4GQTA

N-terminal domain of c. elegans hsp90
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
209
structure length
209
Chain Sequence
ENAETFAFQAEIAQLMSLIINTFYSNKEIYLRELISNASDALDKIRYQALTEPSELDTGKELFIKITPNKEEKTLTIMDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAFLVADKVVVTSKNNDDDSYQWESSAGGSFVVRPFNDPEVTRGTKIVMHIKEDQIDFLEERKIKEIVKKHSQFIGYPIKLVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein 90
publication title N-terminal domain of C. elegans Hsp90
rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 67
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4gqtA00
2YEBA 2WI5A 4KSHA 5FNCA 4I5SA 2BSMA 3VHDA 1YSZA 3VHCA 4E01A 4XKOA 2BU8A 3G7BA 3NMQA 4AS9A 2CG9A 4CWTA 3IEDA 1US7A 1UYKA 4XCJA 4LWGA 5FWKA 1Y4UA 1KZNA 1UY6A 5D7DA 1QZRA 2FXSA 2YEEA 1QYEA 2XX4A 2WEPA 2GFDA 3RLRA 1AH6A 3INXA 4XD8A 2YKEA 3TZ2A 4KP4A 1U0ZA 1YERA 4H85A 3C11A 4GFNA 2WERA 2H55A 3MNRP 5CTXA 2CCUA 2YI7A 1TH8A 4ASAA 4CWOA 2VCJA 1UYEA 3EKOA 4JAVA 3R92A 3FV5A 1BYQA 4MB9A 3O2FA 3PEJA 4R3AA 2YE4A 4B7PA 4CWRA 2CH4A 2VW5A 1YC3A 4MP2A 2ZKJA 2JKIA 1TBWA 4JAUA 4YKRA 4AWPA 2XDXA 2YKBA 1UY9A 2YECA 2K5BA 3B24A 1Y4SA 4CWFA 2IWUA 3FT5A 3K98A 2XDKA 5CPHA 2FWYA 3HZ5A 3TTZA 3A0TA 5CTUA 5M4KA 1TC0A 1BGQA 4CE3A 2YKJA 4BXIA 4XC0A 3B27A 1BXDA 3K60A 3HYZA 4YKZA 3U2KA 4EGIA 2YEIA 3CRKA 2CCSA 4XKKA 3VADA 4QPKA 4ASBA 3B28A 4QPJA 2WI1A 4MP7A 3H4LA 2XCMA 4Q20A 4O05A 2Q2EB 2C2AA 4NH8A 1MX0A 5D6QA 1Z5CA 1YC1A 5J71A 2Q8FA 2O1UA 2QG0A 4KSGA 4H81A 5F5RA 2BYHA 4V26A 4EM7A 1ZXMA 2XJGA 4HY6A 4FPPA 2Q8GA 2IWSA 2WI7A 5BODA 1EA6A 3A0YA 1I58A 2CGFA 1YESA 3R4OA 4EEHA 4L91A 2PNRA 4LP0A 1YS3A 1THNA 5M4HA 2YKIA 3KE6A 4AWQA 3CGZA 4XIQA 3U2DA 4XKAA 3C0EA 5M4PA 3CGYA 2VCIA 3RKZA 1YT1A 4HZ5A 5M4NA 1BKNA 1ZWHA 1B62A 5M4MA 5J6AA 4PU9A 1NHJA 2HKJA 3OMUA 3T0HA 3H80A 4YKWA 4CE2A 2YJWA 2IWXA 1QY8A 2XJXA 2IOQA 3BM9A 3VHAA 4R1FA 2JJCA 3ZXOA 5D7RA 3BMYA 3TZ5A 2YGFA 2YEJA 2YE3A 1A4HA 2E0AA 4XE2A 1Y8NA 3LPSA 2YE9A 4EGHA 3GIEA 3ZKDA 4BQJA 5C93A 2FWZA 2YEAA 4XTJA 1UYLA 2WI4A 3Q5LA 4U7NA 4ZKIA 2HG1A 4U93A 4L90A 4LWIA 1ID0A 1Z5BA 1I5AA 3A0WA 3EHHA 3T10A 1AH8A 1KIJA 2UWDA 4CWNA 5FNFA 4HZ0A 3CWVA 4HXZA 2XK2A 3HEKA 2BTZA 3QDDA 3EHFA 1AMWA 1GKZA 4NH9A 2Q8IA 3EHJA 3HZ1A 3A0RA 2YK2A 4O04A 3R91A 4WUBA 2QG2A 3WQ9A 2YE2A 1UYDA 4FCPA 1TIDA 4GGLA 4ASGA 4XCLA 3T0ZA 4R3MA 3HHUA 2WI3A 3R4MA 4HY1A 4CWPA 5CF0A 5CTWA 5D7CA 2Q8HA 2YEDA 2O1WA 5GGZA 2BYIA 5BOCA 3K97A 4V25A 5IN9A 3O0IA 4X9LA 1TC6A 2XABA 1I5DA 3O6OA 2O1VA 1Z5AA 2BRCA 3Q5JA 3T1KA 4P8OA 2H8MA 2BU5A 4JASA 2YEGA 3D0BA 2WI2A 3OWDA 4BIZA 2XX5A 4UROA 4K4OA 4URNA 5IDMA 3TZ0A 5M4EA 1R62A 1UYMA 2YEFA 1L0OA 1U2OA 4W7TA 2XJJA 4KFGA 2BU2A 4EGKA 4GEEA 4KQVA 1PVGA 4BIUA 4ASFA 2YE6A 2XHTA 4XIRA 4MPEA 4ZVIA 4U7OA 3LNUA 2HCHA 1H7UA 1UYHA 2YI6A 4FMTA 4HXWA 2VWCA 4L94A 4WUDA 2BT0A 4HYPA 3B26A 4JQLA 3GIGB 2WEQA 2BU6A 2EXLA 2YE7A 4PRXA 4DUHA 2YJXA 3GIGA 1YT0A 4WUCA 2WI6A 2XDSA 4CWSA 4B6CA 1YC4A 1Y8OA 4E00A 3D2RA 3B25A 2IORA 1YSRA 4CWQA 2BU7A 1Z59A 3G75A 1UYIA 2XD6A 4MPCA 4O07A 3EHGA 1NHHA 1ZXNA 4GT8A 3GIFA 1H7SA 2YI0A 4CE1A 3ZXQA 4EFTA 1OSFA 4XITA 1UYGA 3DGEA 2YGEA 3HYYA 4E02A 1YETA 4P7AA 5L3JA 2XX2A 5IDJA 1I5BA 4YKQA 1GJVA 3A0ZA 4XIPA 4BAEA 3T2SA 4O0BA 1UY7A 2YGAA 4O09A 1I59A 2YE5A 4MBCA 2YI5A 1EI1A 2ZBKB 4LWFA 3INWA 4MPNA 3PEHA 1GKXA 2ESAA 3K99A 4YKXA 3ZKBA 4PL9A 3R4NA 1S16A 4URMA 4KTNA 1UYFA 2ZDYA 3FT8A 4GCZA 3CRLA 1NHIA 4FCQA 1YT2A 4H7QA 1AM1A 4YKUA 1Y8PA 4URLA 4L93A 5F3KA 3TUHA 3JZ3A 2XHRA 1TILA 4I3HA 3U67A 4MOTA 3QTFA 2QF6A 3R4PA 2YK9A 4LPBA 3WHAA 3ZM7A 2YEHA 2XDLA 4EFUA 1AJ6A 4YKYA 4DZYA 3TZ4A 1ZW9A 2FYPA 1UYCA 1B63A 1UY8A 2CCTA 2XHXA 3OPDA 3EKRA 3OW6A 4L8ZA 4AWOA 5FNDA 2XDUA 2BREA 3SL2A 4FCRA 1B3QA 3RLPA 1I5CA 4BQGA 1S14A 1MU5A 2QFOA 4HYMA 2BZ5A 1JM6A 2YKCA 4YKTA 3D36A 4EMVA 3Q5KA 4NH7A 5CTYA 4PRVA 5D6PA 4LWEA 3RLQA 2IOPA 3A0XA 2YE8A 2GQPA 4GQTA 3G7EA 4XDMA 2ZDXA 4LWHA 3OWBA 2AKPA
chains in the Genus database with same CATH superfamily
2YEBA 2WI5A 4KSHA 5FNCA 4I5SA 2BSMA 3VHDA 1YSZA 3VHCA 4E01A 4XKOA 2BU8A 3G7BA 3NMQA 4AS9A 2CG9A 4CWTA 3S5TA 3IEDA 1US7A 1UYKA 4XCJA 4LWGA 5FWKA 1Y4UA 1KZNA 1UY6A 5D7DA 1QZRA 2FXSA 2YEEA 1QYEA 2XX4A 2WEPA 2GFDA 3RLRA 5JENA 1AH6A 3INXA 4XD8A 2YKEA 3TZ2A 4KP4A 1U0ZA 1YERA 4H85A 3C11A 4GFNA 2WERA 2H55A 3MNRP 5CTXA 2CCUA 2YI7A 1TH8A 4ASAA 4CWOA 2VCJA 1UYEA 3EKOA 4JAVA 3R92A 3FV5A 1BYQA 4MB9A 3O2FA 3PEJA 4R3AA 2YE4A 4B7PA 4CWRA 2CH4A 2VW5A 1YC3A 4MP2A 2ZKJA 2JKIA 1TBWA 4JAUA 4YKRA 4AWPA 2XDXA 2YKBA 1UY9A 2YECA 2K5BA 3B24A 2HHIA 1Y4SA 4CWFA 2IWUA 3FT5A 3K98A 2XDKA 5CPHA 2FWYA 3HZ5A 3TTZA 3A0TA 5CTUA 5M4KA 1TC0A 1BGQA 4CE3A 2YKJA 4BXIA 4XC0A 3B27A 1BXDA 3K60A 3HYZA 4YKZA 3U2KA 4EGIA 2YEIA 3CRKA 2CCSA 4XKKA 3VADA 4QPKA 4ASBA 3B28A 4QPJA 2WI1A 4MP7A 3H4LA 2XCMA 4Q20A 4O05A 2Q2EB 2C2AA 3LMMA 4NH8A 1MX0A 5D6QA 1Z5CA 1YC1A 5J71A 2Q8FA 2O1UA 2QG0A 4KSGA 4H81A 5F5RA 2BYHA 4V26A 4EM7A 1ZXMA 2XJGA 4HY6A 4FPPA 2Q8GA 2IWSA 2WI7A 5BODA 1EA6A 3A0YA 1I58A 2CGFA 1YESA 3R4OA 4EEHA 4L91A 2PNRA 4LP0A 1YS3A 1THNA 5M4HA 2YKIA 3KE6A 4AWQA 3CGZA 4XIQA 3U2DA 4XKAA 3C0EA 5M4PA 3CGYA 2VCIA 3RKZA 1YT1A 4HZ5A 5M4NA 1BKNA 1ZWHA 1B62A 5M4MA 5J6AA 4PU9A 1NHJA 2HKJA 3OMUA 3T0HA 3H80A 4YKWA 4CE2A 2YJWA 2IWXA 1QY8A 2XJXA 2IOQA 3BM9A 3VHAA 4R1FA 2JJCA 3ZXOA 5D7RA 3BMYA 3TZ5A 2YGFA 2YEJA 2YE3A 1A4HA 2E0AA 4XE2A 1Y8NA 3LPSA 2YE9A 4EGHA 3GIEA 3ZKDA 4BQJA 5C93A 2FWZA 2YEAA 4XTJA 1UYLA 2WI4A 3Q5LA 4U7NA 4ZKIA 2HG1A 4U93A 4L90A 4LWIA 1F51A 1ID0A 1Z5BA 1I5AA 3A0WA 3EHHA 3T10A 1AH8A 1KIJA 2UWDA 4CWNA 5FNFA 4HZ0A 3CWVA 4HXZA 2XK2A 3HEKA 2BTZA 3QDDA 3EHFA 1AMWA 1GKZA 4NH9A 2Q8IA 3EHJA 3HZ1A 3A0RA 2YK2A 4O04A 3R91A 4WUBA 2QG2A 3WQ9A 2YE2A 1UYDA 4FCPA 1TIDA 4GGLA 4ASGA 4XCLA 3T0ZA 4R3MA 3HHUA 2WI3A 3R4MA 4HY1A 4CWPA 5CF0A 5CTWA 5D7CA 2Q8HA 2YEDA 2FTKA 2O1WA 5GGZA 2BYIA 5BOCA 2C1IA 3K97A 4V25A 5IN9A 3O0IA 4X9LA 1TC6A 2XABA 1I5DA 3O6OA 2O1VA 1Z5AA 2BRCA 3Q5JA 3T1KA 4P8OA 2H8MA 2BU5A 4JASA 2YEGA 3D0BA 2WI2A 3OWDA 4BIZA 2XX5A 4UROA 4K4OA 4URNA 5IDMA 3TZ0A 5M4EA 1R62A 1UYMA 2YEFA 1L0OA 1U2OA 4W7TA 2C1GA 2XJJA 4KFGA 2BU2A 4E72A 4EGKA 4GEEA 4KQVA 1PVGA 4BIUA 4ASFA 2YE6A 2XHTA 4XIRA 4MPEA 4ZVIA 4U7OA 3LNUA 2HCHA 1H7UA 1UYHA 2YI6A 4FMTA 4HXWA 2VWCA 4L94A 4WUDA 2BT0A 4HYPA 3B26A 4JQLA 3GIGB 2WEQA 2BU6A 2EXLA 2YE7A 4PRXA 4DUHA 2YJXA 3GIGA 1YT0A 4WUCA 2WI6A 2XDSA 4CWSA 4B6CA 1YC4A 1Y8OA 4E00A 3D2RA 3B25A 2IORA 1YSRA 4CWQA 2BU7A 1Z59A 3G75A 1UYIA 2XD6A 4MPCA 4O07A 3EHGA 1NHHA 1ZXNA 4GT8A 3GIFA 1H7SA 2YI0A 4CE1A 3ZXQA 4EFTA 1OSFA 4XITA 1UYGA 3DGEA 2YGEA 3HYYA 4E02A 1YETA 4P7AA 5L3JA 2XX2A 5IDJA 1I5BA 4YKQA 1GJVA 3CYGA 3A0ZA 4XIPA 4BAEA 3T2SA 4O0BA 1UY7A 2YGAA 4O09A 1I59A 2YE5A 4MBCA 2YI5A 1EI1A 2ZBKB 4LWFA 3INWA 1IXMA 4MPNA 3PEHA 1GKXA 2ESAA 3K99A 4YKXA 3ZKBA 4PL9A 3R4NA 1S16A 4URMA 4KTNA 1UYFA 2ZDYA 3FT8A 4GCZA 3CRLA 1NHIA 4FCQA 1YT2A 4H7QA 1AM1A 4YKUA 1Y8PA 4URLA 4L93A 5F3KA 3TUHA 3JZ3A 2XHRA 1TILA 4I3HA 3U67A 4MOTA 3QTFA 2QF6A 3R4PA 2YK9A 4LPBA 3WHAA 3ZM7A 2YEHA 2XDLA 4EFUA 1AJ6A 4YKYA 4DZYA 3TZ4A 1ZW9A 2FYPA 1UYCA 1B63A 1UY8A 2CCTA 2XHXA 3OPDA 3EKRA 3OW6A 4L8ZA 4AWOA 5FNDA 2XDUA 2BREA 3SL2A 4FCRA 1B3QA 3RLPA 1I5CA 4BQGA 1S14A 1MU5A 2QFOA 4HYMA 2BZ5A 1JM6A 2YKCA 4YKTA 3D36A 4EMVA 3Q5KA 4NH7A 5CTYA 4PRVA 5D6PA 4LWEA 3RLQA 2IOPA 3A0XA 2YE8A 2GQPA 4GQTA 3G7EA 4XDMA 2ZDXA 4LWHA 3OWBA 2AKPA
chains in the Genus database with same CATH topology
2YEBA 2WI5A 4KSHA 5FNCA 4I5SA 2BSMA 3VHDA 1YSZA 3VHCA 4E01A 4XKOA 2BU8A 3G7BA 3NMQA 4AS9A 2CG9A 4CWTA 3IEDA 1US7A 1UYKA 4XCJA 4LWGA 5FWKA 1Y4UA 1KZNA 1UY6A 5D7DA 1QZRA 2FXSA 2YEEA 1QYEA 2XX4A 2WEPA 2GFDA 3RLRA 1AH6A 3INXA 4XD8A 2YKEA 3TZ2A 4KP4A 1U0ZA 1YERA 4H85A 3C11A 4GFNA 2WERA 2H55A 3MNRP 5CTXA 2CCUA 2YI7A 1TH8A 4ASAA 4CWOA 2VCJA 1UYEA 3EKOA 4JAVA 3R92A 3FV5A 1BYQA 4MB9A 3O2FA 3PEJA 4R3AA 2YE4A 4B7PA 4CWRA 2CH4A 2VW5A 1YC3A 4MP2A 2ZKJA 2JKIA 1TBWA 4JAUA 4YKRA 4AWPA 2XDXA 2YKBA 1UY9A 2YECA 2K5BA 3B24A 1Y4SA 4CWFA 2IWUA 3FT5A 3K98A 2XDKA 5CPHA 2FWYA 3HZ5A 3TTZA 3A0TA 5CTUA 5M4KA 1TC0A 1BGQA 4CE3A 2YKJA 4BXIA 4XC0A 3B27A 1BXDA 3K60A 3HYZA 4YKZA 3U2KA 4EGIA 2YEIA 3CRKA 2CCSA 4XKKA 3VADA 4QPKA 4ASBA 3B28A 4QPJA 2WI1A 4MP7A 3H4LA 2XCMA 4Q20A 4O05A 2Q2EB 2C2AA 4NH8A 1MX0A 5D6QA 1Z5CA 1YC1A 5J71A 2Q8FA 2O1UA 2QG0A 4KSGA 4H81A 5F5RA 2BYHA 4V26A 4EM7A 1ZXMA 2XJGA 4HY6A 4FPPA 2Q8GA 2IWSA 2WI7A 5BODA 1EA6A 3A0YA 1I58A 2CGFA 1YESA 3R4OA 4EEHA 4L91A 2PNRA 4LP0A 1YS3A 1THNA 5M4HA 2YKIA 3KE6A 4AWQA 3CGZA 4XIQA 3U2DA 4XKAA 3C0EA 5M4PA 3CGYA 2VCIA 3RKZA 1YT1A 4HZ5A 5M4NA 1BKNA 1ZWHA 1B62A 5M4MA 5J6AA 4PU9A 1NHJA 2HKJA 3OMUA 3T0HA 3H80A 4YKWA 4CE2A 2YJWA 2IWXA 1QY8A 2XJXA 2IOQA 3BM9A 3VHAA 4R1FA 2JJCA 3ZXOA 5D7RA 3BMYA 3TZ5A 2YGFA 2YEJA 2YE3A 1A4HA 2E0AA 4XE2A 1Y8NA 3LPSA 2YE9A 4EGHA 3GIEA 3ZKDA 4BQJA 5C93A 2FWZA 2YEAA 4XTJA 1UYLA 2WI4A 3Q5LA 4U7NA 4ZKIA 2HG1A 4U93A 4L90A 4LWIA 1ID0A 1Z5BA 1I5AA 3A0WA 3EHHA 3T10A 1AH8A 1KIJA 2UWDA 4CWNA 5FNFA 4HZ0A 3CWVA 4HXZA 2XK2A 3HEKA 2BTZA 3QDDA 3EHFA 1AMWA 1GKZA 4NH9A 2Q8IA 3EHJA 3HZ1A 3A0RA 2YK2A 4O04A 3R91A 4WUBA 2QG2A 3WQ9A 2YE2A 1UYDA 4FCPA 1TIDA 4GGLA 4ASGA 4XCLA 3T0ZA 4R3MA 3HHUA 2WI3A 3R4MA 4HY1A 4CWPA 5CF0A 5CTWA 5D7CA 2Q8HA 2YEDA 2O1WA 5GGZA 2BYIA 5BOCA 3K97A 4V25A 5IN9A 3O0IA 4X9LA 1TC6A 2XABA 1I5DA 3O6OA 2O1VA 1Z5AA 2BRCA 3Q5JA 3T1KA 4P8OA 2H8MA 2BU5A 4JASA 2YEGA 3D0BA 2WI2A 3OWDA 4BIZA 2XX5A 4UROA 4K4OA 4URNA 5IDMA 3TZ0A 5M4EA 1R62A 1UYMA 2YEFA 1L0OA 1U2OA 4W7TA 2XJJA 4KFGA 2BU2A 4EGKA 4GEEA 4KQVA 1PVGA 4BIUA 4ASFA 2YE6A 2XHTA 4XIRA 4MPEA 4ZVIA 4U7OA 3LNUA 2HCHA 1H7UA 1UYHA 2YI6A 4FMTA 4HXWA 2VWCA 4L94A 4WUDA 2BT0A 4HYPA 3B26A 4JQLA 3GIGB 2WEQA 2BU6A 2EXLA 2YE7A 4PRXA 4DUHA 2YJXA 3GIGA 1YT0A 4WUCA 2WI6A 2XDSA 4CWSA 4B6CA 1YC4A 1Y8OA 4E00A 3D2RA 3B25A 2IORA 1YSRA 4CWQA 2BU7A 1Z59A 3G75A 1UYIA 2XD6A 4MPCA 4O07A 3EHGA 1NHHA 1ZXNA 4GT8A 3GIFA 1H7SA 2YI0A 4CE1A 3ZXQA 4EFTA 1OSFA 4XITA 1UYGA 3DGEA 2YGEA 3HYYA 4E02A 1YETA 4P7AA 5L3JA 2XX2A 5IDJA 1I5BA 4YKQA 1GJVA 3A0ZA 4XIPA 4BAEA 3T2SA 4O0BA 1UY7A 2YGAA 4O09A 1I59A 2YE5A 4MBCA 2YI5A 1EI1A 2ZBKB 4LWFA 3INWA 4MPNA 3PEHA 1GKXA 2ESAA 3K99A 4YKXA 3ZKBA 4PL9A 3R4NA 1S16A 4URMA 4KTNA 1UYFA 2ZDYA 3FT8A 4GCZA 3CRLA 1NHIA 4FCQA 1YT2A 4H7QA 1AM1A 4YKUA 1Y8PA 4URLA 4L93A 5F3KA 3TUHA 3JZ3A 2XHRA 1TILA 4I3HA 3U67A 4MOTA 3QTFA 2QF6A 3R4PA 2YK9A 4LPBA 3WHAA 3ZM7A 2YEHA 2XDLA 4EFUA 1AJ6A 4YKYA 4DZYA 3TZ4A 1ZW9A 2FYPA 1UYCA 1B63A 1UY8A 2CCTA 2XHXA 3OPDA 3EKRA 3OW6A 4L8ZA 4AWOA 5FNDA 2XDUA 2BREA 3SL2A 4FCRA 1B3QA 3RLPA 1I5CA 4BQGA 1S14A 1MU5A 2QFOA 4HYMA 2BZ5A 1JM6A 2YKCA 4YKTA 3D36A 4EMVA 3Q5KA 4NH7A 5CTYA 4PRVA 5D6PA 4LWEA 3RLQA 2IOPA 3A0XA 2YE8A 2GQPA 4GQTA 3G7EA 4XDMA 2ZDXA 4LWHA 3OWBA 2AKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEB A;  2WI5 A;  4KSH A;  5FNC A;  4I5S A;  2BSM A;  3VHD A;  1YSZ A;  3VHC A;  4E01 A;  4XKO A;  2BU8 A;  3G7B A;  3NMQ A;  4AS9 A;  2CG9 A;  4CWT A;  3IED A;  1US7 A;  1UYK A;  4XCJ A;  4LWG A;  5FWK A;  1Y4U A;  1KZN A;  1UY6 A;  5D7D A;  1QZR A;  2FXS A;  2YEE A;  1QYE A;  2XX4 A;  2WEP A;  2GFD A;  3RLR A;  1AH6 A;  3INX A;  4XD8 A;  2YKE A;  3TZ2 A;  4KP4 A;  1U0Z A;  1YER A;  4H85 A;  3C11 A;  4GFN A;  2WER A;  2H55 A;  3MNR P;  5CTX A;  2CCU A;  2YI7 A;  1TH8 A;  4ASA A;  4CWO A;  2VCJ A;  1UYE A;  3EKO A;  4JAV A;  3R92 A;  3FV5 A;  1BYQ A;  4MB9 A;  3O2F A;  3PEJ A;  4R3A A;  2YE4 A;  4B7P A;  4CWR A;  2CH4 A;  2VW5 A;  1YC3 A;  4MP2 A;  2ZKJ A;  2JKI A;  1TBW A;  4JAU A;  4YKR A;  4AWP A;  2XDX A;  2YKB A;  1UY9 A;  2YEC A;  2K5B A;  3B24 A;  1Y4S A;  4CWF A;  2IWU A;  3FT5 A;  3K98 A;  2XDK A;  5CPH A;  2FWY A;  3HZ5 A;  3TTZ A;  3A0T A;  5CTU A;  5M4K A;  1TC0 A;  1BGQ A;  4CE3 A;  2YKJ A;  4BXI A;  4XC0 A;  3B27 A;  1BXD A;  3K60 A;  3HYZ A;  4YKZ A;  3U2K A;  4EGI A;  2YEI A;  3CRK A;  2CCS A;  4XKK A;  3VAD A;  4QPK A;  4ASB A;  3B28 A;  4QPJ A;  2WI1 A;  4MP7 A;  3H4L A;  2XCM A;  4Q20 A;  4O05 A;  2Q2E B;  2C2A A;  4NH8 A;  1MX0 A;  5D6Q A;  1Z5C A;  1YC1 A;  5J71 A;  2Q8F A;  2O1U A;  2QG0 A;  4KSG A;  4H81 A;  5F5R A;  2BYH A;  4V26 A;  4EM7 A;  1ZXM A;  2XJG A;  4HY6 A;  4FPP A;  2Q8G A;  2IWS A;  2WI7 A;  5BOD A;  1EA6 A;  3A0Y A;  1I58 A;  2CGF A;  1YES A;  3R4O A;  4EEH A;  4L91 A;  2PNR A;  4LP0 A;  1YS3 A;  1THN A;  5M4H A;  2YKI A;  3KE6 A;  4AWQ A;  3CGZ A;  4XIQ A;  3U2D A;  4XKA A;  3C0E A;  5M4P A;  3CGY A;  2VCI A;  3RKZ A;  1YT1 A;  4HZ5 A;  5M4N A;  1BKN A;  1ZWH A;  1B62 A;  5M4M A;  5J6A A;  4PU9 A;  1NHJ A;  2HKJ A;  3OMU A;  3T0H A;  3H80 A;  4YKW A;  4CE2 A;  2YJW A;  2IWX A;  1QY8 A;  2XJX A;  2IOQ A;  3BM9 A;  3VHA A;  4R1F A;  2JJC A;  3ZXO A;  5D7R A;  3BMY A;  3TZ5 A;  2YGF A;  2YEJ A;  2YE3 A;  1A4H A;  2E0A A;  4XE2 A;  1Y8N A;  3LPS A;  2YE9 A;  4EGH A;  3GIE A;  3ZKD A;  4BQJ A;  5C93 A;  2FWZ A;  2YEA A;  4XTJ A;  1UYL A;  2WI4 A;  3Q5L A;  4U7N A;  4ZKI A;  2HG1 A;  4U93 A;  4L90 A;  4LWI A;  1ID0 A;  1Z5B A;  1I5A A;  3A0W A;  3EHH A;  3T10 A;  1AH8 A;  1KIJ A;  2UWD A;  4CWN A;  5FNF A;  4HZ0 A;  3CWV A;  4HXZ A;  2XK2 A;  3HEK A;  2BTZ A;  3QDD A;  3EHF A;  1AMW A;  1GKZ A;  4NH9 A;  2Q8I A;  3EHJ A;  3HZ1 A;  3A0R A;  2YK2 A;  4O04 A;  3R91 A;  4WUB A;  2QG2 A;  3WQ9 A;  2YE2 A;  1UYD A;  4FCP A;  1TID A;  4GGL A;  4ASG A;  4XCL A;  3T0Z A;  4R3M A;  3HHU A;  2WI3 A;  3R4M A;  4HY1 A;  4CWP A;  5CF0 A;  5CTW A;  5D7C A;  2Q8H A;  2YED A;  2O1W A;  5GGZ A;  2BYI A;  5BOC A;  3K97 A;  4V25 A;  5IN9 A;  3O0I A;  4X9L A;  1TC6 A;  2XAB A;  1I5D A;  3O6O A;  2O1V A;  1Z5A A;  2BRC A;  3Q5J A;  3T1K A;  4P8O A;  2H8M A;  2BU5 A;  4JAS A;  2YEG A;  3D0B A;  2WI2 A;  3OWD A;  4BIZ A;  2XX5 A;  4URO A;  4K4O A;  4URN A;  5IDM A;  3TZ0 A;  5M4E A;  1R62 A;  1UYM A;  2YEF A;  1L0O A;  1U2O A;  4W7T A;  2XJJ A;  4KFG A;  2BU2 A;  4EGK A;  4GEE A;  4KQV A;  1PVG A;  4BIU A;  4ASF A;  2YE6 A;  2XHT A;  4XIR A;  4MPE A;  4ZVI A;  4U7O A;  3LNU A;  2HCH A;  1H7U A;  1UYH A;  2YI6 A;  4FMT A;  4HXW A;  2VWC A;  4L94 A;  4WUD A;  2BT0 A;  4HYP A;  3B26 A;  4JQL A;  3GIG B;  2WEQ A;  2BU6 A;  2EXL A;  2YE7 A;  4PRX A;  4DUH A;  2YJX A;  3GIG A;  1YT0 A;  4WUC A;  2WI6 A;  2XDS A;  4CWS A;  4B6C A;  1YC4 A;  1Y8O A;  4E00 A;  3D2R A;  3B25 A;  2IOR A;  1YSR A;  4CWQ A;  2BU7 A;  1Z59 A;  3G75 A;  1UYI A;  2XD6 A;  4MPC A;  4O07 A;  3EHG A;  1NHH A;  1ZXN A;  4GT8 A;  3GIF A;  1H7S A;  2YI0 A;  4CE1 A;  3ZXQ A;  4EFT A;  1OSF A;  4XIT A;  1UYG A;  3DGE A;  2YGE A;  3HYY A;  4E02 A;  1YET A;  4P7A A;  5L3J A;  2XX2 A;  5IDJ A;  1I5B A;  4YKQ A;  1GJV A;  3A0Z A;  4XIP A;  4BAE A;  3T2S A;  4O0B A;  1UY7 A;  2YGA A;  4O09 A;  1I59 A;  2YE5 A;  4MBC A;  2YI5 A;  1EI1 A;  2ZBK B;  4LWF A;  3INW A;  4MPN A;  3PEH A;  1GKX A;  2ESA A;  3K99 A;  4YKX A;  3ZKB A;  4PL9 A;  3R4N A;  1S16 A;  4URM A;  4KTN A;  1UYF A;  2ZDY A;  3FT8 A;  4GCZ A;  3CRL A;  1NHI A;  4FCQ A;  1YT2 A;  4H7Q A;  1AM1 A;  4YKU A;  1Y8P A;  4URL A;  4L93 A;  5F3K A;  3TUH A;  3JZ3 A;  2XHR A;  1TIL A;  4I3H A;  3U67 A;  4MOT A;  3QTF A;  2QF6 A;  3R4P A;  2YK9 A;  4LPB A;  3WHA A;  3ZM7 A;  2YEH A;  2XDL A;  4EFU A;  1AJ6 A;  4YKY A;  4DZY A;  3TZ4 A;  1ZW9 A;  2FYP A;  1UYC A;  1B63 A;  1UY8 A;  2CCT A;  2XHX A;  3OPD A;  3EKR A;  3OW6 A;  4L8Z A;  4AWO A;  5FND A;  2XDU A;  2BRE A;  3SL2 A;  4FCR A;  1B3Q A;  3RLP A;  1I5C A;  4BQG A;  1S14 A;  1MU5 A;  2QFO A;  4HYM A;  2BZ5 A;  1JM6 A;  2YKC A;  4YKT A;  3D36 A;  4EMV A;  3Q5K A;  4NH7 A;  5CTY A;  4PRV A;  5D6P A;  4LWE A;  3RLQ A;  2IOP A;  3A0X A;  2YE8 A;  2GQP A;  4GQT A;  3G7E A;  4XDM A;  2ZDX A;  4LWH A;  3OWB A;  2AKP A; 
#chains in the Genus database with same CATH topology
 2YEB A;  2WI5 A;  4KSH A;  5FNC A;  4I5S A;  2BSM A;  3VHD A;  1YSZ A;  3VHC A;  4E01 A;  4XKO A;  2BU8 A;  3G7B A;  3NMQ A;  4AS9 A;  2CG9 A;  4CWT A;  3S5T A;  3IED A;  1US7 A;  1UYK A;  4XCJ A;  4LWG A;  5FWK A;  1Y4U A;  1KZN A;  1UY6 A;  5D7D A;  1QZR A;  2FXS A;  2YEE A;  1QYE A;  2XX4 A;  2WEP A;  2GFD A;  3RLR A;  5JEN A;  1AH6 A;  3INX A;  4XD8 A;  2YKE A;  3TZ2 A;  4KP4 A;  1U0Z A;  1YER A;  4H85 A;  3C11 A;  4GFN A;  2WER A;  2H55 A;  3MNR P;  5CTX A;  2CCU A;  2YI7 A;  1TH8 A;  4ASA A;  4CWO A;  2VCJ A;  1UYE A;  3EKO A;  4JAV A;  3R92 A;  3FV5 A;  1BYQ A;  4MB9 A;  3O2F A;  3PEJ A;  4R3A A;  2YE4 A;  4B7P A;  4CWR A;  2CH4 A;  2VW5 A;  1YC3 A;  4MP2 A;  2ZKJ A;  2JKI A;  1TBW A;  4JAU A;  4YKR A;  4AWP A;  2XDX A;  2YKB A;  1UY9 A;  2YEC A;  2K5B A;  3B24 A;  2HHI A;  1Y4S A;  4CWF A;  2IWU A;  3FT5 A;  3K98 A;  2XDK A;  5CPH A;  2FWY A;  3HZ5 A;  3TTZ A;  3A0T A;  5CTU A;  5M4K A;  1TC0 A;  1BGQ A;  4CE3 A;  2YKJ A;  4BXI A;  4XC0 A;  3B27 A;  1BXD A;  3K60 A;  3HYZ A;  4YKZ A;  3U2K A;  4EGI A;  2YEI A;  3CRK A;  2CCS A;  4XKK A;  3VAD A;  4QPK A;  4ASB A;  3B28 A;  4QPJ A;  2WI1 A;  4MP7 A;  3H4L A;  2XCM A;  4Q20 A;  4O05 A;  2Q2E B;  2C2A A;  3LMM A;  4NH8 A;  1MX0 A;  5D6Q A;  1Z5C A;  1YC1 A;  5J71 A;  2Q8F A;  2O1U A;  2QG0 A;  4KSG A;  4H81 A;  5F5R A;  2BYH A;  4V26 A;  4EM7 A;  1ZXM A;  2XJG A;  4HY6 A;  4FPP A;  2Q8G A;  2IWS A;  2WI7 A;  5BOD A;  1EA6 A;  3A0Y A;  1I58 A;  2CGF A;  1YES A;  3R4O A;  4EEH A;  4L91 A;  2PNR A;  4LP0 A;  1YS3 A;  1THN A;  5M4H A;  2YKI A;  3KE6 A;  4AWQ A;  3CGZ A;  4XIQ A;  3U2D A;  4XKA A;  3C0E A;  5M4P A;  3CGY A;  2VCI A;  3RKZ A;  1YT1 A;  4HZ5 A;  5M4N A;  1BKN A;  1ZWH A;  1B62 A;  5M4M A;  5J6A A;  4PU9 A;  1NHJ A;  2HKJ A;  3OMU A;  3T0H A;  3H80 A;  4YKW A;  4CE2 A;  2YJW A;  2IWX A;  1QY8 A;  2XJX A;  2IOQ A;  3BM9 A;  3VHA A;  4R1F A;  2JJC A;  3ZXO A;  5D7R A;  3BMY A;  3TZ5 A;  2YGF A;  2YEJ A;  2YE3 A;  1A4H A;  2E0A A;  4XE2 A;  1Y8N A;  3LPS A;  2YE9 A;  4EGH A;  3GIE A;  3ZKD A;  4BQJ A;  5C93 A;  2FWZ A;  2YEA A;  4XTJ A;  1UYL A;  2WI4 A;  3Q5L A;  4U7N A;  4ZKI A;  2HG1 A;  4U93 A;  4L90 A;  4LWI A;  1F51 A;  1ID0 A;  1Z5B A;  1I5A A;  3A0W A;  3EHH A;  3T10 A;  1AH8 A;  1KIJ A;  2UWD A;  4CWN A;  5FNF A;  4HZ0 A;  3CWV A;  4HXZ A;  2XK2 A;  3HEK A;  2BTZ A;  3QDD A;  3EHF A;  1AMW A;  1GKZ A;  4NH9 A;  2Q8I A;  3EHJ A;  3HZ1 A;  3A0R A;  2YK2 A;  4O04 A;  3R91 A;  4WUB A;  2QG2 A;  3WQ9 A;  2YE2 A;  1UYD A;  4FCP A;  1TID A;  4GGL A;  4ASG A;  4XCL A;  3T0Z A;  4R3M A;  3HHU A;  2WI3 A;  3R4M A;  4HY1 A;  4CWP A;  5CF0 A;  5CTW A;  5D7C A;  2Q8H A;  2YED A;  2FTK A;  2O1W A;  5GGZ A;  2BYI A;  5BOC A;  2C1I A;  3K97 A;  4V25 A;  5IN9 A;  3O0I A;  4X9L A;  1TC6 A;  2XAB A;  1I5D A;  3O6O A;  2O1V A;  1Z5A A;  2BRC A;  3Q5J A;  3T1K A;  4P8O A;  2H8M A;  2BU5 A;  4JAS A;  2YEG A;  3D0B A;  2WI2 A;  3OWD A;  4BIZ A;  2XX5 A;  4URO A;  4K4O A;  4URN A;  5IDM A;  3TZ0 A;  5M4E A;  1R62 A;  1UYM A;  2YEF A;  1L0O A;  1U2O A;  4W7T A;  2C1G A;  2XJJ A;  4KFG A;  2BU2 A;  4E72 A;  4EGK A;  4GEE A;  4KQV A;  1PVG A;  4BIU A;  4ASF A;  2YE6 A;  2XHT A;  4XIR A;  4MPE A;  4ZVI A;  4U7O A;  3LNU A;  2HCH A;  1H7U A;  1UYH A;  2YI6 A;  4FMT A;  4HXW A;  2VWC A;  4L94 A;  4WUD A;  2BT0 A;  4HYP A;  3B26 A;  4JQL A;  3GIG B;  2WEQ A;  2BU6 A;  2EXL A;  2YE7 A;  4PRX A;  4DUH A;  2YJX A;  3GIG A;  1YT0 A;  4WUC A;  2WI6 A;  2XDS A;  4CWS A;  4B6C A;  1YC4 A;  1Y8O A;  4E00 A;  3D2R A;  3B25 A;  2IOR A;  1YSR A;  4CWQ A;  2BU7 A;  1Z59 A;  3G75 A;  1UYI A;  2XD6 A;  4MPC A;  4O07 A;  3EHG A;  1NHH A;  1ZXN A;  4GT8 A;  3GIF A;  1H7S A;  2YI0 A;  4CE1 A;  3ZXQ A;  4EFT A;  1OSF A;  4XIT A;  1UYG A;  3DGE A;  2YGE A;  3HYY A;  4E02 A;  1YET A;  4P7A A;  5L3J A;  2XX2 A;  5IDJ A;  1I5B A;  4YKQ A;  1GJV A;  3CYG A;  3A0Z A;  4XIP A;  4BAE A;  3T2S A;  4O0B A;  1UY7 A;  2YGA A;  4O09 A;  1I59 A;  2YE5 A;  4MBC A;  2YI5 A;  1EI1 A;  2ZBK B;  4LWF A;  3INW A;  1IXM A;  4MPN A;  3PEH A;  1GKX A;  2ESA A;  3K99 A;  4YKX A;  3ZKB A;  4PL9 A;  3R4N A;  1S16 A;  4URM A;  4KTN A;  1UYF A;  2ZDY A;  3FT8 A;  4GCZ A;  3CRL A;  1NHI A;  4FCQ A;  1YT2 A;  4H7Q A;  1AM1 A;  4YKU A;  1Y8P A;  4URL A;  4L93 A;  5F3K A;  3TUH A;  3JZ3 A;  2XHR A;  1TIL A;  4I3H A;  3U67 A;  4MOT A;  3QTF A;  2QF6 A;  3R4P A;  2YK9 A;  4LPB A;  3WHA A;  3ZM7 A;  2YEH A;  2XDL A;  4EFU A;  1AJ6 A;  4YKY A;  4DZY A;  3TZ4 A;  1ZW9 A;  2FYP A;  1UYC A;  1B63 A;  1UY8 A;  2CCT A;  2XHX A;  3OPD A;  3EKR A;  3OW6 A;  4L8Z A;  4AWO A;  5FND A;  2XDU A;  2BRE A;  3SL2 A;  4FCR A;  1B3Q A;  3RLP A;  1I5C A;  4BQG A;  1S14 A;  1MU5 A;  2QFO A;  4HYM A;  2BZ5 A;  1JM6 A;  2YKC A;  4YKT A;  3D36 A;  4EMV A;  3Q5K A;  4NH7 A;  5CTY A;  4PRV A;  5D6P A;  4LWE A;  3RLQ A;  2IOP A;  3A0X A;  2YE8 A;  2GQP A;  4GQT A;  3G7E A;  4XDM A;  2ZDX A;  4LWH A;  3OWB A;  2AKP A; 
#chains in the Genus database with same CATH homology
 2YEB A;  2WI5 A;  4KSH A;  5FNC A;  4I5S A;  2BSM A;  3VHD A;  1YSZ A;  3VHC A;  4E01 A;  4XKO A;  2BU8 A;  3G7B A;  3NMQ A;  4AS9 A;  2CG9 A;  4CWT A;  3IED A;  1US7 A;  1UYK A;  4XCJ A;  4LWG A;  5FWK A;  1Y4U A;  1KZN A;  1UY6 A;  5D7D A;  1QZR A;  2FXS A;  2YEE A;  1QYE A;  2XX4 A;  2WEP A;  2GFD A;  3RLR A;  1AH6 A;  3INX A;  4XD8 A;  2YKE A;  3TZ2 A;  4KP4 A;  1U0Z A;  1YER A;  4H85 A;  3C11 A;  4GFN A;  2WER A;  2H55 A;  3MNR P;  5CTX A;  2CCU A;  2YI7 A;  1TH8 A;  4ASA A;  4CWO A;  2VCJ A;  1UYE A;  3EKO A;  4JAV A;  3R92 A;  3FV5 A;  1BYQ A;  4MB9 A;  3O2F A;  3PEJ A;  4R3A A;  2YE4 A;  4B7P A;  4CWR A;  2CH4 A;  2VW5 A;  1YC3 A;  4MP2 A;  2ZKJ A;  2JKI A;  1TBW A;  4JAU A;  4YKR A;  4AWP A;  2XDX A;  2YKB A;  1UY9 A;  2YEC A;  2K5B A;  3B24 A;  1Y4S A;  4CWF A;  2IWU A;  3FT5 A;  3K98 A;  2XDK A;  5CPH A;  2FWY A;  3HZ5 A;  3TTZ A;  3A0T A;  5CTU A;  5M4K A;  1TC0 A;  1BGQ A;  4CE3 A;  2YKJ A;  4BXI A;  4XC0 A;  3B27 A;  1BXD A;  3K60 A;  3HYZ A;  4YKZ A;  3U2K A;  4EGI A;  2YEI A;  3CRK A;  2CCS A;  4XKK A;  3VAD A;  4QPK A;  4ASB A;  3B28 A;  4QPJ A;  2WI1 A;  4MP7 A;  3H4L A;  2XCM A;  4Q20 A;  4O05 A;  2Q2E B;  2C2A A;  4NH8 A;  1MX0 A;  5D6Q A;  1Z5C A;  1YC1 A;  5J71 A;  2Q8F A;  2O1U A;  2QG0 A;  4KSG A;  4H81 A;  5F5R A;  2BYH A;  4V26 A;  4EM7 A;  1ZXM A;  2XJG A;  4HY6 A;  4FPP A;  2Q8G A;  2IWS A;  2WI7 A;  5BOD A;  1EA6 A;  3A0Y A;  1I58 A;  2CGF A;  1YES A;  3R4O A;  4EEH A;  4L91 A;  2PNR A;  4LP0 A;  1YS3 A;  1THN A;  5M4H A;  2YKI A;  3KE6 A;  4AWQ A;  3CGZ A;  4XIQ A;  3U2D A;  4XKA A;  3C0E A;  5M4P A;  3CGY A;  2VCI A;  3RKZ A;  1YT1 A;  4HZ5 A;  5M4N A;  1BKN A;  1ZWH A;  1B62 A;  5M4M A;  5J6A A;  4PU9 A;  1NHJ A;  2HKJ A;  3OMU A;  3T0H A;  3H80 A;  4YKW A;  4CE2 A;  2YJW A;  2IWX A;  1QY8 A;  2XJX A;  2IOQ A;  3BM9 A;  3VHA A;  4R1F A;  2JJC A;  3ZXO A;  5D7R A;  3BMY A;  3TZ5 A;  2YGF A;  2YEJ A;  2YE3 A;  1A4H A;  2E0A A;  4XE2 A;  1Y8N A;  3LPS A;  2YE9 A;  4EGH A;  3GIE A;  3ZKD A;  4BQJ A;  5C93 A;  2FWZ A;  2YEA A;  4XTJ A;  1UYL A;  2WI4 A;  3Q5L A;  4U7N A;  4ZKI A;  2HG1 A;  4U93 A;  4L90 A;  4LWI A;  1ID0 A;  1Z5B A;  1I5A A;  3A0W A;  3EHH A;  3T10 A;  1AH8 A;  1KIJ A;  2UWD A;  4CWN A;  5FNF A;  4HZ0 A;  3CWV A;  4HXZ A;  2XK2 A;  3HEK A;  2BTZ A;  3QDD A;  3EHF A;  1AMW A;  1GKZ A;  4NH9 A;  2Q8I A;  3EHJ A;  3HZ1 A;  3A0R A;  2YK2 A;  4O04 A;  3R91 A;  4WUB A;  2QG2 A;  3WQ9 A;  2YE2 A;  1UYD A;  4FCP A;  1TID A;  4GGL A;  4ASG A;  4XCL A;  3T0Z A;  4R3M A;  3HHU A;  2WI3 A;  3R4M A;  4HY1 A;  4CWP A;  5CF0 A;  5CTW A;  5D7C A;  2Q8H A;  2YED A;  2O1W A;  5GGZ A;  2BYI A;  5BOC A;  3K97 A;  4V25 A;  5IN9 A;  3O0I A;  4X9L A;  1TC6 A;  2XAB A;  1I5D A;  3O6O A;  2O1V A;  1Z5A A;  2BRC A;  3Q5J A;  3T1K A;  4P8O A;  2H8M A;  2BU5 A;  4JAS A;  2YEG A;  3D0B A;  2WI2 A;  3OWD A;  4BIZ A;  2XX5 A;  4URO A;  4K4O A;  4URN A;  5IDM A;  3TZ0 A;  5M4E A;  1R62 A;  1UYM A;  2YEF A;  1L0O A;  1U2O A;  4W7T A;  2XJJ A;  4KFG A;  2BU2 A;  4EGK A;  4GEE A;  4KQV A;  1PVG A;  4BIU A;  4ASF A;  2YE6 A;  2XHT A;  4XIR A;  4MPE A;  4ZVI A;  4U7O A;  3LNU A;  2HCH A;  1H7U A;  1UYH A;  2YI6 A;  4FMT A;  4HXW A;  2VWC A;  4L94 A;  4WUD A;  2BT0 A;  4HYP A;  3B26 A;  4JQL A;  3GIG B;  2WEQ A;  2BU6 A;  2EXL A;  2YE7 A;  4PRX A;  4DUH A;  2YJX A;  3GIG A;  1YT0 A;  4WUC A;  2WI6 A;  2XDS A;  4CWS A;  4B6C A;  1YC4 A;  1Y8O A;  4E00 A;  3D2R A;  3B25 A;  2IOR A;  1YSR A;  4CWQ A;  2BU7 A;  1Z59 A;  3G75 A;  1UYI A;  2XD6 A;  4MPC A;  4O07 A;  3EHG A;  1NHH A;  1ZXN A;  4GT8 A;  3GIF A;  1H7S A;  2YI0 A;  4CE1 A;  3ZXQ A;  4EFT A;  1OSF A;  4XIT A;  1UYG A;  3DGE A;  2YGE A;  3HYY A;  4E02 A;  1YET A;  4P7A A;  5L3J A;  2XX2 A;  5IDJ A;  1I5B A;  4YKQ A;  1GJV A;  3A0Z A;  4XIP A;  4BAE A;  3T2S A;  4O0B A;  1UY7 A;  2YGA A;  4O09 A;  1I59 A;  2YE5 A;  4MBC A;  2YI5 A;  1EI1 A;  2ZBK B;  4LWF A;  3INW A;  4MPN A;  3PEH A;  1GKX A;  2ESA A;  3K99 A;  4YKX A;  3ZKB A;  4PL9 A;  3R4N A;  1S16 A;  4URM A;  4KTN A;  1UYF A;  2ZDY A;  3FT8 A;  4GCZ A;  3CRL A;  1NHI A;  4FCQ A;  1YT2 A;  4H7Q A;  1AM1 A;  4YKU A;  1Y8P A;  4URL A;  4L93 A;  5F3K A;  3TUH A;  3JZ3 A;  2XHR A;  1TIL A;  4I3H A;  3U67 A;  4MOT A;  3QTF A;  2QF6 A;  3R4P A;  2YK9 A;  4LPB A;  3WHA A;  3ZM7 A;  2YEH A;  2XDL A;  4EFU A;  1AJ6 A;  4YKY A;  4DZY A;  3TZ4 A;  1ZW9 A;  2FYP A;  1UYC A;  1B63 A;  1UY8 A;  2CCT A;  2XHX A;  3OPD A;  3EKR A;  3OW6 A;  4L8Z A;  4AWO A;  5FND A;  2XDU A;  2BRE A;  3SL2 A;  4FCR A;  1B3Q A;  3RLP A;  1I5C A;  4BQG A;  1S14 A;  1MU5 A;  2QFO A;  4HYM A;  2BZ5 A;  1JM6 A;  2YKC A;  4YKT A;  3D36 A;  4EMV A;  3Q5K A;  4NH7 A;  5CTY A;  4PRV A;  5D6P A;  4LWE A;  3RLQ A;  2IOP A;  3A0X A;  2YE8 A;  2GQP A;  4GQT A;  3G7E A;  4XDM A;  2ZDX A;  4LWH A;  3OWB A;  2AKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...