4GQTA

N-terminal domain of c. elegans hsp90
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
209
structure length
209
Chain Sequence
b'ENAETFAFQAEIAQLMSLIINTFYSNKEIYLRELISNASDALDKIRYQALTEPSELDTGKELFIKITPNKEEKTLTIMDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAFLVADKVVVTSKNNDDDSYQWESSAGGSFVVRPFNDPEVTRGTKIVMHIKEDQIDFLEERKIKEIVKKHSQFIGYPIKLVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein 90
publication title N-terminal domain of C. elegans Hsp90
rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 67
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4gqtA00
1ID0A 4O04A 2FYPA 2BZ5A 1Y8OA 3HYYA 1UYGA 3A0TA 3T0HA 2GQPA 3U2DA 5M4MA 3O0IA 2ZDYA 4E00A 3OPDA 1OSFA 4YKWA 5IDJA 1AJ6A 2XX2A 4O09A 4P7AA 4HZ0A 4GCZA 3RKZA 3VHDA 2FXSA 2K5BA 2YE6A 2BU5A 2YEAA 2YI5A 2CCSA 2E0AA 1THNA 1UYKA 4GFNA 5FNCA 5CTXA 3A0XA 1NHJA 1UYIA 1UYCA 4HXZA 4URNA 4XE2A 3EHHA 2QFOA 1YC3A 4MPNA 2BTZA 4BQJA 2XDKA 4EGHA 2YK2A 3SL2A 4XC0A 3B24A 1B3QA 3TUHA 2VWCA 1Z59A 3R92A 2WI1A 5F5RA 2YEIA 4XKAA 4WUBA 3D2RA 2YJWA 5M4NA 4R1FA 4YKUA 4ASFA 3C11A 4BIUA 2YK9A 1BXDA 3K99A 4YKRA 2HKJA 5M4HA 4ZKIA 2FWYA 1AH6A 2YI0A 3GIEA 3G75A 3GIFA 4L91A 2BRCA 3VADA 5C93A 4LWFA 2YEGA 3LPSA 3FT8A 3T1KA 1QY8A 3DGEA 4L8ZA 1B63A 1Y4SA 2IORA 4URMA 2YKIA 4LPBA 1Z5CA 1I5CA 2XX5A 2ESAA 4CWNA 4H85A 1Y8NA 2VCJA 4L90A 4LWHA 2BYHA 4YKQA 1TC6A 1QYEA 3HHUA 4O07A 2YKJA 3R4OA 3EHFA 4LWIA 3TTZA 1UYLA 4CWOA 3D0BA 1MU5A 5BOCA 4HY1A 4AS9A 5M4KA 1YERA 4U93A 3VHCA 4XIQA 1L0OA 5CTUA 4YKTA 1PVGA 1R62A 4E02A 3H4LA 4ASGA 3BMYA 5FNDA 3EHJA 4DUHA 5L3JA 4B7PA 3U2KA 4ASBA 1UY8A 4ASAA 3PEHA 3B27A 3WHAA 3T2SA 2VCIA 4BQGA 4URLA 1US7A 1TILA 5D7RA 2WI5A 4U7OA 3INXA 4QPJA 1B62A 2QF6A 4MB9A 1A4HA 2BSMA 2YJXA 2BU2A 5D6PA 4BAEA 1Y8PA 2XX4A 4I5SA 5M4PA 3ZKDA 3OWBA 3OW6A 2PNRA 3CGZA 4JAVA 1AH8A 1U2OA 2XD6A 3Q5JA 4XITA 4KQVA 1I58A 1TC0A 2WEPA 4FCRA 4KSHA 5FWKA 3K97A 1H7UA 3T10A 4V25A 3CWVA 4BXIA 4KTNA 2IWSA 2CH4A 4U7NA 4YKXA 3RLPA 2WI2A 5FNFA 2YE9A 4B6CA 3U67A 4HXWA 1BGQA 4CWSA 2BU6A 4MP2A 5IDMA 3G7EA 3PEJA 2YEJA 3O6OA 3A0WA 4W7TA 3OMUA 3ZXQA 4V26A 4CWPA 1Z5BA 3TZ5A 4EFUA 2EXLA 5CF0A 2GFDA 5CPHA 3LNUA 2CGFA 3A0RA 1YETA 4HYPA 5D6QA 4EMVA 2JJCA 1U0ZA 1YC1A 2YEBA 4GT8A 4YKYA 1EI1A 3G7BA 5D7DA 2YI7A 3HZ1A 4QPKA 2ZBKB 2YE4A 3TZ0A 1UYMA 2IWXA 4YKZA 2YEFA 2YEHA 4ZVIA 4FCQA 1UYFA 4PU9A 1H7SA 3WQ9A 4R3MA 4HY6A 4AWOA 3QTFA 2C2AA 3Q5KA 5CTYA 2YKEA 1I5BA 2BYIA 4BIZA 3Q5LA 4Q20A 3K60A 1UY9A 2IOQA 4JAUA 4O05A 2XDLA 4CE1A 2Q2EB 1S16A 3B28A 1TH8A 2YEDA 4CE3A 1KIJA 4LWGA 4EGKA 4MBCA 4MPCA 4NH9A 2Q8HA 3HZ5A 5D7CA 4UROA 2CG9A 4AWPA 4PRVA 1AM1A 4HZ5A 5M4EA 2XDSA 4GGLA 1KZNA 3QDDA 2O1VA 3ZM7A 1GKXA 3GIGB 4HYMA 3EKOA 3INWA 4K4OA 2ZDXA 1S14A 3B25A 3ZXOA 3R4NA 4XCLA 4WUCA 2YGFA 3O2FA 2Q8FA 2WEQA 3D36A 3R91A 2YE3A 5F3KA 4EFTA 3A0YA 5BODA 2YECA 4NH7A 2XHTA 3BM9A 5J71A 1YT2A 2WI3A 1BKNA 4FMTA 2JKIA 4CWFA 4EGIA 3MNRP 5CTWA 2YEEA 2WI6A 4CWQA 2XDXA 4KP4A 4CE2A 3T0ZA 2QG2A 1BYQA 3FT5A 4L94A 2O1WA 1YC4A 4DZYA 2Q8GA 4AWQA 1NHIA 2XJJA 2Q8IA 1JM6A 1GJVA 3R4MA 3JZ3A 4XCJA 1I59A 2WERA 4XKKA 1QZRA 3A0ZA 5GGZA 3IEDA 1YSRA 1TIDA 4KSGA 2H8MA 4R3AA 2H55A 4P8OA 4GQTA 3CRLA 3C0EA 2YE7A 3OWDA 1YT0A 1TBWA 4H81A 4XIRA 4L93A 2XK2A 4EM7A 3EKRA 2YE2A 3VHAA 1YSZA 4XTJA 4EEHA 3H80A 1NHHA 4CWTA 1ZW9A 2XHRA 3HEKA 4XDMA 1ZXMA 2YKBA 2BREA 1UY7A 2YE8A 2VW5A 2QG0A 3K98A 2XHXA 3EHGA 2XDUA 1I5AA 4WUDA 3RLRA 3TZ2A 2XABA 4LWEA 2HCHA 2YI6A 2BU7A 1ZWHA 1YT1A 1Y4UA 4XKOA 1UYEA 4LP0A 2YGEA 1YS3A 1GKZA 4KFGA 3NMQA 4O0BA 2O1UA 4X9LA 3ZKBA 1MX0A 4JASA 4PRXA 1Z5AA 2XCMA 3RLQA 4MP7A 1UYHA 4JQLA 4NH8A 2AKPA 2UWDA 1AMWA 4FPPA 1YESA 2IOPA 1EA6A 3TZ4A 5J6AA 3CRKA 4MPEA 3R4PA 2BU8A 3B26A 2XJGA 1UYDA 3CGYA 1I5DA 4XD8A 1UY6A 3GIGA 4FCPA 5IN9A 2YGAA 2XJXA 4CWRA 4H7QA 2CCTA 2FWZA 4GEEA 2BT0A 4PL9A 2ZKJA 4E01A 2YKCA 4I3HA 4XIPA 2HG1A 1ZXNA 4MOTA 2YE5A 2WI4A 2WI7A 2IWUA 3HYZA 3FV5A 2CCUA 3KE6A
chains in the Genus database with same CATH superfamily
1ID0A 4O04A 2FYPA 2BZ5A 1Y8OA 3HYYA 1UYGA 3A0TA 3T0HA 2GQPA 3U2DA 5M4MA 3O0IA 2ZDYA 4E00A 3OPDA 1OSFA 4YKWA 5IDJA 1AJ6A 2XX2A 4O09A 4P7AA 4HZ0A 4GCZA 3RKZA 3VHDA 2FXSA 2K5BA 2YE6A 2BU5A 2YEAA 2YI5A 2CCSA 2E0AA 1THNA 1UYKA 4GFNA 5FNCA 5CTXA 1F51A 1NHJA 1UYIA 1UYCA 3A0XA 4HXZA 4URNA 4XE2A 3EHHA 2QFOA 1YC3A 4MPNA 2BTZA 4BQJA 2XDKA 4EGHA 2YK2A 3SL2A 3LMMA 4XC0A 3B24A 1B3QA 3TUHA 2VWCA 1Z59A 3R92A 2WI1A 5F5RA 2YEIA 4XKAA 4WUBA 3D2RA 2YJWA 5M4NA 4R1FA 4YKUA 4ASFA 3C11A 4BIUA 2YK9A 1BXDA 3K99A 4YKRA 2HKJA 5M4HA 4ZKIA 2FWYA 1AH6A 2YI0A 3GIEA 3G75A 3GIFA 4L91A 2BRCA 3VADA 5C93A 4LWFA 2YEGA 3LPSA 3FT8A 3T1KA 1QY8A 3DGEA 4L8ZA 1B63A 1Y4SA 2IORA 4URMA 2YKIA 4LPBA 1Z5CA 1I5CA 2XX5A 2ESAA 4CWNA 4H85A 3CYGA 2HHIA 1Y8NA 2VCJA 4L90A 4LWHA 2BYHA 4YKQA 1TC6A 1QYEA 3HHUA 4O07A 2YKJA 3R4OA 3EHFA 4LWIA 3TTZA 1UYLA 4CWOA 3D0BA 1MU5A 5BOCA 4HY1A 4AS9A 5M4KA 1YERA 4U93A 3VHCA 4XIQA 1L0OA 5CTUA 4YKTA 1PVGA 1R62A 4E02A 3H4LA 4ASGA 3BMYA 5FNDA 3EHJA 4DUHA 5L3JA 4B7PA 3U2KA 4ASBA 1UY8A 4ASAA 3PEHA 3B27A 3WHAA 3T2SA 2VCIA 4BQGA 4URLA 1US7A 1TILA 5D7RA 2WI5A 4U7OA 3INXA 4QPJA 1B62A 2QF6A 4MB9A 1A4HA 2BSMA 2YJXA 2BU2A 5D6PA 4BAEA 1Y8PA 2XX4A 3S5TA 4I5SA 5M4PA 3ZKDA 3OWBA 3OW6A 2PNRA 3CGZA 4JAVA 1AH8A 1U2OA 2XD6A 3Q5JA 4XITA 4KQVA 1I58A 1TC0A 2WEPA 4FCRA 4KSHA 5FWKA 3K97A 1H7UA 3T10A 4V25A 3CWVA 4BXIA 4KTNA 2IWSA 2CH4A 4U7NA 4YKXA 3RLPA 2WI2A 5FNFA 2YE9A 4B6CA 3U67A 4HXWA 1BGQA 4CWSA 2BU6A 4MP2A 5IDMA 3G7EA 3PEJA 2YEJA 3O6OA 3A0WA 4W7TA 3OMUA 3ZXQA 4V26A 4CWPA 1Z5BA 3TZ5A 4EFUA 2EXLA 5CF0A 2GFDA 5CPHA 3LNUA 2CGFA 3A0RA 1YETA 4HYPA 5D6QA 4EMVA 2JJCA 1U0ZA 1YC1A 2YEBA 4GT8A 4YKYA 1EI1A 3G7BA 5D7DA 2YI7A 3HZ1A 4QPKA 2ZBKB 2YE4A 3TZ0A 1UYMA 2IWXA 4YKZA 2YEFA 2YEHA 4ZVIA 4FCQA 1UYFA 4PU9A 1H7SA 3WQ9A 4R3MA 4HY6A 4AWOA 3QTFA 2C2AA 3Q5KA 5CTYA 2YKEA 1I5BA 2BYIA 4BIZA 3Q5LA 4Q20A 3K60A 1UY9A 2IOQA 4JAUA 4O05A 2XDLA 4CE1A 2Q2EB 2C1IA 1S16A 3B28A 1TH8A 2YEDA 4CE3A 1KIJA 4LWGA 4EGKA 4MBCA 4MPCA 5JENA 4NH9A 2Q8HA 3HZ5A 5D7CA 4UROA 2CG9A 4AWPA 4PRVA 1AM1A 4HZ5A 5M4EA 2XDSA 4GGLA 1KZNA 3QDDA 2O1VA 3ZM7A 1GKXA 3GIGB 4HYMA 3EKOA 3INWA 4K4OA 2ZDXA 1S14A 3B25A 3ZXOA 3R4NA 4XCLA 4WUCA 2YGFA 3O2FA 2Q8FA 2WEQA 3D36A 3R91A 2YE3A 5F3KA 4EFTA 3A0YA 5BODA 2YECA 4NH7A 2XHTA 3BM9A 5J71A 1YT2A 2WI3A 1BKNA 4FMTA 2JKIA 4CWFA 4EGIA 3MNRP 5CTWA 2YEEA 2WI6A 4CWQA 2XDXA 4KP4A 4CE2A 3T0ZA 2QG2A 1BYQA 3FT5A 4L94A 2O1WA 1YC4A 4DZYA 2Q8GA 4AWQA 1NHIA 2XJJA 2Q8IA 1JM6A 1GJVA 3R4MA 2C1GA 3JZ3A 4XCJA 1I59A 2WERA 4XKKA 1QZRA 3A0ZA 5GGZA 3IEDA 1YSRA 1TIDA 4KSGA 2H8MA 4R3AA 2H55A 4P8OA 4GQTA 3CRLA 3C0EA 2YE7A 3OWDA 1YT0A 1TBWA 4H81A 4XIRA 4L93A 2XK2A 4EM7A 3EKRA 2YE2A 3VHAA 1YSZA 4XTJA 4EEHA 3H80A 1NHHA 4CWTA 1ZW9A 2XHRA 3HEKA 4XDMA 1ZXMA 2YKBA 2BREA 4E72A 1UY7A 2YE8A 2VW5A 2QG0A 3K98A 2XHXA 3EHGA 2XDUA 1I5AA 4WUDA 3RLRA 3TZ2A 2XABA 4LWEA 2HCHA 2YI6A 2BU7A 1ZWHA 1YT1A 1Y4UA 4XKOA 1UYEA 4LP0A 2YGEA 1YS3A 1GKZA 4KFGA 3NMQA 4O0BA 2O1UA 4X9LA 3ZKBA 1MX0A 4JASA 4PRXA 1Z5AA 2XCMA 3RLQA 4MP7A 1UYHA 4JQLA 4NH8A 2AKPA 2UWDA 1AMWA 4FPPA 1YESA 2IOPA 1EA6A 3TZ4A 5J6AA 3CRKA 4MPEA 3R4PA 2BU8A 3B26A 2XJGA 1UYDA 3CGYA 1I5DA 4XD8A 1UY6A 3GIGA 4FCPA 5IN9A 2YGAA 2XJXA 4CWRA 4H7QA 2CCTA 2FWZA 4GEEA 2BT0A 4PL9A 2ZKJA 4E01A 2YKCA 4I3HA 4XIPA 2HG1A 1ZXNA 4MOTA 2YE5A 2WI4A 2FTKA 2WI7A 2IWUA 3HYZA 1IXMA 3FV5A 2CCUA 3KE6A
chains in the Genus database with same CATH topology
1ID0A 4O04A 2FYPA 2BZ5A 1Y8OA 3HYYA 1UYGA 3A0TA 3T0HA 2GQPA 3U2DA 5M4MA 3O0IA 2ZDYA 4E00A 3OPDA 1OSFA 4YKWA 5IDJA 1AJ6A 2XX2A 4O09A 4P7AA 4HZ0A 4GCZA 3RKZA 3VHDA 2FXSA 2K5BA 2YE6A 2BU5A 2YEAA 2YI5A 2CCSA 2E0AA 1THNA 1UYKA 4GFNA 5FNCA 5CTXA 3A0XA 1NHJA 1UYIA 1UYCA 4HXZA 4URNA 4XE2A 3EHHA 2QFOA 1YC3A 4MPNA 2BTZA 4BQJA 2XDKA 4EGHA 2YK2A 3SL2A 4XC0A 3B24A 1B3QA 3TUHA 2VWCA 1Z59A 3R92A 2WI1A 5F5RA 2YEIA 4XKAA 4WUBA 3D2RA 2YJWA 5M4NA 4R1FA 4YKUA 4ASFA 3C11A 4BIUA 2YK9A 1BXDA 3K99A 4YKRA 2HKJA 5M4HA 4ZKIA 2FWYA 1AH6A 2YI0A 3GIEA 3G75A 3GIFA 4L91A 2BRCA 3VADA 5C93A 4LWFA 2YEGA 3LPSA 3FT8A 3T1KA 1QY8A 3DGEA 4L8ZA 1B63A 1Y4SA 2IORA 4URMA 2YKIA 4LPBA 1Z5CA 1I5CA 2XX5A 2ESAA 4CWNA 4H85A 1Y8NA 2VCJA 4L90A 4LWHA 2BYHA 4YKQA 1TC6A 1QYEA 3HHUA 4O07A 2YKJA 3R4OA 3EHFA 4LWIA 3TTZA 1UYLA 4CWOA 3D0BA 1MU5A 5BOCA 4HY1A 4AS9A 5M4KA 1YERA 4U93A 3VHCA 4XIQA 1L0OA 5CTUA 4YKTA 1PVGA 1R62A 4E02A 3H4LA 4ASGA 3BMYA 5FNDA 3EHJA 4DUHA 5L3JA 4B7PA 3U2KA 4ASBA 1UY8A 4ASAA 3PEHA 3B27A 3WHAA 3T2SA 2VCIA 4BQGA 4URLA 1US7A 1TILA 5D7RA 2WI5A 4U7OA 3INXA 4QPJA 1B62A 2QF6A 4MB9A 1A4HA 2BSMA 2YJXA 2BU2A 5D6PA 4BAEA 1Y8PA 2XX4A 4I5SA 5M4PA 3ZKDA 3OWBA 3OW6A 2PNRA 3CGZA 4JAVA 1AH8A 1U2OA 2XD6A 3Q5JA 4XITA 4KQVA 1I58A 1TC0A 2WEPA 4FCRA 4KSHA 5FWKA 3K97A 1H7UA 3T10A 4V25A 3CWVA 4BXIA 4KTNA 2IWSA 2CH4A 4U7NA 4YKXA 3RLPA 2WI2A 5FNFA 2YE9A 4B6CA 3U67A 4HXWA 1BGQA 4CWSA 2BU6A 4MP2A 5IDMA 3G7EA 3PEJA 2YEJA 3O6OA 3A0WA 4W7TA 3OMUA 3ZXQA 4V26A 4CWPA 1Z5BA 3TZ5A 4EFUA 2EXLA 5CF0A 2GFDA 5CPHA 3LNUA 2CGFA 3A0RA 1YETA 4HYPA 5D6QA 4EMVA 2JJCA 1U0ZA 1YC1A 2YEBA 4GT8A 4YKYA 1EI1A 3G7BA 5D7DA 2YI7A 3HZ1A 4QPKA 2ZBKB 2YE4A 3TZ0A 1UYMA 2IWXA 4YKZA 2YEFA 2YEHA 4ZVIA 4FCQA 1UYFA 4PU9A 1H7SA 3WQ9A 4R3MA 4HY6A 4AWOA 3QTFA 2C2AA 3Q5KA 5CTYA 2YKEA 1I5BA 2BYIA 4BIZA 3Q5LA 4Q20A 3K60A 1UY9A 2IOQA 4JAUA 4O05A 2XDLA 4CE1A 2Q2EB 1S16A 3B28A 1TH8A 2YEDA 4CE3A 1KIJA 4LWGA 4EGKA 4MBCA 4MPCA 4NH9A 2Q8HA 3HZ5A 5D7CA 4UROA 2CG9A 4AWPA 4PRVA 1AM1A 4HZ5A 5M4EA 2XDSA 4GGLA 1KZNA 3QDDA 2O1VA 3ZM7A 1GKXA 3GIGB 4HYMA 3EKOA 3INWA 4K4OA 2ZDXA 1S14A 3B25A 3ZXOA 3R4NA 4XCLA 4WUCA 2YGFA 3O2FA 2Q8FA 2WEQA 3D36A 3R91A 2YE3A 5F3KA 4EFTA 3A0YA 5BODA 2YECA 4NH7A 2XHTA 3BM9A 5J71A 1YT2A 2WI3A 1BKNA 4FMTA 2JKIA 4CWFA 4EGIA 3MNRP 5CTWA 2YEEA 2WI6A 4CWQA 2XDXA 4KP4A 4CE2A 3T0ZA 2QG2A 1BYQA 3FT5A 4L94A 2O1WA 1YC4A 4DZYA 2Q8GA 4AWQA 1NHIA 2XJJA 2Q8IA 1JM6A 1GJVA 3R4MA 3JZ3A 4XCJA 1I59A 2WERA 4XKKA 1QZRA 3A0ZA 5GGZA 3IEDA 1YSRA 1TIDA 4KSGA 2H8MA 4R3AA 2H55A 4P8OA 4GQTA 3CRLA 3C0EA 2YE7A 3OWDA 1YT0A 1TBWA 4H81A 4XIRA 4L93A 2XK2A 4EM7A 3EKRA 2YE2A 3VHAA 1YSZA 4XTJA 4EEHA 3H80A 1NHHA 4CWTA 1ZW9A 2XHRA 3HEKA 4XDMA 1ZXMA 2YKBA 2BREA 1UY7A 2YE8A 2VW5A 2QG0A 3K98A 2XHXA 3EHGA 2XDUA 1I5AA 4WUDA 3RLRA 3TZ2A 2XABA 4LWEA 2HCHA 2YI6A 2BU7A 1ZWHA 1YT1A 1Y4UA 4XKOA 1UYEA 4LP0A 2YGEA 1YS3A 1GKZA 4KFGA 3NMQA 4O0BA 2O1UA 4X9LA 3ZKBA 1MX0A 4JASA 4PRXA 1Z5AA 2XCMA 3RLQA 4MP7A 1UYHA 4JQLA 4NH8A 2AKPA 2UWDA 1AMWA 4FPPA 1YESA 2IOPA 1EA6A 3TZ4A 5J6AA 3CRKA 4MPEA 3R4PA 2BU8A 3B26A 2XJGA 1UYDA 3CGYA 1I5DA 4XD8A 1UY6A 3GIGA 4FCPA 5IN9A 2YGAA 2XJXA 4CWRA 4H7QA 2CCTA 2FWZA 4GEEA 2BT0A 4PL9A 2ZKJA 4E01A 2YKCA 4I3HA 4XIPA 2HG1A 1ZXNA 4MOTA 2YE5A 2WI4A 2WI7A 2IWUA 3HYZA 3FV5A 2CCUA 3KE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID0 A;  4O04 A;  2FYP A;  2BZ5 A;  1Y8O A;  3HYY A;  1UYG A;  3A0T A;  3T0H A;  2GQP A;  3U2D A;  5M4M A;  3O0I A;  2ZDY A;  4E00 A;  3OPD A;  1OSF A;  4YKW A;  5IDJ A;  1AJ6 A;  2XX2 A;  4O09 A;  4P7A A;  4HZ0 A;  4GCZ A;  3RKZ A;  3VHD A;  2FXS A;  2K5B A;  2YE6 A;  2BU5 A;  2YEA A;  2YI5 A;  2CCS A;  2E0A A;  1THN A;  1UYK A;  4GFN A;  5FNC A;  5CTX A;  3A0X A;  1NHJ A;  1UYI A;  1UYC A;  4HXZ A;  4URN A;  4XE2 A;  3EHH A;  2QFO A;  1YC3 A;  4MPN A;  2BTZ A;  4BQJ A;  2XDK A;  4EGH A;  2YK2 A;  3SL2 A;  4XC0 A;  3B24 A;  1B3Q A;  3TUH A;  2VWC A;  1Z59 A;  3R92 A;  2WI1 A;  5F5R A;  2YEI A;  4XKA A;  4WUB A;  3D2R A;  2YJW A;  5M4N A;  4R1F A;  4YKU A;  4ASF A;  3C11 A;  4BIU A;  2YK9 A;  1BXD A;  3K99 A;  4YKR A;  2HKJ A;  5M4H A;  4ZKI A;  2FWY A;  1AH6 A;  2YI0 A;  3GIE A;  3G75 A;  3GIF A;  4L91 A;  2BRC A;  3VAD A;  5C93 A;  4LWF A;  2YEG A;  3LPS A;  3FT8 A;  3T1K A;  1QY8 A;  3DGE A;  4L8Z A;  1B63 A;  1Y4S A;  2IOR A;  4URM A;  2YKI A;  4LPB A;  1Z5C A;  1I5C A;  2XX5 A;  2ESA A;  4CWN A;  4H85 A;  1Y8N A;  2VCJ A;  4L90 A;  4LWH A;  2BYH A;  4YKQ A;  1TC6 A;  1QYE A;  3HHU A;  4O07 A;  2YKJ A;  3R4O A;  3EHF A;  4LWI A;  3TTZ A;  1UYL A;  4CWO A;  3D0B A;  1MU5 A;  5BOC A;  4HY1 A;  4AS9 A;  5M4K A;  1YER A;  4U93 A;  3VHC A;  4XIQ A;  1L0O A;  5CTU A;  4YKT A;  1PVG A;  1R62 A;  4E02 A;  3H4L A;  4ASG A;  3BMY A;  5FND A;  3EHJ A;  4DUH A;  5L3J A;  4B7P A;  3U2K A;  4ASB A;  1UY8 A;  4ASA A;  3PEH A;  3B27 A;  3WHA A;  3T2S A;  2VCI A;  4BQG A;  4URL A;  1US7 A;  1TIL A;  5D7R A;  2WI5 A;  4U7O A;  3INX A;  4QPJ A;  1B62 A;  2QF6 A;  4MB9 A;  1A4H A;  2BSM A;  2YJX A;  2BU2 A;  5D6P A;  4BAE A;  1Y8P A;  2XX4 A;  4I5S A;  5M4P A;  3ZKD A;  3OWB A;  3OW6 A;  2PNR A;  3CGZ A;  4JAV A;  1AH8 A;  1U2O A;  2XD6 A;  3Q5J A;  4XIT A;  4KQV A;  1I58 A;  1TC0 A;  2WEP A;  4FCR A;  4KSH A;  5FWK A;  3K97 A;  1H7U A;  3T10 A;  4V25 A;  3CWV A;  4BXI A;  4KTN A;  2IWS A;  2CH4 A;  4U7N A;  4YKX A;  3RLP A;  2WI2 A;  5FNF A;  2YE9 A;  4B6C A;  3U67 A;  4HXW A;  1BGQ A;  4CWS A;  2BU6 A;  4MP2 A;  5IDM A;  3G7E A;  3PEJ A;  2YEJ A;  3O6O A;  3A0W A;  4W7T A;  3OMU A;  3ZXQ A;  4V26 A;  4CWP A;  1Z5B A;  3TZ5 A;  4EFU A;  2EXL A;  5CF0 A;  2GFD A;  5CPH A;  3LNU A;  2CGF A;  3A0R A;  1YET A;  4HYP A;  5D6Q A;  4EMV A;  2JJC A;  1U0Z A;  1YC1 A;  2YEB A;  4GT8 A;  4YKY A;  1EI1 A;  3G7B A;  5D7D A;  2YI7 A;  3HZ1 A;  4QPK A;  2ZBK B;  2YE4 A;  3TZ0 A;  1UYM A;  2IWX A;  4YKZ A;  2YEF A;  2YEH A;  4ZVI A;  4FCQ A;  1UYF A;  4PU9 A;  1H7S A;  3WQ9 A;  4R3M A;  4HY6 A;  4AWO A;  3QTF A;  2C2A A;  3Q5K A;  5CTY A;  2YKE A;  1I5B A;  2BYI A;  4BIZ A;  3Q5L A;  4Q20 A;  3K60 A;  1UY9 A;  2IOQ A;  4JAU A;  4O05 A;  2XDL A;  4CE1 A;  2Q2E B;  1S16 A;  3B28 A;  1TH8 A;  2YED A;  4CE3 A;  1KIJ A;  4LWG A;  4EGK A;  4MBC A;  4MPC A;  4NH9 A;  2Q8H A;  3HZ5 A;  5D7C A;  4URO A;  2CG9 A;  4AWP A;  4PRV A;  1AM1 A;  4HZ5 A;  5M4E A;  2XDS A;  4GGL A;  1KZN A;  3QDD A;  2O1V A;  3ZM7 A;  1GKX A;  3GIG B;  4HYM A;  3EKO A;  3INW A;  4K4O A;  2ZDX A;  1S14 A;  3B25 A;  3ZXO A;  3R4N A;  4XCL A;  4WUC A;  2YGF A;  3O2F A;  2Q8F A;  2WEQ A;  3D36 A;  3R91 A;  2YE3 A;  5F3K A;  4EFT A;  3A0Y A;  5BOD A;  2YEC A;  4NH7 A;  2XHT A;  3BM9 A;  5J71 A;  1YT2 A;  2WI3 A;  1BKN A;  4FMT A;  2JKI A;  4CWF A;  4EGI A;  3MNR P;  5CTW A;  2YEE A;  2WI6 A;  4CWQ A;  2XDX A;  4KP4 A;  4CE2 A;  3T0Z A;  2QG2 A;  1BYQ A;  3FT5 A;  4L94 A;  2O1W A;  1YC4 A;  4DZY A;  2Q8G A;  4AWQ A;  1NHI A;  2XJJ A;  2Q8I A;  1JM6 A;  1GJV A;  3R4M A;  3JZ3 A;  4XCJ A;  1I59 A;  2WER A;  4XKK A;  1QZR A;  3A0Z A;  5GGZ A;  3IED A;  1YSR A;  1TID A;  4KSG A;  2H8M A;  4R3A A;  2H55 A;  4P8O A;  4GQT A;  3CRL A;  3C0E A;  2YE7 A;  3OWD A;  1YT0 A;  1TBW A;  4H81 A;  4XIR A;  4L93 A;  2XK2 A;  4EM7 A;  3EKR A;  2YE2 A;  3VHA A;  1YSZ A;  4XTJ A;  4EEH A;  3H80 A;  1NHH A;  4CWT A;  1ZW9 A;  2XHR A;  3HEK A;  4XDM A;  1ZXM A;  2YKB A;  2BRE A;  1UY7 A;  2YE8 A;  2VW5 A;  2QG0 A;  3K98 A;  2XHX A;  3EHG A;  2XDU A;  1I5A A;  4WUD A;  3RLR A;  3TZ2 A;  2XAB A;  4LWE A;  2HCH A;  2YI6 A;  2BU7 A;  1ZWH A;  1YT1 A;  1Y4U A;  4XKO A;  1UYE A;  4LP0 A;  2YGE A;  1YS3 A;  1GKZ A;  4KFG A;  3NMQ A;  4O0B A;  2O1U A;  4X9L A;  3ZKB A;  1MX0 A;  4JAS A;  4PRX A;  1Z5A A;  2XCM A;  3RLQ A;  4MP7 A;  1UYH A;  4JQL A;  4NH8 A;  2AKP A;  2UWD A;  1AMW A;  4FPP A;  1YES A;  2IOP A;  1EA6 A;  3TZ4 A;  5J6A A;  3CRK A;  4MPE A;  3R4P A;  2BU8 A;  3B26 A;  2XJG A;  1UYD A;  3CGY A;  1I5D A;  4XD8 A;  1UY6 A;  3GIG A;  4FCP A;  5IN9 A;  2YGA A;  2XJX A;  4CWR A;  4H7Q A;  2CCT A;  2FWZ A;  4GEE A;  2BT0 A;  4PL9 A;  2ZKJ A;  4E01 A;  2YKC A;  4I3H A;  4XIP A;  2HG1 A;  1ZXN A;  4MOT A;  2YE5 A;  2WI4 A;  2WI7 A;  2IWU A;  3HYZ A;  3FV5 A;  2CCU A;  3KE6 A; 
#chains in the Genus database with same CATH topology
 1ID0 A;  4O04 A;  2FYP A;  2BZ5 A;  1Y8O A;  3HYY A;  1UYG A;  3A0T A;  3T0H A;  2GQP A;  3U2D A;  5M4M A;  3O0I A;  2ZDY A;  4E00 A;  3OPD A;  1OSF A;  4YKW A;  5IDJ A;  1AJ6 A;  2XX2 A;  4O09 A;  4P7A A;  4HZ0 A;  4GCZ A;  3RKZ A;  3VHD A;  2FXS A;  2K5B A;  2YE6 A;  2BU5 A;  2YEA A;  2YI5 A;  2CCS A;  2E0A A;  1THN A;  1UYK A;  4GFN A;  5FNC A;  5CTX A;  1F51 A;  1NHJ A;  1UYI A;  1UYC A;  3A0X A;  4HXZ A;  4URN A;  4XE2 A;  3EHH A;  2QFO A;  1YC3 A;  4MPN A;  2BTZ A;  4BQJ A;  2XDK A;  4EGH A;  2YK2 A;  3SL2 A;  3LMM A;  4XC0 A;  3B24 A;  1B3Q A;  3TUH A;  2VWC A;  1Z59 A;  3R92 A;  2WI1 A;  5F5R A;  2YEI A;  4XKA A;  4WUB A;  3D2R A;  2YJW A;  5M4N A;  4R1F A;  4YKU A;  4ASF A;  3C11 A;  4BIU A;  2YK9 A;  1BXD A;  3K99 A;  4YKR A;  2HKJ A;  5M4H A;  4ZKI A;  2FWY A;  1AH6 A;  2YI0 A;  3GIE A;  3G75 A;  3GIF A;  4L91 A;  2BRC A;  3VAD A;  5C93 A;  4LWF A;  2YEG A;  3LPS A;  3FT8 A;  3T1K A;  1QY8 A;  3DGE A;  4L8Z A;  1B63 A;  1Y4S A;  2IOR A;  4URM A;  2YKI A;  4LPB A;  1Z5C A;  1I5C A;  2XX5 A;  2ESA A;  4CWN A;  4H85 A;  3CYG A;  2HHI A;  1Y8N A;  2VCJ A;  4L90 A;  4LWH A;  2BYH A;  4YKQ A;  1TC6 A;  1QYE A;  3HHU A;  4O07 A;  2YKJ A;  3R4O A;  3EHF A;  4LWI A;  3TTZ A;  1UYL A;  4CWO A;  3D0B A;  1MU5 A;  5BOC A;  4HY1 A;  4AS9 A;  5M4K A;  1YER A;  4U93 A;  3VHC A;  4XIQ A;  1L0O A;  5CTU A;  4YKT A;  1PVG A;  1R62 A;  4E02 A;  3H4L A;  4ASG A;  3BMY A;  5FND A;  3EHJ A;  4DUH A;  5L3J A;  4B7P A;  3U2K A;  4ASB A;  1UY8 A;  4ASA A;  3PEH A;  3B27 A;  3WHA A;  3T2S A;  2VCI A;  4BQG A;  4URL A;  1US7 A;  1TIL A;  5D7R A;  2WI5 A;  4U7O A;  3INX A;  4QPJ A;  1B62 A;  2QF6 A;  4MB9 A;  1A4H A;  2BSM A;  2YJX A;  2BU2 A;  5D6P A;  4BAE A;  1Y8P A;  2XX4 A;  3S5T A;  4I5S A;  5M4P A;  3ZKD A;  3OWB A;  3OW6 A;  2PNR A;  3CGZ A;  4JAV A;  1AH8 A;  1U2O A;  2XD6 A;  3Q5J A;  4XIT A;  4KQV A;  1I58 A;  1TC0 A;  2WEP A;  4FCR A;  4KSH A;  5FWK A;  3K97 A;  1H7U A;  3T10 A;  4V25 A;  3CWV A;  4BXI A;  4KTN A;  2IWS A;  2CH4 A;  4U7N A;  4YKX A;  3RLP A;  2WI2 A;  5FNF A;  2YE9 A;  4B6C A;  3U67 A;  4HXW A;  1BGQ A;  4CWS A;  2BU6 A;  4MP2 A;  5IDM A;  3G7E A;  3PEJ A;  2YEJ A;  3O6O A;  3A0W A;  4W7T A;  3OMU A;  3ZXQ A;  4V26 A;  4CWP A;  1Z5B A;  3TZ5 A;  4EFU A;  2EXL A;  5CF0 A;  2GFD A;  5CPH A;  3LNU A;  2CGF A;  3A0R A;  1YET A;  4HYP A;  5D6Q A;  4EMV A;  2JJC A;  1U0Z A;  1YC1 A;  2YEB A;  4GT8 A;  4YKY A;  1EI1 A;  3G7B A;  5D7D A;  2YI7 A;  3HZ1 A;  4QPK A;  2ZBK B;  2YE4 A;  3TZ0 A;  1UYM A;  2IWX A;  4YKZ A;  2YEF A;  2YEH A;  4ZVI A;  4FCQ A;  1UYF A;  4PU9 A;  1H7S A;  3WQ9 A;  4R3M A;  4HY6 A;  4AWO A;  3QTF A;  2C2A A;  3Q5K A;  5CTY A;  2YKE A;  1I5B A;  2BYI A;  4BIZ A;  3Q5L A;  4Q20 A;  3K60 A;  1UY9 A;  2IOQ A;  4JAU A;  4O05 A;  2XDL A;  4CE1 A;  2Q2E B;  2C1I A;  1S16 A;  3B28 A;  1TH8 A;  2YED A;  4CE3 A;  1KIJ A;  4LWG A;  4EGK A;  4MBC A;  4MPC A;  5JEN A;  4NH9 A;  2Q8H A;  3HZ5 A;  5D7C A;  4URO A;  2CG9 A;  4AWP A;  4PRV A;  1AM1 A;  4HZ5 A;  5M4E A;  2XDS A;  4GGL A;  1KZN A;  3QDD A;  2O1V A;  3ZM7 A;  1GKX A;  3GIG B;  4HYM A;  3EKO A;  3INW A;  4K4O A;  2ZDX A;  1S14 A;  3B25 A;  3ZXO A;  3R4N A;  4XCL A;  4WUC A;  2YGF A;  3O2F A;  2Q8F A;  2WEQ A;  3D36 A;  3R91 A;  2YE3 A;  5F3K A;  4EFT A;  3A0Y A;  5BOD A;  2YEC A;  4NH7 A;  2XHT A;  3BM9 A;  5J71 A;  1YT2 A;  2WI3 A;  1BKN A;  4FMT A;  2JKI A;  4CWF A;  4EGI A;  3MNR P;  5CTW A;  2YEE A;  2WI6 A;  4CWQ A;  2XDX A;  4KP4 A;  4CE2 A;  3T0Z A;  2QG2 A;  1BYQ A;  3FT5 A;  4L94 A;  2O1W A;  1YC4 A;  4DZY A;  2Q8G A;  4AWQ A;  1NHI A;  2XJJ A;  2Q8I A;  1JM6 A;  1GJV A;  3R4M A;  2C1G A;  3JZ3 A;  4XCJ A;  1I59 A;  2WER A;  4XKK A;  1QZR A;  3A0Z A;  5GGZ A;  3IED A;  1YSR A;  1TID A;  4KSG A;  2H8M A;  4R3A A;  2H55 A;  4P8O A;  4GQT A;  3CRL A;  3C0E A;  2YE7 A;  3OWD A;  1YT0 A;  1TBW A;  4H81 A;  4XIR A;  4L93 A;  2XK2 A;  4EM7 A;  3EKR A;  2YE2 A;  3VHA A;  1YSZ A;  4XTJ A;  4EEH A;  3H80 A;  1NHH A;  4CWT A;  1ZW9 A;  2XHR A;  3HEK A;  4XDM A;  1ZXM A;  2YKB A;  2BRE A;  4E72 A;  1UY7 A;  2YE8 A;  2VW5 A;  2QG0 A;  3K98 A;  2XHX A;  3EHG A;  2XDU A;  1I5A A;  4WUD A;  3RLR A;  3TZ2 A;  2XAB A;  4LWE A;  2HCH A;  2YI6 A;  2BU7 A;  1ZWH A;  1YT1 A;  1Y4U A;  4XKO A;  1UYE A;  4LP0 A;  2YGE A;  1YS3 A;  1GKZ A;  4KFG A;  3NMQ A;  4O0B A;  2O1U A;  4X9L A;  3ZKB A;  1MX0 A;  4JAS A;  4PRX A;  1Z5A A;  2XCM A;  3RLQ A;  4MP7 A;  1UYH A;  4JQL A;  4NH8 A;  2AKP A;  2UWD A;  1AMW A;  4FPP A;  1YES A;  2IOP A;  1EA6 A;  3TZ4 A;  5J6A A;  3CRK A;  4MPE A;  3R4P A;  2BU8 A;  3B26 A;  2XJG A;  1UYD A;  3CGY A;  1I5D A;  4XD8 A;  1UY6 A;  3GIG A;  4FCP A;  5IN9 A;  2YGA A;  2XJX A;  4CWR A;  4H7Q A;  2CCT A;  2FWZ A;  4GEE A;  2BT0 A;  4PL9 A;  2ZKJ A;  4E01 A;  2YKC A;  4I3H A;  4XIP A;  2HG1 A;  1ZXN A;  4MOT A;  2YE5 A;  2WI4 A;  2FTK A;  2WI7 A;  2IWU A;  3HYZ A;  1IXM A;  3FV5 A;  2CCU A;  3KE6 A; 
#chains in the Genus database with same CATH homology
 1ID0 A;  4O04 A;  2FYP A;  2BZ5 A;  1Y8O A;  3HYY A;  1UYG A;  3A0T A;  3T0H A;  2GQP A;  3U2D A;  5M4M A;  3O0I A;  2ZDY A;  4E00 A;  3OPD A;  1OSF A;  4YKW A;  5IDJ A;  1AJ6 A;  2XX2 A;  4O09 A;  4P7A A;  4HZ0 A;  4GCZ A;  3RKZ A;  3VHD A;  2FXS A;  2K5B A;  2YE6 A;  2BU5 A;  2YEA A;  2YI5 A;  2CCS A;  2E0A A;  1THN A;  1UYK A;  4GFN A;  5FNC A;  5CTX A;  3A0X A;  1NHJ A;  1UYI A;  1UYC A;  4HXZ A;  4URN A;  4XE2 A;  3EHH A;  2QFO A;  1YC3 A;  4MPN A;  2BTZ A;  4BQJ A;  2XDK A;  4EGH A;  2YK2 A;  3SL2 A;  4XC0 A;  3B24 A;  1B3Q A;  3TUH A;  2VWC A;  1Z59 A;  3R92 A;  2WI1 A;  5F5R A;  2YEI A;  4XKA A;  4WUB A;  3D2R A;  2YJW A;  5M4N A;  4R1F A;  4YKU A;  4ASF A;  3C11 A;  4BIU A;  2YK9 A;  1BXD A;  3K99 A;  4YKR A;  2HKJ A;  5M4H A;  4ZKI A;  2FWY A;  1AH6 A;  2YI0 A;  3GIE A;  3G75 A;  3GIF A;  4L91 A;  2BRC A;  3VAD A;  5C93 A;  4LWF A;  2YEG A;  3LPS A;  3FT8 A;  3T1K A;  1QY8 A;  3DGE A;  4L8Z A;  1B63 A;  1Y4S A;  2IOR A;  4URM A;  2YKI A;  4LPB A;  1Z5C A;  1I5C A;  2XX5 A;  2ESA A;  4CWN A;  4H85 A;  1Y8N A;  2VCJ A;  4L90 A;  4LWH A;  2BYH A;  4YKQ A;  1TC6 A;  1QYE A;  3HHU A;  4O07 A;  2YKJ A;  3R4O A;  3EHF A;  4LWI A;  3TTZ A;  1UYL A;  4CWO A;  3D0B A;  1MU5 A;  5BOC A;  4HY1 A;  4AS9 A;  5M4K A;  1YER A;  4U93 A;  3VHC A;  4XIQ A;  1L0O A;  5CTU A;  4YKT A;  1PVG A;  1R62 A;  4E02 A;  3H4L A;  4ASG A;  3BMY A;  5FND A;  3EHJ A;  4DUH A;  5L3J A;  4B7P A;  3U2K A;  4ASB A;  1UY8 A;  4ASA A;  3PEH A;  3B27 A;  3WHA A;  3T2S A;  2VCI A;  4BQG A;  4URL A;  1US7 A;  1TIL A;  5D7R A;  2WI5 A;  4U7O A;  3INX A;  4QPJ A;  1B62 A;  2QF6 A;  4MB9 A;  1A4H A;  2BSM A;  2YJX A;  2BU2 A;  5D6P A;  4BAE A;  1Y8P A;  2XX4 A;  4I5S A;  5M4P A;  3ZKD A;  3OWB A;  3OW6 A;  2PNR A;  3CGZ A;  4JAV A;  1AH8 A;  1U2O A;  2XD6 A;  3Q5J A;  4XIT A;  4KQV A;  1I58 A;  1TC0 A;  2WEP A;  4FCR A;  4KSH A;  5FWK A;  3K97 A;  1H7U A;  3T10 A;  4V25 A;  3CWV A;  4BXI A;  4KTN A;  2IWS A;  2CH4 A;  4U7N A;  4YKX A;  3RLP A;  2WI2 A;  5FNF A;  2YE9 A;  4B6C A;  3U67 A;  4HXW A;  1BGQ A;  4CWS A;  2BU6 A;  4MP2 A;  5IDM A;  3G7E A;  3PEJ A;  2YEJ A;  3O6O A;  3A0W A;  4W7T A;  3OMU A;  3ZXQ A;  4V26 A;  4CWP A;  1Z5B A;  3TZ5 A;  4EFU A;  2EXL A;  5CF0 A;  2GFD A;  5CPH A;  3LNU A;  2CGF A;  3A0R A;  1YET A;  4HYP A;  5D6Q A;  4EMV A;  2JJC A;  1U0Z A;  1YC1 A;  2YEB A;  4GT8 A;  4YKY A;  1EI1 A;  3G7B A;  5D7D A;  2YI7 A;  3HZ1 A;  4QPK A;  2ZBK B;  2YE4 A;  3TZ0 A;  1UYM A;  2IWX A;  4YKZ A;  2YEF A;  2YEH A;  4ZVI A;  4FCQ A;  1UYF A;  4PU9 A;  1H7S A;  3WQ9 A;  4R3M A;  4HY6 A;  4AWO A;  3QTF A;  2C2A A;  3Q5K A;  5CTY A;  2YKE A;  1I5B A;  2BYI A;  4BIZ A;  3Q5L A;  4Q20 A;  3K60 A;  1UY9 A;  2IOQ A;  4JAU A;  4O05 A;  2XDL A;  4CE1 A;  2Q2E B;  1S16 A;  3B28 A;  1TH8 A;  2YED A;  4CE3 A;  1KIJ A;  4LWG A;  4EGK A;  4MBC A;  4MPC A;  4NH9 A;  2Q8H A;  3HZ5 A;  5D7C A;  4URO A;  2CG9 A;  4AWP A;  4PRV A;  1AM1 A;  4HZ5 A;  5M4E A;  2XDS A;  4GGL A;  1KZN A;  3QDD A;  2O1V A;  3ZM7 A;  1GKX A;  3GIG B;  4HYM A;  3EKO A;  3INW A;  4K4O A;  2ZDX A;  1S14 A;  3B25 A;  3ZXO A;  3R4N A;  4XCL A;  4WUC A;  2YGF A;  3O2F A;  2Q8F A;  2WEQ A;  3D36 A;  3R91 A;  2YE3 A;  5F3K A;  4EFT A;  3A0Y A;  5BOD A;  2YEC A;  4NH7 A;  2XHT A;  3BM9 A;  5J71 A;  1YT2 A;  2WI3 A;  1BKN A;  4FMT A;  2JKI A;  4CWF A;  4EGI A;  3MNR P;  5CTW A;  2YEE A;  2WI6 A;  4CWQ A;  2XDX A;  4KP4 A;  4CE2 A;  3T0Z A;  2QG2 A;  1BYQ A;  3FT5 A;  4L94 A;  2O1W A;  1YC4 A;  4DZY A;  2Q8G A;  4AWQ A;  1NHI A;  2XJJ A;  2Q8I A;  1JM6 A;  1GJV A;  3R4M A;  3JZ3 A;  4XCJ A;  1I59 A;  2WER A;  4XKK A;  1QZR A;  3A0Z A;  5GGZ A;  3IED A;  1YSR A;  1TID A;  4KSG A;  2H8M A;  4R3A A;  2H55 A;  4P8O A;  4GQT A;  3CRL A;  3C0E A;  2YE7 A;  3OWD A;  1YT0 A;  1TBW A;  4H81 A;  4XIR A;  4L93 A;  2XK2 A;  4EM7 A;  3EKR A;  2YE2 A;  3VHA A;  1YSZ A;  4XTJ A;  4EEH A;  3H80 A;  1NHH A;  4CWT A;  1ZW9 A;  2XHR A;  3HEK A;  4XDM A;  1ZXM A;  2YKB A;  2BRE A;  1UY7 A;  2YE8 A;  2VW5 A;  2QG0 A;  3K98 A;  2XHX A;  3EHG A;  2XDU A;  1I5A A;  4WUD A;  3RLR A;  3TZ2 A;  2XAB A;  4LWE A;  2HCH A;  2YI6 A;  2BU7 A;  1ZWH A;  1YT1 A;  1Y4U A;  4XKO A;  1UYE A;  4LP0 A;  2YGE A;  1YS3 A;  1GKZ A;  4KFG A;  3NMQ A;  4O0B A;  2O1U A;  4X9L A;  3ZKB A;  1MX0 A;  4JAS A;  4PRX A;  1Z5A A;  2XCM A;  3RLQ A;  4MP7 A;  1UYH A;  4JQL A;  4NH8 A;  2AKP A;  2UWD A;  1AMW A;  4FPP A;  1YES A;  2IOP A;  1EA6 A;  3TZ4 A;  5J6A A;  3CRK A;  4MPE A;  3R4P A;  2BU8 A;  3B26 A;  2XJG A;  1UYD A;  3CGY A;  1I5D A;  4XD8 A;  1UY6 A;  3GIG A;  4FCP A;  5IN9 A;  2YGA A;  2XJX A;  4CWR A;  4H7Q A;  2CCT A;  2FWZ A;  4GEE A;  2BT0 A;  4PL9 A;  2ZKJ A;  4E01 A;  2YKC A;  4I3H A;  4XIP A;  2HG1 A;  1ZXN A;  4MOT A;  2YE5 A;  2WI4 A;  2WI7 A;  2IWU A;  3HYZ A;  3FV5 A;  2CCU A;  3KE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...