4GR3A

Crystal structure of the catalytic domain of human mmp12 in complex with selective phosphinic inhibitor rxp470a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Molecular determinants of a selective matrix metalloprotease-12 inhibitor: insights from crystallography and thermodynamic studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 45
structure length 159
sequence length 159
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4gr3A00
1G4KA 4JA1A 2Y6DA 1XFVA 1UTZA 5H8XA 1Q3AA 3ELMA 4DPEA 2X7MA 1YQYA 2D1OA 1O0QA 1KAPP 1CIZA 4ON1A 2AYKA 4XCTA 5LABA 1BZSA 1K7QA 3HDBA 3VTGA 4JIJA 1FLSA 4PKQA 1GKCA 3P1VA 1EAKA 1JIZA 2OXZA 3TVCA 3AYKA 3ZVSA 1QJIA 3KMCA 3Q2HA 1XUCA 1B3DA 4GWMA 1R1IA 456CA 1OS9A 3KHIA 1GE6A 3KWVC 830CA 2A8HA 3EDIA 2MLRA 3LILA 1A85A 1XURA 3B8ZA 4I03A 1R55A 1KUGA 2J83A 3KECA 4H84A 1JIWP 2CKIA 5D1SA 3MA2A 3LGPA 4JP4A 4XM8A 3LJTA 1G9KA 1CQRA 3KEJA 3V96B 4PKRA 4WZVA 3TT4A 5I12A 1AKLA 3LUMA 1USNA 1IACA 2MLSA 1G05A 1JANA 2DDYA 2AIGP 2OVXA 4L63A 4JPAA 1UMTA 3DNGA 1BM6A 3AIGA 3HY9A 4H2EA 1AYKA 1UEAA 3EDHA 3HDAP 2MZEA 2J0TA 4FU4A 1EUBA 3TSKA 1HY7A 1I1IP 1IADA 2YB9A 1QICA 1HOVA 1R54A 4AXQA 4PKSA 1QJJA 4WK7A 3O2XA 2OW9A 3K7NA 1QIAA 1JAOA 5D2BA 2Y6CA 4GWNA 1IAAA 3LJGA 2K9CA 4XM7A 5BPAA 1MMPA 3F1AA 1C3IA 2OW0A 3B2ZA 1O0TA 3I7IA 1D7XA 1ATLA 2OY2A 1JAPA 1B8YA 1KUIA 3LIRA 3DWBA 1G12A 1PWUA 1GO7P 3E8RA 3VI1A 4HX3A 1OMJA 4PKUA 1G49A 2RJPA 1RMZA 4DV8A 2FV5A 4AIGA 5I4OA 2OXUA 4WKEA 4H3XA 3BA0A 2N8RA 3KMEA 1D5JA 3U1RA 5I2ZA 1JAQA 1HTDA 2TCLA 2D1NA 1AF0A 1CK7A 1JKYA 4L6TA 1BSWA 1HFSA 2W15A 3K7LA 4FVLA 4IJOA 3ZUKA 3F16A 2USNA 3USNA 4H30A 3HBVP 5CXAA 1JJ9A 2W13A 2O3EA 1OO9A 4GR8A 1R1JA 4PKTA 4DD8A 1ZS0A 5B5OA 1K7IA 4L19A 2V4BA 1PWVA 2JIHA 1SLMA 2OVZA 1BKCA 3CKIA 1C7KA 3LE9A 1BKCI 3N2VA 1A86A 1ZXVA 1OS2A 3HY7A 2E2DA 4PKVA 1OM8A 3TS4A 1XFYA 2E3XA 3DL1A 1QIBA 1GE5A 1MMBA 1CGEA 1I73A 2JT5A 4PKWA 5I3MA 2OI0A 3KEKA 5BOYA 3L0VA 3LQ0A 3WV1A 1KUHA 3DPFA 4GQLA 1JH1A 3HBUP 2DW1A 1PWWA 2FV9A 1KUKA 3F19A 2RJQA 1KBCA 1CXVA 2MZHA 4H76A 1S4BP 1HV5A 2WO9A 3RTSA 3WV2A 1ZTQA 966CA 2XS3A 2W14A 3LUNA 1ROSA 1SU3A 1IAGA 5L7FA 3RTTA 5L79A 4I35A 1WNIA 4GR0A 1UTTA 1KUFA 1GO8P 3EDZA 3Q2GA 1XUDA 1BUDA 2Z2DA 3GBOA 2OY4A 4ILWD 3HYGA 1CGLA 1BIWA 1BQOA 3F17A 2ERQA 1XFUA 2EROA 4WKIA 3HB2P 4H1QA 2HU6A 3LIKA 1MMQA 4H82A 5CZMA 3UVCA 4Q1LA 2PJTA 1DTHA 1FBLA 1CAQA 4CTHA 2W0DA 3WV3A 1D8FA 1YCMA 2WOAA 3LKAA 5JMYA 1YP1A 1ZXCA 3F18A 2JNPA 1FM1A 3L0TA 3DPEA 1RM8A 2WO8A 1XFWA 1BKCE 4H49A 1CGFA 4A3WA 4FXQA 1ZVXA 2QPJA 1SRPA 5D3CA 1XFXA 1BQQM 3SHIA 3EHXA 1MMRA 1EB6A 3G5CA 3LQBA 3I7GA 2JSDA 2SRTA 2XS4A 2K2GA 4WF6A 2X3BA 2DDFA 3LJZA 4A7BA 1BUVM 1H71P 1PWPA 3F15A 1Y0VA 4EFSA 3LEAA 4XBHA 5CUHA 1D8MA 2CLTA 3EDGA 2OXWA 3ZXHA 1GE7A 1ND1A 2KRJA 1Z3JA 2X3CA 1GKDA 4FXYP 4DF9A 1HFCA 4G9LA 3EWJA 3P24A 1GXDA 1IABA 4HMAA 1R1HA 4IUWA 2DW0A 4AYKA 3G42A 2DW2A 1Y93A 3OHOA 4AUOA 5D7WA 1OM6A 2OW2A 1DMTA 4R3VA 4ZR5A 1IAEA 3B92A 1YOUA 1Y8JA 1SMPA 3OHLA 1I76A 2JT6A 2OZRA 5B5PA 4JQGA 4J4MA 2W12A 2POJA 3O64A 1L6JA 5D1UA 3N2UA 4XM6A 2L0RA 2X3AA 2I47A 1C8TA 1J7NA 1SATA 4GR3A 2YIGA 3LK8A 1K7GA 1ASTA 2O36A 1ZP5A 1MNCA 3AYUA 3EHYA 5D1TA 5BOTA 4GF1A 2MZIA 1QUAA 2ERPA 3DSLA 4GUYA 4QKZA 3LMCA 3NX7A 1OM7A 5I0LA 1UMSA 1XFZA 4G0DA 1PWQA 2OW1A 5I43A 4IN9A 1JK3A 3KRYA 1SLNA
chains in the Genus database with same CATH superfamily
1G4KA 4JA1A 2Y6DA 1XFVA 1UTZA 5H8XA 1Q3AA 3ELMA 4DPEA 2X7MA 1YQYA 2D1OA 1O0QA 1KAPP 1CIZA 4ON1A 2AYKA 4XCTA 5LABA 1BZSA 1K7QA 3HDBA 3VTGA 4JIJA 1FLSA 4PKQA 1GKCA 3P1VA 1EAKA 1JIZA 2OXZA 3TVCA 3AYKA 3ZVSA 1QJIA 3KMCA 3Q2HA 1XUCA 1B3DA 4GWMA 1R1IA 456CA 1OS9A 3KHIA 1GE6A 3KWVC 830CA 2A8HA 3EDIA 2MLRA 3LILA 1A85A 1XURA 3B8ZA 4I03A 1R55A 1KUGA 2J83A 3KECA 4H84A 1JIWP 2CKIA 5D1SA 3MA2A 3LGPA 4JP4A 4XM8A 3LJTA 1G9KA 1CQRA 3KEJA 3V96B 4PKRA 4WZVA 3TT4A 5I12A 1AKLA 3LUMA 1USNA 1IACA 2MLSA 1G05A 1JANA 2DDYA 2AIGP 2OVXA 4L63A 4JPAA 1UMTA 3DNGA 1BM6A 3AIGA 3HY9A 4H2EA 1AYKA 1UEAA 3EDHA 3HDAP 2MZEA 2J0TA 4FU4A 1EUBA 3TSKA 1HY7A 1I1IP 1IADA 2YB9A 1QICA 1HOVA 1R54A 4AXQA 4PKSA 1QJJA 4WK7A 3O2XA 2OW9A 3K7NA 1QIAA 1JAOA 5D2BA 2Y6CA 4GWNA 1IAAA 3LJGA 2K9CA 4XM7A 5BPAA 1MMPA 3F1AA 1C3IA 2OW0A 3B2ZA 1O0TA 3I7IA 1D7XA 1ATLA 2OY2A 1JAPA 1B8YA 1KUIA 3LIRA 3DWBA 1G12A 1PWUA 1GO7P 3E8RA 3VI1A 4HX3A 1OMJA 4PKUA 1G49A 2RJPA 1RMZA 4DV8A 2FV5A 4AIGA 5I4OA 2OXUA 4WKEA 4H3XA 3BA0A 2N8RA 3KMEA 1D5JA 3U1RA 5I2ZA 1JAQA 1HTDA 1XAXA 2TCLA 2D1NA 1AF0A 1CK7A 1JKYA 4L6TA 3K7LA 1BSWA 1HFSA 2W15A 4FVLA 4IJOA 3ZUKA 3DTKA 3F16A 2USNA 3USNA 4H30A 3HBVP 5CXAA 1JJ9A 2W13A 2O3EA 1OO9A 4GR8A 1R1JA 4PKTA 4DD8A 1ZS0A 5B5OA 1K7IA 4L19A 2V4BA 1PWVA 2JIHA 1SLMA 2OVZA 1BKCA 3CKIA 1C7KA 3LE9A 1BKCI 3N2VA 1A86A 1ZXVA 1OS2A 3HY7A 2E2DA 4PKVA 1OM8A 3TS4A 1XFYA 2E3XA 3DL1A 1QIBA 1GE5A 1MMBA 1CGEA 1I73A 2JT5A 4PKWA 5I3MA 2OI0A 3KEKA 5BOYA 3L0VA 3LQ0A 1OZ9A 3WV1A 1KUHA 3DPFA 4GQLA 1JH1A 3HBUP 2DW1A 1PWWA 2FV9A 1KUKA 3F19A 2RJQA 1KBCA 1CXVA 2MZHA 4H76A 1S4BP 1HV5A 2WO9A 3RTSA 3WV2A 1ZTQA 966CA 2XS3A 2W14A 3LUNA 1ROSA 1SU3A 1IAGA 5L7FA 3RTTA 5L79A 4I35A 1WNIA 4GR0A 1UTTA 1KUFA 1TVIA 1GO8P 3EDZA 3Q2GA 1XUDA 1BUDA 2Z2DA 3GBOA 2OY4A 4ILWD 3DTIA 3HYGA 1CGLA 1BIWA 1BQOA 3F17A 2ERQA 1XFUA 1XM5A 2EROA 4WKIA 3HB2P 4H1QA 2HU6A 3LIKA 1MMQA 4H82A 5CZMA 3UVCA 4Q1LA 2PJTA 1DTHA 1FBLA 1CAQA 4CTHA 2W0DA 3WV3A 1D8FA 1YCMA 2WOAA 3LKAA 5JMYA 1YP1A 1ZXCA 3F18A 2JNPA 1FM1A 3L0TA 3DPEA 1RM8A 2WO8A 1XFWA 1BKCE 4H49A 1CGFA 4A3WA 4FXQA 1ZVXA 2QPJA 1SRPA 5D3CA 1XFXA 1BQQM 3SHIA 3EHXA 1MMRA 1EB6A 3G5CA 3LQBA 3I7GA 2JSDA 2SRTA 2XS4A 2K2GA 4WF6A 2X3BA 2DDFA 3LJZA 4A7BA 2YUFA 1BUVM 1H71P 1PWPA 3F15A 1Y0VA 4EFSA 3LEAA 4XBHA 5CUHA 1D8MA 2CLTA 3EDGA 2OXWA 3ZXHA 1GE7A 1ND1A 2KRJA 1Z3JA 2X3CA 1GKDA 4FXYP 4DF9A 1HFCA 4G9LA 3EWJA 3P24A 1GXDA 1IABA 4HMAA 1R1HA 4IUWA 2DW0A 4AYKA 3G42A 2DW2A 1Y93A 3OHOA 4AUOA 5D7WA 1OM6A 2OW2A 1DMTA 4R3VA 4ZR5A 3DTEA 1IAEA 3B92A 1YOUA 1Y8JA 1SMPA 3OHLA 1I76A 2JT6A 2OZRA 5B5PA 4JQGA 4J4MA 2W12A 2POJA 3O64A 1L6JA 5D1UA 3N2UA 4XM6A 2L0RA 2X3AA 2I47A 1C8TA 1J7NA 1SATA 4GR3A 2YIGA 4L7AA 3LK8A 1K7GA 1ASTA 2O36A 1ZP5A 1MNCA 3AYUA 3EHYA 5D1TA 5BOTA 4GF1A 2MZIA 1QUAA 2ERPA 3DSLA 4GUYA 4QKZA 3LMCA 3NX7A 1OM7A 5I0LA 1UMSA 1XFZA 4G0DA 1PWQA 2OW1A 5I43A 4IN9A 1JK3A 3KRYA 1SLNA
chains in the Genus database with same CATH topology
1G4KA 4JA1A 2Y6DA 1XFVA 1UTZA 5H8XA 1Q3AA 3ELMA 4DPEA 2X7MA 1YQYA 2D1OA 1O0QA 1KAPP 1CIZA 4ON1A 2AYKA 4XCTA 5LABA 1BZSA 1K7QA 3HDBA 3VTGA 4JIJA 1FLSA 4PKQA 1GKCA 3P1VA 1EAKA 1JIZA 2OXZA 3TVCA 3AYKA 3ZVSA 1QJIA 3KMCA 3Q2HA 1XUCA 1B3DA 4GWMA 1R1IA 456CA 1OS9A 3KHIA 1GE6A 3KWVC 830CA 2A8HA 3EDIA 2MLRA 3LILA 1A85A 1XURA 3B8ZA 4I03A 1R55A 1KUGA 2J83A 3KECA 4H84A 1JIWP 2CKIA 5D1SA 3MA2A 3LGPA 4JP4A 4XM8A 3LJTA 1G9KA 1CQRA 3KEJA 3V96B 4PKRA 4WZVA 3TT4A 5I12A 1AKLA 3LUMA 1USNA 1IACA 2MLSA 1G05A 1JANA 2DDYA 2AIGP 2OVXA 4L63A 4JPAA 1UMTA 3DNGA 1BM6A 3AIGA 3HY9A 4H2EA 1AYKA 1UEAA 3EDHA 3HDAP 2MZEA 2J0TA 4FU4A 1EUBA 3TSKA 1HY7A 1I1IP 1IADA 2YB9A 1QICA 1HOVA 1R54A 4AXQA 4PKSA 1QJJA 4WK7A 3O2XA 2OW9A 3K7NA 1QIAA 1JAOA 5D2BA 2Y6CA 4GWNA 1IAAA 3LJGA 2K9CA 4XM7A 5BPAA 1MMPA 3F1AA 1C3IA 2OW0A 3B2ZA 1O0TA 3I7IA 1D7XA 1ATLA 2OY2A 1JAPA 1B8YA 1KUIA 3LIRA 3DWBA 1G12A 1PWUA 1GO7P 3E8RA 3VI1A 4HX3A 1OMJA 4PKUA 1G49A 2RJPA 1RMZA 4DV8A 2FV5A 4AIGA 5I4OA 2OXUA 4WKEA 4H3XA 3BA0A 2N8RA 3KMEA 1D5JA 3U1RA 5I2ZA 1JAQA 1HTDA 2TCLA 2D1NA 1AF0A 1CK7A 1JKYA 4L6TA 3K7LA 1BSWA 1HFSA 2W15A 4FVLA 4IJOA 3ZUKA 3DTKA 3F16A 2USNA 3USNA 4H30A 3HBVP 5CXAA 1JJ9A 2W13A 2O3EA 1OO9A 4GR8A 1R1JA 4PKTA 4DD8A 1ZS0A 5B5OA 1K7IA 4L19A 2V4BA 1PWVA 2JIHA 1SLMA 2OVZA 1BKCA 3CKIA 1C7KA 3LE9A 1BKCI 3N2VA 1A86A 1ZXVA 1OS2A 3HY7A 2E2DA 4PKVA 1OM8A 3TS4A 1XFYA 2E3XA 3DL1A 1QIBA 1GE5A 1MMBA 1CGEA 1I73A 2JT5A 4PKWA 5I3MA 2OI0A 3KEKA 5BOYA 3L0VA 3LQ0A 3WV1A 1KUHA 3DPFA 4GQLA 1JH1A 3HBUP 2DW1A 1PWWA 2FV9A 1KUKA 3F19A 2RJQA 1KBCA 1CXVA 2MZHA 4H76A 1S4BP 1HV5A 2WO9A 3RTSA 3WV2A 1ZTQA 966CA 2XS3A 2W14A 3LUNA 1ROSA 1SU3A 1IAGA 5L7FA 3RTTA 5L79A 4I35A 1WNIA 4GR0A 1UTTA 1KUFA 1GO8P 3EDZA 3Q2GA 1XUDA 1BUDA 2Z2DA 3GBOA 2OY4A 4ILWD 3DTIA 3HYGA 1CGLA 1BIWA 1BQOA 3F17A 2ERQA 1XFUA 2EROA 4WKIA 3HB2P 4H1QA 2HU6A 3LIKA 1MMQA 4H82A 5CZMA 3UVCA 4Q1LA 2PJTA 1DTHA 1FBLA 1CAQA 4CTHA 2W0DA 3WV3A 1D8FA 1YCMA 2WOAA 3LKAA 5JMYA 1YP1A 1ZXCA 3F18A 2JNPA 1FM1A 3L0TA 3DPEA 1RM8A 2WO8A 1XFWA 1BKCE 4H49A 1CGFA 4A3WA 4FXQA 1ZVXA 2QPJA 1SRPA 5D3CA 1XFXA 1BQQM 3SHIA 3EHXA 1MMRA 1EB6A 3G5CA 3LQBA 3I7GA 2JSDA 2SRTA 2XS4A 2K2GA 4WF6A 2X3BA 2DDFA 3LJZA 4A7BA 2YUFA 1BUVM 1H71P 1PWPA 3F15A 1Y0VA 4EFSA 3LEAA 4XBHA 5CUHA 1D8MA 2CLTA 3EDGA 2OXWA 3ZXHA 1GE7A 1ND1A 2KRJA 1Z3JA 2X3CA 1GKDA 4FXYP 4DF9A 1HFCA 4G9LA 3EWJA 3P24A 1GXDA 1IABA 4HMAA 1R1HA 4IUWA 2DW0A 4AYKA 3G42A 2DW2A 1Y93A 3OHOA 4AUOA 5D7WA 1OM6A 2OW2A 1DMTA 4R3VA 4ZR5A 3DTEA 1IAEA 3B92A 1YOUA 1Y8JA 1SMPA 3OHLA 1I76A 2JT6A 2OZRA 5B5PA 4JQGA 4J4MA 2W12A 2POJA 3O64A 1L6JA 5D1UA 3N2UA 4XM6A 2L0RA 2X3AA 2I47A 1C8TA 1J7NA 1SATA 4GR3A 2YIGA 4L7AA 3LK8A 1K7GA 1ASTA 2O36A 1ZP5A 1MNCA 3AYUA 3EHYA 5D1TA 5BOTA 4GF1A 2MZIA 1QUAA 2ERPA 3DSLA 4GUYA 4QKZA 3LMCA 3NX7A 1OM7A 5I0LA 1UMSA 1XFZA 4G0DA 1PWQA 2OW1A 5I43A 4IN9A 1JK3A 3KRYA 1SLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4K A;  4JA1 A;  2Y6D A;  1XFV A;  1UTZ A;  5H8X A;  1Q3A A;  3ELM A;  4DPE A;  2X7M A;  1YQY A;  2D1O A;  1O0Q A;  1KAP P;  1CIZ A;  4ON1 A;  2AYK A;  4XCT A;  5LAB A;  1BZS A;  1K7Q A;  3HDB A;  3VTG A;  4JIJ A;  1FLS A;  4PKQ A;  1GKC A;  3P1V A;  1EAK A;  1JIZ A;  2OXZ A;  3TVC A;  3AYK A;  3ZVS A;  1QJI A;  3KMC A;  3Q2H A;  1XUC A;  1B3D A;  4GWM A;  1R1I A;  456C A;  1OS9 A;  3KHI A;  1GE6 A;  3KWV C;  830C A;  2A8H A;  3EDI A;  2MLR A;  3LIL A;  1A85 A;  1XUR A;  3B8Z A;  4I03 A;  1R55 A;  1KUG A;  2J83 A;  3KEC A;  4H84 A;  1JIW P;  2CKI A;  5D1S A;  3MA2 A;  3LGP A;  4JP4 A;  4XM8 A;  3LJT A;  1G9K A;  1CQR A;  3KEJ A;  3V96 B;  4PKR A;  4WZV A;  3TT4 A;  5I12 A;  1AKL A;  3LUM A;  1USN A;  1IAC A;  2MLS A;  1G05 A;  1JAN A;  2DDY A;  2AIG P;  2OVX A;  4L63 A;  4JPA A;  1UMT A;  3DNG A;  1BM6 A;  3AIG A;  3HY9 A;  4H2E A;  1AYK A;  1UEA A;  3EDH A;  3HDA P;  2MZE A;  2J0T A;  4FU4 A;  1EUB A;  3TSK A;  1HY7 A;  1I1I P;  1IAD A;  2YB9 A;  1QIC A;  1HOV A;  1R54 A;  4AXQ A;  4PKS A;  1QJJ A;  4WK7 A;  3O2X A;  2OW9 A;  3K7N A;  1QIA A;  1JAO A;  5D2B A;  2Y6C A;  4GWN A;  1IAA A;  3LJG A;  2K9C A;  4XM7 A;  5BPA A;  1MMP A;  3F1A A;  1C3I A;  2OW0 A;  3B2Z A;  1O0T A;  3I7I A;  1D7X A;  1ATL A;  2OY2 A;  1JAP A;  1B8Y A;  1KUI A;  3LIR A;  3DWB A;  1G12 A;  1PWU A;  1GO7 P;  3E8R A;  3VI1 A;  4HX3 A;  1OMJ A;  4PKU A;  1G49 A;  2RJP A;  1RMZ A;  4DV8 A;  2FV5 A;  4AIG A;  5I4O A;  2OXU A;  4WKE A;  4H3X A;  3BA0 A;  2N8R A;  3KME A;  1D5J A;  3U1R A;  5I2Z A;  1JAQ A;  1HTD A;  2TCL A;  2D1N A;  1AF0 A;  1CK7 A;  1JKY A;  4L6T A;  1BSW A;  1HFS A;  2W15 A;  3K7L A;  4FVL A;  4IJO A;  3ZUK A;  3F16 A;  2USN A;  3USN A;  4H30 A;  3HBV P;  5CXA A;  1JJ9 A;  2W13 A;  2O3E A;  1OO9 A;  4GR8 A;  1R1J A;  4PKT A;  4DD8 A;  1ZS0 A;  5B5O A;  1K7I A;  4L19 A;  2V4B A;  1PWV A;  2JIH A;  1SLM A;  2OVZ A;  1BKC A;  3CKI A;  1C7K A;  3LE9 A;  1BKC I;  3N2V A;  1A86 A;  1ZXV A;  1OS2 A;  3HY7 A;  2E2D A;  4PKV A;  1OM8 A;  3TS4 A;  1XFY A;  2E3X A;  3DL1 A;  1QIB A;  1GE5 A;  1MMB A;  1CGE A;  1I73 A;  2JT5 A;  4PKW A;  5I3M A;  2OI0 A;  3KEK A;  5BOY A;  3L0V A;  3LQ0 A;  3WV1 A;  1KUH A;  3DPF A;  4GQL A;  1JH1 A;  3HBU P;  2DW1 A;  1PWW A;  2FV9 A;  1KUK A;  3F19 A;  2RJQ A;  1KBC A;  1CXV A;  2MZH A;  4H76 A;  1S4B P;  1HV5 A;  2WO9 A;  3RTS A;  3WV2 A;  1ZTQ A;  966C A;  2XS3 A;  2W14 A;  3LUN A;  1ROS A;  1SU3 A;  1IAG A;  5L7F A;  3RTT A;  5L79 A;  4I35 A;  1WNI A;  4GR0 A;  1UTT A;  1KUF A;  1GO8 P;  3EDZ A;  3Q2G A;  1XUD A;  1BUD A;  2Z2D A;  3GBO A;  2OY4 A;  4ILW D;  3HYG A;  1CGL A;  1BIW A;  1BQO A;  3F17 A;  2ERQ A;  1XFU A;  2ERO A;  4WKI A;  3HB2 P;  4H1Q A;  2HU6 A;  3LIK A;  1MMQ A;  4H82 A;  5CZM A;  3UVC A;  4Q1L A;  2PJT A;  1DTH A;  1FBL A;  1CAQ A;  4CTH A;  2W0D A;  3WV3 A;  1D8F A;  1YCM A;  2WOA A;  3LKA A;  5JMY A;  1YP1 A;  1ZXC A;  3F18 A;  2JNP A;  1FM1 A;  3L0T A;  3DPE A;  1RM8 A;  2WO8 A;  1XFW A;  1BKC E;  4H49 A;  1CGF A;  4A3W A;  4FXQ A;  1ZVX A;  2QPJ A;  1SRP A;  5D3C A;  1XFX A;  1BQQ M;  3SHI A;  3EHX A;  1MMR A;  1EB6 A;  3G5C A;  3LQB A;  3I7G A;  2JSD A;  2SRT A;  2XS4 A;  2K2G A;  4WF6 A;  2X3B A;  2DDF A;  3LJZ A;  4A7B A;  1BUV M;  1H71 P;  1PWP A;  3F15 A;  1Y0V A;  4EFS A;  3LEA A;  4XBH A;  5CUH A;  1D8M A;  2CLT A;  3EDG A;  2OXW A;  3ZXH A;  1GE7 A;  1ND1 A;  2KRJ A;  1Z3J A;  2X3C A;  1GKD A;  4FXY P;  4DF9 A;  1HFC A;  4G9L A;  3EWJ A;  3P24 A;  1GXD A;  1IAB A;  4HMA A;  1R1H A;  4IUW A;  2DW0 A;  4AYK A;  3G42 A;  2DW2 A;  1Y93 A;  3OHO A;  4AUO A;  5D7W A;  1OM6 A;  2OW2 A;  1DMT A;  4R3V A;  4ZR5 A;  1IAE A;  3B92 A;  1YOU A;  1Y8J A;  1SMP A;  3OHL A;  1I76 A;  2JT6 A;  2OZR A;  5B5P A;  4JQG A;  4J4M A;  2W12 A;  2POJ A;  3O64 A;  1L6J A;  5D1U A;  3N2U A;  4XM6 A;  2L0R A;  2X3A A;  2I47 A;  1C8T A;  1J7N A;  1SAT A;  4GR3 A;  2YIG A;  3LK8 A;  1K7G A;  1AST A;  2O36 A;  1ZP5 A;  1MNC A;  3AYU A;  3EHY A;  5D1T A;  5BOT A;  4GF1 A;  2MZI A;  1QUA A;  2ERP A;  3DSL A;  4GUY A;  4QKZ A;  3LMC A;  3NX7 A;  1OM7 A;  5I0L A;  1UMS A;  1XFZ A;  4G0D A;  1PWQ A;  2OW1 A;  5I43 A;  4IN9 A;  1JK3 A;  3KRY A;  1SLN A; 
#chains in the Genus database with same CATH topology
 1G4K A;  4JA1 A;  2Y6D A;  1XFV A;  1UTZ A;  5H8X A;  1Q3A A;  3ELM A;  4DPE A;  2X7M A;  1YQY A;  2D1O A;  1O0Q A;  1KAP P;  1CIZ A;  4ON1 A;  2AYK A;  4XCT A;  5LAB A;  1BZS A;  1K7Q A;  3HDB A;  3VTG A;  4JIJ A;  1FLS A;  4PKQ A;  1GKC A;  3P1V A;  1EAK A;  1JIZ A;  2OXZ A;  3TVC A;  3AYK A;  3ZVS A;  1QJI A;  3KMC A;  3Q2H A;  1XUC A;  1B3D A;  4GWM A;  1R1I A;  456C A;  1OS9 A;  3KHI A;  1GE6 A;  3KWV C;  830C A;  2A8H A;  3EDI A;  2MLR A;  3LIL A;  1A85 A;  1XUR A;  3B8Z A;  4I03 A;  1R55 A;  1KUG A;  2J83 A;  3KEC A;  4H84 A;  1JIW P;  2CKI A;  5D1S A;  3MA2 A;  3LGP A;  4JP4 A;  4XM8 A;  3LJT A;  1G9K A;  1CQR A;  3KEJ A;  3V96 B;  4PKR A;  4WZV A;  3TT4 A;  5I12 A;  1AKL A;  3LUM A;  1USN A;  1IAC A;  2MLS A;  1G05 A;  1JAN A;  2DDY A;  2AIG P;  2OVX A;  4L63 A;  4JPA A;  1UMT A;  3DNG A;  1BM6 A;  3AIG A;  3HY9 A;  4H2E A;  1AYK A;  1UEA A;  3EDH A;  3HDA P;  2MZE A;  2J0T A;  4FU4 A;  1EUB A;  3TSK A;  1HY7 A;  1I1I P;  1IAD A;  2YB9 A;  1QIC A;  1HOV A;  1R54 A;  4AXQ A;  4PKS A;  1QJJ A;  4WK7 A;  3O2X A;  2OW9 A;  3K7N A;  1QIA A;  1JAO A;  5D2B A;  2Y6C A;  4GWN A;  1IAA A;  3LJG A;  2K9C A;  4XM7 A;  5BPA A;  1MMP A;  3F1A A;  1C3I A;  2OW0 A;  3B2Z A;  1O0T A;  3I7I A;  1D7X A;  1ATL A;  2OY2 A;  1JAP A;  1B8Y A;  1KUI A;  3LIR A;  3DWB A;  1G12 A;  1PWU A;  1GO7 P;  3E8R A;  3VI1 A;  4HX3 A;  1OMJ A;  4PKU A;  1G49 A;  2RJP A;  1RMZ A;  4DV8 A;  2FV5 A;  4AIG A;  5I4O A;  2OXU A;  4WKE A;  4H3X A;  3BA0 A;  2N8R A;  3KME A;  1D5J A;  3U1R A;  5I2Z A;  1JAQ A;  1HTD A;  1XAX A;  2TCL A;  2D1N A;  1AF0 A;  1CK7 A;  1JKY A;  4L6T A;  3K7L A;  1BSW A;  1HFS A;  2W15 A;  4FVL A;  4IJO A;  3ZUK A;  3DTK A;  3F16 A;  2USN A;  3USN A;  4H30 A;  3HBV P;  5CXA A;  1JJ9 A;  2W13 A;  2O3E A;  1OO9 A;  4GR8 A;  1R1J A;  4PKT A;  4DD8 A;  1ZS0 A;  5B5O A;  1K7I A;  4L19 A;  2V4B A;  1PWV A;  2JIH A;  1SLM A;  2OVZ A;  1BKC A;  3CKI A;  1C7K A;  3LE9 A;  1BKC I;  3N2V A;  1A86 A;  1ZXV A;  1OS2 A;  3HY7 A;  2E2D A;  4PKV A;  1OM8 A;  3TS4 A;  1XFY A;  2E3X A;  3DL1 A;  1QIB A;  1GE5 A;  1MMB A;  1CGE A;  1I73 A;  2JT5 A;  4PKW A;  5I3M A;  2OI0 A;  3KEK A;  5BOY A;  3L0V A;  3LQ0 A;  1OZ9 A;  3WV1 A;  1KUH A;  3DPF A;  4GQL A;  1JH1 A;  3HBU P;  2DW1 A;  1PWW A;  2FV9 A;  1KUK A;  3F19 A;  2RJQ A;  1KBC A;  1CXV A;  2MZH A;  4H76 A;  1S4B P;  1HV5 A;  2WO9 A;  3RTS A;  3WV2 A;  1ZTQ A;  966C A;  2XS3 A;  2W14 A;  3LUN A;  1ROS A;  1SU3 A;  1IAG A;  5L7F A;  3RTT A;  5L79 A;  4I35 A;  1WNI A;  4GR0 A;  1UTT A;  1KUF A;  1TVI A;  1GO8 P;  3EDZ A;  3Q2G A;  1XUD A;  1BUD A;  2Z2D A;  3GBO A;  2OY4 A;  4ILW D;  3DTI A;  3HYG A;  1CGL A;  1BIW A;  1BQO A;  3F17 A;  2ERQ A;  1XFU A;  1XM5 A;  2ERO A;  4WKI A;  3HB2 P;  4H1Q A;  2HU6 A;  3LIK A;  1MMQ A;  4H82 A;  5CZM A;  3UVC A;  4Q1L A;  2PJT A;  1DTH A;  1FBL A;  1CAQ A;  4CTH A;  2W0D A;  3WV3 A;  1D8F A;  1YCM A;  2WOA A;  3LKA A;  5JMY A;  1YP1 A;  1ZXC A;  3F18 A;  2JNP A;  1FM1 A;  3L0T A;  3DPE A;  1RM8 A;  2WO8 A;  1XFW A;  1BKC E;  4H49 A;  1CGF A;  4A3W A;  4FXQ A;  1ZVX A;  2QPJ A;  1SRP A;  5D3C A;  1XFX A;  1BQQ M;  3SHI A;  3EHX A;  1MMR A;  1EB6 A;  3G5C A;  3LQB A;  3I7G A;  2JSD A;  2SRT A;  2XS4 A;  2K2G A;  4WF6 A;  2X3B A;  2DDF A;  3LJZ A;  4A7B A;  2YUF A;  1BUV M;  1H71 P;  1PWP A;  3F15 A;  1Y0V A;  4EFS A;  3LEA A;  4XBH A;  5CUH A;  1D8M A;  2CLT A;  3EDG A;  2OXW A;  3ZXH A;  1GE7 A;  1ND1 A;  2KRJ A;  1Z3J A;  2X3C A;  1GKD A;  4FXY P;  4DF9 A;  1HFC A;  4G9L A;  3EWJ A;  3P24 A;  1GXD A;  1IAB A;  4HMA A;  1R1H A;  4IUW A;  2DW0 A;  4AYK A;  3G42 A;  2DW2 A;  1Y93 A;  3OHO A;  4AUO A;  5D7W A;  1OM6 A;  2OW2 A;  1DMT A;  4R3V A;  4ZR5 A;  3DTE A;  1IAE A;  3B92 A;  1YOU A;  1Y8J A;  1SMP A;  3OHL A;  1I76 A;  2JT6 A;  2OZR A;  5B5P A;  4JQG A;  4J4M A;  2W12 A;  2POJ A;  3O64 A;  1L6J A;  5D1U A;  3N2U A;  4XM6 A;  2L0R A;  2X3A A;  2I47 A;  1C8T A;  1J7N A;  1SAT A;  4GR3 A;  2YIG A;  4L7A A;  3LK8 A;  1K7G A;  1AST A;  2O36 A;  1ZP5 A;  1MNC A;  3AYU A;  3EHY A;  5D1T A;  5BOT A;  4GF1 A;  2MZI A;  1QUA A;  2ERP A;  3DSL A;  4GUY A;  4QKZ A;  3LMC A;  3NX7 A;  1OM7 A;  5I0L A;  1UMS A;  1XFZ A;  4G0D A;  1PWQ A;  2OW1 A;  5I43 A;  4IN9 A;  1JK3 A;  3KRY A;  1SLN A; 
#chains in the Genus database with same CATH homology
 1G4K A;  4JA1 A;  2Y6D A;  1XFV A;  1UTZ A;  5H8X A;  1Q3A A;  3ELM A;  4DPE A;  2X7M A;  1YQY A;  2D1O A;  1O0Q A;  1KAP P;  1CIZ A;  4ON1 A;  2AYK A;  4XCT A;  5LAB A;  1BZS A;  1K7Q A;  3HDB A;  3VTG A;  4JIJ A;  1FLS A;  4PKQ A;  1GKC A;  3P1V A;  1EAK A;  1JIZ A;  2OXZ A;  3TVC A;  3AYK A;  3ZVS A;  1QJI A;  3KMC A;  3Q2H A;  1XUC A;  1B3D A;  4GWM A;  1R1I A;  456C A;  1OS9 A;  3KHI A;  1GE6 A;  3KWV C;  830C A;  2A8H A;  3EDI A;  2MLR A;  3LIL A;  1A85 A;  1XUR A;  3B8Z A;  4I03 A;  1R55 A;  1KUG A;  2J83 A;  3KEC A;  4H84 A;  1JIW P;  2CKI A;  5D1S A;  3MA2 A;  3LGP A;  4JP4 A;  4XM8 A;  3LJT A;  1G9K A;  1CQR A;  3KEJ A;  3V96 B;  4PKR A;  4WZV A;  3TT4 A;  5I12 A;  1AKL A;  3LUM A;  1USN A;  1IAC A;  2MLS A;  1G05 A;  1JAN A;  2DDY A;  2AIG P;  2OVX A;  4L63 A;  4JPA A;  1UMT A;  3DNG A;  1BM6 A;  3AIG A;  3HY9 A;  4H2E A;  1AYK A;  1UEA A;  3EDH A;  3HDA P;  2MZE A;  2J0T A;  4FU4 A;  1EUB A;  3TSK A;  1HY7 A;  1I1I P;  1IAD A;  2YB9 A;  1QIC A;  1HOV A;  1R54 A;  4AXQ A;  4PKS A;  1QJJ A;  4WK7 A;  3O2X A;  2OW9 A;  3K7N A;  1QIA A;  1JAO A;  5D2B A;  2Y6C A;  4GWN A;  1IAA A;  3LJG A;  2K9C A;  4XM7 A;  5BPA A;  1MMP A;  3F1A A;  1C3I A;  2OW0 A;  3B2Z A;  1O0T A;  3I7I A;  1D7X A;  1ATL A;  2OY2 A;  1JAP A;  1B8Y A;  1KUI A;  3LIR A;  3DWB A;  1G12 A;  1PWU A;  1GO7 P;  3E8R A;  3VI1 A;  4HX3 A;  1OMJ A;  4PKU A;  1G49 A;  2RJP A;  1RMZ A;  4DV8 A;  2FV5 A;  4AIG A;  5I4O A;  2OXU A;  4WKE A;  4H3X A;  3BA0 A;  2N8R A;  3KME A;  1D5J A;  3U1R A;  5I2Z A;  1JAQ A;  1HTD A;  2TCL A;  2D1N A;  1AF0 A;  1CK7 A;  1JKY A;  4L6T A;  3K7L A;  1BSW A;  1HFS A;  2W15 A;  4FVL A;  4IJO A;  3ZUK A;  3DTK A;  3F16 A;  2USN A;  3USN A;  4H30 A;  3HBV P;  5CXA A;  1JJ9 A;  2W13 A;  2O3E A;  1OO9 A;  4GR8 A;  1R1J A;  4PKT A;  4DD8 A;  1ZS0 A;  5B5O A;  1K7I A;  4L19 A;  2V4B A;  1PWV A;  2JIH A;  1SLM A;  2OVZ A;  1BKC A;  3CKI A;  1C7K A;  3LE9 A;  1BKC I;  3N2V A;  1A86 A;  1ZXV A;  1OS2 A;  3HY7 A;  2E2D A;  4PKV A;  1OM8 A;  3TS4 A;  1XFY A;  2E3X A;  3DL1 A;  1QIB A;  1GE5 A;  1MMB A;  1CGE A;  1I73 A;  2JT5 A;  4PKW A;  5I3M A;  2OI0 A;  3KEK A;  5BOY A;  3L0V A;  3LQ0 A;  3WV1 A;  1KUH A;  3DPF A;  4GQL A;  1JH1 A;  3HBU P;  2DW1 A;  1PWW A;  2FV9 A;  1KUK A;  3F19 A;  2RJQ A;  1KBC A;  1CXV A;  2MZH A;  4H76 A;  1S4B P;  1HV5 A;  2WO9 A;  3RTS A;  3WV2 A;  1ZTQ A;  966C A;  2XS3 A;  2W14 A;  3LUN A;  1ROS A;  1SU3 A;  1IAG A;  5L7F A;  3RTT A;  5L79 A;  4I35 A;  1WNI A;  4GR0 A;  1UTT A;  1KUF A;  1GO8 P;  3EDZ A;  3Q2G A;  1XUD A;  1BUD A;  2Z2D A;  3GBO A;  2OY4 A;  4ILW D;  3DTI A;  3HYG A;  1CGL A;  1BIW A;  1BQO A;  3F17 A;  2ERQ A;  1XFU A;  2ERO A;  4WKI A;  3HB2 P;  4H1Q A;  2HU6 A;  3LIK A;  1MMQ A;  4H82 A;  5CZM A;  3UVC A;  4Q1L A;  2PJT A;  1DTH A;  1FBL A;  1CAQ A;  4CTH A;  2W0D A;  3WV3 A;  1D8F A;  1YCM A;  2WOA A;  3LKA A;  5JMY A;  1YP1 A;  1ZXC A;  3F18 A;  2JNP A;  1FM1 A;  3L0T A;  3DPE A;  1RM8 A;  2WO8 A;  1XFW A;  1BKC E;  4H49 A;  1CGF A;  4A3W A;  4FXQ A;  1ZVX A;  2QPJ A;  1SRP A;  5D3C A;  1XFX A;  1BQQ M;  3SHI A;  3EHX A;  1MMR A;  1EB6 A;  3G5C A;  3LQB A;  3I7G A;  2JSD A;  2SRT A;  2XS4 A;  2K2G A;  4WF6 A;  2X3B A;  2DDF A;  3LJZ A;  4A7B A;  2YUF A;  1BUV M;  1H71 P;  1PWP A;  3F15 A;  1Y0V A;  4EFS A;  3LEA A;  4XBH A;  5CUH A;  1D8M A;  2CLT A;  3EDG A;  2OXW A;  3ZXH A;  1GE7 A;  1ND1 A;  2KRJ A;  1Z3J A;  2X3C A;  1GKD A;  4FXY P;  4DF9 A;  1HFC A;  4G9L A;  3EWJ A;  3P24 A;  1GXD A;  1IAB A;  4HMA A;  1R1H A;  4IUW A;  2DW0 A;  4AYK A;  3G42 A;  2DW2 A;  1Y93 A;  3OHO A;  4AUO A;  5D7W A;  1OM6 A;  2OW2 A;  1DMT A;  4R3V A;  4ZR5 A;  3DTE A;  1IAE A;  3B92 A;  1YOU A;  1Y8J A;  1SMP A;  3OHL A;  1I76 A;  2JT6 A;  2OZR A;  5B5P A;  4JQG A;  4J4M A;  2W12 A;  2POJ A;  3O64 A;  1L6J A;  5D1U A;  3N2U A;  4XM6 A;  2L0R A;  2X3A A;  2I47 A;  1C8T A;  1J7N A;  1SAT A;  4GR3 A;  2YIG A;  4L7A A;  3LK8 A;  1K7G A;  1AST A;  2O36 A;  1ZP5 A;  1MNC A;  3AYU A;  3EHY A;  5D1T A;  5BOT A;  4GF1 A;  2MZI A;  1QUA A;  2ERP A;  3DSL A;  4GUY A;  4QKZ A;  3LMC A;  3NX7 A;  1OM7 A;  5I0L A;  1UMS A;  1XFZ A;  4G0D A;  1PWQ A;  2OW1 A;  5I43 A;  4IN9 A;  1JK3 A;  3KRY A;  1SLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...