4GQTA

N-terminal domain of c. elegans hsp90
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
209
structure length
209
Chain Sequence
ENAETFAFQAEIAQLMSLIINTFYSNKEIYLRELISNASDALDKIRYQALTEPSELDTGKELFIKITPNKEEKTLTIMDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAFLVADKVVVTSKNNDDDSYQWESSAGGSFVVRPFNDPEVTRGTKIVMHIKEDQIDFLEERKIKEIVKKHSQFIGYPIKLVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-terminal domain of C. elegans Hsp90
rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
molecule keywords Heat shock protein 90
total genus 67
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4gqtA00
4HYPA 4L94A 2XJJA 4B7PA 3HEKA 5FNFA 1GJVA 3R92A 1YT0A 2XHTA 4MPCA 1YC4A 4CWTA 4CWSA 2XHXA 2ZDYA 4GT8A 5M4NA 3EKRA 4XC0A 4AWQA 5J71A 2BYHA 3Q5LA 3G7BA 4HXWA 2YKJA 4JAUA 4JASA 1UY7A 1UYIA 2HCHA 3O6OA 3JZ3A 1U2OA 2YKBA 2XDKA 4CWQA 2EXLA 2BU2A 1AM1A 3BMYA 1TH8A 4KP4A 1Z5CA 4KTNA 2BTZA 3EKOA 2YGAA 4GCZA 1YERA 1US7A 2PNRA 4XIRA 2H55A 2JKIA 1UYFA 2IOQA 1QZRA 2YE6A 1TC0A 4FMTA 2YI6A 3GIGB 4DZYA 1KZNA 2YE7A 5M4PA 3CGYA 3EHJA 4EFUA 2BU8A 4R1FA 4YKYA 1I5AA 4BAEA 4LWEA 5GGZA 5CF0A 4L93A 2YK2A 3NMQA 1GKZA 3CWVA 3C0EA 3TZ0A 2ZBKB 4Q20A 4XKAA 3ZXOA 2XDUA 4BQGA 4YKXA 2GQPA 1UY6A 2XABA 2YEJA 3B26A 3OPDA 3OWBA 4NH8A 4CWOA 2BRCA 4HY6A 3TTZA 4U93A 2IWSA 2YEBA 3CRKA 2BU6A 3IEDA 1U0ZA 4YKQA 4HZ0A 1R62A 3GIEA 4XIPA 3A0ZA 3GIFA 1I5CA 1AMWA 2XDLA 3WQ9A 4FCRA 4P8OA 4XD8A 3B25A 2QFOA 1KIJA 1I5BA 4XKOA 1ID0A 2YGEA 5D7RA 3O2FA 5M4EA 2Q2EB 4HYMA 4CWFA 4HXZA 1QYEA 3A0XA 4MPNA 2YE3A 3T10A 2C2AA 4MOTA 4MBCA 3T0HA 3OW6A 3CGZA 2CCSA 2IWXA 5IDJA 2Q8FA 3R4NA 3CRLA 2ZKJA 4O0BA 1MX0A 4EFTA 4URLA 4XIQA 5CTYA 4HZ5A 1Y4UA 1TIDA 2YKCA 4CE3A 3MNRP 2WEPA 2WI1A 3PEHA 3EHGA 4V25A 4MP2A 4PU9A 4R3MA 2BT0A 2BU5A 2FWZA 3OWDA 3T1KA 5IN9A 4YKRA 3K99A 3G75A 4O05A 2WERA 2WI3A 4H7QA 2ESAA 3U2KA 2YI7A 3HHUA 4L90A 2BZ5A 4EEHA 1UY8A 5D6PA 4L91A 1AH6A 4H81A 1NHJA 4PRXA 2YEFA 2GFDA 1JM6A 1TILA 3K60A 2YGFA 4EGKA 4EMVA 4ASAA 2YEEA 2FXSA 4W7TA 1YESA 4XKKA 4YKUA 4E02A 1AH8A 2QG2A 3G7EA 1AJ6A 3WHAA 3ZM7A 4ASFA 3R4MA 4E00A 1A4HA 2HKJA 4CE2A 4CWPA 2YI0A 1YC3A 4LWFA 3B28A 1H7UA 2YKIA 2FWYA 4PL9A 5M4KA 1S14A 5C93A 2YJWA 3B27A 2WI7A 5CTXA 5F3KA 1YC1A 4ASBA 2YEIA 1YS3A 2WEQA 1UYCA 4QPKA 1TBWA 4YKWA 4AS9A 3QDDA 3HYYA 3QTFA 4EM7A 4CWNA 4BXIA 3EHHA 1THNA 2UWDA 3R4OA 1Z59A 4O09A 1S16A 2ZDXA 4LPBA 2CG9A 1UYHA 2YEDA 3U2DA 2VCIA 2VWCA 4JAVA 1I5DA 3TZ2A 1Y4SA 2H8MA 1BXDA 5CPHA 5D7DA 2YEGA 2BU7A 2AKPA 4O07A 4NH9A 2CH4A 1PVGA 1UYMA 3C11A 2WI5A 1YT2A 1UYGA 1B3QA 4O04A 2Q8IA 5CTUA 1ZXNA 5IDMA 4CE1A 1BYQA 1MU5A 1YSZA 3VADA 4DUHA 1EA6A 4LWGA 4X9LA 1I59A 2WI6A 1BKNA 2XHRA 3DGEA 2BYIA 3LNUA 4XCJA 1OSFA 1UY9A 2O1UA 2YJXA 4UROA 2XK2A 1NHHA 3TZ5A 1ZW9A 4I3HA 4YKTA 4WUDA 5M4HA 3R4PA 3ZKDA 4GQTA 3Q5KA 2XX2A 2YK9A 4XITA 3D2RA 2YEHA 2O1VA 3GIGA 1YT1A 2K5BA 1ZWHA 1Y8OA 3LPSA 4BQJA 2CGFA 3OMUA 5BODA 3INXA 3T2SA 4EGIA 3RKZA 3A0YA 2YE8A 5D6QA 3D0BA 3A0RA 4URNA 4XE2A 4AWOA 4MB9A 2XDXA 4NH7A 1Z5AA 1YSRA 5FNDA 2WI4A 1L0OA 3PEJA 4P7AA 5BOCA 5D7CA 1UYDA 3D36A 1UYEA 2Q8HA 2YE2A 2XCMA 3FT8A 4HY1A 4I5SA 5F5RA 4JQLA 3RLRA 4K4OA 4BIZA 4U7OA 3VHAA 2XD6A 3A0WA 2WI2A 4ASGA 3EHFA 4V26A 2XJXA 3TUHA 2IORA 2YECA 3K98A 4XTJA 4GEEA 2YE9A 3K97A 3RLQA 3HZ5A 4QPJA 2XX5A 3KE6A 3A0TA 4XCLA 4LP0A 1QY8A 2XDSA 2IOPA 1GKXA 1UYLA 3INWA 2BREA 4AWPA 5CTWA 2BSMA 2XJGA 5FNCA 4BIUA 2JJCA 2XX4A 4MPEA 3B24A 3H4LA 3R91A 3VHDA 4EGHA 2IWUA 2YEAA 4U7NA 1B62A 4MP7A 1H7SA 1TC6A 3BM9A 1NHIA 3HZ1A 1B63A 4R3AA 2YI5A 3H80A 2QF6A 4FPPA 4GGLA 4WUBA 4URMA 3SL2A 4ZVIA 5J6AA 2CCTA 2VCJA 4KSGA 4ZKIA 3TZ4A 1I58A 1Y8PA 5L3JA 3ZXQA 1BGQA 3FT5A 1Y8NA 2YE4A 4KSHA 4GFNA 2YKEA 1YETA 3O0IA 3Q5JA 4KFGA 4KQVA 4B6CA 4PRVA 5FWKA 2YE5A 1EI1A 3U67A 4L8ZA 4CWRA 2O1WA 2CCUA 2E0AA 3VHCA 4XDMA 2Q8GA 3RLPA 1UYKA 2QG0A 4LWIA 2FYPA 4WUCA 1ZXMA 4FCQA 3ZKBA 2HG1A 5M4MA 3FV5A 3T0ZA 2VW5A 3HYZA 4YKZA 1Z5BA 4LWHA 4H85A 4FCPA 4E01A
chains in the Genus database with same CATH superfamily
4HYPA 4L94A 2XJJA 4B7PA 3HEKA 5FNFA 1GJVA 3R92A 1YT0A 2XHTA 4MPCA 1YC4A 4CWTA 4CWSA 2XHXA 2ZDYA 4GT8A 5M4NA 3EKRA 4XC0A 4AWQA 5J71A 2BYHA 3Q5LA 3G7BA 4HXWA 2YKJA 4JAUA 4JASA 1UY7A 1UYIA 2HCHA 3O6OA 3JZ3A 1U2OA 2YKBA 2XDKA 4CWQA 2EXLA 3S5TA 2BU2A 1AM1A 3BMYA 1TH8A 4KP4A 1Z5CA 4KTNA 2BTZA 3EKOA 2YGAA 4GCZA 1YERA 1US7A 2PNRA 4XIRA 2H55A 2JKIA 1UYFA 2IOQA 1QZRA 2YE6A 2C1IA 1TC0A 4FMTA 2YI6A 3GIGB 4DZYA 1KZNA 2YE7A 5M4PA 3CGYA 3EHJA 4EFUA 2BU8A 4R1FA 4YKYA 1I5AA 4BAEA 4LWEA 5GGZA 5CF0A 4L93A 2YK2A 3NMQA 1GKZA 3CWVA 3C0EA 3TZ0A 2ZBKB 4Q20A 4XKAA 3ZXOA 2XDUA 4BQGA 4YKXA 2GQPA 1UY6A 2XABA 2YEJA 3B26A 3OPDA 3OWBA 4NH8A 4CWOA 2BRCA 4HY6A 3TTZA 4U93A 2IWSA 2YEBA 3CRKA 2BU6A 3IEDA 1U0ZA 4YKQA 4HZ0A 1R62A 3GIEA 4XIPA 3A0ZA 3GIFA 1I5CA 1AMWA 2XDLA 3WQ9A 4FCRA 4P8OA 4XD8A 3B25A 2QFOA 1KIJA 1I5BA 4XKOA 1ID0A 2YGEA 5JENA 5D7RA 3O2FA 5M4EA 2Q2EB 4HYMA 4CWFA 4HXZA 1QYEA 3A0XA 4MPNA 2YE3A 3T10A 2C2AA 4MOTA 4MBCA 3T0HA 3OW6A 3CGZA 2CCSA 2IWXA 5IDJA 2Q8FA 3R4NA 3CRLA 2ZKJA 4O0BA 1MX0A 4EFTA 4URLA 4XIQA 5CTYA 4HZ5A 1Y4UA 1TIDA 2YKCA 4CE3A 3MNRP 2WEPA 2WI1A 3PEHA 3EHGA 4V25A 4MP2A 4PU9A 4R3MA 2BT0A 2BU5A 2FWZA 3OWDA 3T1KA 5IN9A 4YKRA 3K99A 3G75A 3LMMA 4O05A 2WERA 2WI3A 4H7QA 2ESAA 3U2KA 2YI7A 3HHUA 4L90A 2BZ5A 4EEHA 3CYGA 1UY8A 5D6PA 4L91A 1AH6A 4H81A 1NHJA 4PRXA 2YEFA 2GFDA 1JM6A 1TILA 3K60A 2YGFA 4EGKA 4EMVA 4ASAA 2YEEA 2FXSA 4W7TA 1YESA 4XKKA 4YKUA 4E02A 1AH8A 2QG2A 3G7EA 1AJ6A 3WHAA 3ZM7A 4ASFA 3R4MA 4E00A 1A4HA 2HKJA 4CE2A 4CWPA 2YI0A 1YC3A 4LWFA 3B28A 1H7UA 2YKIA 2FWYA 4PL9A 5M4KA 1S14A 5C93A 2YJWA 3B27A 2WI7A 5CTXA 5F3KA 1YC1A 4ASBA 2YEIA 1YS3A 2WEQA 1UYCA 4QPKA 1TBWA 4YKWA 4AS9A 3QDDA 3HYYA 3QTFA 4EM7A 4CWNA 4BXIA 3EHHA 1THNA 2UWDA 3R4OA 1Z59A 4O09A 1S16A 2ZDXA 4LPBA 2CG9A 1UYHA 2YEDA 3U2DA 2VCIA 2VWCA 4JAVA 1I5DA 3TZ2A 1Y4SA 2H8MA 1BXDA 5CPHA 5D7DA 2YEGA 2BU7A 2AKPA 4O07A 4NH9A 2CH4A 1PVGA 1UYMA 3C11A 2C1GA 1YT2A 1UYGA 1B3QA 2WI5A 4O04A 2Q8IA 5CTUA 1ZXNA 5IDMA 4CE1A 1BYQA 1MU5A 1YSZA 3VADA 4DUHA 1EA6A 4LWGA 4X9LA 1IXMA 1I59A 2WI6A 1BKNA 2XHRA 3DGEA 2BYIA 3LNUA 4XCJA 1OSFA 1UY9A 2O1UA 2YJXA 4UROA 2XK2A 1NHHA 3TZ5A 1ZW9A 4I3HA 4YKTA 4WUDA 5M4HA 3R4PA 3ZKDA 4GQTA 3Q5KA 2XX2A 2YK9A 4XITA 3D2RA 2YEHA 2O1VA 2HHIA 3GIGA 1YT1A 2K5BA 1ZWHA 1Y8OA 3LPSA 4BQJA 2CGFA 3OMUA 5BODA 3INXA 3T2SA 2FTKA 4EGIA 3RKZA 3A0YA 2YE8A 5D6QA 3D0BA 3A0RA 4URNA 4XE2A 4AWOA 4MB9A 2XDXA 4NH7A 1Z5AA 1YSRA 5FNDA 2WI4A 1L0OA 3PEJA 4P7AA 5BOCA 5D7CA 1UYDA 3D36A 1UYEA 2Q8HA 2YE2A 2XCMA 3FT8A 4HY1A 4I5SA 5F5RA 4JQLA 3RLRA 4K4OA 4BIZA 4U7OA 3VHAA 2XD6A 3A0WA 2WI2A 4ASGA 3EHFA 4V26A 2XJXA 3TUHA 2IORA 2YECA 3K98A 4XTJA 4GEEA 2YE9A 3K97A 3RLQA 3HZ5A 4QPJA 2XX5A 3KE6A 3A0TA 4XCLA 4LP0A 1QY8A 4E72A 2XDSA 2IOPA 1GKXA 1UYLA 3INWA 2BREA 4AWPA 5CTWA 2BSMA 2XJGA 5FNCA 4BIUA 2JJCA 2XX4A 4MPEA 3B24A 3H4LA 3R91A 3VHDA 4EGHA 2IWUA 2YEAA 4U7NA 1F51A 1B62A 4MP7A 1H7SA 1TC6A 3BM9A 1NHIA 3HZ1A 1B63A 4R3AA 2YI5A 3H80A 2QF6A 4FPPA 4GGLA 4WUBA 4URMA 3SL2A 4ZVIA 5J6AA 2CCTA 2VCJA 4KSGA 4ZKIA 3TZ4A 1I58A 1Y8PA 5L3JA 3ZXQA 1BGQA 3FT5A 1Y8NA 2YE4A 4KSHA 4GFNA 2YKEA 1YETA 3O0IA 3Q5JA 4KFGA 4KQVA 4B6CA 4PRVA 5FWKA 2YE5A 1EI1A 3U67A 4L8ZA 4CWRA 2O1WA 2CCUA 2E0AA 3VHCA 4XDMA 2Q8GA 3RLPA 1UYKA 2QG0A 4LWIA 2FYPA 4WUCA 1ZXMA 4FCQA 3ZKBA 2HG1A 5M4MA 3FV5A 3T0ZA 2VW5A 3HYZA 4YKZA 1Z5BA 4LWHA 4H85A 4FCPA 4E01A
chains in the Genus database with same CATH topology
4HYPA 4L94A 2XJJA 4B7PA 3HEKA 5FNFA 1GJVA 3R92A 1YT0A 2XHTA 4MPCA 1YC4A 4CWTA 4CWSA 2XHXA 2ZDYA 4GT8A 5M4NA 3EKRA 4XC0A 4AWQA 5J71A 2BYHA 3Q5LA 3G7BA 4HXWA 2YKJA 4JAUA 4JASA 1UY7A 1UYIA 2HCHA 3O6OA 3JZ3A 1U2OA 2YKBA 2XDKA 4CWQA 2EXLA 2BU2A 1AM1A 3BMYA 1TH8A 4KP4A 1Z5CA 4KTNA 2BTZA 3EKOA 2YGAA 4GCZA 1YERA 1US7A 2PNRA 4XIRA 2H55A 2JKIA 1UYFA 2IOQA 1QZRA 2YE6A 1TC0A 4FMTA 2YI6A 3GIGB 4DZYA 1KZNA 2YE7A 5M4PA 3CGYA 3EHJA 4EFUA 2BU8A 4R1FA 4YKYA 1I5AA 4BAEA 4LWEA 5GGZA 5CF0A 4L93A 2YK2A 3NMQA 1GKZA 3CWVA 3C0EA 3TZ0A 2ZBKB 4Q20A 4XKAA 3ZXOA 2XDUA 4BQGA 4YKXA 2GQPA 1UY6A 2XABA 2YEJA 3B26A 3OPDA 3OWBA 4NH8A 4CWOA 2BRCA 4HY6A 3TTZA 4U93A 2IWSA 2YEBA 3CRKA 2BU6A 3IEDA 1U0ZA 4YKQA 4HZ0A 1R62A 3GIEA 4XIPA 3A0ZA 3GIFA 1I5CA 1AMWA 2XDLA 3WQ9A 4FCRA 4P8OA 4XD8A 3B25A 2QFOA 1KIJA 1I5BA 4XKOA 1ID0A 2YGEA 5D7RA 3O2FA 5M4EA 2Q2EB 4HYMA 4CWFA 4HXZA 1QYEA 3A0XA 4MPNA 2YE3A 3T10A 2C2AA 4MOTA 4MBCA 3T0HA 3OW6A 3CGZA 2CCSA 2IWXA 5IDJA 2Q8FA 3R4NA 3CRLA 2ZKJA 4O0BA 1MX0A 4EFTA 4URLA 4XIQA 5CTYA 4HZ5A 1Y4UA 1TIDA 2YKCA 4CE3A 3MNRP 2WEPA 2WI1A 3PEHA 3EHGA 4V25A 4MP2A 4PU9A 4R3MA 2BT0A 2BU5A 2FWZA 3OWDA 3T1KA 5IN9A 4YKRA 3K99A 3G75A 4O05A 2WERA 2WI3A 4H7QA 2ESAA 3U2KA 2YI7A 3HHUA 4L90A 2BZ5A 4EEHA 1UY8A 5D6PA 4L91A 1AH6A 4H81A 1NHJA 4PRXA 2YEFA 2GFDA 1JM6A 1TILA 3K60A 2YGFA 4EGKA 4EMVA 4ASAA 2YEEA 2FXSA 4W7TA 1YESA 4XKKA 4YKUA 4E02A 1AH8A 2QG2A 3G7EA 1AJ6A 3WHAA 3ZM7A 4ASFA 3R4MA 4E00A 1A4HA 2HKJA 4CE2A 4CWPA 2YI0A 1YC3A 4LWFA 3B28A 1H7UA 2YKIA 2FWYA 4PL9A 5M4KA 1S14A 5C93A 2YJWA 3B27A 2WI7A 5CTXA 5F3KA 1YC1A 4ASBA 2YEIA 1YS3A 2WEQA 1UYCA 4QPKA 1TBWA 4YKWA 4AS9A 3QDDA 3HYYA 3QTFA 4EM7A 4CWNA 4BXIA 3EHHA 1THNA 2UWDA 3R4OA 1Z59A 4O09A 1S16A 2ZDXA 4LPBA 2CG9A 1UYHA 2YEDA 3U2DA 2VCIA 2VWCA 4JAVA 1I5DA 3TZ2A 1Y4SA 2H8MA 1BXDA 5CPHA 5D7DA 2YEGA 2BU7A 2AKPA 4O07A 4NH9A 2CH4A 1PVGA 1UYMA 3C11A 2WI5A 1YT2A 1UYGA 1B3QA 4O04A 2Q8IA 5CTUA 1ZXNA 5IDMA 4CE1A 1BYQA 1MU5A 1YSZA 3VADA 4DUHA 1EA6A 4LWGA 4X9LA 1I59A 2WI6A 1BKNA 2XHRA 3DGEA 2BYIA 3LNUA 4XCJA 1OSFA 1UY9A 2O1UA 2YJXA 4UROA 2XK2A 1NHHA 3TZ5A 1ZW9A 4I3HA 4YKTA 4WUDA 5M4HA 3R4PA 3ZKDA 4GQTA 3Q5KA 2XX2A 2YK9A 4XITA 3D2RA 2YEHA 2O1VA 3GIGA 1YT1A 2K5BA 1ZWHA 1Y8OA 3LPSA 4BQJA 2CGFA 3OMUA 5BODA 3INXA 3T2SA 4EGIA 3RKZA 3A0YA 2YE8A 5D6QA 3D0BA 3A0RA 4URNA 4XE2A 4AWOA 4MB9A 2XDXA 4NH7A 1Z5AA 1YSRA 5FNDA 2WI4A 1L0OA 3PEJA 4P7AA 5BOCA 5D7CA 1UYDA 3D36A 1UYEA 2Q8HA 2YE2A 2XCMA 3FT8A 4HY1A 4I5SA 5F5RA 4JQLA 3RLRA 4K4OA 4BIZA 4U7OA 3VHAA 2XD6A 3A0WA 2WI2A 4ASGA 3EHFA 4V26A 2XJXA 3TUHA 2IORA 2YECA 3K98A 4XTJA 4GEEA 2YE9A 3K97A 3RLQA 3HZ5A 4QPJA 2XX5A 3KE6A 3A0TA 4XCLA 4LP0A 1QY8A 2XDSA 2IOPA 1GKXA 1UYLA 3INWA 2BREA 4AWPA 5CTWA 2BSMA 2XJGA 5FNCA 4BIUA 2JJCA 2XX4A 4MPEA 3B24A 3H4LA 3R91A 3VHDA 4EGHA 2IWUA 2YEAA 4U7NA 1B62A 4MP7A 1H7SA 1TC6A 3BM9A 1NHIA 3HZ1A 1B63A 4R3AA 2YI5A 3H80A 2QF6A 4FPPA 4GGLA 4WUBA 4URMA 3SL2A 4ZVIA 5J6AA 2CCTA 2VCJA 4KSGA 4ZKIA 3TZ4A 1I58A 1Y8PA 5L3JA 3ZXQA 1BGQA 3FT5A 1Y8NA 2YE4A 4KSHA 4GFNA 2YKEA 1YETA 3O0IA 3Q5JA 4KFGA 4KQVA 4B6CA 4PRVA 5FWKA 2YE5A 1EI1A 3U67A 4L8ZA 4CWRA 2O1WA 2CCUA 2E0AA 3VHCA 4XDMA 2Q8GA 3RLPA 1UYKA 2QG0A 4LWIA 2FYPA 4WUCA 1ZXMA 4FCQA 3ZKBA 2HG1A 5M4MA 3FV5A 3T0ZA 2VW5A 3HYZA 4YKZA 1Z5BA 4LWHA 4H85A 4FCPA 4E01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYP A;  4L94 A;  2XJJ A;  4B7P A;  3HEK A;  5FNF A;  1GJV A;  3R92 A;  1YT0 A;  2XHT A;  4MPC A;  1YC4 A;  4CWT A;  4CWS A;  2XHX A;  2ZDY A;  4GT8 A;  5M4N A;  3EKR A;  4XC0 A;  4AWQ A;  5J71 A;  2BYH A;  3Q5L A;  3G7B A;  4HXW A;  2YKJ A;  4JAU A;  4JAS A;  1UY7 A;  1UYI A;  2HCH A;  3O6O A;  3JZ3 A;  1U2O A;  2YKB A;  2XDK A;  4CWQ A;  2EXL A;  2BU2 A;  1AM1 A;  3BMY A;  1TH8 A;  4KP4 A;  1Z5C A;  4KTN A;  2BTZ A;  3EKO A;  2YGA A;  4GCZ A;  1YER A;  1US7 A;  2PNR A;  4XIR A;  2H55 A;  2JKI A;  1UYF A;  2IOQ A;  1QZR A;  2YE6 A;  1TC0 A;  4FMT A;  2YI6 A;  3GIG B;  4DZY A;  1KZN A;  2YE7 A;  5M4P A;  3CGY A;  3EHJ A;  4EFU A;  2BU8 A;  4R1F A;  4YKY A;  1I5A A;  4BAE A;  4LWE A;  5GGZ A;  5CF0 A;  4L93 A;  2YK2 A;  3NMQ A;  1GKZ A;  3CWV A;  3C0E A;  3TZ0 A;  2ZBK B;  4Q20 A;  4XKA A;  3ZXO A;  2XDU A;  4BQG A;  4YKX A;  2GQP A;  1UY6 A;  2XAB A;  2YEJ A;  3B26 A;  3OPD A;  3OWB A;  4NH8 A;  4CWO A;  2BRC A;  4HY6 A;  3TTZ A;  4U93 A;  2IWS A;  2YEB A;  3CRK A;  2BU6 A;  3IED A;  1U0Z A;  4YKQ A;  4HZ0 A;  1R62 A;  3GIE A;  4XIP A;  3A0Z A;  3GIF A;  1I5C A;  1AMW A;  2XDL A;  3WQ9 A;  4FCR A;  4P8O A;  4XD8 A;  3B25 A;  2QFO A;  1KIJ A;  1I5B A;  4XKO A;  1ID0 A;  2YGE A;  5D7R A;  3O2F A;  5M4E A;  2Q2E B;  4HYM A;  4CWF A;  4HXZ A;  1QYE A;  3A0X A;  4MPN A;  2YE3 A;  3T10 A;  2C2A A;  4MOT A;  4MBC A;  3T0H A;  3OW6 A;  3CGZ A;  2CCS A;  2IWX A;  5IDJ A;  2Q8F A;  3R4N A;  3CRL A;  2ZKJ A;  4O0B A;  1MX0 A;  4EFT A;  4URL A;  4XIQ A;  5CTY A;  4HZ5 A;  1Y4U A;  1TID A;  2YKC A;  4CE3 A;  3MNR P;  2WEP A;  2WI1 A;  3PEH A;  3EHG A;  4V25 A;  4MP2 A;  4PU9 A;  4R3M A;  2BT0 A;  2BU5 A;  2FWZ A;  3OWD A;  3T1K A;  5IN9 A;  4YKR A;  3K99 A;  3G75 A;  4O05 A;  2WER A;  2WI3 A;  4H7Q A;  2ESA A;  3U2K A;  2YI7 A;  3HHU A;  4L90 A;  2BZ5 A;  4EEH A;  1UY8 A;  5D6P A;  4L91 A;  1AH6 A;  4H81 A;  1NHJ A;  4PRX A;  2YEF A;  2GFD A;  1JM6 A;  1TIL A;  3K60 A;  2YGF A;  4EGK A;  4EMV A;  4ASA A;  2YEE A;  2FXS A;  4W7T A;  1YES A;  4XKK A;  4YKU A;  4E02 A;  1AH8 A;  2QG2 A;  3G7E A;  1AJ6 A;  3WHA A;  3ZM7 A;  4ASF A;  3R4M A;  4E00 A;  1A4H A;  2HKJ A;  4CE2 A;  4CWP A;  2YI0 A;  1YC3 A;  4LWF A;  3B28 A;  1H7U A;  2YKI A;  2FWY A;  4PL9 A;  5M4K A;  1S14 A;  5C93 A;  2YJW A;  3B27 A;  2WI7 A;  5CTX A;  5F3K A;  1YC1 A;  4ASB A;  2YEI A;  1YS3 A;  2WEQ A;  1UYC A;  4QPK A;  1TBW A;  4YKW A;  4AS9 A;  3QDD A;  3HYY A;  3QTF A;  4EM7 A;  4CWN A;  4BXI A;  3EHH A;  1THN A;  2UWD A;  3R4O A;  1Z59 A;  4O09 A;  1S16 A;  2ZDX A;  4LPB A;  2CG9 A;  1UYH A;  2YED A;  3U2D A;  2VCI A;  2VWC A;  4JAV A;  1I5D A;  3TZ2 A;  1Y4S A;  2H8M A;  1BXD A;  5CPH A;  5D7D A;  2YEG A;  2BU7 A;  2AKP A;  4O07 A;  4NH9 A;  2CH4 A;  1PVG A;  1UYM A;  3C11 A;  2WI5 A;  1YT2 A;  1UYG A;  1B3Q A;  4O04 A;  2Q8I A;  5CTU A;  1ZXN A;  5IDM A;  4CE1 A;  1BYQ A;  1MU5 A;  1YSZ A;  3VAD A;  4DUH A;  1EA6 A;  4LWG A;  4X9L A;  1I59 A;  2WI6 A;  1BKN A;  2XHR A;  3DGE A;  2BYI A;  3LNU A;  4XCJ A;  1OSF A;  1UY9 A;  2O1U A;  2YJX A;  4URO A;  2XK2 A;  1NHH A;  3TZ5 A;  1ZW9 A;  4I3H A;  4YKT A;  4WUD A;  5M4H A;  3R4P A;  3ZKD A;  4GQT A;  3Q5K A;  2XX2 A;  2YK9 A;  4XIT A;  3D2R A;  2YEH A;  2O1V A;  3GIG A;  1YT1 A;  2K5B A;  1ZWH A;  1Y8O A;  3LPS A;  4BQJ A;  2CGF A;  3OMU A;  5BOD A;  3INX A;  3T2S A;  4EGI A;  3RKZ A;  3A0Y A;  2YE8 A;  5D6Q A;  3D0B A;  3A0R A;  4URN A;  4XE2 A;  4AWO A;  4MB9 A;  2XDX A;  4NH7 A;  1Z5A A;  1YSR A;  5FND A;  2WI4 A;  1L0O A;  3PEJ A;  4P7A A;  5BOC A;  5D7C A;  1UYD A;  3D36 A;  1UYE A;  2Q8H A;  2YE2 A;  2XCM A;  3FT8 A;  4HY1 A;  4I5S A;  5F5R A;  4JQL A;  3RLR A;  4K4O A;  4BIZ A;  4U7O A;  3VHA A;  2XD6 A;  3A0W A;  2WI2 A;  4ASG A;  3EHF A;  4V26 A;  2XJX A;  3TUH A;  2IOR A;  2YEC A;  3K98 A;  4XTJ A;  4GEE A;  2YE9 A;  3K97 A;  3RLQ A;  3HZ5 A;  4QPJ A;  2XX5 A;  3KE6 A;  3A0T A;  4XCL A;  4LP0 A;  1QY8 A;  2XDS A;  2IOP A;  1GKX A;  1UYL A;  3INW A;  2BRE A;  4AWP A;  5CTW A;  2BSM A;  2XJG A;  5FNC A;  4BIU A;  2JJC A;  2XX4 A;  4MPE A;  3B24 A;  3H4L A;  3R91 A;  3VHD A;  4EGH A;  2IWU A;  2YEA A;  4U7N A;  1B62 A;  4MP7 A;  1H7S A;  1TC6 A;  3BM9 A;  1NHI A;  3HZ1 A;  1B63 A;  4R3A A;  2YI5 A;  3H80 A;  2QF6 A;  4FPP A;  4GGL A;  4WUB A;  4URM A;  3SL2 A;  4ZVI A;  5J6A A;  2CCT A;  2VCJ A;  4KSG A;  4ZKI A;  3TZ4 A;  1I58 A;  1Y8P A;  5L3J A;  3ZXQ A;  1BGQ A;  3FT5 A;  1Y8N A;  2YE4 A;  4KSH A;  4GFN A;  2YKE A;  1YET A;  3O0I A;  3Q5J A;  4KFG A;  4KQV A;  4B6C A;  4PRV A;  5FWK A;  2YE5 A;  1EI1 A;  3U67 A;  4L8Z A;  4CWR A;  2O1W A;  2CCU A;  2E0A A;  3VHC A;  4XDM A;  2Q8G A;  3RLP A;  1UYK A;  2QG0 A;  4LWI A;  2FYP A;  4WUC A;  1ZXM A;  4FCQ A;  3ZKB A;  2HG1 A;  5M4M A;  3FV5 A;  3T0Z A;  2VW5 A;  3HYZ A;  4YKZ A;  1Z5B A;  4LWH A;  4H85 A;  4FCP A;  4E01 A; 
#chains in the Genus database with same CATH topology
 4HYP A;  4L94 A;  2XJJ A;  4B7P A;  3HEK A;  5FNF A;  1GJV A;  3R92 A;  1YT0 A;  2XHT A;  4MPC A;  1YC4 A;  4CWT A;  4CWS A;  2XHX A;  2ZDY A;  4GT8 A;  5M4N A;  3EKR A;  4XC0 A;  4AWQ A;  5J71 A;  2BYH A;  3Q5L A;  3G7B A;  4HXW A;  2YKJ A;  4JAU A;  4JAS A;  1UY7 A;  1UYI A;  2HCH A;  3O6O A;  3JZ3 A;  1U2O A;  2YKB A;  2XDK A;  4CWQ A;  2EXL A;  3S5T A;  2BU2 A;  1AM1 A;  3BMY A;  1TH8 A;  4KP4 A;  1Z5C A;  4KTN A;  2BTZ A;  3EKO A;  2YGA A;  4GCZ A;  1YER A;  1US7 A;  2PNR A;  4XIR A;  2H55 A;  2JKI A;  1UYF A;  2IOQ A;  1QZR A;  2YE6 A;  2C1I A;  1TC0 A;  4FMT A;  2YI6 A;  3GIG B;  4DZY A;  1KZN A;  2YE7 A;  5M4P A;  3CGY A;  3EHJ A;  4EFU A;  2BU8 A;  4R1F A;  4YKY A;  1I5A A;  4BAE A;  4LWE A;  5GGZ A;  5CF0 A;  4L93 A;  2YK2 A;  3NMQ A;  1GKZ A;  3CWV A;  3C0E A;  3TZ0 A;  2ZBK B;  4Q20 A;  4XKA A;  3ZXO A;  2XDU A;  4BQG A;  4YKX A;  2GQP A;  1UY6 A;  2XAB A;  2YEJ A;  3B26 A;  3OPD A;  3OWB A;  4NH8 A;  4CWO A;  2BRC A;  4HY6 A;  3TTZ A;  4U93 A;  2IWS A;  2YEB A;  3CRK A;  2BU6 A;  3IED A;  1U0Z A;  4YKQ A;  4HZ0 A;  1R62 A;  3GIE A;  4XIP A;  3A0Z A;  3GIF A;  1I5C A;  1AMW A;  2XDL A;  3WQ9 A;  4FCR A;  4P8O A;  4XD8 A;  3B25 A;  2QFO A;  1KIJ A;  1I5B A;  4XKO A;  1ID0 A;  2YGE A;  5JEN A;  5D7R A;  3O2F A;  5M4E A;  2Q2E B;  4HYM A;  4CWF A;  4HXZ A;  1QYE A;  3A0X A;  4MPN A;  2YE3 A;  3T10 A;  2C2A A;  4MOT A;  4MBC A;  3T0H A;  3OW6 A;  3CGZ A;  2CCS A;  2IWX A;  5IDJ A;  2Q8F A;  3R4N A;  3CRL A;  2ZKJ A;  4O0B A;  1MX0 A;  4EFT A;  4URL A;  4XIQ A;  5CTY A;  4HZ5 A;  1Y4U A;  1TID A;  2YKC A;  4CE3 A;  3MNR P;  2WEP A;  2WI1 A;  3PEH A;  3EHG A;  4V25 A;  4MP2 A;  4PU9 A;  4R3M A;  2BT0 A;  2BU5 A;  2FWZ A;  3OWD A;  3T1K A;  5IN9 A;  4YKR A;  3K99 A;  3G75 A;  3LMM A;  4O05 A;  2WER A;  2WI3 A;  4H7Q A;  2ESA A;  3U2K A;  2YI7 A;  3HHU A;  4L90 A;  2BZ5 A;  4EEH A;  3CYG A;  1UY8 A;  5D6P A;  4L91 A;  1AH6 A;  4H81 A;  1NHJ A;  4PRX A;  2YEF A;  2GFD A;  1JM6 A;  1TIL A;  3K60 A;  2YGF A;  4EGK A;  4EMV A;  4ASA A;  2YEE A;  2FXS A;  4W7T A;  1YES A;  4XKK A;  4YKU A;  4E02 A;  1AH8 A;  2QG2 A;  3G7E A;  1AJ6 A;  3WHA A;  3ZM7 A;  4ASF A;  3R4M A;  4E00 A;  1A4H A;  2HKJ A;  4CE2 A;  4CWP A;  2YI0 A;  1YC3 A;  4LWF A;  3B28 A;  1H7U A;  2YKI A;  2FWY A;  4PL9 A;  5M4K A;  1S14 A;  5C93 A;  2YJW A;  3B27 A;  2WI7 A;  5CTX A;  5F3K A;  1YC1 A;  4ASB A;  2YEI A;  1YS3 A;  2WEQ A;  1UYC A;  4QPK A;  1TBW A;  4YKW A;  4AS9 A;  3QDD A;  3HYY A;  3QTF A;  4EM7 A;  4CWN A;  4BXI A;  3EHH A;  1THN A;  2UWD A;  3R4O A;  1Z59 A;  4O09 A;  1S16 A;  2ZDX A;  4LPB A;  2CG9 A;  1UYH A;  2YED A;  3U2D A;  2VCI A;  2VWC A;  4JAV A;  1I5D A;  3TZ2 A;  1Y4S A;  2H8M A;  1BXD A;  5CPH A;  5D7D A;  2YEG A;  2BU7 A;  2AKP A;  4O07 A;  4NH9 A;  2CH4 A;  1PVG A;  1UYM A;  3C11 A;  2C1G A;  1YT2 A;  1UYG A;  1B3Q A;  2WI5 A;  4O04 A;  2Q8I A;  5CTU A;  1ZXN A;  5IDM A;  4CE1 A;  1BYQ A;  1MU5 A;  1YSZ A;  3VAD A;  4DUH A;  1EA6 A;  4LWG A;  4X9L A;  1IXM A;  1I59 A;  2WI6 A;  1BKN A;  2XHR A;  3DGE A;  2BYI A;  3LNU A;  4XCJ A;  1OSF A;  1UY9 A;  2O1U A;  2YJX A;  4URO A;  2XK2 A;  1NHH A;  3TZ5 A;  1ZW9 A;  4I3H A;  4YKT A;  4WUD A;  5M4H A;  3R4P A;  3ZKD A;  4GQT A;  3Q5K A;  2XX2 A;  2YK9 A;  4XIT A;  3D2R A;  2YEH A;  2O1V A;  2HHI A;  3GIG A;  1YT1 A;  2K5B A;  1ZWH A;  1Y8O A;  3LPS A;  4BQJ A;  2CGF A;  3OMU A;  5BOD A;  3INX A;  3T2S A;  2FTK A;  4EGI A;  3RKZ A;  3A0Y A;  2YE8 A;  5D6Q A;  3D0B A;  3A0R A;  4URN A;  4XE2 A;  4AWO A;  4MB9 A;  2XDX A;  4NH7 A;  1Z5A A;  1YSR A;  5FND A;  2WI4 A;  1L0O A;  3PEJ A;  4P7A A;  5BOC A;  5D7C A;  1UYD A;  3D36 A;  1UYE A;  2Q8H A;  2YE2 A;  2XCM A;  3FT8 A;  4HY1 A;  4I5S A;  5F5R A;  4JQL A;  3RLR A;  4K4O A;  4BIZ A;  4U7O A;  3VHA A;  2XD6 A;  3A0W A;  2WI2 A;  4ASG A;  3EHF A;  4V26 A;  2XJX A;  3TUH A;  2IOR A;  2YEC A;  3K98 A;  4XTJ A;  4GEE A;  2YE9 A;  3K97 A;  3RLQ A;  3HZ5 A;  4QPJ A;  2XX5 A;  3KE6 A;  3A0T A;  4XCL A;  4LP0 A;  1QY8 A;  4E72 A;  2XDS A;  2IOP A;  1GKX A;  1UYL A;  3INW A;  2BRE A;  4AWP A;  5CTW A;  2BSM A;  2XJG A;  5FNC A;  4BIU A;  2JJC A;  2XX4 A;  4MPE A;  3B24 A;  3H4L A;  3R91 A;  3VHD A;  4EGH A;  2IWU A;  2YEA A;  4U7N A;  1F51 A;  1B62 A;  4MP7 A;  1H7S A;  1TC6 A;  3BM9 A;  1NHI A;  3HZ1 A;  1B63 A;  4R3A A;  2YI5 A;  3H80 A;  2QF6 A;  4FPP A;  4GGL A;  4WUB A;  4URM A;  3SL2 A;  4ZVI A;  5J6A A;  2CCT A;  2VCJ A;  4KSG A;  4ZKI A;  3TZ4 A;  1I58 A;  1Y8P A;  5L3J A;  3ZXQ A;  1BGQ A;  3FT5 A;  1Y8N A;  2YE4 A;  4KSH A;  4GFN A;  2YKE A;  1YET A;  3O0I A;  3Q5J A;  4KFG A;  4KQV A;  4B6C A;  4PRV A;  5FWK A;  2YE5 A;  1EI1 A;  3U67 A;  4L8Z A;  4CWR A;  2O1W A;  2CCU A;  2E0A A;  3VHC A;  4XDM A;  2Q8G A;  3RLP A;  1UYK A;  2QG0 A;  4LWI A;  2FYP A;  4WUC A;  1ZXM A;  4FCQ A;  3ZKB A;  2HG1 A;  5M4M A;  3FV5 A;  3T0Z A;  2VW5 A;  3HYZ A;  4YKZ A;  1Z5B A;  4LWH A;  4H85 A;  4FCP A;  4E01 A; 
#chains in the Genus database with same CATH homology
 4HYP A;  4L94 A;  2XJJ A;  4B7P A;  3HEK A;  5FNF A;  1GJV A;  3R92 A;  1YT0 A;  2XHT A;  4MPC A;  1YC4 A;  4CWT A;  4CWS A;  2XHX A;  2ZDY A;  4GT8 A;  5M4N A;  3EKR A;  4XC0 A;  4AWQ A;  5J71 A;  2BYH A;  3Q5L A;  3G7B A;  4HXW A;  2YKJ A;  4JAU A;  4JAS A;  1UY7 A;  1UYI A;  2HCH A;  3O6O A;  3JZ3 A;  1U2O A;  2YKB A;  2XDK A;  4CWQ A;  2EXL A;  2BU2 A;  1AM1 A;  3BMY A;  1TH8 A;  4KP4 A;  1Z5C A;  4KTN A;  2BTZ A;  3EKO A;  2YGA A;  4GCZ A;  1YER A;  1US7 A;  2PNR A;  4XIR A;  2H55 A;  2JKI A;  1UYF A;  2IOQ A;  1QZR A;  2YE6 A;  1TC0 A;  4FMT A;  2YI6 A;  3GIG B;  4DZY A;  1KZN A;  2YE7 A;  5M4P A;  3CGY A;  3EHJ A;  4EFU A;  2BU8 A;  4R1F A;  4YKY A;  1I5A A;  4BAE A;  4LWE A;  5GGZ A;  5CF0 A;  4L93 A;  2YK2 A;  3NMQ A;  1GKZ A;  3CWV A;  3C0E A;  3TZ0 A;  2ZBK B;  4Q20 A;  4XKA A;  3ZXO A;  2XDU A;  4BQG A;  4YKX A;  2GQP A;  1UY6 A;  2XAB A;  2YEJ A;  3B26 A;  3OPD A;  3OWB A;  4NH8 A;  4CWO A;  2BRC A;  4HY6 A;  3TTZ A;  4U93 A;  2IWS A;  2YEB A;  3CRK A;  2BU6 A;  3IED A;  1U0Z A;  4YKQ A;  4HZ0 A;  1R62 A;  3GIE A;  4XIP A;  3A0Z A;  3GIF A;  1I5C A;  1AMW A;  2XDL A;  3WQ9 A;  4FCR A;  4P8O A;  4XD8 A;  3B25 A;  2QFO A;  1KIJ A;  1I5B A;  4XKO A;  1ID0 A;  2YGE A;  5D7R A;  3O2F A;  5M4E A;  2Q2E B;  4HYM A;  4CWF A;  4HXZ A;  1QYE A;  3A0X A;  4MPN A;  2YE3 A;  3T10 A;  2C2A A;  4MOT A;  4MBC A;  3T0H A;  3OW6 A;  3CGZ A;  2CCS A;  2IWX A;  5IDJ A;  2Q8F A;  3R4N A;  3CRL A;  2ZKJ A;  4O0B A;  1MX0 A;  4EFT A;  4URL A;  4XIQ A;  5CTY A;  4HZ5 A;  1Y4U A;  1TID A;  2YKC A;  4CE3 A;  3MNR P;  2WEP A;  2WI1 A;  3PEH A;  3EHG A;  4V25 A;  4MP2 A;  4PU9 A;  4R3M A;  2BT0 A;  2BU5 A;  2FWZ A;  3OWD A;  3T1K A;  5IN9 A;  4YKR A;  3K99 A;  3G75 A;  4O05 A;  2WER A;  2WI3 A;  4H7Q A;  2ESA A;  3U2K A;  2YI7 A;  3HHU A;  4L90 A;  2BZ5 A;  4EEH A;  1UY8 A;  5D6P A;  4L91 A;  1AH6 A;  4H81 A;  1NHJ A;  4PRX A;  2YEF A;  2GFD A;  1JM6 A;  1TIL A;  3K60 A;  2YGF A;  4EGK A;  4EMV A;  4ASA A;  2YEE A;  2FXS A;  4W7T A;  1YES A;  4XKK A;  4YKU A;  4E02 A;  1AH8 A;  2QG2 A;  3G7E A;  1AJ6 A;  3WHA A;  3ZM7 A;  4ASF A;  3R4M A;  4E00 A;  1A4H A;  2HKJ A;  4CE2 A;  4CWP A;  2YI0 A;  1YC3 A;  4LWF A;  3B28 A;  1H7U A;  2YKI A;  2FWY A;  4PL9 A;  5M4K A;  1S14 A;  5C93 A;  2YJW A;  3B27 A;  2WI7 A;  5CTX A;  5F3K A;  1YC1 A;  4ASB A;  2YEI A;  1YS3 A;  2WEQ A;  1UYC A;  4QPK A;  1TBW A;  4YKW A;  4AS9 A;  3QDD A;  3HYY A;  3QTF A;  4EM7 A;  4CWN A;  4BXI A;  3EHH A;  1THN A;  2UWD A;  3R4O A;  1Z59 A;  4O09 A;  1S16 A;  2ZDX A;  4LPB A;  2CG9 A;  1UYH A;  2YED A;  3U2D A;  2VCI A;  2VWC A;  4JAV A;  1I5D A;  3TZ2 A;  1Y4S A;  2H8M A;  1BXD A;  5CPH A;  5D7D A;  2YEG A;  2BU7 A;  2AKP A;  4O07 A;  4NH9 A;  2CH4 A;  1PVG A;  1UYM A;  3C11 A;  2WI5 A;  1YT2 A;  1UYG A;  1B3Q A;  4O04 A;  2Q8I A;  5CTU A;  1ZXN A;  5IDM A;  4CE1 A;  1BYQ A;  1MU5 A;  1YSZ A;  3VAD A;  4DUH A;  1EA6 A;  4LWG A;  4X9L A;  1I59 A;  2WI6 A;  1BKN A;  2XHR A;  3DGE A;  2BYI A;  3LNU A;  4XCJ A;  1OSF A;  1UY9 A;  2O1U A;  2YJX A;  4URO A;  2XK2 A;  1NHH A;  3TZ5 A;  1ZW9 A;  4I3H A;  4YKT A;  4WUD A;  5M4H A;  3R4P A;  3ZKD A;  4GQT A;  3Q5K A;  2XX2 A;  2YK9 A;  4XIT A;  3D2R A;  2YEH A;  2O1V A;  3GIG A;  1YT1 A;  2K5B A;  1ZWH A;  1Y8O A;  3LPS A;  4BQJ A;  2CGF A;  3OMU A;  5BOD A;  3INX A;  3T2S A;  4EGI A;  3RKZ A;  3A0Y A;  2YE8 A;  5D6Q A;  3D0B A;  3A0R A;  4URN A;  4XE2 A;  4AWO A;  4MB9 A;  2XDX A;  4NH7 A;  1Z5A A;  1YSR A;  5FND A;  2WI4 A;  1L0O A;  3PEJ A;  4P7A A;  5BOC A;  5D7C A;  1UYD A;  3D36 A;  1UYE A;  2Q8H A;  2YE2 A;  2XCM A;  3FT8 A;  4HY1 A;  4I5S A;  5F5R A;  4JQL A;  3RLR A;  4K4O A;  4BIZ A;  4U7O A;  3VHA A;  2XD6 A;  3A0W A;  2WI2 A;  4ASG A;  3EHF A;  4V26 A;  2XJX A;  3TUH A;  2IOR A;  2YEC A;  3K98 A;  4XTJ A;  4GEE A;  2YE9 A;  3K97 A;  3RLQ A;  3HZ5 A;  4QPJ A;  2XX5 A;  3KE6 A;  3A0T A;  4XCL A;  4LP0 A;  1QY8 A;  2XDS A;  2IOP A;  1GKX A;  1UYL A;  3INW A;  2BRE A;  4AWP A;  5CTW A;  2BSM A;  2XJG A;  5FNC A;  4BIU A;  2JJC A;  2XX4 A;  4MPE A;  3B24 A;  3H4L A;  3R91 A;  3VHD A;  4EGH A;  2IWU A;  2YEA A;  4U7N A;  1B62 A;  4MP7 A;  1H7S A;  1TC6 A;  3BM9 A;  1NHI A;  3HZ1 A;  1B63 A;  4R3A A;  2YI5 A;  3H80 A;  2QF6 A;  4FPP A;  4GGL A;  4WUB A;  4URM A;  3SL2 A;  4ZVI A;  5J6A A;  2CCT A;  2VCJ A;  4KSG A;  4ZKI A;  3TZ4 A;  1I58 A;  1Y8P A;  5L3J A;  3ZXQ A;  1BGQ A;  3FT5 A;  1Y8N A;  2YE4 A;  4KSH A;  4GFN A;  2YKE A;  1YET A;  3O0I A;  3Q5J A;  4KFG A;  4KQV A;  4B6C A;  4PRV A;  5FWK A;  2YE5 A;  1EI1 A;  3U67 A;  4L8Z A;  4CWR A;  2O1W A;  2CCU A;  2E0A A;  3VHC A;  4XDM A;  2Q8G A;  3RLP A;  1UYK A;  2QG0 A;  4LWI A;  2FYP A;  4WUC A;  1ZXM A;  4FCQ A;  3ZKB A;  2HG1 A;  5M4M A;  3FV5 A;  3T0Z A;  2VW5 A;  3HYZ A;  4YKZ A;  1Z5B A;  4LWH A;  4H85 A;  4FCP A;  4E01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...