4GQRA

Human pancreatic alpha-amylase in complex with myricetin
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Order and disorder: differential structural impacts of myricetin and ethyl caffeate on human amylase, an antidiabetic target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pancreatic alpha-amylase
total genus 172
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4gqrA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4gqrA01
2EEXA 1F4AA 1BTCA 5GNZA 1BVZA 1BYAA 3VUPA 1QWUA 3UCQA 3AYSA 3GTNA 2OWXA 4LXFA 1JZ6A 1PAMA 3ZOAA 4ACZB 1QX1A 1WZKA 2DH3A 3QOMA 1WZAA 3S2CA 3S6TA 1VFMA 3EMCA 3EJUA 3PZVA 3RJYA 3TTQA 4AY1A 4NZCA 1AQMA 3TP4A 5D9MA 3AIBA 1WPCA 1UKTA 2FHFA 2QF8A 2VCCA 2YDRA 2WC3A 1PBGA 2WVSA 1LG2A 3TTSA 3AXHA 3RDKA 1HJWA 4DUVA 2J8FA 1V3LA 5A69A 5F7UA 4DWSD 1QHZA 1PX3A 4AISA 1FHLA 2NSXA 2ZE0A 2VZTA 1TMQA 4W93A 5A8QA 5ABEA 1GQKA 2EPKX 3IJ9A 3DECA 1B3YA 3DHPA 3CHCA 1NWTA 1H49A 2XM2A 3VGHA 4UFKA 1PZ3A 1XD0A 3BUPA 3F5JA 4MB4A 4CU7A 5I23A 1NOWA 2O9PA 3KEHA 1GVYA 5C71A 1A3HA 4OBRA 4X0NA 2X09A 3PZQA 3VD3A 5I78A 5A1AA 5ABGA 2VJXA 1TA3A 3CHDA 3PZNA 2IUZA 3D5HA 2WWCA 5DMYA 4OUEA 3ARXA 3L2MA 1OB0A 2CPUA 4M8UA 3W6LA 4D6FA 2CESA 3PZTA 1OT1A 1SFSA 1TCMA 3CZLA 3EMQA 1DEDA 3MMUA 2WHMA 1BG9A 5CGTA 1D7FA 3BAJA 3VM7A 2J74A 4D6DA 4UCFA 5CQ1A 4UOJA 2Z1SA 4MAVA 1OGSA 3GXPA 3RM4A 3NDYA 3WNPA 4GZEA 3WY4A 1ISXA 3LX9A 1WB0A 1NWRA 1OIFA 4FNQA 1WDQA 2VQTA 1NM9A 3WF3A 1KB3A 1GPFA 1V02E 1BPLB 1V6WA 4QP0A 3GNOA 4EK7A 4M24A 2XSAA 1KWGA 1D2KA 5EFDA 4AEFA 3SCRA 2BHZA 1EHAA 3DYMA 1WCGA 1FP9A 1R34A 4DWSA 3KL3A 4W5ZA 2GJXA 1UR1A 3ZT6A 1XSKA 3AXXA 1XSIA 4CU6A 5M03A 5JIPA 1MW1A 1WDPA 3WBEA 3T2OA 1QOXA 2XGBA 5A6JA 2DDXA 1WDRA 3ZJ7A 4MNLA 4W8BA 4PSPA 4XV0A 2VX4A 4HA1A 3HG4A 1JNDA 1ZL1A 3AICA 3RM8A 4NF7A 1B3ZA 1R86A 1KQZA 1H4PA 4CCEA 4GIAA 4PTXA 1LG1A 5HDRA 4DM1A 3WH8A 4UFIA 4Z2KA 2EPOA 2O9OA 3BLPX 2WLYA 1G0CA 2WC4A 3QHNA 2XGIA 3AISA 1JI2A 4V27A 1PS3A 2YLAA 3U5UA 3SCTA 3LPGA 4JZ5A 5BYWA 1GVIA 4J3VA 1UH3A 4N0RA 1QPKA 1E3ZA 1FH9A 3VIPA 1E0VA 1CTNA 3ZSSA 1UD3A 1WZMA 4CKQA 2WKGA 3CZNA 3EJQA 1GOIA 3ARZA 1EO7A 3EJTA 2JFEX 4YHGA 4UFMA 5GPRA 1V0KA 3KLKA 3PZOA 3W26A 3WNMA 1E71M 4UQBA 4CD4A 4AW7A 1DWGM 4Y7EA 3M7SA 3BGAA 3T2PA 1TQTA 3UR7A 3HG3A 2EACA 4EAMA 2G41A 4L4PA 5HNNA 2XFRA 1GCYA 5A2BA 1C90A 1EQCA 5A2CA 2ZOXA 2Z1KA 4V28A 4UQAA 2J8GA 2VZVA 1UR4A 1KCKA 1HT6A 1E6ZA 1FA2A 4XZBA 2WHKA 1RP9A 3MU7A 1E4MM 2OSWA 2VZOA 1UOKA 3GXMA 1CPUA 4RE3A 4A4AA 1JYXA 1PIFA 3FNDA 3LPPA 2XWEA 2WBKA 2FH6A 2WMHA 5AY7A 2JE8A 7TAAA 5TD4A 4HPHA 4TX6A 5A6AA 1O6IA 3L4YA 1B2YA 3SCNA 3WQ4A 3OLEA 2VR5A 1H1NA 1B3WA 3ZM8A 4LYPA 3WY2A 4H8HA 1ITXA 4UTFA 4F9JA 3CV5A 2ZUTA 1JXKA 2ZX5A 2A3AA 3CMGA 1MW0A 1J11A 1LL7A 2C7FA 2WCAA 2JALA 4AIEA 3VGGA 2UY3A 3BXWA 3VPLA 6CGTA 1ZU8A 4UFHA 4TXEA 4ZE5A 4H04A 2XIBA 2J7DA 3WFZA 4CCDA 5CG0A 4E4PA 2NT1A 4PEEA 3VDCA 5CLWA 1WKYA 1QI5A 4MB5A 3GXNA 4W8LA 4RL3A 3VIOA 2WB5A 3O9NA 4JHZA 1CECA 3W0KA 3W4RA 5M17A 4B15A 3WUGA 2E9LA 1OD8A 3W24A 3BUDA 1UWTA 2YIHA 1F4HA 4B16A 1GJUA 3AIVA 4MB1A 3WNOA 3WF1A 4OOUA 1JD7A 1J0ZA 3ARYA 3BSHA 3WH5A 2ALWA 1MW3A 3QOKA 3AIQA 3EBVA 1GQLA 1JYVA 3DX0A 4MPKA 4PMNA 5CSYA 2FGLA 2ZUNA 1K9FA 1JNEA 2IXUA 2DSZA 1UKQA 3E1F1 1OSEA 2VC9A 1C7TA 1ESWA 2J79A 2GK1A 2BHUA 3FAWA 1E6QM 4PMXA 2D0GA 2VX5A 3OGVA 3WUBA 1EO5A 4AD2A 3FHQA 4W8AA 3L2LA 1E4IA 1UD4A 2X2IA 1DHKA 1JAEA 2AMGA 1C8XA 1SR0A 2X2HA 2BY1A 4J28A 3MV01 3D3AA 1UR9A 4MB3A 4UQCA 2EBNA 1EDQA 1KGWA 1C92A 4HU0A 4DO5A 1H3GA 3WDIA 3ZIZA 1TZ7A 2QMJA 4AZCB 4FNRA 3MUY1 3LRLA 4U5IA 3LXCA 3GH4A 5E09A 2OYKA 1KXTA 4NXSA 3NUKA 3ZR5A 5A8PA 5BXPA 2EXOA 4URIA 3MMDA 2EABA 4PMOA 1Z32X 1HJSA 4HZ6A 4HOXA 1TR1A 3AHXA 2J25A 3MSDA 2XYLA 1GW1A 3WUEA 1AQ0A 4HMDA 1ZBWA 2OW7A 4ATWA 1HKKA 3MO4A 1R46A 2WPGA 3WUFA 1E0WA 3WD1A 3VGFA 3VMOA 1W3LA 3DDFA 1M53A 3OBAA 4PMDA 2YOCA 1V3JA 3NSMA 1BSIA 5FL1A 3H53A 4C7DA 1MVYA 3W37A 2VRJA 3VIFA 5DFAA 1CXLA 1E1FA 3NYDA 4ZXOA 2ZWZA 2WBGA 1GOOA 2XTKA 3AIWA 1E5JA 3EDDA 4PCTA 4MNJA 3VM5A 2YLLA 3WSUA 3VSTA 1L0PA 1PIGA 2VVNA 2WNWA 1FHDA 3BAWA 1JD9A 1KGXA 3DDGA 3VDBA 3FAXA 5E6ZA 1JI1A 4XUYA 3EDEA 4D6CA 2ZIDA 2YFNA 4DO6A 3ARRA 3IGUA 2Q8XA 2ZXDA 3WN6A 5DT5A 2WLZA 3THCA 3BCFA 1CEOA 4W7WA 1W3KA 1RPKA 1BVNP 3U57A 3AIUA 4W88A 2XG9A 3HG2A 6TAAA 1CBGA 3KWXA 5GNYA 4ATDA 4EANA 1NP0A 1KBKA 3CUHA 2O9TA 1E70M 3AQUA 1HP4A 4UFJA 1FH8A 2WMKA 4GQQA 5D8WA 5JBFA 1W32A 3A5VA 4M81A 2BXZA 3BMVA 2YBTA 3I3DA 3ARUA 4P8XA 3GM8A 3N9KA 2D3LA 4AWEA 5CPQA 3ZR6A 1R85A 3A23A 4J7RA 3ARTA 5HPOA 1PX8A 3DYPA 2VL4A 1CGVA 3AHYA 3UG4A 3VTRA 3CUFA 5BRQA 2X2JA 1ECEA 1VFOA 2QHAA 4D72A 1E6SM 4HMEA 3WD0A 1HL8A 1PX4A 3RPMA 3L4ZA 3CZKA 3BCDA 3K8LA 3AZRA 3GH7A 3FN9A 1U2YA 4MNMA 2PWFA 3PTMA 3OA5A 2BVYA 4CD8A 1CIUA 2O9RA 2ZUVA 5IFTA 4HU8A 2XWDA 2YA1A 5A95A 2ZX9A 4P7QA 3VNZA 4W7VA 3H54A 1E15A 2PF0A 1SMDA 4GKLA 5E0CA 3BVVA 3WNKA 2WMIA 1UQYA 1QBBA 1GOKA 4Z2HA 2X1IA 1UR2A 2J7HA 1BQCA 4KGLA 2CHOA 4AZBA 2PWEA 4NSBA 4MADA 3AS2A 3BUQA 2AAAA 2BY3A 3N13A 3NDZA 1E73M 1CXFA 2FH8A 4BA0A 3VSUA 3GXFA 4MJ4A 1WE5A 4AZIA 3OZOA 4QLKA 2HVMA 1NOFA 4MTVA 2V5DA 4OZOA 3W6MA 3W25A 1UWUA 1X6LA 4LGXA 1E40A 1NP2A 3GXDA 3OG2A 3U5YA 2FE0A 3CH9A 4JL2A 4D6EA 1NWSA 2WCGA 4PMUA 1JZ2A 1HKJA 1MQRA 3KLLA 4W87A 1V02A 4AYSA 3ECQA 2D24A 4NRRA 4QAWA 1UZ4A 3MUAA 4AMCA 1OM0A 3AFBA 5CGMA 2Y8VA 3VD9A 1JG9A 2VO5A 3J7HA 4E2OA 4ZFMA 1JXJA 2WANA 2UY2A 1MWOA 1FH7A 2G4FA 2GJRA 3PTQA 2D0HA 1W9UA 1H09A 3CUJA 5JBEA 4TTUA 2D22A 2Y24A 1FOBA 1NWUA 2WCSA 3GNPA 2PB1A 1E72M 4IM4A 3WD3A 1M03A 2JIEA 2E0PA 1BAGA 1R75A 1J18A 1V03A 4H41A 3WNNA 3SCWA 4M56A 4HZ7A 3K1DA 1JF5A 2BVDA 4AIUA 3AYRA 1G5AA 1HJUA 2PC8A 5EFFA 5EBAA 1VIWA 3HZ3A 2VURA 1R33A 3SIMA 2E9BA 2QMKA 1JZ8A 5E9AA 7A3HA 1WP6A 3DX3A 1R7OA 4PMQA 3GDBA 4AXNA 1DWIM 3I3EA 4LQ1A 3N1AA 1H11A 3WKZA 4P7LA 1CGWA 4AD0A 2PWHA 1JL8A 1UD6A 3VX1A 4GO8A 5A8NA 1VEPA 3AI0A 9CGTA 2EO7A 1EOMA 3A6OA 3AZSA 2FHCA 1BHGA 4L4OA 4UFLA 1XV8A 3VMNA 1YHTA 4PSRA 3ZT7A 4P8VA 2F1AA 2HISA 3WF2A 2DT0A 2BXYA 1HX0A 1ZBCA 1VFFA 3BMWA 1LL4A 3N18A 8CGTA 3W38A 1JDCA 1OGGA 3N04A 1NH6A 3HMCA 1CXHA 2D73A 3SURA 5FCZA 2F7PA 2J77A 5HXMA 2J7CA 3K8MA 3AHVA 1KR0A 2JEPA 3A4XA 6A3HA 2FGZA 3CC1A 2CYGA 4Z2GA 1JGIA 1C7SA 3MUIA 1VRXA 4LYRA 3MI6A 4BQ3A 1JYNA 4JAWA 3AMDA 1B90A 1ZB5A 2VVSA 1JDDA 1X6NA 2J75A 2DSUA 3NIYA 2J7GA 1W1TA 1EHNA 3OIHA 2A3BA 4ZEPA 4QDMA 1EDTA 2J47A 1MFUA 3DX1A 2X2YA 3KL0A 5BRPA 1SMAA 4HPGA 1EOKA 3ZO9A 4FF5A 4GXPA 4TUFA 5BXSA 1ISYA 5A6LA 1E6XM 4JHOA 1BFNA 3OLDA 1VBUA 2JF6A 2CBIA 4GI9A 1LQ0A 3NJ3A 2OSYA 1I1XA 3CUIA 1QNPA 1JAKA 1GQIA 3A22A 4HA3A 4JKMA 4LX4A 1HVQA 4AZ7A 3JUGA 2V38A 3DX2A 1TQUA 3HN3A 3FHAA 1QNQA 4S3KA 1UYQA 3VMPA 5JIWA 1CXEA 3SUVA 1UQZA 1V0LA 2O92A 5E6YA 2VZUA 2WZHA 3CBWA 1XCWA 3T08A 4Z2JA 4EKJA 4J3SA 5KEZA 4JKLA 1V6UA 4GO9A 4U3AA 1US2A 2CHNA 3QHOA 1W9XA 2J78A 3A21A 2WVUA 1W2VA 3ALGA 2CNCA 1CWYA 2EPLX 4LYQA 2Y4SA 1C93A 1K6AA 4FLSA 1M7XA 4AZ6A 1E3XA 1HP5A 1OT2A 3IANA 1C8YA 4TVDA 1UD8A 2XVNA 5CZKA 2E40A 4AD3A 1J9YA 1CENA 1DTUA 2WVVB 4IPNB 4WF7A 4Z2IA 3UERA 2WMJA 1W9PA 3ARSA 5IFPA 5I6SA 4PMYA 3BSGA 4FLRA 2D1ZA 4OIFA 1XH0A 4GZJA 2BV9A 1C3FA 1Q4NX 1GQJA 1QVBA 2UY4A 4UR9A 1W1YA 3SCSA 2ZX8A 2EJ1A 3VINA 3VGEA 4BF7A 4D1JA 1K9TA 4KMQA 3A3HA 2ZICA 3AMCA 3G6LA 4YN5A 2DT1A 4XZWA 4W86A 3AMGA 1JZ5A 4QFUA 1PPIA 1V0MA 3D52A 3WDHA 3OLIA 1JZ4A 1CGXA 1GOMA 3SCPA 4AMXA 4AEEA 5A8OA 2W62A 1CLVA 1ZBKA 4ZE4A 4JCMA 3N11A 1G1YA 3O2LA 2A3HA 3M46A 2ZX7A 4NZJA 1GNXA 3WDPP 3AXIA 2CITA 4OOZA 2FYVA 2V3GA 4TVCA 3T0DA 5M5DA 3QGVA 2CIPA 1CGYA 1KTCA 2W67A 4H8UA 5BXTA 4UQ9A 1D3CA 1HN1A 4WKHA 2GSJA 3G6MA 1MQQA 4FK9A 1IZJA 2E9MA 5C70A 5D9OA 2OWCA 4M80A 4GI8A 1V6VA 2W92A 4B3LA 4BZYA 4WJXA 3WEOA 4AD1A 4PMRA 3EJPA 3APGA 3K4AA 1C8QA 4U33A 1B9ZA 1J12A 2GDVA 1V08A 1LF1A 1GONA 4HZ8A 5IDIA 4KRUA 2VTFA 2W4XA 1V3MA 3HG5A 4M29A 3K8KA 4E8DA 3U7VA 3BUBA 3WIJA 1KQYA 4PBGA 4TVUA 3GXIA 3WD2A 5HPCA 2XFFA 2F61A 2W5FA 1QWNA 1JDAA 2VUYA 1DWJM 3ZJKA 3AMKA 4GQRA 4ACYA 4F66A 3PBGA 1Q6DA 4JKKA 3BVWA 4D6JA 2IGTA 1B31A 3AMLA 3VO0A 4A3HA 2VRQA 3LRMA 7CGTA 3WMCA 2WSPA 2WAGA 2CEQA 3BVUA 4U2YA 4N42A 2DSVA 1CLXA 4D6HA 4M82A 5CPSA 3T09A 1XD1A 1UWSA 4DWSC 4MAZA 1GORA 1VEMA 3GXTA 2VCAA 3T0AA 2CKSA 1H41A 4GI6A 4U2ZA 1OINA 2J62A 3I3BA 4W7UA 3WENA 5CXPA 1JFXA 3MS8A 4PTWA 3CHEA 4BQ2A 2W63A 3WH9A 3LPFA 1XHGA 3IJ7A 3AROA 1OIMA 3QR3A 3THDA 4PTMA 2WM0A 4GPNA 4M1RA 3GZAA 3SCVA 3VU2A 2NT0A 4IPLA 1TE1A 2GDUA 1W9DM 2VZSA 5HOSA 1GJWA 1DP0A 1N82A 1UZ1A 1AQHA 5A94A 1QBAA 5FKYA 4KRTA 1LWHA 1W9BM 2F1BA 3GH5A 4HMCA 3L4XA 4H2CA 2B31A 1LWJA 4CUCA 1RP8A 1R87A 1ZS2A 1RD6A 3WQVA 1JFHA 4PMVA 4PTVA 1VF8A 3K4DA 1C91A 1HKIA 2WW5A 3W29A 2XIIA 4JFVA 4QLJA 4FLQA 3ZJ6A 4TTGA 4JFWA 1U30A 1IT0A 4PMZA 4WKFA 3CZJA 1J10A 2EPNA 1Y7VA 3D50A 3FW6A 4YHEA 2XN0A 4P7RA 4D1IA 5GNXA 3PZ9A 3O6AA 2FDMA 1BG4A 3VX0A 5CSUA 1TUXA 5I2UA 2CETA 2PBOA 4W84A 1ISVA 4FNTA 4DUXA 4B9YA 5I0DA 3W81A 2YKKA 2TAAA 2VX7A 1J01A 1W1VA 2W91A 2GFTA 1KXQA 3UG3A 4AZCA 3ZJ8A 4JL1A 1ODZA 4UNIA 3VIJA 1R7AA 4AZHA 2BNJA 2OYMA 3A4AA 3H55A 1T0OA 4CVUA 1WNOA 4ML4A 5DO8A 3AOFA 1KWKA 4U5KA 3WELA 3B9DA 4D71A 3EYPA 2XVLA 2WHJA 2ZWYA 4CD7A 2DT3A 5EB8A 1EQPA 4P7OA 1J0KA 1B3VA 5BROA 4MJ2A 1V3HA 4WIWA 2XN1A 3M6DA 4CN6A 3DX4A 1AMYA 3A47A 3UETA 1G01A 4KGJA 1GOQA 2C0HA 2GK1B 1K9EA 3LXBA 3W27A 2D23A 4P8UA 1JZ7A 1KTBA 3ZMRA 1EH9A 2WZIA 3PHAA 3LXAA 2WMIB 2YJQA 3WEMA 4YPJA 4OBSA 1UKOA 3GBEA 2ZUSA 1MXDA 4HP5A 1W9VA 2BS9A 3UESA 4DUWA 3TONA 1CYGA 1I75A 3ZT5A 2PI6A 1WZLA 3ARVA 1XC6A 3N17A 4AD5A 3WD4A 3DC0A 3SEPA 4FMVA 2F18A 1ZJBA 3VILA 2V3EA 2J7EA 2DIEA 4FNPA 2GJXB 1V6XA 1QNOA 3T0BA 3LRKA 3B8SA 5FD0A 5FIPA 1W1PA 1BYDA 3RJXA 3SUTA 4ZXLA 5FL0A 3M07A 3BLBA 5EMYA 5I3DA 1KGUA 5KZ6A 3BLKA 1UKSA 2Y5EA 3L4WA 5I77A 2UWFA 4WSJA 1XRVA 2G3IA 2WZEA 3CGTA 3ARQA 3AS0A 2V3FA 2YDSA 4DM2A 1A47A 4UZSA 3WDJA 1HIZA 1XYFA 1KR1A 4MNKA 1BGGA 3OLGA 2DQXA 2EAEA 1B1YA 3HU7A 3WL1A 1HF6A 3L4UA 2CBJA 2F7RA 1QI0A 2C8NA 3GBDA 3F5KA 2ZUWA 1W91A 1JF6A 3VIIA 1TVNA 2PWDA 1B0IA 3EDKA 1QHPA 5ABHA 1NQ6A 1E6PA 4HTYA 3VD4A 4R27A 2OWWA 2XVPA 4BS0A 1UR8A 1TG7A 4J27A 3UR8A 3D4ZA 1JYWA 3B9AA 1CXIA 5DF0A 4DWSB 2Y8KA 2F7QA 1VJSA 2WK2A 1Q6FA 1PEZA 4H8VA 1G94A 4OJYA 2E3ZA 1OGBA 2D20A 2UY5A 3K46A 1CXKA 4ACZA 2CKRA 2DEPA 3AHZA 3WL0A 2G8ZA 2WSKA 3CZGA 2EADA 3SCUA 2DIJA 1QI2A 5BWFA 1EGZA 3U7BA 4CCCA 5E0FA 4H7VA 1DWHM 2WXDM 1ODUA 4TX8A 3WNLA 5BXRA 1CNVA 1UWIA 5BCAA 1H0IA 3EJSA 1VAHA 1ZJAA 1HJXA 1VBRA 1V6YA 1CGUA 1UG6A 2BY2A 4PUDA 3RCNA 4W89A 3L4TA 3POCA 4HOZA 1I1WA 4AYGA 3VGDA 4NI3A 2BFGA 3TTYA 3MANA 4R5EA 1DWFM 5AC5A 2Y2WA 2RGLA 1OCQA 1O7AA 4AIOA 1M04A 1H0GA 2OSXA 2ZXQA 1UWQA 1V0NA 1VJZA 3GNRA 1XH2A 4U31A 2F8QA 3OGSA 3S5ZA 4W5UA 2BY0A 5LYRA 2J7BA 2VOTA 2XM1A 1FP8A 3WQ5A 3BVXA 1VB9A 4NZFA 1H2JA 4B9ZA 3IK2A 4CN4A 4NRSA 1BLIA 4AZ5A 2D2OA 3BH4A 1TVPA 1KFWA 3ALFA 3OGRA 4C7FA 3L4VA 1ZBVA 2YL5A 3WQWA 1QNSA 5E70A 2YA0A 1XGZA 1WDSA 1UHVA 3VKKA 3AS1A 3S5YA 1NARA 2ZX6A 3HJEA 3AJ7A 1HJQA 1HVXA 5ABFA 1PJ9A 2CBVA 1EXPA 4F79A 2ZXAA 5JBDA 3MMWA 1MW2A 4CVWA 4QCFA 1HTYA 1XH1A 3WY1A 4F9DA 1KXHA 1P6WA 4OGZA 1E6NA 5DT7A 5HBFA 4JFSA 4Z2LA 3CLWA 4WKAA 3RMEA 3PZUA 4FNSA 3MV11 5A6KA 3SUUA 3BVTA 4JFUA 3BUIA 3AS3A 3RO8A 2W61A 3TV8A 3TA9A 2ZUMA 3W82A 1S46A 2VI0A 5JUVA 2WHLA 2ZUUA 3RIKA 3AHTA 3RILA 2E8ZA 4CN1A 2WYSA 5A6BD 2GUYA 1U33A 4KWUA 1CGTA 3PN8A 3NSNA 5IHRA 3ZSTA 1KCLA 3OB8A 3CZ8A 3EDJA 1J0IA 4JFTA 1SZNA 1E0XA 4NXKA 4WSKA 2WMGA 1OWQA 1IZKA 3WF0A 3F4VA 4PCSA 1MXGA 2G3NA 1TA3B 1BYBA 1KBBA 2XUCA 2DH2A 2AOSA 3WDQA 8A3HA 2PWGA 2V3DA 2CXGA 1MQPA 3KL5A 2YBUA 1L8NA 4RE4A 4XX6A 2XVGA 4PRWA 2DGAA 3AIRA 2X8RA 2QPSA 4F8XA 2GJPA 4UQEA 1QW9A 1KXVA 2YL6A 2FHBA 4B3KA 4BCEA 2D3NA 1H5VA 3NCOA 2QV4A 2OLHA 4LPCA 1BF2A 2YDQA 4S3JA 4D6IA 3BAIA 3CIVA 1J0YA 1UR0A 5FOOA 4E8CA 3TTOA 3ARWA 1EA9C 1UUQA 3VIGA 3WQ6A 3DHUA 3WFLA 1W2PA 4CGTA 2VCBA 2CCRA 4KH2A 2XHYA 1UA3A 3EMZA 1NOUA 5CJ5A 2G3JA 2J4GA 5C8BB 2WWDA 5AYIA 2NW0A 3CMJA 5A6SA 3WQ8A 4GZIA 4WLCA 3VNYA 3CTTA 2YL8A 1JIBA 2XVKA 3TOPA 3AZTA 3VDHA 5LA0A 4EE9A 3LMYA 3II1A 1VENA 5D9NA 2BVTA 1QI4A 3CZEA 2XPKA 1QHOA 1E5NA 1Q6EA 4CU8A 4JIEA 2WKLA 1UWRA 5ABFB 1RH9A 3SUSA 3AIEA 4J3WA 1Q6CA 3POHA 3KE0A 3WMSA 2WVVA 4J3XA 3MUZ1 5LA2A 4K68A 1V3KA 1GOWA 2VX6A 1GUVA 2E8YA 5I5RA 1J0HA 1UH2A 5D9PA 5LA1A 2PBGA 4PYSA 4FLOA 2XJ7A 1TQWA 2BHYA 3WMBA 3IJ8A 2XN2A 3PZIA 4ATLA 2MANA 1UKPA 5AC4A 4HOWA 1FFRA 3ZQ9A 3CHFA 5A8MA 2DPEA 1TQSA 3VIHA 3BC9A 3FXYA 4J3UA 4PN2A 1Q6GA 5ECUA 1XYZA 1XCXA 3CZSA 3UG5A 2YA2A 5A3HA 2WC7A 2YFOA 1HXKA 2VR4A 3EJRA 1W3HA 2D0FA 4HA4A 4P8WA 2DT2A 2VT0A 5AYBA 1PZ2A 3SUWA 4CD6A 1ITCA 1LJYA 1G9HA 4AC1X 2J7FA 3FY1A 1B30A 3WH6A 3VDAA 1TFVA 2OYLA 2JF7A 1HXJA 1OBAA 1X1NA 5A6BA 2VMFA 4X9YA 3WEZA 2RGMA 3BAYA 3CUGA 2QLYA 5IHSA 1HKMA 4TOQA 3GYCA 2EPMX 2JEQA 1E4LA 5DEZA 1K9DA 4UOZA 1UD5A 1W3JA 5CPTA 1GHSA 1XSJA 1MFVA 1QNRA 1QI3A 3WY3A 4FNUA 1OD0A 1ISZA 4WK9A 4Q22A 3A24A 2CBUA 1HNYA 1R47A 4UOQA 3NSXA 1FFQA 2YL9A 2F7OA 2OW6A 2A3EA 2GVYA 3D51A 1GHRA 3IAPA 1E56A 5E1QA 4DO4A 3UEQA 5CLTA 2EQDA 3D4YA 3N15A 1VFUA 3VSVA 1DWAM 2JIWA 1JZ3A 1MYRA 2IXVA 1BGAA 4MDPA 4MDOA 3MKKA 3MSGA 4V2XA 1TQVA 4GINA 4BQ5A 3RM9A 3T2QA 2DSWA 3VOCA 3VD7A 3B9EA 4IISA 1E1EA 1LL6A 1CDGA 3N12A 3SCQA 3VVGA 4CD5A 1SYTA 3OZPA 3PTKA 1QW8A 3VD5A 1HWWA 5A6MA 2XFYA 4W85A 4OKDA 4RE2A 1UH4A 4IUGA 3BAXA 5A2AA 3CPUA 2X0HA 1WO2A 1V3IA 3DYOA 5I79A 2W66A 2WMFA 2ZXBA 1E6RA 3WDRA 2E4TA 3QHMA 1VEOA 3VGBA 2XSBA 3WBAA 4AMWA 1R8LA 1US3A 1CZ1A 1UASA 4JCLA 4PUEA 3SCOA 4XB3A 3ARPA 1UD2A 1ISWA 4UZUA 2G3MA 3BAKA 4J3TA 2V5CA 2QPUA 1B3XA 3W28A 5GQBA 4AZGA 1EDGA 1EIBA 1AVAA 1E55A 3VIKA 4NX0A 3IAQA 2CERA 4Q7NA 1E43A 1GZJA 3PZMA 5D4YA 3LPOA 3F5LA 2ESCA 4D6GA 4UQDA 1WAWA 4BQ4A 2X0YA 2WVTA 5D8ZA 3KZSA 2F2HA 2VRKA 1UA7A 4A3YA 3EDFA 5I24A 4C7GA 2DSKA 5M3WA 1IV8A 1M01A 1BYCA 2A3CA 4AD4A 3VIMA 3A4WA 1HL9A 1E9LA 3WH7A 2VQUA 1HJVA 3CO4A 4QLLA 3WF4A 4ZENA 1YQ2A 4X0VA 1J0JA 5IXEA 2VNCA 1O7DC 2X05A 4P7NA 1LLOA 4U3CA 1E4NA 3W53A 3PZGA 4QCEA
chains in the Genus database with same CATH superfamily
1WEJL 1RJLB 1PWLA 3DJZA 3T9WA 1CQKA 3LQLA 5FM4A 1BTCA 5GNZA 1BVZA 4ZOBA 4NO0D 2X1QA 4MGGA 3ET9F 4X6DA 3HS0B 3CL7A 1GIGH 1ICTA 3PUOA 4IX0A 4C6OA 3GTNA 5EPMB 2OWXA 4PB3A 3WFEL 2W79A 3EGDB 4FP8L 3ZOAA 4HJUA 4B9PA 4NJGA 1W5QA 4AQ1B 1A7OH 3LCGA 3GR7A 4C1NA 3IJEA 3V8OA 2HMCA 3G6JA 1D9KB 3CWNA 1T2QH 3VA2C 4HTBA 1THCA 4PRPE 4WEBH 4YYFA 1L7IL 2FJHA 3M1CA 3S2CA 2VH5L 5I6NA 1SHXA 2A0LD 3DFOA 1VFMA 3EMCA 2VLKB 4CVZB 4QD2E 3RBSA 1CS6A 3ZXAC 4AY1A 4KFPA 1AQMA 2NZ1A 1LEIB 5AHLA 1KYUA 5D9MA 4O1CA 3QORA 1WPCA 1YPZE 2NY4C 5B3JE 3GSWA 3W0WA 4MIMA 1IGJB 1SVZA 2V2XB 4G8GD 1UKTA 4D0CA 4Y5XC 2P5EB 2DQEL 2YDRA 2P7TA 4DFHA 4LSRL 4NDMA 1RY7B 3OGOE 1N68A 4XHJD 1GEQA 2OEKA 2EC9U 3R6IA 3RU6A 5CBBA 5J04A 4LPWA 3IS0X 3EXSA 4LCQA 5JIHA 2HFFB 2J27A 3VI2A 5C2GA 5DCDA 3FMGH 2F1EA 1B0GA 4DUVA 5IMLA 2BOEX 1V3LA 5F7UA 1UVQB 4J2XA 4DEPC 1QHZA 1RZ8A 1ZSDA 3IDJB 2K9UA 2VZTA 3FRUA 1FHLA 2XDFA 2OXHA 3AG1B 2VABB 3NG3A 2O1AA 3BSZA 4LC8A 4LY4A 5A8QA 1NJ9B 3C09C 4OJEH 5ABEA 4LSBA 1BOYA 4DJEA 1PZSA 3R06A 3QUZC 3FTXA 1U8MB 3CHCA 4GNKB 4WFEE 3TMLA 3AY2A 5EZOL 2JCCA 2YCEA 3VGHA 1OM3L 3QZWA 3TLQA 3WBAA 4PCNA 1NZRA 2JELH 2UWEA 4MB4A 4WWKA 3F5JA 1VHNA 5BZWB 2ISFA 5I23A 3ZRFC 4F33B 3GRBA 1DIKA 1V7ML 3UJEA 1A3HA 3C08L 4X0NA 1TV8A 2NX9A 4O52A 3B3DA 1NCIA 2DWXA 1AACA 3RFRA 4AM0Q 1NBZB 2VMEA 3LS4H 3SDDA 1LE9B 3KP0A 1OT4A 4AGLA 3PZNA 1LOLA 2IUZA 1KGJA 2WWCA 3RWIA 2PDFA 4FN0A 3G1DA 3C6LD 3FSAA 5DRXB 2E7LC 3MRPB 1E8WA 1YNKL 3ULAB 4AGMA 5CCKL 4M7SA 4FABL 3NRFA 4HNNA 1EAOA 3W6LA 2A1WL 3AW5A 4H88L 3HE6A 3NYKA 3PZTA 5SWQB 1PNDA 4AT6A 1KFJA 3H2NA 2YUVA 3S36X 1SFSA 1TCMA 2AJZB 2G95A 1DEDA 4GSDH 5C0AA 4S0HA 5E9NA 4QRRB 3TH4T 4MLSA 3GFUA 3QTPA 4FALA 1JS4A 2JI1A 4M7LL 2OX1A 3RVWD 2WHMA 3BZJA 3QVAA 4PJ5E 4X8CA 4ZNEE 2G9KA 3DFQA 1F3JA 3EYVB 1MRFL 3P3TA 2DEXX 4L1TA 4XZ4A 4AC4A 4BHUI 5IFJB 4LO9A 4HNCA 4UCFA 4CEXC 4EWJA 5CQ1A 1QRND 5DMGD 2Z1SA 4HCRL 3HAEH 1OGSA 4LK4A 4QWWC 1MAML 2GUOA 4KOBA 4WUUB 4NKOB 2FBJL 3W11C 4GHRA 1AOHA 2VN4A 5L7XH 1WISA 3NDYA 3GSXB 1H8SA 2P8MB 2XWTB 4WK0B 3SQOL 1ISXA 3T0CA 4AMCA 5LQBL 3NIFE 4HNOA 5G4HC 1JFQH 1UC6A 3QUML 4MJ6A 2ZRUA 1QFUL 4KZEL 2VQTA 5FUZL 2GBUA 3L5MA 4X42A 4WWOA 1KB3A 4NWUL 1MAMH 4CRPA 1HO4A 3R5EA 3WF3A 3UPRA 1U9KA 3OKEB 1GPFA 3GE7A 2CLPA 5G1TA 3TSBA 4EK7A 1RK5A 4M24A 3SZ6A 3BFWA 4TNGA 5HYJE 2XSAA 1YY9D 2JQXA 4WNSA 4R90H 3KBHE 2R8SH 3NIGE 3H9ZA 4AEFA 1BD2A 1I7ZB 3LB6D 1EHAA 3DYMA 1G9MC 1T20B 2IAMC 3CXFA 3KPNA 4JRLA 1WD9A 4TF4A 1QR4A 1IBGH 3LCFA 4G7EA 4PUJA 1FP9A 3IDIB 4MY1A 1LM1A 5D30A 2LT9A 5K9DA 3KL3A 2VEIA 3ZFHA 2VN6A 4C55A 3TVMC 1QZNA 1UR1A 2DZUA 4NT6A 3FO1B 4HQQH 1I2OA 3AXXA 4Q8QA 1T21A 3IRZA 4KWSA 4NERA 2GWGA 1TZIA 4D8PA 1EHLH 1BZEA 1YMMA 3N85L 3SSJA 4NJHA 4I8YA 3I50H 5A6JA 1MIEL 2L0DA 1KC5H 4LGRB 2DWDB 5GJTH 3ZE0E 1MEWA 2B1AL 1B57A 1JZIA 4Z95L 3O3RA 4JHMA 3ZJ7A 2BBFA 2EECA 3GD1C 4XPFH 4FZIA 4Z08A 4EZLA 4WI3A 5KZCD 2EDBA 1VADA 4KY1H 1N55A 2RAGA 4I9TA 5IBUG 3MN8A 1FWNA 3CU1A 4OU3A 5DXWA 1F6PA 1TZGH 2GAZB 3KBWA 2B4CH 4JMNA 1JPGB 4NY2A 1Y1DA 4GSRA 2EF9A 3THAA 4G80A 4GNJA 2ROYA 1UC5A 3DIPA 5DEFB 1KM5A 2V33A 4UU9A 1FKWA 3ATYA 3DUUB 4UFIA 3OKMA 4ECLA 1A7RH 4EUPA 2WLYA 4HAFA 5KBKA 3KLHD 2X0UA 1A49A 2XPYA 2AJSL 3NTYA 4H9ZA 4F1SA 5IMMB 4XMVA 2WC4A 3QHNA 4XAGA 1UM5L 2HJKA 5GIRB 2CQVA 1RQ5A 4G8FA 4IKKA 1P0EA 2NXYC 5D1XB 2WBJB 4IOSA 1A4MA 4OHQA 4PGLA 4V27A 1ZGLB 1QPOA 1K85A 3MBEC 3U5UA 3TZVB 1P4IL 4CQDA 3C6SA 1EAJA 1JXDA 4JZ5A 1NANH 1GVIA 4FE9A 4M93B 3WMPA 3J8F7 3SOTA 4MDJA 4Q33A 3VIPA 4B9CA 1UD3A 3DXAD 5I66A 2JI2A 3PL6D 4O9HL 2WKGA 3EJQA 2C9PA 3JZYA 4WWKB 2J20A 1S9WA 3MSRA 3S42A 1CN4A 2AC0A 5EZIL 5AVWB 2A83A 3EJTA 1P69B 2ODIA 4JKPL 2JFEX 2P1FA 3UBFA 4HPXA 2O61B 4RRPM 1Q8AA 3OYXA 4NUQA 4Z23A 1L9MA 3WNMA 3W26A 4Y4HB 5KZEA 3CAFA 4S1DC 3UGUA 4D9RD 1D7DA 3LN4A 1DFXA 1WF5A 2VLKD 3NJXA 4GQZA 4LZKA 4PRHB 5E2UL 4TLKA 2Z8WC 1DWGM 2P9RA 2MCMA 1OF6A 2PUZA 3LZRA 1OAUL 3P0YL 5XIMA 4X22A 2VAAA 3DKHA 4GS7C 3VFSA 4AYMC 3NRQA 3QEGH 1PU0A 3ID7A 2B59B 3WUWA 1F76A 3IJDA 4RNHA 2G41A 1ZHNA 4TLTA 3IACA 1QTYT 2V9UA 4DJMA 3R79A 3UU0A 2DLIA 4ICMA 1C90A 5GGRB 3MV9D 5F7NC 1MREH 2BJMH 1IKNA 1Y07A 4FQXC 3FQNA 3IDGA 2ZNWA 3SM0A 3BPCA 3FC8A 4URTB 2DTML 5TBOA 4D8ZA 3WIIH 3TN5A 1A0QH 1DQLH 3JV0A 1E6ZA 2OAAA 2KLSA 2KAUC 3WQEA 4Q9CA 2WHKA 4J40A 4AQEB 4P59L 1RP9A 2NY6C 3STBA 1NTDA 3UAJA 3MU7A 3QRGL 3Q2WA 2PLJA 3WFDL 4KRMB 4JFEA 1FXQA 4JW3A 4QBXA 4DJDC 3BIKB 3KDOA 3GXMA 3IN2A 4IFOA 4X5XB 1MAJA 3MCLL 1AL7A 3CBJB 3QNYA 3ES6A 4GIEA 3IPEA 4E42A 1PIFA 3FT9A 3FNDA 4RPQA 2VDOB 2WMPB 2M26A 3L5HA 3LPPA 1JZFA 4EOUA 4BI5A 3DGGB 1NLDL 4M19A 5AUMB 1KYAA 4JFZL 1IT8A 2BVOB 2X7LA 3OHMB 4RGNC 2PA6A 3TJEH 3G3MA 1UCWA 1ZLVK 4RW3A 3TC3A 3GBNH 4Q8VA 3MXWH 2ZYSA 1ASQA 5FW8A 5T1KA 2ZDRA 1ZCOA 4A37A 2GBAA 4PL2A 2DYRB 1BQHG 1KRAC 1KD0A 1AD0B 3VD0A 2AQPA 3V7AE 4PHZA 3SKUD 1QSFD 1L9NA 3TT3H 3U7WL 3H9SB 5EU9A 1B2YA 1NCAL 1JHKH 3MUGB 1G43A 3V0HA 3SCNA 1UJTA 2G3ZA 4NUPA 2Z1VA 3H4FA 5FJPA 3T3MB 4XTRD 2O6FA 1U92A 4QO1A 1B3WA 4JM2C 5I8OH 5H8PA 3WY2A 3RWGB 4F5CE 3W00A 3KBSA 2NRDA 2DQUH 3II2A 4G7FA 2DZWA 4LVNB 2P0IA 1PF3A 4I9WE 2CMRH 4PJ9B 1ITXA 4MLIA 1YDNA 4MZRA 4R0LB 2JJWA 1FLTX 1AGBA 2X4OB 1B4JL 4FD0A 5F4SA 5EO0A 3IAGC 2ZG2A 2X4TB 4LPVA 3AQZA 5FI8A 4HGWB 3SJVE 3S5LG 4JBRA 2IV9A 1V54B 2VLRB 4NAJA 4AIEA 2UY3A 3Q43A 4C6PA 6CGTA 2WWNA 1U8JB 3LNFA 3D0LB 5AL8A 2IANE 1DN0B 2HLFD 1JERA 4ZE5A 2X4OA 2H6UA 3LIZL 3VFUA 1MRCL 1ZXQA 3WO4C 2KX9A 3F2BA 4AQAB 2PYEB 3IV8A 4XMZA 3FRPA 3W39B 2CAKA 3WFZA 2E6DA 5JHDE 1JZHA 3W0WE 4XKYB 4PRPD 2FB3A 4DUOA 5CG0A 3RITA 4LMQI 1Q6RA 1OGTB 3VDCA 3UZXA 2Z4TA 1JZEA 1T83A 2AEQL 2APWA 2GITA 2JXMB 3MLTB 4K71B 1A5UA 3VQMA 3IJSB 2NZLA 1G7PB 1QI5A 1MVUA 3H2PA 1D5XB 2P48B 3DMMA 2GK0A 4QJ3B 5KOMC 3VG9B 3PJLA 1EX0A 4BQBA 4PY8J 1AD4A 5FYLH 1JPST 2ADFL 5DD0H 2A1YA 2WB5A 3CVDA 5LNEA 2O5XL 3QFEA 3MO1A 5T1DH 3TBYA 5CHNB 4ZTPH 4CNTA 2VGBA 2ADGB 3OKNB 2R0WH 5XIAA 1QMUA 3ZHLA 1E4JA 1M7UA 3IIVA 1XL6A 3PNZA 4OKVB 4ODBD 4TSCH 4P5TC 4U3XA 2GVJA 5TTRA 2VFHA 3MKCA 6XIAA 3FTYA 4OM0H 3UWQA 3L5AA 1UT2A 3BE1H 2ZCHH 3KLQA 3LVTA 1LLAA 3BUDA 3MO1B 4PLKD 4HUCA 1DE6A 1GTHA 4ALDA 3RCMA 1UWTA 5GGSY 3HAEG 5I18H 5FOJA 4P5TA 4K9EH 3AIVA 1OAXH 4PJFF 4KMTL 2Z8RA 1DL7L 1T7YA 1DANU 3NJLA 1O7DE 2UVEA 4XOAA 5E4IA 2HMIC 1Q65A 3WF1A 1WBZA 3B40A 4YBQC 3NP3A 1C1EH 1J0ZA 4HEPA 4PI2A 4WDXA 1A6AB 4NYYA 1A3XA 4UOW1 3BSHA 3JUZA 4UIKH 4D3CL 3AIQA 4ZUVA 3OU8A 4KUCF 5ESQA 3SAZA 4FTDA 4KVCH 3SI9A 4JG9A 5H37G 4MPKA 1TX2A 1J5HA 4M4RA 2QAPA 4NP4L 3OR7A 4GC3A 1JNEA 2IXUA 1KBJA 4GQ9L 2DSZA 4AEIH 4JMXA 3M6YA 3E1F1 4Y9PA 1OSEA 4N90D 3MY9A 2QUTA 4WOQA 3O2DA 5CJNA 2SEBA 4FMKA 1C7TA 2P88A 4RDZA 4GBXC 1D6VL 3EO9L 5IVZB 1BLNB 4OV9A 3KBMA 1IAIM 1KJVA 1EO5A 1HINL 1OPGH 4GRWF 4BZ1A 1JRHH 4MYPA 1LE5A 1W16A 4KVNH 1E4IA 3IK4A 3SY5A 3JZ7A 2WXLA 4AZ8B 2AK4D 4ZUWA 3TO4A 5AVVB 4EDWL 3IMBA 1IC4H 3KGUA 1B3OA 3D3AA 4FFVD 4AJWA 3QN3A 2OX5B 2OMNA 2O7QA 3FLUA 4MB3A 3W1ZA 1KYFA 4W4NA 1EDQA 3CN3A 3ARDD 5C0BE 5F9OH 3RYMA 3CB3A 5D2LB 1V7NH 4DCQA 2DW7A 4HJJL 2PDNA 2P80A 5BRZA 4LVFA 5I3KA 4FP8H 4HU0A 4S3AA 5IEHB 1UA6L 4DO5A 2VFIA 3M0ZA 2F6UA 2PDWA 1NFDF 1C5DB 3ZIZA 2G2PA 2ZA3A 3B3IB 4KWWA 5L9DL 5I1AB 1OSYA 4LRSA 1U3HD 3LRLA 3B83A 4MTMA 2OLDA 1J88A 1KM3A 3MMTA 3GH4A 2OVLA 5E09A 1EPFA 1XGYH 2OYKA 1ZHKA 2ZRXA 3ES8A 1OTUD 1RUQL 4KITB 4TOYL 3ZR5A 4WU7A 3CLFH 2XUWA 4G72B 1VCVA 5A8PA 3G5ZB 4P06A 3SGUA 4URIA 1UOLA 4C65A 1OCJA 3PUUA 4ZYKB 1R9ZA 1H6UA 1TPH1 2REQA 3PFRA 4IP7A 1IQDB 4JY5H 4JKPH 3VRLF 2WD0A 1TR1A 4WW1B 4RV8A 2V37A 2W88A 3ZJAA 2ZJSH 3X2QB 2A5HA 2DI7A 4JCWA 5DWPA 3Q06A 5EU7C 3HBLA 4OD3H 5K2ZA 1LQSR 3WUEA 4HMDA 4KK8D 4NNAA 1GC1C 3VGAC 4PJAF 4UILH 1FIGL 4ATWA 4BFIB 1S2CA 2HKAA 1NC2B 4NPYB 3MO4A 4O4VA 3QJSB 4POZC 3FO0L 3ASWA 3LV3B 4FG0A 4PS3A 5DVKA 1FIGH 5E9DA 4QOKE 1I2QA 4DN3L 2DQWA 2OZTA 2J5LB 4IOTA 3VGFA 1EBPA 1GT8A 4Y16D 1MUCA 3STCA 2X3AA 3H8AA 4PJ5D 5MHBA 2F68X 3QCUH 5ADOH 3OBAA 2HNHA 1HYRC 1VGKB 1SOSA 3SECA 3QZNA 3ZHNA 4DYKA 3AGVA 1BSIA 3O4LA 5FL1A 4P46A 5MENA 3QXUA 4UF7C 1TETH 3EBIA 4XC3H 3SY0B 1AC0A 2NNAB 3T1WA 3W37A 2Z29A 4RNIA 5HJLA 1YAIA 2H32A 5DFAA 3SGEH 4WI2A 4N8UA 4XPAH 3U2IA 1EP2A 5BQDA 4AUUA 1S5TA 3PPSA 4UT6A 5C0DB 2C14A 2XIMA 1E5JA 4KZDL 3SBWC 4A8NA 3CMOH 3W70A 3VE9A 2QFPA 3FQUB 5FO7A 4PREB 3Q2CA 3VM5A 1KM1A 2ATSA 2YLLA 2LABA 2XN9E 1S7VB 5K1VA 1X1ZA 1ANUA 2WJFA 1BVLB 4Z5RA 1L0PA 1PIGA 1KYOJ 2VR7A 2FZ3B 4YUEL 3LMJL 1KKOA 1R2RA 3BAWA 2YMOA 2IANB 1YZZA 1KGXA 4O58L 4XPTH 1ZLWH 3WIFB 4ERSH 3VDBA 4AAJA 4BEUA 1CT8B 2VDML 1EBGA 3S46A 1THAA 2QDWA 7REQA 2X0SA 2L3BA 3AAMA 4A7QA 4KHTL 2ICWI 4MASA 4W9LC 2GJJA 4UDTA 4Z5RB 1TTBA 2NXZD 5FWQA 3S6OA 4OZ4B 2YKLL 5IESH 3JT0A 3C6LC 1QOQA 2PO6C 5KBPA 5LNGA 3IGUA 4CMMB 4RAHA 4XP6L 3LN5A 3WN6A 4DH2A 5C8JB 2Q8XA 4N2YA 2DQIL 3P93A 4JLRA 2PRHA 3NO1A 5CZRA 3PUDA 1BAFH 1WWWX 1RPKA 2GW5A 3Q3GB 1TPXB 5C2UB 2GOUA 4FIRA 3FU9A 3O6MH 5MENB 4KNQA 1PVNA 2Y0FA 3NQVA 5HINA 2ENYA 1K4GA 4QRRA 3SGJA 2DZAA 2QDDA 3OTRA 1E28B 1T22B 3EOTH 3HG2A 3ITLA 2Q2EB 4M7JL 5F7KC 4FMFA 3MV7E 4IRZA 6TAAA 2WKJA 4C5YA 2ZAHA 1SDDB 2QBWA 4F9PA 5GNYA 1QZ1A 4U1IA 2FSEB 5I02A 1N8OE 4PRPB 1NP0A 1E30A 2P5PA 1H7XA 2Z7GA 3CUHA 2RFXB 1UG9A 4MA7L 4L1XA 5JU6A 2MKWA 5E00B 1E70M 1KN4H 5E23A 4ACPA 3H0TB 1U6AL 3SPJA 4PJGA 3TGXA 1Z5LB 5BWAA 4RZCB 3M7FB 1Q9KA 4XMUA 3LLFA 4GQQA 3SDAD 3WE6B 3NQMA 3WLHA 4O5LH 3CG8A 4KNTA 5JBFA 1YEGL 2PYEA 3A5VA 4OJDH 5IWLC 1NTHA 4M81A 1EANA 3HZVA 3TBBA 1C29A 1BGXH 3WJJA 4GISA 1F3TA 3ARUA 5AOIA 5DR5H 4S0SD 2YMTA 5B3NA 2JKNA 1XGRB 3BW9B 3EOAA 4G6JH 4KAQL 3N14A 3A23A 4XKMA 2R9HC 2I1OA 1L9PA 2E9IA 3OAWA 5IG7A 4PVNA 4KCVA 4R96A 4UTTA 3T4YA 3P7YA 3SKJH 4HSOA 4X7CC 3KDNA 1SUJA 3I9IA 2BMKB 1X5LA 2PTTA 2HNEA 4YK4B 2ZXCA 3RN6A 2JKRM 4YL9A 3TWCL 4DN4H 3CUFA 4H2HA 3S2AA 3QRHA 4Y4HD 1FCQA 2X1RA 2FD6H 3MV8A 4D72A 3W2DH 5CJOH 2NX1A 1WITA 2ZVIA 1UT1A 3H9SA 4U6XA 3WLSA 3MLVL 2NSQA 5AZ0A 1FLRH 2H32H 4MMZB 1PX4A 2LAAA 5HYIA 5KYYB 2OI9C 1HSBB 5LN4A 3DFHA 4V1XA 4UTKA 2VLME 4QTHB 3TZFA 3CQHA 4XR8C 4P9HH 5T3XL 1U2YA 3I9GL 5C0BA 2EVFA 3PTMA 4JIQA 3VXRA 1TVBA 2BP0A 2UV8G 1GZQB 3MA9L 1A1NB 1CIUA 4M8VA 4YDKL 2O9RA 4LKXA 2QJIA 3QW4B 4DYJA 1AJ7L 2ZUVA 3MRPA 4HU8A 1K8ZA 4PW4A 4UBDC 2VDLB 5A95A 5IW1A 4LF3A 4PH8A 5E2WL 4N0YH 2I7SA 4GQGA 4WGHA 3STLA 5DZ9A 5EN2B 5C07A 2PF0A 3LCIA 1SMDA 1RZQA 3ESUF 1G7UA 2ZKYA 2HRGA 3MLRL 1UEYA 5AKSA 1FWSA 1R3HB 5BNXD 4WK4B 3C0LA 3WNKA 4JM4L 1TV4A 4XD6A 1UQYA 3NL3A 5DMGC 5CCJA 1IEAA 5D1ZB 3JTTA 2YZRA 4NO2B 4EZJA 8TIMA 4Z2HA 2Z1BA 1BYOA 5C3TA 2ZCZA 4D8OA 4MS8C 4U0RC 3VI4B 4WENB 5CD3B 1NCOA 3IU4H 2FUTA 3D3VD 1XGUB 3QUXC 2MOVA 4NN5B 2NY0B 1IAKA 4UM8B 3LH9A 5CP7B 2ICEC 3P69A 4D9RE 1TQJA 2WUBL 2O26U 4XWGL 5TE4H 2A4AA 3B06A 3P2TA 2BLFA 4MJMA 5C9ZA 2AAAA 2F53B 3N13A 3QLLA 4NYUA 3PIQA 5CN3A 1RALA 2LQRA 3VSUA 2FUQA 4NN7C 5CFAA 5JYLA 4DYEA 4DK6A 5CLXA 3GXFA 4YN3A 4G9FB 4TQIA 1GC1L 2MTAA 2Y36H 4V33A 5DA0B 1X9RA 4V11A 1IR2A 1VBHA 3VXMB 2BSDA 5DLLA 3ZDWA 3FYOA 2ZXEB 5GGSB 4QLKA 3WD1A 4BGLA 4BZ2L 1UWEH 3BJFA 4O57A 3N2OA 1XBYA 3PG2A 1A6PA 5DJYB 2VFGA 1OP3H 1AH0A 4OZOA 3W6MA 2DTMH 1RULH 4XVTH 1UWUA 4LH8A 5HHXH 1EJSC 3L5WB 2NX5A 4YNGA 4PRIB 5E8NB 1E40A 3MUXA 2AERT 4OZ4A 4JO1L 5C0IA 1F58H 3BZ4A 3GXDA 1NP2A 3OG2A 1X5GA 1XCQA 4PB0H 5DQ9B 1DLHB 2I26N 1FAKT 4KJQD 1AOZA 1DJNA 3UBGA 4N2MA 2I07A 2DYPD 4BQ8A 5B4MD 1FUNA 1T6VN 1SLXA 3CFDB 5JHDD 5JVLA 2CBTA 4F8OA 2WTRB 3M0IA 4TNWK 3PFMA 4M3HA 4B3VA 2OOGA 3F6LA 4AYSA 1K4DA 1SYVA 4FA3A 3ECQA 3T0EA 2D24A 4QAWA 2X4SA 1IC4L 3CN0A 1UZ4A 4XXWA 4PJ8C 3B0YA 1FNGB 1EL3A 3L5LA 1F6AA 2GQ3A 4I2XE 3UTTA 1UURA 4JZOB 3VD9A 1JG9A 4OTXH 1AUSL 1N2VA 4BHYA 1PCWA 1LO2H 4RISH 1OARH 2NXIA 2NNAA 2WANA 5G5IA 4FQXD 1FDZA 1QA9A 5ICZA 1LEGA 2PZNA 4K5NA 2CWXA 5C9UA 4TSAH 1ZWIA 4W4OC 2XYCA 2B3IA 4N5ED 1J1OL 2DV0A 3K5SA 4CC0A 4E0RA 3PTQA 3TQVA 1NEYA 3D48R 1XAUA 4RDVA 1KYDA 2DI9A 5JBEA 1HH9A 3OVRA 3V0DA 2QKIC 4LBEB 2NUPB 3MJ9L 2WSRA 4QRRE 1BG1A 5FKAA 2NX5D 4L4VD 5T3XE 1AFVL 2E74C 1Q7ZA 3WD3A 2KBGA 4N4YB 1CI5A 4JQ2A 4JDZB 3U1PA 1XGYL 2DKMA 1DXFA 2E0PA 1BAGA 2A5UA 1E67A 1MRDL 4X5QA 1RPUA 3HQ1A 3LUTA 4H41A 3WNNA 5BMFH 2ZUQC 4LKCB 3UT0A 3P5ZA 5TF0A 3N9GL 2CDGB 2X2GA 3G5ZA 3DIVA 3RA7H 5JIIA 3OSVA 1JF5A 4MKTA 4AJ0A 1BVOA 2CBMA 1J2WA 3HE7C 4DP5X 4HK0A 4XD5A 4N68A 1NCCH 3F1QA 1VFBB 1DJQA 2WJZA 1OGAA 2OJPA 3TO2A 4XAFA 3GUTA 3UWVA 4XN2A 5EBAA 1K4DB 3BKCH 1N4XL 3MJ7B 4ADIA 1MUJB 2ZADA 4M3PA 3D3VA 4NP9A 2ISWA 1Q94B 1K72A 2WZ5A 3C60A 4QEGA 4F24A 3H7RA 3KDMA 7A3HA 1R7OA 1Z0NA 4XNYH 5T1DL 1A1MB 3M17B 1IO4C 2ED9A 4N7QA 4AXNA 4Y1AD 3UZEC 4FB7A 1MFDH 4Z7UE 3N1AA 3FB8B 3WLWD 4GW1A 4F8PA 2AL2B 4P7LA 5IBXA 1RJPA 1G6RA 1Z9PA 4E0RB 3SDYL 3GZ3A 4AD0A 1QASA 4GMSH 1YO4A 1JL8A 1X5HA 3O7UA 2ALRA 1KCVL 5FHAH 2LTQB 4OQTL 2QIWA 9CGTA 4K3JL 2V7HB 3VG0L 5PCYA 4AC2A 4QHPA 4AQZA 1BHGA 4CW1A 4YXKL 1AH1A 1ADOA 4L4OA 4ENLA 1MCNA 4H9VA 4LQFL 3BX7C 3FUIA 2WTPA 4LAQL 3UTZB 3M64A 5KTLA 1UCBL 3ESOA 1K7FA 3FHEA 4AV4A 3N42F 4UTLA 3WF2A 4R34A 1LDPH 1BQKA 4AVHA 1M05B 4ZXBB 5A40E 1R3KA 1PD0A 3KYKL 3PIQB 1F02I 1RKRA 2X3BA 2QELA 3QDJA 1LL4A 3HRZA 3I6KB 8CGTA 3W38A 1YPIA 5HJ3A 3N18A 2X4NA 1MHPH 5HYFA 1YDPA 3PWLA 4MWAB 1YMHB 1YUHB 5IVXF 3MV7A 3RWJA 3DXAE 2H3XC 2EXTA 3N04A 1A7NL 4ADGA 1T8XA 3MV8D 3KM1A 5DJDB 2EUXA 2KZWA 3KOYA 2PXYA 5FCZA 1E8ZA 2HXAA 2P0OA 4LAZA 1CL7H 4GNVA 1WA3A 2EIZB 2F7PA 3NZQA 1GZHC 1XISA 2HROA 3CS2A 4Y1AE 1S1RA 1LLWA 2J7CA 1ZTXE 3BEVB 2FQFA 2JEPA 6A3HA 3EEGA 2EYRA 3K91A 3LTVA 2IDUA 4LRIC 2FB2A 3MYJB 1A6AA 3GQFA 1AIZA 3AWFA 3U46B 4ERAA 1C7SA 3U2ZA 4YQXH 5K9KB 3CVIH 2FO1A 3QFGA 3MODL 4RWYL 1JYNA 1JSYA 1OK8A 2JJSC 3CCHA 2ZRYA 3PV6B 1KTLA 4AM0A 4ZMZA 2N1TE 4DERA 1C08A 1A1NA 3V1HA 3VNIA 3DSNA 1MRCH 4WWNA 3NQCA 4IHOA 2MPVA 5IROA 5C0BB 2XG5A 1P7TA 3NIYA 4M6VA 5K9KA 3EWYA 2DWEA 2ZP8A 3SPHA 4R8WL 3EYOA 1T6MA 3WG7B 5ADPH 5IEKA 1NFPA 1WGOA 3ABZA 1ITUA 5ABZA 4HJGB 2A3BA 2NQ3A 4ZFFA 4H0HB 4ZEPA 4LMQE 1IGYB 3TFXA 5IHUL 1WIPA 1EDTA 2J47A 1OO2A 1MFUA 4ACTA 4QG9A 3EBHA 4K7PH 4FQQB 2PXYB 2TYSA 3ZQWA 3ULVH 3D4CA 1U8JA 3OAYH 5IF0A 3LSOB 4HXAH 3HR5A 2EUZA 1MIML 4LW7A 4JZJB 4FF5A 4GXPA 4TUFA 4B4FA 4HVBA 1ISYA 3OVUB 4MXWH 5AAMC 3QLDA 4QE1A 5E6IA 4KCTA 1EVTC 2GTZB 1A80A 1I8IB 2GTQA 2J71A 1R3KB 1E6XM 1IEVA 4ZA0A 3HG1A 3HMXL 1E5ZA 1LGVA 3TBTA 3CK0H 3EKGA 2YGQA 4UTBL 3OLDA 1CB7B 4Y2WA 3DBXA 3GT6A 5EY5A 3BESR 4YHML 3VNMA 2JF6A 1FVEA 2YR1A 3E6EA 2FYMA 5E5LA 1A3QA 1LQ0A 3GU1A 1W9BM 2P8MA 2XWTA 5KVEE 3C12A 1NEZG 2QAFA 2ZKWA 5AVZB 1E4XL 4Z3HA 1JAKA 1SBSL 1GQIA 3T3ME 4HA3A 5GSVB 1XC4A 1KV7A 2VUKA 1JVOA 1WBZB 2WO4A 4KO9A 3JUGA 1LP9F 2R4SH 1MCOH 2GPZA 3QXVA 3M8OH 5E99H 2V2WA 4YAQA 5AB3A 2J56A 2V38A 5M95B 2CCLA 3FFOA 4U05A 3VFGL 2Y9RT 4E9LA 2L7EA 4R5TA 1Z9OA 2A6NA 1R4XA 4JHWH 4Y8EA 1TQUA 4W9HC 1IWPA 3O9WA 2OZ4L 3FHAA 4PJ8A 4AX7A 2FSEA 1BCIA 3EG9B 4HG4J 1U8IA 2NVDA 3NWRA 1LWRA 3VMPA 5ID0A 4WV1A 5D1ZD 1M42A 4NC0B 5AOZA 1X5AA 3C5ZA 2GQAA 1CXEA 3OG4B 1RZ7H 4Y6GA 3SUVA 1VDGA 3FUKA 4OV5A 4P2VA 3G1HA 3CBWA 3QHFL 1ZLDA 3MREA 4L9DA 3T08A 1TSIA 4V15A 1MZYA 3FYEB 3O8XD 1TIMA 3STEA 4XN1A 4J1UB 4F7PA 1Q9LB 2GT9B 4XRCB 1X8FA 1XS2A 1V6UA 1FN4B 2W1NA 2CK2A 1US2A 3QZEA 4HU2A 3HA0A 1NDYA 3QHOA 3BP5B 4NZ8A 5JH1A 1J1OH 2XBZA 2I69A 1W2VA 4XAPA 3V6OA 3LU2A 1WAAE 1CWYA 2EPLX 4ZUTB 3PV7A 5EDXA 3P81A 4L5ZA 3VFUB 4NQCE 3P4NB 4BF9A 3OC5A 1EHLL 3GU9A 4FLSA 1M7XA 2IMNA 3OKKB 4Y16B 5FAJA 1OT2A 3KS0J 1ADDA 2E9GA 3VWJD 4Z1YA 1JRHL 3WIFA 3C56A 3TJLA 2Y1AA 2NUPA 1J1XL 5CZKA 5CU5A 5B7EA 2R0LH 2E40A 4ZSTA 2HK1A 1ADQL 4OLZL 2FQDA 4XMLH 3SGKA 1IE5A 4YSSA 1CB2A 5D2XA 3AGWA 4LOFA 1S38A 1QO3B 4QLRA 1TPUA 3WQFA 3FFDB 5KYXA 2QVFB 1ME7A 2ICEA 3EEZA 2MNUA 4QT5A 4XP5H 3NQGA 2ZNXA 4WIQA 3G1VA 4HYRA 1INEH 3QDGD 4GACA 4MLRA 4DKEH 1W9PA 4PBXA 3L1FA 3C2OA 4PMYA 8XIAA 2ATKA 4OJAA 2GSGA 1AQ8A 1FO0B 3C2RA 3BSGA 3KHDA 5F9AC 1TPWA 3MRRA 3MUGA 3ZWSA 2FZDA 2R1YB 4GZJA 1OTTD 2BV9A 4S10A 4HNUA 1DQQB 1LD9A 4PR4A 1NEZA 4QGYA 4XPGH 5L8KB 3HGSA 3MNDA 2ZX8A 2EJ1A 5FM5M 3X1BA 4CJ0A 5J11B 1F3XA 2R69A 1JFQL 5DHYB 5F1IB 3V6OC 1ZALA 2BLEA 3M5ZA 3FSUA 4BF7A 2RDXA 1KENL 2C6QA 3BQ6A 4QNPE 4BCXA 2GCYA 2VKWA 1YMME 3K3QA 3PGDB 5F1OB 3VQLA 4F2EA 3BKYL 3RXZA 4KMQA 2CJUH 4A2FA 3BZEA 1AW1A 2AQOA 4GUOA 1Q13A 2DWTA 3KDMB 4NWTH 4DGIL 4IL2A 2XPGB 5JOPD 1HCYA 2ZFAA 3M17A 1GVRA 4YN5A 5EBGA 1DKWA 4XZWA 4DTGL 4LNYA 4U1MA 2GJ6A 4QFUA 5FYLD 3FTGA 4F0HA 4V1DB 1BRLA 1J8HE 3ULUF 3FRPG 2JGQA 1KTDA 1WGVA 1CTMA 5A2LH 4AZUA 2KUTA 2ALDA 3SCPA 3DO4A 2YRPA 2LU7A 3OMNB 4PJIA 4AEEA 1QSED 1OLLA 2Z2AA 2W62A 1QNVA 1CLVA 2GAZA 4GSDL 1ZBKA 2UY6A 4H26B 4OW6A 3VTAA 1JPGA 1IQWL 3EA3A 1G1YA 1PLGH 4ZQCA 3RPIA 3TFKC 4PJDE 2V9DA 2GGIA 2AGJL 2RR3A 3L8QA 1J5OL 4L0PB 2CITA 4ZFQA 3BCJA 4AEIL 3IDUA 1VGKA 2J2ZA 3NPSC 4JIRA 4KQ4H 2NXHA 5M5DA 4P2CG 5C0QA 2DVTA 1CGYA 2P43B 4JDZA 1KTCA 1E4KC 5CUSL 4H8UA 4NO0B 4TULH 3U4AA 4CMHC 1XRTA 2MFNA 1ZAIA 4QTGA 2H3NB 3WKPA 2ZOTA 1XBRA 1CIDA 5MEPB 1W1ZA 4N0YL 3D18B 3IGHX 1IGCL 1U4FA 3CSBA 4H1ZA 1TLMA 4ELMF 4JYEA 4BH7B 3S4TA 4NWUH 2E9MA 2APXA 5HVHC 4XP9L 1NCGA 2V5BA 2OPJA 5F2FA 4LLUA 4O2FB 2DZBA 3W88A 5EFIA 5CBAB 1BD2B 1UIPA 3KPNB 2LFGA 2N56A 2HAZA 2VXSH 4GI8A 4YDMA 5D5MF 3VFPA 4JLRB 5ICYA 3WLNA 2RDWA 2O0TA 4J6RL 1IGCH 1LK2B 2D7MA 1OZTG 3T0WA 2PSNA 3N44F 5I6OA 3QG6B 1R3SA 4GXFA 4U33A 4W9KC 3MXVL 3WD5L 5BU9A 1OVDA 3GI9L 2L4OA 5BJTB 2P28B 5DJAA 4H1LH 1B3JA 1FORL 3I6GA 2ATMA 2QCFA 2ARWA 1LF1A 2N3JA 4DI8A 2V9TA 3L5IA 4HQQL 1H1ZA 4RLIA 4JTSA 3H2WA 2Z7ZA 2FK9A 1T5XB 5HGHB 4Q7BA 2V5RA 3ZVVA 2WUCL 5IDIA 3HUJA 5GJSL 2VXVL 1QVOB 3HN8A 1V3MA 4X9BA 2A1WH 4H88H 2R6OA 3ALWA 3FOLA 3MBEA 1F3JB 3EYVA 1Y6NR 1BPVA 1ZT7A 1A22B 4FX8A 5IFJA 1HILB 1S7TA 2IMMA 4RBPK 2F58H 1S7WB 1H5BC 3TA3B 2ZD0A 1FBIL 4H0IA 4NNPL 4QHRA 1XR9B 4E8DA 1ZT1B 3QJUB 5HHQA 3DTDA 3BUBA 4G9FA 4TMBA 3S2LA 4AOFA 3L16A 4PBGA 1MHPL 1TQBB 4MA3A 3TBSB 1YSOA 2QQKH 3KGSA 2QUMA 3FT0A 5HPCA 1JGEB 1EEZA 4ZTYA 1EKOA 5F88B 1NPUA 2F61A 3SY1A 2Q86A 4HHLA 5D7HA 4CVUA 1WBHA 4GRWE 1JDAA 1QSFA 2BSLA 3MLUH 1DWJM 4M7TA 4GRLB 1FRGH 1LL1A 1FRBA 4GQRA 1ZVSA 4C59B 4DBUA 4JKKA 1MQKL 3BVWA 4YHOH 2QT6A 4A7GF 4BA8A 1B31A 3EOEA 1Q1JH 4D6JA 3CFKB 3CPGA 4C6MA 3LRMA 2HCVA 3CZUB 5CGYC 1J8VA 5GISH 4HBKA 4K94H 2XG4B 4R84A 2WAGA 5INDB 1JNLL 1IFHH 3BI9X 1W72H 2ICCA 2REQB 2HPOA 2ZRVA 2ROXA 3ULVF 4D6HA 1IAMA 3H9HA 3WTWA 1OCWH 4JTHA 2N7BA 2PDJA 4YBLB 5GJSH 5CC3A 5DXYA 1IBDA 3L3JB 1A5BA 2FWLB 4OZFH 1EZLA 1KBGL 4C56D 4EZMA 1ZP4A 4MAZA 3ULSA 1SOKA 2VJ8A 1W6TA 1QFWL 1VEMA 3T40A 1XQLA 4DGUA 4JFHE 4DP1X 4E9SA 1C5CH 3GHSA 3WLQA 3RUGF 1QJWA 4KKCD 3EIFA 3C5ZB 5I1JL 3RNDA 2J66A 3CBKB 4YTSA 2IC2A 2G75A 3TWAA 5HHQB 3ILQD 3VZYA 1OINA 1HSBA 1GGBL 2GUOB 1OM9A 3QUMA 1TZZA 3LZLA 4XX1E 2AVGA 4MDIA 3MS8A 1TB3A 2IS7A 2N0MA 4NDMB 2MNJB 1MREL 2W63A 1I85C 3FQTA 2DQJH 4JN2A 1RXLA 4KUZH 2YBRA 1XHGA 3GRGA 3IJ7A 2A6DA 3QUXD 2Y69B 2WO2B 4KXCA 3T77A 3UBXI 1OIMA 1LEIA 1XIMA 5IFAH 4IQEA 3QQDB 1YC7A 3KW7A 2VLKA 4CVZA 4WEVX 4F8NA 5J57B 4QRUA 5FDWB 1QKZL 3MRDB 5KSBF 4L1SA 3HE6B 3GZAA 3H24A 2BRRL 4ZMXA 1AXIB 3UACA 4ZW5A 2WWMC 5E2TL 1TE1A 2VZSA 2GDUA 4HEMA 2DQCH 5FA3B 4EIVA 1EC7A 1O6SB 4ZSOE 1INEL 5JIMA 2Q8ZA 5FJOA 3PL6A 4CA4A 2OTPA 3DXAA 4MQ7B 1OFPA 1I1FB 5EULV 1Z41A 2H9AA 4NM8L 4GLRH 4YHYB 4W68A 5B8CA 4OWGA 5FKYA 1WBXB 1CBJA 1C5CL 1LWHA 1SY6L 3GJFA 1OCOB 1U8QB 1XGTB 1PCSA 2F1BA 5CN2A 3STZB 4HV8A 2DUAA 3GH5A 4JFZH 1LWJA 4ELDA 4CUCA 1KBWA 1KPRB 3DHFA 3MROB 2LLNA 4LSTL 4OZHA 3A6BH 5ELIA 3DU0A 1RD6A 1BFOA 3QYSA 2EKGA 1AS7A 1D5ZA 3M1BB 4NN5C 2J5WA 1KFKA 3AQDA 4WVXA 4PJFA 2RFXA 3HI6H 5C9WA 3DVNA 4PMVA 3H0TA 5ALBL 3K4DA 5HDBE 4X6CE 2I5YH 4MCYA 2QQLH 3BZGA 3MA8A 3SRHA 3RZCD 4G2DA 5JUEH 1XCTB 4WXZA 4IHOB 4JFVA 5HVGB 1P7TB 2VWSA 3GTHA 1T7LA 3OO2A 4QLJA 3UXIA 3U0TB 5D72L 5D2NE 2H8ZA 3EWZA 1IEBB 4E68A 5HYEA 4I5UA 1CICA 2GG1A 3LKNA 1FGNL 2F7FA 2QCLA 3QA3A 4UUIA 2X6AA 1E4XI 1FGNH 1Q2RA 1AIFB 1A2YB 3FPYA 1TWDA 1O9ZA 2DTSA 3D50A 4JFEB 2YB4A 5EO9B 1EYWA 4YHEA 2XN0A 2RMNA 1OXYA 2OMXA 3QUYB 4N85A 5T1LA 2Y07L 4KFMA 2P8CA 2ZTJA 4LC6A 3IJSA 1BEXA 3R7MA 3RDJA 1Z66A 1BG4A 2FDMA 1FZOB 4DEWA 3VM7A 5CJQH 3PWUA 4EACA 1DE4B 2R9RA 4RDWA 1IAOA 2YQGA 4TQ8A 4KKQA 1MDRA 4LCWA 5DJXB 1IGMH 1HI6A 4JN8A 1I1CA 3RX5A 4W84A 4ZQNA 4NQCA 1XDJA 2Q71A 4Y5VA 1A53A 5KBDA 1TUFA 3LBCA 3TSMA 1T6WA 4YVNA 3BRDA 1ZZMA 3DURA 3MJMA 4LEFA 4HS6A 2K78A 4EDXA 1BD2D 2VX7A 4LLWB 5MEQA 1QK2A 1W37A 4Z0BL 2W91A 3WIHA 4LVAA 4GW5B 4O17A 3TYAA 5CC6A 3E2RA 3RYSA 1KDJA 4UTWA 1DVXA 3NL2A 1UXWA 4H6QA 3F03K 2FIKA 2OV0A 5K1JA 4JL1A 1QDSA 2J1KA 3BDYL 3COTA 4WAFA 2Y7SA 1J5TA 3TBVB 1XUUA 4NC1E 1Z5YD 4XNDA 3VIJA 4BSWB 5DD5H 3QORC 1T0OA 3IPBA 3FJTA 4KWVA 1XF4B 1BZ9A 1FHNA 3QIBC 5HHOD 2ORBH 3N2TA 5D71H 5DYOA 3Q65A 2WB1A 3FUDA 4JRXE 3KLHC 4L37A 1ZENA 4GUHA 3HC0B 5DJZB 3T65A 4L4MA 3BPNB 5D7IF 4H6EA 3N25A 4CD7A 2XVLA 4UM9B 3LEXB 1YYCA 4O0KA 2DT3A 2BC4A 4WDUA 1UYWH 3LAFA 4OF7A 2X1TA 4XO6A 2L7QA 1INDH 3N1FC 4OI8A 1QRNA 6XIMA 4P23B 1DIEA 2Y1VA 4C4UA 2DFAA 1HAUA 1EEYB 2XN1A 5LGHH 4S3CA 4NRYA 2D8KA 3A47A 1XH3A 4NQED 3GNNA 4Y4KB 4LUTA 4RVBA 1WVZA 4IXXA 4XO3A 3STFA 5F97E 4KGJA 3LQGA 3F12B 3P77A 2GABA 3H7VA 3TN6A 4Q2ZA 2W3ZA 5AW6B 1BBJB 2AK4E 5IWLA 3PS7A 3W27A 1O68A 3D3VB 2D23A 2J1YA 5LIUX 3KRUA 3MHUA 1MEHA 4LEXH 4D2JA 4DWDA 3DROA 3ZMRA 1G6RH 4GVGA 4ZFCA 3T78A 3IGAA 4I0PD 1F3RB 3N85H 1T04A 2WMIB 2YJQA 2DVUA 4PU2A 3HIZA 3L7EA 3N1MC 1GW0A 4HDIA 3LKPA 4OBSA 4QXIA 1XEDA 4DQOL 2BASA 3NVTA 1XVSA 3TQPA 2AJXL 2OYPA 5SX5H 5DLMH 2WXIA 4DUWA 3RWFA 2YWYA 4IJBA 3UBHA 2O5YL 3D9AL 4RMRA 4A38A 3CHVA 3EB2A 4N9EA 3FNKA 3QFJB 2LE9A 4M7KL 3QC3A 3R94A 1KPUA 4IGNA 3TNMA 4JR9H 3OKYA 1T1XA 1NF7A 5EEVA 4NJJA 2YXWA 1VKFA 2A2IA 2R8SL 3MRQA 2XTJB 4KQ3H 4R4BB 2DS4A 4H25A 4WWKD 2HP4A 3BKCL 4FMVA 4U7MA 4YO0A 3SEPA 1KTNA 5DK0A 1HL5A 3HC4L 4QRPB 1HH9B 2J7EA 3I6LD 5IQOA 2WTOA 4KHXL 1RAMA 3UX9B 5M94B 2WLNA 3JV4A 2P76A 4GG6F 5DZPA 3TA4D 3F2DA 1I8LC 1CI3M 1V8EA 2WZTA 3U36B 3EGSA 2V67A 1VPOH 5B7MA 3UAJC 5J6GA 5BUAA 4UTIA 1W72A 1RCXB 3K4WA 3B8SA 4F3FA 4R4FL 3VVVA 1G7IA 4JRYA 1W1PA 5E5UB 5B39B 1BYDA 1W5MA 2Y61A 4NT0A 4NLHA 5IVNA 1KLGB 2Y7LA 3E8UL 3PS6A 3W7QA 7ODCA 4ZXLA 1J8SA 3KOZA 3S47A 4EN3B 3W7DA 3BLBA 3ARGB 4YH6A 5HNRA 3QJAA 5I3DA 1DYZA 5HJBA 1ZEAH 2VDHA 3DGBA 3NCYP 1INQA 1C12B 3GMLA 4ENEC 4HXBL 5CF3A 5JLZA 5KZ6A 1H3VA 4OJCA 2R29L 3O3EB 4JX6A 4DIAA 3L4WA 1GGCL 4AFYA 5I77A 2W0LA 2OGJA 1FX6A 3WSQL 5GS0L 4F92B 1EX1A 1OFQA 2G3IA 4LUTB 1I1AA 1JGVH 4GMTH 4NKIL 2UZYB 3QULB 4BWLA 5F3BA 1F8IA 2WZEA 1DQDH 2VLJB 5EZLB 3W0WD 4IU3B 1R17A 3GTVA 3ARQA 4P57A 2V3FA 5IB2A 3QGAC 4AHQA 3GC3A 4I85A 4ZS7H 5IMMA 4PY7A 5AOLA 1HIZA 4IMEA 5F6HJ 1ONQB 4X5RA 2IDCA 2H2PD 4YGVB 1VBJA 5DGQA 3VGAB 2ODOA 3FX4A 3WUFA 4Y4KD 5F0PB 4R3SB 4BFFA 4KKAD 4PH6A 1S3TC 3AB0C 5JIDA 1VYPX 1UMLA 3JUYA 4EF9A 2IPTH 5TDPB 3QMTA 4ZO8A 2C8NA 4EBQH 5KSUB 1BXNA 4PN6A 1AZCA 4UNTA 3QDHA 4L3EA 3P73A 3D87B 1A0QL 4WDIB 1A3WA 3PUEA 1IGIH 2D3VA 2BVOA 2X7LB 3FRUB 2IPFA 3AXMA 2PWDA 3UZEA 4IHBA 2DQHH 3OKOB 2FTAA 5HGAA 2QV2A 3TQ0A 4FSAA 5ABHA 4HTYA 1JOIA 5D33A 3GS4A 1K3IA 3MTWA 1XLBA 1G1OA 2Z35A 2AK1L 2UWEF 3F62A 2BNRA 5D55A 4JEJA 1QCWA 4XWOD 2H6OA 1BZ7B 1RUKL 4O1BA 4LDCA 3DMMB 4YXKH 4IZGA 4P2OB 4N22A 1TG7A 3QG6A 1OFEA 3FU3A 3D4ZA 5CZVL 3B9AA 2PDLA 4DWSB 5I07A 5KETA 3M0HA 4JFHD 4NQUA 2OMVB 3CH8A 5E5RB 5H2BB 5ISZB 2B1HH 2ENJA 4QS5A 4GVIA 3AITA 2F7QA 5CEWA 4R2GB 5LGKA 1IE4A 1I9CB 3V5HB 2WK2A 4ZMYA 2GPTA 3WIHL 1SM3L 3WGVB 2A7RA 1L5GA 4Z7WF 5AYZA 3MOAL 1U8KB 2CE6A 2IBZX 1X5IA 4H2AA 4JDEA 4HGWA 3L5JA 1CXKA 4X7FC 1TTJA 2D20A 3O15A 4N8VA 3CVHB 4R7OA 4GIOA 4XHJC 3AHZA 3WL0A 4EPKA 1P6FA 2HVKB 3CV2A 4PLKC 3RNQB 2W9DH 4QRPE 5DHEA 2DIJA 1GZQA 1TZAA 4YDLB 4PC8A 3SCUA 5GRVL 3HPJB 4ZW3A 5DCEA 5J9PB 3DUSA 3U7BA 4UTBH 3VFMB 4CCCA 2APFA 2F7IA 3TO4C 4LHUD 3X1FA 3U0PA 4GVHA 1ODUA 5HY9B 2D2GA 4KEVA 1VCAA 3HLKA 3KPSE 1XWYA 5JOFB 5BXRA 2FJFB 1IC7H 1AS6A 1LXMA 4ELKA 5BCAA 4PGCA 3B04A 4POYA 1VAHA 4Y16C 4IRJB 3ZK0A 2GSEA 2P5EA 1ESOA 1KIPB 4ZT1A 2JBMA 1TLKA 1HXMB 2R1XB 2V8MA 2J4WL 2V2XA 3V4VH 3VFTB 4B7IA 2NQCA 3BTNA 3OA3A 4YTTA 1CGUA 1R38A 2IOIA 3D39B 5CJBA 5KSAB 3E6FA 1S1PA 4EVZA 1RUML 3A5FA 3SUSA 4PUDA 3TEVA 2X4UA 4W89A 2UUDK 1FG9C 2YQ3A 3NGFA 4WCJA 1O94A 2HQAA 5I06A 2FJSA 1C5BL 1G9NC 5D2NA 4M6OL 4MZ3A 3MANA 2IGFH 4MPQA 3QPQD 1KN2L 1DWFM 4Z7NF 5AC5A 2Y2WA 4FCAA 1TQBC 5GIRA 1MUMA 1OCQA 5DRCA 1FFNA 2ICWB 4JHWL 1XF0A 3EYUL 2C15A 5FYKE 1QOPA 3GHEL 1N2RB 3CWHA 3DG7A 1I0BA 1TE6A 2E86A 1NBYA 4PJHB 4JG0H 3WFBL 1NFBA 2OSXA 4ZQTA 2CUMA 2ZXQA 1XX1A 4M1DH 3NJGA 1BFSA 2YPVA 1V0NA 4WFED 4NQ1A 1F13A 4MWAD 1XH2A 1AYRA 2FRGP 1JNNH 5ERWA 5C0AE 1NGQL 2FD6L 3GSQA 3T8MA 2I25N 1D6EA 4P23C 3GIQA 2BY0A 2PW2B 3M7OA 4W5UA 5TE4L 3KWSA 4X2PA 3VG9C 5IW6B 3JZUA 1NL0L 2J44A 5GGRA 2V17H 1FP8A 2H3BA 4L7ZA 4QJ1A 5CZTA 3DX5A 3Q9QA 3QG7H 3LHWA 4PYHA 3BT2L 3QEQD 1UQSB 3OWEA 1KBVA 1F3DJ 3QJHB 4DZBA 4JX5A 4O50A 4AZ5A 5DQDH 2VAAB 3OGRA 3BH4A 5DFWH 2XSXA 3ZDZB 3Q45A 3FU0A 4JG5A 5GGVL 3K72A 1UZ8B 2UXTA 4N8VB 2YL5A 4Q4MA 3WQWA 4AEOA 3OXRA 1RJZB 5KVGL 5KSBB 2OK0H 5L4FA 3IPWA 4W81A 1XGZA 4IJRA 3DO3A 1WDSA 1UHVA 1A7BA 1RHFA 2YMXH 3L1OH 4NZTH 2FVNA 5EU7E 5J0BA 1PKYA 3GMOA 4HCLA 3VKKA 5CEZH 4ZX3A 3UTPD 4ZRGA 2ZX6A 3AJ7A 5CZXC 1N6VA 5E2JA 5ABFA 3QC5X 2CZFA 4XK2A 1P7QD 3ZYZA 4HJ0C 1VYRA 4QOKD 2VXUH 4QCIB 2WINA 2BSSB 1S5HB 4PJDF 4CVWA 3N34A 4K2SA 3FZUD 1DE4A 3GC5A 1VHPA 3ARFA 1OZUA 1PZBA 5EUOA 2J9XA 3B7TA 3S5NA 1LO0L 2PC4A 3MJGX 3RTQA 4OGZA 4UB9A 1BAWA 3M8OL 4XAWL 3EFFA 4JFSA 5HBFA 4Z2LA 3CLWA 4OZGE 4W9TA 1KLFA 5HANA 3URQA 1K8DB 4P9MH 1F00I 1KJ3L 3IKCB 4OLXH 4U0QB 1Y0LA 2Q86B 2WXNA 4KROB 3QG7L 2X30A 3FA5A 2OP4H 4HZMA 3TW6A 4LOVA 2W60A 2HJKB 1NL0H 5A6KA 3TVMD 5H94B 4ZQRA 3RLHA 4H6RA 3OJDA 1ONEA 4LRNL 1GZPA 1A3LH 1XAKA 3MRLA 5GS1A 2HFGH 4O19A 1DJYA 4PUNA 5DUML 4GUIA 1AHWA 4NNYA 1SGKA 1UB6B 4PR5B 5LXVA 2Q7AA 1EJWC 4ZAKC 3B9OA 3TA9A 3W82A 1G9ML 35C8H 5B1BB 4Y5XA 3OR6A 3GYEA 3ZDYE 4BFEA 3QWOB 3AHTA 1G7HA 4HU4A 4W9ZA 2Q3AA 4UQ2B 3B7SA 3HS9A 4LEOA 4LHUB 4TNVK 1RJRA 1CGTA 4HSAC 5JDSB 3PN8A 5I1GH 4LVDA 4N4QA 5KTEH 8RUCA 1E7UA 2EYSA 2X44D 4TUJA 2XZQH 3OB8A 4XP9H 5DJ6B 1ZPTA 3HCVA 4AENA 3DO7A 4RIRB 5J3HC 5C3LD 3F85A 1KO0A 3FO1A 4QDPA 5DXXA 1T7WA 1RZKC 1SZNA 2G5WA 3AQXA 2LVCA 1MLBB 4C6CA 2P3EA 1JGLH 3N41B 3O3EA 1M56B 1GJPA 2VHLA 1SVBA 1N5AA 4MWAC 1GL4B 3ZU8A 3LZ5A 2BSTA 1OCRB 4D0DB 1TA3B 1G7QB 3GDKA 2XUCA 4IU2A 2AOSA 4BD4A 4S2SB 5JMUA 1NGWA 4HIIB 3F5KA 1ITBB 4B5NA 1HH6B 4OH2A 4ZNEA 3S88H 1KXVC 4ZTEA 1D3GA 4LT9A 2ZWSA 3AT8A 5DD6A 1T89A 3NQ6A 2CA3A 5T3ZL 2WWKT 5HSFA 2YBUA 3CVIL 4X2UA 4S3FA 3VTMA 2FEJA 5IJDC 1BWKA 4UNLA 3VC6A 4Z7QB 1BXUA 4WEEA 2JKAA 3P0WA 2EEBA 4D0DA 3BGJA 1NM4A 4XX6A 5BVPL 5DA4A 2XQBL 3O05A 4NUGH 2NY3D 5EEXA 2VABA 2DGAA 3AIRA 3CJJA 2KLTA 2N1KA 3UYOD 3VYOA 5IHZB 4BEIA 1RBAA 3DV4B 5HI4D 5FK9B 3ROLB 2VGGA 5DI8B 4GRMB 2YL6A 4JPVH 3KPRE 2OJEB 3ZKXC 3MRQB 4R4BA 2Z00A 2WQRA 2ZJSL 3NCJH 1H5VA 3LBOA 2CRMA 3CU7A 3EYSH 3JVGC 3NCOA 2CD0A 3RRXA 3ECBB 4PJAB 4N1CA 4JY5L 4X7TB 1RZKL 1Q7MA 2DZVA 5CJXA 2B20A 2OLHA 3HIJA 2A4EA