4GQWA

Crystal structure of cbs-pair protein, cbsx1 (loop deletion) from arabidopsis thaliana
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
132
Chain Sequence
GVYTVGEFMTKKEDLHVVKPTTTVDEALELLVENRITGFPVIDEDWKLVGLVSDYDLLALDTWKTFNAVQKLGKLVGDLMTPAPLVVEEKTNLEDAAKILLETKYRRLPVVDSDGKLVGIITRGNVVRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CBSX1 (loop deletion)
pubmed doi rcsb
molecule keywords CBS domain-containing protein CBSX1, chloroplastic
molecule tags Protein binding
source organism Arabidopsis thaliana
total genus 31
structure length 132
sequence length 141
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4gqwA00
3FWRA 2NYEA 3KPCA 3FWSA 4GQVA 2QREE 2UV6A 2UV7A 3KH5A 3TE5C 3PC4A 3L31A 4L3VA 2OOXE 4P1GA 1O50A 3OI8A 3FV6A 4O9KA 4L0DA 4UUUA 3KPBA 3OCMA 2O16A 3LQNA 2YZQA 3L2BA 2QRCE 3DDJA 1Y5HA 3HF7A 3KPDA 5K25C 3OCOA 2ZY9A 3KXRA 2UV5A 2YZIA 3K2VA 3GBYA 3PC3A 5KS7A 2PFIA 4ESYA 2EF7A 4DQWA 2RIHA 2QRDE 3LHHA 4FXSA 3T4NC 3SL7A 3FHMA 4IY4A 2RIFA 2OOYE 3K6EA 4FRYA 2QH1A 4IY3A 3LFZA 2EMQA 4NOCA 2YVYA 4ESYB 4GQWA 1XKFA 2RC3A 4GQYA 2NYCA 4L27A 2D4ZA 4PCUA 2YVXA 4HG0A 5IIPA 3LV9A 5K23C 2P9MA 3I8NA 4L28A 2OUXA 4COOA 3ORGA 2QLVC 3FNAA 5LXQA 2YVZA 1PBJA 4IYSA 5K22B 3PC2A 4IY0A 4P1OA 2UV4A 5MMZA 4IY2A 5K24C 1YAVA 2QR1E 3TDHC 1PVMA
chains in the Genus database with same CATH superfamily
3FWRA 2NYEA 3KPCA 3FWSA 4GQVA 2QREE 2UV6A 2UV7A 3KH5A 3TE5C 3PC4A 3L31A 4L3VA 2OOXE 4P1GA 1O50A 3OI8A 3FV6A 4O9KA 4L0DA 4UUUA 3KPBA 3OCMA 2O16A 3LQNA 2JA3A 2YZQA 3L2BA 2QRCE 3DDJA 1Y5HA 3HF7A 3KPDA 5K25C 3OCOA 2ZY9A 3KXRA 2UV5A 2YZIA 3K2VA 3GBYA 3PC3A 5KS7A 2PFIA 4ESYA 2EF7A 4DQWA 2RIHA 2QRDE 3LHHA 4FXSA 3T4NC 3SL7A 3FHMA 4IY4A 2RIFA 2OOYE 3K6EA 4FRYA 2QH1A 4IY3A 3LFZA 2EMQA 4NOCA 2YVYA 4ESYB 4GQWA 1XKFA 2RC3A 4GQYA 2NYCA 4L27A 2D4ZA 4PCUA 2YVXA 4HG0A 5IIPA 3LV9A 5K23C 2P9MA 3I8NA 4L28A 2OUXA 4COOA 3ORGA 2QLVC 3FNAA 5LXQA 2YVZA 1PBJA 4IYSA 5K22B 3PC2A 4IY0A 4P1OA 2UV4A 5MMZA 4IY2A 5K24C 1YAVA 2QR1E 2J9LA 3TDHC 1PVMA
chains in the Genus database with same CATH topology
3FWRA 2NYEA 3KPCA 3FWSA 4GQVA 2QREE 2UV6A 2UV7A 3KH5A 3TE5C 3PC4A 3L31A 4L3VA 2OOXE 4P1GA 1O50A 3OI8A 3FV6A 4O9KA 4L0DA 4UUUA 3KPBA 3OCMA 2O16A 3LQNA 2JA3A 2YZQA 3L2BA 2QRCE 3DDJA 1Y5HA 3HF7A 3KPDA 5K25C 3OCOA 2ZY9A 3KXRA 2UV5A 2YZIA 3K2VA 3GBYA 3PC3A 5KS7A 2PFIA 4ESYA 2EF7A 4DQWA 2RIHA 2QRDE 3LHHA 4FXSA 3T4NC 3SL7A 3FHMA 4IY4A 2RIFA 2OOYE 3K6EA 4FRYA 2QH1A 4IY3A 3LFZA 2EMQA 4NOCA 2YVYA 4ESYB 4GQWA 1XKFA 2RC3A 4GQYA 2NYCA 4L27A 2D4ZA 4PCUA 2YVXA 4HG0A 5IIPA 3LV9A 5K23C 2P9MA 3I8NA 4L28A 2OUXA 4COOA 3ORGA 2QLVC 3FNAA 5LXQA 2YVZA 1PBJA 4IYSA 5K22B 3PC2A 4IY0A 4P1OA 2UV4A 5MMZA 4IY2A 5K24C 1YAVA 2QR1E 2J9LA 3TDHC 1PVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWR A;  2NYE A;  3KPC A;  3FWS A;  4GQV A;  2QRE E;  2UV6 A;  2UV7 A;  3KH5 A;  3TE5 C;  3PC4 A;  3L31 A;  4L3V A;  2OOX E;  4P1G A;  1O50 A;  3OI8 A;  3FV6 A;  4O9K A;  4L0D A;  4UUU A;  3KPB A;  3OCM A;  2O16 A;  3LQN A;  2YZQ A;  3L2B A;  2QRC E;  3DDJ A;  1Y5H A;  3HF7 A;  3KPD A;  5K25 C;  3OCO A;  2ZY9 A;  3KXR A;  2UV5 A;  2YZI A;  3K2V A;  3GBY A;  3PC3 A;  5KS7 A;  2PFI A;  4ESY A;  2EF7 A;  4DQW A;  2RIH A;  2QRD E;  3LHH A;  4FXS A;  3T4N C;  3SL7 A;  3FHM A;  4IY4 A;  2RIF A;  2OOY E;  3K6E A;  4FRY A;  2QH1 A;  4IY3 A;  3LFZ A;  2EMQ A;  4NOC A;  2YVY A;  4ESY B;  4GQW A;  1XKF A;  2RC3 A;  4GQY A;  2NYC A;  4L27 A;  2D4Z A;  4PCU A;  2YVX A;  4HG0 A;  5IIP A;  3LV9 A;  5K23 C;  2P9M A;  3I8N A;  4L28 A;  2OUX A;  4COO A;  3ORG A;  2QLV C;  3FNA A;  5LXQ A;  2YVZ A;  1PBJ A;  4IYS A;  5K22 B;  3PC2 A;  4IY0 A;  4P1O A;  2UV4 A;  5MMZ A;  4IY2 A;  5K24 C;  1YAV A;  2QR1 E;  3TDH C;  1PVM A; 
#chains in the Genus database with same CATH topology
 3FWR A;  2NYE A;  3KPC A;  3FWS A;  4GQV A;  2QRE E;  2UV6 A;  2UV7 A;  3KH5 A;  3TE5 C;  3PC4 A;  3L31 A;  4L3V A;  2OOX E;  4P1G A;  1O50 A;  3OI8 A;  3FV6 A;  4O9K A;  4L0D A;  4UUU A;  3KPB A;  3OCM A;  2O16 A;  3LQN A;  2JA3 A;  2YZQ A;  3L2B A;  2QRC E;  3DDJ A;  1Y5H A;  3HF7 A;  3KPD A;  5K25 C;  3OCO A;  2ZY9 A;  3KXR A;  2UV5 A;  2YZI A;  3K2V A;  3GBY A;  3PC3 A;  5KS7 A;  2PFI A;  4ESY A;  2EF7 A;  4DQW A;  2RIH A;  2QRD E;  3LHH A;  4FXS A;  3T4N C;  3SL7 A;  3FHM A;  4IY4 A;  2RIF A;  2OOY E;  3K6E A;  4FRY A;  2QH1 A;  4IY3 A;  3LFZ A;  2EMQ A;  4NOC A;  2YVY A;  4ESY B;  4GQW A;  1XKF A;  2RC3 A;  4GQY A;  2NYC A;  4L27 A;  2D4Z A;  4PCU A;  2YVX A;  4HG0 A;  5IIP A;  3LV9 A;  5K23 C;  2P9M A;  3I8N A;  4L28 A;  2OUX A;  4COO A;  3ORG A;  2QLV C;  3FNA A;  5LXQ A;  2YVZ A;  1PBJ A;  4IYS A;  5K22 B;  3PC2 A;  4IY0 A;  4P1O A;  2UV4 A;  5MMZ A;  4IY2 A;  5K24 C;  1YAV A;  2QR1 E;  2J9L A;  3TDH C;  1PVM A; 
#chains in the Genus database with same CATH homology
 3FWR A;  2NYE A;  3KPC A;  3FWS A;  4GQV A;  2QRE E;  2UV6 A;  2UV7 A;  3KH5 A;  3TE5 C;  3PC4 A;  3L31 A;  4L3V A;  2OOX E;  4P1G A;  1O50 A;  3OI8 A;  3FV6 A;  4O9K A;  4L0D A;  4UUU A;  3KPB A;  3OCM A;  2O16 A;  3LQN A;  2JA3 A;  2YZQ A;  3L2B A;  2QRC E;  3DDJ A;  1Y5H A;  3HF7 A;  3KPD A;  5K25 C;  3OCO A;  2ZY9 A;  3KXR A;  2UV5 A;  2YZI A;  3K2V A;  3GBY A;  3PC3 A;  5KS7 A;  2PFI A;  4ESY A;  2EF7 A;  4DQW A;  2RIH A;  2QRD E;  3LHH A;  4FXS A;  3T4N C;  3SL7 A;  3FHM A;  4IY4 A;  2RIF A;  2OOY E;  3K6E A;  4FRY A;  2QH1 A;  4IY3 A;  3LFZ A;  2EMQ A;  4NOC A;  2YVY A;  4ESY B;  4GQW A;  1XKF A;  2RC3 A;  4GQY A;  2NYC A;  4L27 A;  2D4Z A;  4PCU A;  2YVX A;  4HG0 A;  5IIP A;  3LV9 A;  5K23 C;  2P9M A;  3I8N A;  4L28 A;  2OUX A;  4COO A;  3ORG A;  2QLV C;  3FNA A;  5LXQ A;  2YVZ A;  1PBJ A;  4IYS A;  5K22 B;  3PC2 A;  4IY0 A;  4P1O A;  2UV4 A;  5MMZ A;  4IY2 A;  5K24 C;  1YAV A;  2QR1 E;  2J9L A;  3TDH C;  1PVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...