4A 4ABWA 2D7OA 5G4WA 4AY7A 2RQ8A 1AHKA 3LQMA 5G55A 1J5DA 3CSFA 3DYPA 1IV8A 2VOTA 5LAXB 3RGVA 4KBXA 3PBGA 2D2OA 1UWXH 3PS7A 1F4AA 1QR1B 2DS4A 3C8KB 3C6EA 2WNXA 3O6ML 4ACZB 3EGXB 1K9TA 2WCGA 4GP5B 2IAMB 3KYKL 4FKEA 4HJSA 5AVRB 3S2CA 3WD3A 3HEIB 4BUGA 4N9GB 1XR9B 3O2LA 4ROQA 5IDIA 4OTXH 4HZ7A 3JV4A 3WJWA 4OT7A 2E4FA 1MFEL 3BP4A 4BR1A 1GGOA 4ALAC 1MO0A 3LNIA 3RWIB 2ONEA 1E55A 3BKJL 4LE8A 2CU0A 4WRLA 4ZL1A 4TQEH 4KPHH 4M1CD 3VGAB 2OSXA 3BUTA 4P3DB 4NJAH 3CQIA 5DMNA 2Q0ZX 3DROA 1GGBL 3PQYE 4J3ZA 4JDZA 3WDQA 5C2CA 2C0AA 4NB7A 4QI3A 3Q94A 3H2OA 1ZAJA 1LLAA 1QBBA 4NSKA 3KPSD 4OI8A 3FO1B 1VZIA 3GLEA 2CCLA 1VBJA 3ANVA 4NYLA 2Y0SA 3RL2B 3DTXA 4HGWA 5D7EA 2AERT 2Y7NA 3U4BH 3PLYA 4YDKL 3QDGA 2ICWA 4NP9A 3U7AA 4R85A 1RALA 4B91A 3DJ9A 4HDIB 5KUMA 4X6DA 4JKWA 4H1LB 5B1BB 3C5JA 3GXPA 1DSWA 4KKAD 4NCC2 4P2AA 4IFRA 5K3VA 3MOBL 2EDDA 3MLXL 4QXVA 3B9KA 3SBQA 1BIHA 2ICCA 2ALAA 2X4UB 3ZJAA 3OHIA 4HAFA 4A21A 4IQHA 4M5ZL 4A2FA 2DIAA 2OLSA 3G6JA 3OKDB 3WL0A 3GNMH 1OCOB 3LU2A 1GONA 1A4JA 4ODTH 3QEHB 5IFJB 2FWOA 4XBKA 2QVNA 1UCTA 3D85A 4DP0X 1MQRA 5FO8A 4JE4B 1N82A 3HPSA 1BM7A 4ELKA 3USZA 1KPRB 1MW0A 2XZQH 5T8IA 3V0WL 1YZZA 3KTCA 1HHIB 2EVJA 2Q71A 3NCBB 2Z27A 1OZTG 2VXTL 1Q38A 1KY7A 2PR9A 5KYXA 4FJYA 2J12B 4X8GA 5EU7E 2UZXA 3BQUB 4FS9A 2ZRYA 4WY7H 1RZ8A 2YN3A 4PD4J 2XXCB 1G7PA 2BIPA 1NANH 2AITA 4HZ1A 1NPUA 1ZTXH 3C8DA 4U1GC 4EACA 4X5XB 3EH2A 3POHA 4AGOA 3AXXA 4JXCA 2ORBH 3NPSC 1ZBVA 1WAEA 2OO6A 4GSDL 4U6TA 1F11B 2XTSA 4N7QA 1CDBA 1PG7X 1QPRA 2EPLX 5C0DB 1A21A 1MCJA 1REQA 3HGSA 4HU3A 5D1ZA 4MY9A 3WIFA 2J9XA 4UCGA 1NBYB 3H3BC 4PJ9A 4WI7A 3KLAA 4UV4H 4KY2A 4HGXA 1HCYA 2BDNL 3K6OA 4JNZA 4QNPE 3FTGB 1F58L 4ATDA 4U1MB 4HG4J 5ABDE 2CA3A 1MXDA 2AXWA 2OZ8A 1AJ0A 2NLIA 4AC2A 4UANA 1CBVL 2WIMA 4X6EB 1MSPA 3BE1L 3ULVE 3KL5A 3MNWB 1A3ZA 3QO1A 5JIKA 1JCXA 5AZEL 2FQDA 1R3RA 2VFGA 1L6WA 3IIVA 3WK0A 4ZNCD 3AXLB 2NY2D 3VSVA 1JUKA 3MBWA 2AMXA 1QSFA 1G5GA 3GRWH 3ISRA 4PCSA 1ZT4B 3H53A 3WOVA 4DQOH 2A5UA 1XH3B 4WHCA 1K4DB 5CEZD 1ZGLP 1UA6L 4DUVA 2ACUA 3WLMA 3O16A 5K9XA 2G2PA 2GAZA 2X1XR 3AM8A 4DN3L 5L4MA 4XK2A 3SCPA 2WPGA 4KQ3H 1PKQB 2W9DL 1G7MB 1OADA 3HI6H 3CHVA 3QRBA 1WTLA 1EJRC 3ENEA 1B88A 4WU7B 1HFUA 2QIIA 3EYPA 4HS3B 3Q65A 4RR4A 4YWSA 2YMXH 2CH8A 3QZOA 4ORGB 5E0FA 2I9EA 4L1WA 4A22A 3NJVA 2GVJA 2XVKA 1ZANH 3QUXC 3ZT7A 3O9WD 2DU2A 1AJ7L 1KN4L 2OQJA 4HQVA 2YRLA 2G3MA 4NC1C 4HLEA 4AD3A 4YSEA 2DL2A 5CJXA 2APFA 4PJHB 1L3WA 2QT6A 3ULVF 2VI0A 2WUBH 2XUWA 1D3GA 1B0RB 3UBXG 5E09A 1J18A 2O5XL 2QSQA 1PBGA 3D0AA 2DVTA 4TUOB 4X7DC 1S7RA 3OQ8A 4CQBA 1I9RH 4GSUA 1E5ZA 4E36A 4O51B 3ULVD 4ELMA 1AL7A 4G7EA 3TW6A 3I6EA 1OARL 1E9OA 4LIQH 3KWTA 4FR1A 2R7EB 4L0ZA 1O0VA 3U4EB 1EFXD 3VWKC 4TN9A 4ZTOL 1NF7A 1UYWH 5DHDA 1AGFB 3VD2A 5BROA 2ZF8A 1KC5L 1ADOA 3QCUL 1B30A 2WLIA 2OPCA 2ZP0T 1QPOA 4X7TB 2CG9X 2P5EA 1KTKE 4L8SB 1QT1A 2VNCA 3NZ8A 1LEKB 1MUJA 2CLHA 3ULUC 4OOZA 1NQBA 3FT4A 3I6LD 1RUAL 1TVBB 2Q1EA 4FNTA 4RAUB 2WPBA 4XODA 5BJTB 4XC1L 2OTWA 5I76A 5DMKB 5IM7B 1A7OH 4OCWL 5GGTA 1OM9A 1EXUA 3OMNB 1FCBA 2PDGA 3T0TA 1CR9H 3KVMA 4KQ4H 1CGXA 2VDOB 3LI1A 1JDEA 5EUOE 4G6CA 2J8UB 4OJFL 1C16A 2DV0A 4GQGA 4Y96A 4PJHF 4B16A 3WLBB 2AMGA 4WFGE 2CALA 2YB4A 3JUGA 2VLRD 3KNBB 2A4CA 3N2MA 4N6FA 3SDXA 3IUIA 1HJXA 1WGOA 3B5GA 3ZHNA 3ZKQD 1YRRA 4NIYE 3QHFL 3DX7A 7PAZA 4BWLA 1KN2L 4GYPC 4F7TB 3ARFD 1N0XH 2OK0H 4OVXA 2Z7UA 1MCPH 3PAZA 3N41F 4LCWA 4U05A 3N44F 4F5CA 4HSNA 3T6ZA 1EJFA 2ZICA 4L4OA 5AUMB 2NY2B 5CPTA 43C9A 1U8IB 3ZTJG 2KERA 3OKLB 4PEKA 1NQ6A 1M3JA 3P4NA 4WIQA 3ROOA 3SCMA 1S5WA 5FDWA 1PLAA 4WEEA 2F18A 2ADIA 1WHOA 4UM9B 1CTOA 3V8OA 3M16A 1J8HE 3R7RA 3WIAA 1CLKA 3MVSA 3IUHA 4JR5A 4NIKB 1I2QA 2A0LD 3M0MA 1CF1A 2ETWA 4YLWA 3VCLB 4OIIH 5CD3A 4AAJA 2C1PB 3O0LA 4CC4C 3CZKA 3EJYD 1H60A 3GB6A 3KS6A 5IXEA 1WUZA 2IANE 3MNDA 5IROC 2FEEI 3E0FA 2INZA 5CCZA 1G1CA 1BEUA 4S1FA 4Z1YA 5F1IA 3KLQA 2B0MA 4R9XA 3OB0H 5DJ0A 1PD1A 3MA7B 1CXIA 4FG2A 2EPOA 2E7FA 1XWVA 1HCFX 2VC2B 3B9OA 3N29A 4KX8A 1QA9A 3BOXA 3IDYC 2JIXD 2MOQA 3RVUD 4BHUI 4N2MA 4GW1A 4OJCA 2ZX5A 3DIVA 2XG4A 1CE6B 2CNYA 3HHRB 3OSKA 4M6NH 4X5RA 4N0UB 3AW5A 3VDCA 1DL3A 3Q4DA 4P46B 4GVGA 3TU9A 3AC0A 1U1UA 1JZEA 1SO6A 1GSMA 3MV8B 3B03A 2BJML 2PABA 3RGHA 5CJBA 3RY5A 1FO0H 2PTZA 4Y4KC 1LORA 4P9HC 3CSGA 3V10A 1OCJA 2YDQA 3UMNA 2NT1A 4MAZA 1SJEA 3F7PC 2Z4QB 3VSUA 2C1HA 2WM1A 1O6SA 2NY0B 4CCEA 2NSXA 2NUPA 2JE8A 4OCSH 2X1RA 4UZUA 3O2VL 4P2QE 3F6IA 3HG1E 3IFNH 2XVLA 3OC8A 1KXTA 1S7VA 5J12C 4FA7B 1JGMA 3WYZA 3UD6A 1UZGA 3BPLB 2VRKA 4K8RH 1WHPA 2JF7A 5D7LE 3T2LA 4LAOA 3DXAE 2AC0A 2QJNA 4GBUA 1CG9A 4XMLL 4IFKB 3VOIA 2POZA 2PGWA 4ZSUA 3RWDB 4HIBA 2QJMA 1IKNA 2L7UA 4AYDC 1KY6A 3BW2A 4NO2A 3UH8A 4ONVA 2WQRA 2NYYC 2IFFL 3DI2B 1PQZA 1A7NH 1JZ8A 4TVCA 1MWAL 4K3EL 1D6VL 5JDSA 4NDMB 5CINH 4GGBA 5I6MA 5J9PB 4PWKA 3AAZB 4ZQPA 5EBGA 1SEQH 1TFVA 4YR6A 4X6BA 3ZYIA 4J12A 3BP5B 3TBVA 4L8CA 1A3QA 4TRPH 1CYGA 3PB2A 2VM9A 2WLLB 3CHDA 3UWUA 1RU9H 2Q3AA 3LPPA 3V1HA 1MNSA 4Z7IA 4Y2DD 1BGXH 2V82A 4PB3A 4LF3B 2R2HA 4L3FA 1BLIA 3IMVA 2ZCKL 3TCSA 1TQVA 4FQQB 2F74B 1OHLA 1YE4A 4FFWC 4EN3B 1D9KC 3CC1A 2Z1WA 5CSUA 4C4KO 4DVBB 1N6QH 1DN2A 2ZE3A 4H1ZA 4YVVA 5AHLA 2AF2A 4J2QA 3T6WA 1FYTE 3LI0A 1Q72L 2MJWA 3Q2NA 3NH7L 4YDVB 1H3WM 4GJTB 4TF4A 4QYAA 2Z9TA 1FQ9C 2QPFA 1GQIA 1CX9A 4MJ5A 2QQNL 1J8VA 3B7UX 2X9YA 3M7FB 3MLWL 1SEQL 3RIAK 4DZ8A 4B15A 1KIQB 4WHDA 1M42A 2F5AH 3DUUB 5DJAA 1HNYA 4L29A 4PJCF 1Q7QA 1OO2A 2A6NA 5DRZA 5ILTL 1VERA 5JW3H 4LTSA 3OB8A 4JFOA 2NCMA 3QWNA 1BQUA 3GZ3A 3HZKA 1LT7A 3RZCD 4PREA 1WFUA 2A6IB 3PWNB 1H1NA 4BXSV 3C2AL 4EWND 3W57A 1O94A 2P7TB 2J44A 3N2XA 1P53A 1AHWA 4TTDC 4A67A 1AL8A 1YBQA 3TXVA 4LHJB 4YFLI 1YY8A 4JRXA 3FFCA 4HH9B 4QHMA 4A04A 3PTKA 5LIUX 3CBRA 2EIKB 2YCIX 4H01A 1ILUA 2YD9A 4HCRH 4QTIL 2NZ9D 4FQIL 3E2HC 5DMIL 1IXNA 1IWPA 3BK0A 3MBXH 3H8AA 1KJ2A 5LB1A 1DUZA 2POTA 3DVGB 4FNUA 5D9SB 5DRNA 3ULUF 2IXQB 4HPJA 4PJGF 3WL1A 4LAMA 4ANVA 1SGKA 2DQWA 4YE4H 2KZ1B 4HW6A 4N1CA 2W92A 3U1SL 3IN2A 1RSCA 1PZ3A 1YIXA 4LB4A 1X9LA 4H13C 1EQWA 3W1LA 1MCEA 3DBXA 1H8NA 1BEYH 3IWUA 4GG6A 1XO8A 2JF6A 1EYEA 2AK1H 2RH0A 4ZUWA 4NQVB 3E3QE 3CFUA 2XN9D 5DRWB 2IUZA 2P8MA 4ONHB 4JFUA 4F33A 3KPMA 1L6GA 4D6JA 1KFEA 2B0SH 4Y4FA 1U58A 4UNVA 3VABA 4HK7A 3MUGA 3GSNB 4IMLB 4H9TA 2OULB 1HXMA 4N0YH 4GRWE 4ZW7A 1GZPB 4XPTL 4DGVL 5K1NA 4JFQB 3RPIB 4G2AA 3TYFB 2NY3B 1K02A 1LRNA 2P76A 4MNJA 3UXFA 2CUAA 3APCA 3QHZH 5L7XH 3IF1A 3U57A 2WLJA 1SHWA 2BPBA 3U4AA 2CLFA 3MUY1 1UH4A 2IPTH 5T1KB 1BD2A 4BK4A 5KSAB 4Z2IA 4OZIE 5LG1A 1RQEA 2D1ZA 1M9WA 1SFDA 1MI5D 5EMLA 1ETB1 4NGHH 1TLMA 1OB1A 4LLYB 4PG9A 5C0IA 1ZVYA 1CGYA 1ZLUH 1N2RA 1WAAA 2GCYB 5BVJB 1TDQA 1Z9SB 5IHRA 1PKNA 1WBZA 5C0RL 3FNDA 4JY5H 4FJ6A 4Z77B 3VDHA 1P7KB 4AMWA 1WZLA 2BODX 2V6HA 4NNXB 1I1AA 3U9PH 3R0NA 4QOKA 1YN7A 1ISVA 2Y0FA 3ITCA 2BSRB 3VIHA 1UOKA 3U0TB 4HLJA 4KI5F 2YBTA 2Z31C 4UT6H 1TU2A 5DHXB 2W27A 3WLHA 4MQSB 3WKML 3OP2A 4YHML 4ZTEA 2AEWA 2XVBA 2J2ZA 3I6KB 4K9EC 3ZE1F 4HPXA 4W86A 3RWGA 2IPUG 4FL4B 4ZUUB 1GL4B 5DUJA 2B15A 4XVUD 2DM7A 2OX1A 4CEUC 4D0BB 3OODA 1TIWA 3BG3A 1FGVL 2DH3A 4AUUA 2PDHA 4YNYB 4LC6A 1EVTC 4DTGL 2JKAA 3PBUA 3G5VB 1E9PA 2XZ9A 4B3VA 3D52A 5FL1A 5TE7H 1F4YH 4F7EA 2CWNA 3N06B 1R9XA 3CUZA 4H6EA 4JTCA 4DBSA 4QHLB 1QHOA 5ITFA 5E4IA 6REQA 5TNVA 4ZXBD 4BFKA 1UQSA 5FOJA 2WYHA 5GS1A 2VD9A 5CC6A 1PVHA 5HHOD 3ZDZB 3NPWA 4H6KA 4YYCA 3BZDA 2IOMA 2Y5EA 1K9FA 3UBXA 1PCXA 3LKPA 5K9JL 4QF1B 2DIKA 4PLKD 4O2EA 3OGSA 4X6CA 4IIGA 4B4FA 4TMBA 1I8LC 4OZGB 3QQ1A 5CJ5A 1FVEA 4DSYA 4X8CA 3ZDXE 2XZZA 1UB5A 4B5NA 4XNYL 3OPUA 5GGQH 4PJEB 1G4TA 3UZXA 1LEGA 3HA0A 4MCNA 4N2HA 3WO4B 4P2CG 1UACL 2F54D 1KCZA 1Z9LA 1G6RA 2C1OB 2NW3B 1VCBC 4YHEA 5T91A 3QPQC 2Y88A 3SUTA 4LLQA 3REWA 5ESQA 2QGDA 5DLMH 1GS8A 1THCA 2XKNB 4JFTA 4AQ8A 1RZGB 3AS2A 4GT0A 3UW6A 3QFJD 1T40A 2AK4B 1ZTXE 1ZT7A 3DUSB 1T1YB 2YUXA 4LT9A 3WLTA 4F2BA 2BP0A 1XH2A 4K5MA 5D96C 4AWJC 1FWEC 5JNYB 2PDIA 3F1QA 4W8BA 3F12A 3CV1A 2VXQL 3ABRA 5AZ1A 5C6TH 3L3DB 4M7ZB 1S39A 4KWOA 3LS5L 4TVPE 3KRBA 1Z2KA 4N22A 4H8PA 1BAFL 3HHSA 1NDGA 1X5JA 2J3SA 2DZAA 2RJMA 1F3XA 1TR9A 3CL8A 2WXKA 5DN1A 3BE1H 3IWPA 3RM8A 2YAHA 1OTTC 1TWSA 2Q8ZA 4XKMA 4MVBC 3OR6A 4E8GA 3RP1A 4YZFF 2GWNA 3CSBA 5EC2A 4DHGA 2VC2H 4MKMA 3GUGA 4RDBA 3EX2A 4XP1H 1W3KA 3S3CB 2WMKA 5JHDE 4GK8A 4L3AA 2NQ5A 1CL7I 4I18A 2BO0A 2DL9A 3S37X 1LO5A