4GR8A

Crystal structure of the catalytic domain of human mmp12 in complex with selective phosphinic inhibitor rxp470c
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
152
structure length
152
Chain Sequence
KHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Molecular determinants of a selective matrix metalloprotease-12 inhibitor: insights from crystallography and thermodynamic studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 152
sequence length 152
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2012-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4gr8A00
1OS9A 4H76A 3OHLA 5D2BA 5CZMA 4A3WA 3LEAA 1HV5A 830CA 1BIWA 2L0RA 4IJOA 2CKIA 5BOYA 3RTSA 1QIBA 4H2EA 5CUHA 4PKVA 3RTTA 3G5CA 3L0TA 966CA 4FU4A 2RJQA 1CK7A 1R1HA 2N8RA 4JQGA 5H8XA 3N2UA 3DWBA 1KUGA 4PKWA 3HYGA 1CGLA 1JANA 3LIRA 4GR0A 1XURA 1FM1A 3LJGA 1EAKA 4GWNA 3DPFA 1SLMA 1IAEA 1ZXVA 2W15A 1R55A 4L6TA 3EHXA 1SATA 2Y6CA 1G9KA 1EUBA 2JIHA 3KMCA 1CIZA 3SHIA 3OHOA 1Z3JA 3Q2GA 4DV8A 2OZRA 2PJTA 4PKSA 1UMTA 3LMCA 4GF1A 1ZXCA 4QKZA 1A85A 4XBHA 4JPAA 1BQOA 1MMPA 3HDAP 4J4MA 1KUHA 4H84A 4G0DA 1H71P 1JAQA 1ZVXA 1R54A 1XFWA 3WV2A 3KECA 1GXDA 4XM8A 4FXQA 1G49A 4ON1A 2OXUA 5CXAA 3ZVSA 4IUWA 1DMTA 1CAQA 3CKIA 3N2VA 5D1TA 4AIGA 5B5OA 1QJIA 4HMAA 1PWUA 2DDFA 1HOVA 4Q1LA 1EB6A 2OY2A 4AYKA 3TSKA 3KWVC 2X3CA 4H1QA 3F19A 2O3EA 3HY9A 2X3BA 1OMJA 1KUIA 2E2DA 2W14A 3KEJA 1XUCA 3LJZA 1QICA 1PWQA 1JIWP 1BKCE 1CGFA 1XUDA 3TS4A 4FXYP 2JSDA 4WK7A 3DL1A 4GQLA 2WO9A 1K7QA 4A7BA 1IADA 2QPJA 3LIKA 3ELMA 3GBOA 1JK3A 1UEAA 5BOTA 2USNA 2DW0A 2HU6A 2FV5A 1KAPP 3K7NA 2SRTA 3UVCA 2MLSA 1O0TA 1BKCA 3LK8A 1Q3AA 2MLRA 1S4BP 1J7NA 4GR3A 2XS4A 2J83A 1JJ9A 1FLSA 3K7LA 3HDBA 1ROSA 4GUYA 1SU3A 3Q2HA 5I4OA 2KRJA 1PWVA 1R1JA 3LUNA 3EWJA 1HFSA 3F18A 1SMPA 4XCTA 5D7WA 2OXZA 4GR8A 4DD8A 4HX3A 1HFCA 1UMSA 5LABA 3P24A 3F15A 4DPEA 1HTDA 2MZHA 1XFXA 5B5PA 4R3VA 1PWPA 1QUAA 1FBLA 3G42A 3LQBA 4L19A 5D1UA 5L7FA 1I1IP 1RMZA 1CQRA 1KUKA 1UTTA 1CXVA 1IAGA 1YCMA 2W13A 2TCLA 3ZUKA 3O64A 2MZIA 3E8RA 3B8ZA 2OVZA 2W0DA 3LUMA 3L0VA 3LJTA 4I35A 3EDZA 1D8MA 1UTZA 3LILA 1B8YA 1O0QA 3EDHA 3DSLA 1RM8A 1GKDA 3EHYA 4WKEA 2E3XA 1XFUA 2X3AA 3AYUA 1XFZA 1WNIA 2RJPA 1QJJA 1ZP5A 3F1AA 3KMEA 1GE6A 1C8TA 3WV3A 5BPAA 4CTHA 2FV9A 2POJA 3F17A 1D8FA 4DF9A 2OW1A 1Y93A 2Y6DA 1JAOA 2X7MA 2OXWA 1BUVM 2W12A 1BQQM 1XFYA 1IABA 2OW9A 1JKYA 1Y0VA 4IN9A 3U1RA 1C3IA 5I3MA 3DNGA 2CLTA 5I0LA 3VI1A 1MMQA 4JP4A 1SLNA 4PKRA 3HY7A 1BM6A 1K7IA 1D5JA 5D1SA 4EFSA 1GKCA 4ZR5A 1IAAA 2D1OA 4L63A 1USNA 3HBVP 4AXQA 1GO7P 1G12A 2OI0A 1KBCA 2XS3A 1R1IA 1YQYA 3AIGA 4H3XA 3KRYA 1AKLA 3V96B 1OM6A 1IACA 3ZXHA 1I73A 3USNA 1MMBA 2DDYA 1ZTQA 1SRPA 1Y8JA 5I2ZA 3LQ0A 1DTHA 3AYKA 4H49A 3KHIA 3LKAA 5D3CA 1L6JA 1I76A 1D7XA 1XFVA 3B92A 2D1NA 4JIJA 1JH1A 2ERQA 3EDIA 1BZSA 3I7GA 1YP1A 4XM7A 2WOAA 3LGPA 2JT6A 3DPEA 1OO9A 1CGEA 5I43A 3LE9A 3HBUP 4WKIA 2K2GA 4PKTA 3BA0A 3NX7A 4FVLA 1QIAA 2EROA 4H82A 3TVCA 1OS2A 2ERPA 4PKUA 2OY4A 3P1VA 4WF6A 2OW2A 5I12A 4WZVA 1K7GA 2MZEA 2DW2A 1BUDA 4ILWD 1OM7A 3B2ZA 1ASTA 1A86A 3WV1A 2J0TA 2YB9A 1BKCI 1GO8P 456CA 3VTGA 1BSWA 1G4KA 1B3DA 5JMYA 1YOUA 3HB2P 4H30A 2JT5A 1ND1A 1AF0A 1PWWA 2K9CA 2V4BA 4I03A 4AUOA 1MNCA 1OM8A 2JNPA 3O2XA 2AYKA 2I47A 3EDGA 3I7IA 4G9LA 1MMRA 3KEKA 1KUFA 1HY7A 3MA2A 1G05A 2DW1A 2AIGP 2A8HA 1GE7A 2O36A 1AYKA 2OW0A 4PKQA 1JIZA 4GWMA 2Z2DA 4JA1A 4XM6A 1JAPA 2YIGA 3F16A 1ATLA 2OVXA 1ZS0A 2WO8A 3TT4A 1C7KA 5L79A 1GE5A
chains in the Genus database with same CATH superfamily
1OS9A 4H76A 3OHLA 5D2BA 5CZMA 4A3WA 3LEAA 1HV5A 3DTEA 830CA 1BIWA 2L0RA 4IJOA 2CKIA 5BOYA 3RTSA 1QIBA 4H2EA 5CUHA 4PKVA 3RTTA 3G5CA 1TVIA 3L0TA 966CA 4FU4A 2RJQA 1CK7A 1R1HA 2N8RA 4JQGA 5H8XA 3N2UA 3DWBA 1KUGA 4PKWA 3HYGA 1CGLA 1JANA 3LIRA 4GR0A 1XURA 1FM1A 3LJGA 1EAKA 4GWNA 3DPFA 1SLMA 1IAEA 1ZXVA 2W15A 1R55A 4L6TA 3EHXA 1SATA 2Y6CA 1G9KA 1EUBA 2JIHA 3KMCA 1CIZA 3SHIA 3OHOA 1Z3JA 3Q2GA 4DV8A 2OZRA 2PJTA 4PKSA 1UMTA 3LMCA 4GF1A 1ZXCA 4QKZA 1A85A 4XBHA 4JPAA 1BQOA 1MMPA 3HDAP 4J4MA 1KUHA 4H84A 4G0DA 1H71P 1JAQA 1ZVXA 1R54A 1XFWA 3WV2A 3KECA 1GXDA 4XM8A 4FXQA 1G49A 4ON1A 2OXUA 5CXAA 3ZVSA 4IUWA 1DMTA 1CAQA 3CKIA 3N2VA 5D1TA 4AIGA 5B5OA 1QJIA 4HMAA 1PWUA 2DDFA 1HOVA 4Q1LA 1EB6A 2OY2A 4AYKA 3TSKA 3KWVC 2X3CA 4H1QA 3F19A 2O3EA 3HY9A 2X3BA 1OMJA 1KUIA 1XM5A 2E2DA 2W14A 3KEJA 1XUCA 3LJZA 1QICA 1PWQA 1JIWP 1BKCE 1CGFA 1XUDA 3TS4A 4FXYP 2JSDA 4WK7A 3DL1A 4GQLA 2WO9A 1K7QA 4A7BA 1IADA 2QPJA 3LIKA 3ELMA 3GBOA 1JK3A 1UEAA 5BOTA 2USNA 2DW0A 2HU6A 2FV5A 1KAPP 3K7NA 2SRTA 3UVCA 2MLSA 1O0TA 1BKCA 3LK8A 1Q3AA 2MLRA 1S4BP 1J7NA 4GR3A 2XS4A 2J83A 1JJ9A 1FLSA 3K7LA 3HDBA 1ROSA 4GUYA 1SU3A 3Q2HA 5I4OA 2KRJA 1PWVA 1R1JA 3LUNA 3EWJA 1HFSA 3F18A 1SMPA 4XCTA 5D7WA 3DTKA 2OXZA 4GR8A 4DD8A 4HX3A 1HFCA 1UMSA 5LABA 3P24A 3F15A 4DPEA 1HTDA 2MZHA 1XFXA 5B5PA 4R3VA 1PWPA 1QUAA 1FBLA 3G42A 3LQBA 4L19A 5D1UA 5L7FA 1I1IP 1RMZA 1CQRA 1KUKA 1UTTA 1CXVA 1IAGA 1YCMA 2W13A 2TCLA 3ZUKA 3O64A 2MZIA 3E8RA 3B8ZA 2OVZA 2W0DA 3LUMA 3L0VA 3LJTA 4I35A 3EDZA 1D8MA 1UTZA 3LILA 1B8YA 1O0QA 3EDHA 3DSLA 1RM8A 1GKDA 1XAXA 3EHYA 4WKEA 2E3XA 1XFUA 2X3AA 3AYUA 1XFZA 1WNIA 2RJPA 1QJJA 1ZP5A 3F1AA 3KMEA 1GE6A 1C8TA 3WV3A 5BPAA 4CTHA 2FV9A 2POJA 3F17A 1D8FA 4DF9A 2OW1A 1Y93A 2Y6DA 1JAOA 2X7MA 2OXWA 1BUVM 2W12A 1BQQM 1XFYA 1IABA 2OW9A 1JKYA 1Y0VA 4IN9A 3U1RA 1C3IA 5I3MA 3DNGA 2CLTA 5I0LA 3VI1A 1MMQA 4JP4A 1SLNA 4PKRA 3HY7A 1BM6A 1K7IA 1D5JA 5D1SA 4EFSA 4L7AA 1GKCA 4ZR5A 1IAAA 2D1OA 4L63A 1USNA 3HBVP 4AXQA 1GO7P 2OI0A 1G12A 1KBCA 2XS3A 1R1IA 1YQYA 3AIGA 4H3XA 3KRYA 1AKLA 3V96B 1OM6A 1IACA 3ZXHA 1I73A 3USNA 1MMBA 2DDYA 1ZTQA 1SRPA 1Y8JA 5I2ZA 3LQ0A 1DTHA 3AYKA 4H49A 3KHIA 3LKAA 5D3CA 1L6JA 1I76A 1D7XA 1XFVA 3B92A 2D1NA 4JIJA 1JH1A 2ERQA 3EDIA 1BZSA 3I7GA 1YP1A 4XM7A 2WOAA 3LGPA 2JT6A 3DPEA 1OO9A 1CGEA 5I43A 3LE9A 3HBUP 4WKIA 2K2GA 4PKTA 3BA0A 3NX7A 4FVLA 1QIAA 3DTIA 2EROA 4H82A 3TVCA 1OS2A 2ERPA 4PKUA 2OY4A 3P1VA 4WF6A 2OW2A 5I12A 2YUFA 4WZVA 1K7GA 2MZEA 2DW2A 1BUDA 4ILWD 1OM7A 3B2ZA 1ASTA 1A86A 3WV1A 2J0TA 2YB9A 1BKCI 1GO8P 456CA 3VTGA 1BSWA 1G4KA 1B3DA 5JMYA 1YOUA 3HB2P 4H30A 2JT5A 1ND1A 1AF0A 1PWWA 2K9CA 2V4BA 4I03A 4AUOA 1MNCA 1OM8A 2JNPA 3O2XA 2AYKA 2I47A 3EDGA 3I7IA 4G9LA 1MMRA 3KEKA 1KUFA 1HY7A 3MA2A 1G05A 1OZ9A 2DW1A 2AIGP 2A8HA 1GE7A 2O36A 1AYKA 2OW0A 4PKQA 1JIZA 4GWMA 2Z2DA 4JA1A 4XM6A 1JAPA 2YIGA 3F16A 1ATLA 2OVXA 1ZS0A 2WO8A 3TT4A 1C7KA 5L79A 1GE5A
chains in the Genus database with same CATH topology
1OS9A 4H76A 3OHLA 5D2BA 5CZMA 4A3WA 3LEAA 1HV5A 3DTEA 830CA 1BIWA 2L0RA 4IJOA 2CKIA 5BOYA 3RTSA 1QIBA 4H2EA 5CUHA 4PKVA 3RTTA 3G5CA 3L0TA 966CA 4FU4A 2RJQA 1CK7A 1R1HA 2N8RA 4JQGA 5H8XA 3N2UA 3DWBA 1KUGA 4PKWA 3HYGA 1CGLA 1JANA 3LIRA 4GR0A 1XURA 1FM1A 3LJGA 1EAKA 4GWNA 3DPFA 1SLMA 1IAEA 1ZXVA 2W15A 1R55A 4L6TA 3EHXA 1SATA 2Y6CA 1G9KA 1EUBA 2JIHA 3KMCA 1CIZA 3SHIA 3OHOA 1Z3JA 3Q2GA 4DV8A 2OZRA 2PJTA 4PKSA 1UMTA 3LMCA 4GF1A 1ZXCA 4QKZA 1A85A 4XBHA 4JPAA 1BQOA 1MMPA 3HDAP 4J4MA 1KUHA 4H84A 4G0DA 1H71P 1JAQA 1ZVXA 1R54A 1XFWA 3WV2A 3KECA 1GXDA 4XM8A 4FXQA 1G49A 4ON1A 2OXUA 5CXAA 3ZVSA 4IUWA 1DMTA 1CAQA 3CKIA 3N2VA 5D1TA 4AIGA 5B5OA 1QJIA 4HMAA 1PWUA 2DDFA 1HOVA 4Q1LA 1EB6A 2OY2A 4AYKA 3TSKA 3KWVC 2X3CA 4H1QA 3F19A 2O3EA 3HY9A 2X3BA 1OMJA 1KUIA 2E2DA 2W14A 3KEJA 1XUCA 3LJZA 1QICA 1PWQA 1JIWP 1BKCE 1CGFA 1XUDA 3TS4A 4FXYP 2JSDA 4WK7A 3DL1A 4GQLA 2WO9A 1K7QA 4A7BA 1IADA 2QPJA 3LIKA 3ELMA 3GBOA 1JK3A 1UEAA 5BOTA 2USNA 2DW0A 2HU6A 2FV5A 1KAPP 3K7NA 2SRTA 3UVCA 2MLSA 1O0TA 1BKCA 3LK8A 1Q3AA 2MLRA 1S4BP 1J7NA 4GR3A 2XS4A 2J83A 1JJ9A 1FLSA 3K7LA 3HDBA 1ROSA 4GUYA 1SU3A 3Q2HA 5I4OA 2KRJA 1PWVA 1R1JA 3LUNA 3EWJA 1HFSA 3F18A 1SMPA 4XCTA 5D7WA 3DTKA 2OXZA 4GR8A 4DD8A 4HX3A 1HFCA 1UMSA 5LABA 3P24A 3F15A 4DPEA 1HTDA 2MZHA 1XFXA 5B5PA 4R3VA 1PWPA 1QUAA 1FBLA 3G42A 3LQBA 4L19A 5D1UA 5L7FA 1I1IP 1RMZA 1CQRA 1KUKA 1UTTA 1CXVA 1IAGA 1YCMA 2W13A 2TCLA 3ZUKA 3O64A 2MZIA 3E8RA 3B8ZA 2OVZA 2W0DA 3LUMA 3L0VA 3LJTA 4I35A 3EDZA 1D8MA 1UTZA 3LILA 1B8YA 1O0QA 3EDHA 3DSLA 1RM8A 1GKDA 3EHYA 4WKEA 2E3XA 1XFUA 2X3AA 3AYUA 1XFZA 1WNIA 2RJPA 1QJJA 1ZP5A 3F1AA 3KMEA 1GE6A 1C8TA 3WV3A 5BPAA 4CTHA 2FV9A 2POJA 3F17A 1D8FA 4DF9A 2OW1A 1Y93A 2Y6DA 1JAOA 2X7MA 2OXWA 1BUVM 2W12A 1BQQM 1XFYA 1IABA 2OW9A 1JKYA 1Y0VA 4IN9A 3U1RA 1C3IA 5I3MA 3DNGA 2CLTA 5I0LA 3VI1A 1MMQA 4JP4A 1SLNA 4PKRA 3HY7A 1BM6A 1K7IA 1D5JA 5D1SA 4EFSA 4L7AA 1GKCA 4ZR5A 1IAAA 2D1OA 4L63A 1USNA 3HBVP 4AXQA 1GO7P 1G12A 2OI0A 1KBCA 2XS3A 1R1IA 1YQYA 3AIGA 4H3XA 3KRYA 1AKLA 3V96B 1OM6A 1IACA 3ZXHA 1I73A 3USNA 1MMBA 2DDYA 1ZTQA 1SRPA 1Y8JA 5I2ZA 3LQ0A 1DTHA 3AYKA 4H49A 3KHIA 3LKAA 5D3CA 1L6JA 1I76A 1D7XA 1XFVA 3B92A 2D1NA 4JIJA 1JH1A 2ERQA 3EDIA 1BZSA 3I7GA 1YP1A 4XM7A 2WOAA 3LGPA 2JT6A 3DPEA 1OO9A 1CGEA 5I43A 3LE9A 3HBUP 4WKIA 2K2GA 4PKTA 3BA0A 3NX7A 4FVLA 1QIAA 3DTIA 2EROA 4H82A 3TVCA 1OS2A 2ERPA 4PKUA 2OY4A 3P1VA 4WF6A 2OW2A 5I12A 2YUFA 4WZVA 1K7GA 2MZEA 2DW2A 1BUDA 4ILWD 1OM7A 3B2ZA 1ASTA 1A86A 3WV1A 2J0TA 2YB9A 1BKCI 1GO8P 456CA 3VTGA 1BSWA 1G4KA 1B3DA 5JMYA 1YOUA 3HB2P 4H30A 2JT5A 1ND1A 1AF0A 1PWWA 2K9CA 2V4BA 4I03A 4AUOA 1MNCA 1OM8A 2JNPA 3O2XA 2AYKA 2I47A 3EDGA 3I7IA 4G9LA 1MMRA 3KEKA 1KUFA 1HY7A 3MA2A 1G05A 2DW1A 2AIGP 2A8HA 1GE7A 2O36A 1AYKA 2OW0A 4PKQA 1JIZA 4GWMA 2Z2DA 4JA1A 4XM6A 1JAPA 2YIGA 3F16A 1ATLA 2OVXA 1ZS0A 2WO8A 3TT4A 1C7KA 5L79A 1GE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OS9 A;  4H76 A;  3OHL A;  5D2B A;  5CZM A;  4A3W A;  3LEA A;  1HV5 A;  830C A;  1BIW A;  2L0R A;  4IJO A;  2CKI A;  5BOY A;  3RTS A;  1QIB A;  4H2E A;  5CUH A;  4PKV A;  3RTT A;  3G5C A;  3L0T A;  966C A;  4FU4 A;  2RJQ A;  1CK7 A;  1R1H A;  2N8R A;  4JQG A;  5H8X A;  3N2U A;  3DWB A;  1KUG A;  4PKW A;  3HYG A;  1CGL A;  1JAN A;  3LIR A;  4GR0 A;  1XUR A;  1FM1 A;  3LJG A;  1EAK A;  4GWN A;  3DPF A;  1SLM A;  1IAE A;  1ZXV A;  2W15 A;  1R55 A;  4L6T A;  3EHX A;  1SAT A;  2Y6C A;  1G9K A;  1EUB A;  2JIH A;  3KMC A;  1CIZ A;  3SHI A;  3OHO A;  1Z3J A;  3Q2G A;  4DV8 A;  2OZR A;  2PJT A;  4PKS A;  1UMT A;  3LMC A;  4GF1 A;  1ZXC A;  4QKZ A;  1A85 A;  4XBH A;  4JPA A;  1BQO A;  1MMP A;  3HDA P;  4J4M A;  1KUH A;  4H84 A;  4G0D A;  1H71 P;  1JAQ A;  1ZVX A;  1R54 A;  1XFW A;  3WV2 A;  3KEC A;  1GXD A;  4XM8 A;  4FXQ A;  1G49 A;  4ON1 A;  2OXU A;  5CXA A;  3ZVS A;  4IUW A;  1DMT A;  1CAQ A;  3CKI A;  3N2V A;  5D1T A;  4AIG A;  5B5O A;  1QJI A;  4HMA A;  1PWU A;  2DDF A;  1HOV A;  4Q1L A;  1EB6 A;  2OY2 A;  4AYK A;  3TSK A;  3KWV C;  2X3C A;  4H1Q A;  3F19 A;  2O3E A;  3HY9 A;  2X3B A;  1OMJ A;  1KUI A;  2E2D A;  2W14 A;  3KEJ A;  1XUC A;  3LJZ A;  1QIC A;  1PWQ A;  1JIW P;  1BKC E;  1CGF A;  1XUD A;  3TS4 A;  4FXY P;  2JSD A;  4WK7 A;  3DL1 A;  4GQL A;  2WO9 A;  1K7Q A;  4A7B A;  1IAD A;  2QPJ A;  3LIK A;  3ELM A;  3GBO A;  1JK3 A;  1UEA A;  5BOT A;  2USN A;  2DW0 A;  2HU6 A;  2FV5 A;  1KAP P;  3K7N A;  2SRT A;  3UVC A;  2MLS A;  1O0T A;  1BKC A;  3LK8 A;  1Q3A A;  2MLR A;  1S4B P;  1J7N A;  4GR3 A;  2XS4 A;  2J83 A;  1JJ9 A;  1FLS A;  3K7L A;  3HDB A;  1ROS A;  4GUY A;  1SU3 A;  3Q2H A;  5I4O A;  2KRJ A;  1PWV A;  1R1J A;  3LUN A;  3EWJ A;  1HFS A;  3F18 A;  1SMP A;  4XCT A;  5D7W A;  2OXZ A;  4GR8 A;  4DD8 A;  4HX3 A;  1HFC A;  1UMS A;  5LAB A;  3P24 A;  3F15 A;  4DPE A;  1HTD A;  2MZH A;  1XFX A;  5B5P A;  4R3V A;  1PWP A;  1QUA A;  1FBL A;  3G42 A;  3LQB A;  4L19 A;  5D1U A;  5L7F A;  1I1I P;  1RMZ A;  1CQR A;  1KUK A;  1UTT A;  1CXV A;  1IAG A;  1YCM A;  2W13 A;  2TCL A;  3ZUK A;  3O64 A;  2MZI A;  3E8R A;  3B8Z A;  2OVZ A;  2W0D A;  3LUM A;  3L0V A;  3LJT A;  4I35 A;  3EDZ A;  1D8M A;  1UTZ A;  3LIL A;  1B8Y A;  1O0Q A;  3EDH A;  3DSL A;  1RM8 A;  1GKD A;  3EHY A;  4WKE A;  2E3X A;  1XFU A;  2X3A A;  3AYU A;  1XFZ A;  1WNI A;  2RJP A;  1QJJ A;  1ZP5 A;  3F1A A;  3KME A;  1GE6 A;  1C8T A;  3WV3 A;  5BPA A;  4CTH A;  2FV9 A;  2POJ A;  3F17 A;  1D8F A;  4DF9 A;  2OW1 A;  1Y93 A;  2Y6D A;  1JAO A;  2X7M A;  2OXW A;  1BUV M;  2W12 A;  1BQQ M;  1XFY A;  1IAB A;  2OW9 A;  1JKY A;  1Y0V A;  4IN9 A;  3U1R A;  1C3I A;  5I3M A;  3DNG A;  2CLT A;  5I0L A;  3VI1 A;  1MMQ A;  4JP4 A;  1SLN A;  4PKR A;  3HY7 A;  1BM6 A;  1K7I A;  1D5J A;  5D1S A;  4EFS A;  1GKC A;  4ZR5 A;  1IAA A;  2D1O A;  4L63 A;  1USN A;  3HBV P;  4AXQ A;  1GO7 P;  1G12 A;  2OI0 A;  1KBC A;  2XS3 A;  1R1I A;  1YQY A;  3AIG A;  4H3X A;  3KRY A;  1AKL A;  3V96 B;  1OM6 A;  1IAC A;  3ZXH A;  1I73 A;  3USN A;  1MMB A;  2DDY A;  1ZTQ A;  1SRP A;  1Y8J A;  5I2Z A;  3LQ0 A;  1DTH A;  3AYK A;  4H49 A;  3KHI A;  3LKA A;  5D3C A;  1L6J A;  1I76 A;  1D7X A;  1XFV A;  3B92 A;  2D1N A;  4JIJ A;  1JH1 A;  2ERQ A;  3EDI A;  1BZS A;  3I7G A;  1YP1 A;  4XM7 A;  2WOA A;  3LGP A;  2JT6 A;  3DPE A;  1OO9 A;  1CGE A;  5I43 A;  3LE9 A;  3HBU P;  4WKI A;  2K2G A;  4PKT A;  3BA0 A;  3NX7 A;  4FVL A;  1QIA A;  2ERO A;  4H82 A;  3TVC A;  1OS2 A;  2ERP A;  4PKU A;  2OY4 A;  3P1V A;  4WF6 A;  2OW2 A;  5I12 A;  4WZV A;  1K7G A;  2MZE A;  2DW2 A;  1BUD A;  4ILW D;  1OM7 A;  3B2Z A;  1AST A;  1A86 A;  3WV1 A;  2J0T A;  2YB9 A;  1BKC I;  1GO8 P;  456C A;  3VTG A;  1BSW A;  1G4K A;  1B3D A;  5JMY A;  1YOU A;  3HB2 P;  4H30 A;  2JT5 A;  1ND1 A;  1AF0 A;  1PWW A;  2K9C A;  2V4B A;  4I03 A;  4AUO A;  1MNC A;  1OM8 A;  2JNP A;  3O2X A;  2AYK A;  2I47 A;  3EDG A;  3I7I A;  4G9L A;  1MMR A;  3KEK A;  1KUF A;  1HY7 A;  3MA2 A;  1G05 A;  2DW1 A;  2AIG P;  2A8H A;  1GE7 A;  2O36 A;  1AYK A;  2OW0 A;  4PKQ A;  1JIZ A;  4GWM A;  2Z2D A;  4JA1 A;  4XM6 A;  1JAP A;  2YIG A;  3F16 A;  1ATL A;  2OVX A;  1ZS0 A;  2WO8 A;  3TT4 A;  1C7K A;  5L79 A;  1GE5 A; 
#chains in the Genus database with same CATH topology
 1OS9 A;  4H76 A;  3OHL A;  5D2B A;  5CZM A;  4A3W A;  3LEA A;  1HV5 A;  3DTE A;  830C A;  1BIW A;  2L0R A;  4IJO A;  2CKI A;  5BOY A;  3RTS A;  1QIB A;  4H2E A;  5CUH A;  4PKV A;  3RTT A;  3G5C A;  1TVI A;  3L0T A;  966C A;  4FU4 A;  2RJQ A;  1CK7 A;  1R1H A;  2N8R A;  4JQG A;  5H8X A;  3N2U A;  3DWB A;  1KUG A;  4PKW A;  3HYG A;  1CGL A;  1JAN A;  3LIR A;  4GR0 A;  1XUR A;  1FM1 A;  3LJG A;  1EAK A;  4GWN A;  3DPF A;  1SLM A;  1IAE A;  1ZXV A;  2W15 A;  1R55 A;  4L6T A;  3EHX A;  1SAT A;  2Y6C A;  1G9K A;  1EUB A;  2JIH A;  3KMC A;  1CIZ A;  3SHI A;  3OHO A;  1Z3J A;  3Q2G A;  4DV8 A;  2OZR A;  2PJT A;  4PKS A;  1UMT A;  3LMC A;  4GF1 A;  1ZXC A;  4QKZ A;  1A85 A;  4XBH A;  4JPA A;  1BQO A;  1MMP A;  3HDA P;  4J4M A;  1KUH A;  4H84 A;  4G0D A;  1H71 P;  1JAQ A;  1ZVX A;  1R54 A;  1XFW A;  3WV2 A;  3KEC A;  1GXD A;  4XM8 A;  4FXQ A;  1G49 A;  4ON1 A;  2OXU A;  5CXA A;  3ZVS A;  4IUW A;  1DMT A;  1CAQ A;  3CKI A;  3N2V A;  5D1T A;  4AIG A;  5B5O A;  1QJI A;  4HMA A;  1PWU A;  2DDF A;  1HOV A;  4Q1L A;  1EB6 A;  2OY2 A;  4AYK A;  3TSK A;  3KWV C;  2X3C A;  4H1Q A;  3F19 A;  2O3E A;  3HY9 A;  2X3B A;  1OMJ A;  1KUI A;  1XM5 A;  2E2D A;  2W14 A;  3KEJ A;  1XUC A;  3LJZ A;  1QIC A;  1PWQ A;  1JIW P;  1BKC E;  1CGF A;  1XUD A;  3TS4 A;  4FXY P;  2JSD A;  4WK7 A;  3DL1 A;  4GQL A;  2WO9 A;  1K7Q A;  4A7B A;  1IAD A;  2QPJ A;  3LIK A;  3ELM A;  3GBO A;  1JK3 A;  1UEA A;  5BOT A;  2USN A;  2DW0 A;  2HU6 A;  2FV5 A;  1KAP P;  3K7N A;  2SRT A;  3UVC A;  2MLS A;  1O0T A;  1BKC A;  3LK8 A;  1Q3A A;  2MLR A;  1S4B P;  1J7N A;  4GR3 A;  2XS4 A;  2J83 A;  1JJ9 A;  1FLS A;  3K7L A;  3HDB A;  1ROS A;  4GUY A;  1SU3 A;  3Q2H A;  5I4O A;  2KRJ A;  1PWV A;  1R1J A;  3LUN A;  3EWJ A;  1HFS A;  3F18 A;  1SMP A;  4XCT A;  5D7W A;  3DTK A;  2OXZ A;  4GR8 A;  4DD8 A;  4HX3 A;  1HFC A;  1UMS A;  5LAB A;  3P24 A;  3F15 A;  4DPE A;  1HTD A;  2MZH A;  1XFX A;  5B5P A;  4R3V A;  1PWP A;  1QUA A;  1FBL A;  3G42 A;  3LQB A;  4L19 A;  5D1U A;  5L7F A;  1I1I P;  1RMZ A;  1CQR A;  1KUK A;  1UTT A;  1CXV A;  1IAG A;  1YCM A;  2W13 A;  2TCL A;  3ZUK A;  3O64 A;  2MZI A;  3E8R A;  3B8Z A;  2OVZ A;  2W0D A;  3LUM A;  3L0V A;  3LJT A;  4I35 A;  3EDZ A;  1D8M A;  1UTZ A;  3LIL A;  1B8Y A;  1O0Q A;  3EDH A;  3DSL A;  1RM8 A;  1GKD A;  1XAX A;  3EHY A;  4WKE A;  2E3X A;  1XFU A;  2X3A A;  3AYU A;  1XFZ A;  1WNI A;  2RJP A;  1QJJ A;  1ZP5 A;  3F1A A;  3KME A;  1GE6 A;  1C8T A;  3WV3 A;  5BPA A;  4CTH A;  2FV9 A;  2POJ A;  3F17 A;  1D8F A;  4DF9 A;  2OW1 A;  1Y93 A;  2Y6D A;  1JAO A;  2X7M A;  2OXW A;  1BUV M;  2W12 A;  1BQQ M;  1XFY A;  1IAB A;  2OW9 A;  1JKY A;  1Y0V A;  4IN9 A;  3U1R A;  1C3I A;  5I3M A;  3DNG A;  2CLT A;  5I0L A;  3VI1 A;  1MMQ A;  4JP4 A;  1SLN A;  4PKR A;  3HY7 A;  1BM6 A;  1K7I A;  1D5J A;  5D1S A;  4EFS A;  4L7A A;  1GKC A;  4ZR5 A;  1IAA A;  2D1O A;  4L63 A;  1USN A;  3HBV P;  4AXQ A;  1GO7 P;  2OI0 A;  1G12 A;  1KBC A;  2XS3 A;  1R1I A;  1YQY A;  3AIG A;  4H3X A;  3KRY A;  1AKL A;  3V96 B;  1OM6 A;  1IAC A;  3ZXH A;  1I73 A;  3USN A;  1MMB A;  2DDY A;  1ZTQ A;  1SRP A;  1Y8J A;  5I2Z A;  3LQ0 A;  1DTH A;  3AYK A;  4H49 A;  3KHI A;  3LKA A;  5D3C A;  1L6J A;  1I76 A;  1D7X A;  1XFV A;  3B92 A;  2D1N A;  4JIJ A;  1JH1 A;  2ERQ A;  3EDI A;  1BZS A;  3I7G A;  1YP1 A;  4XM7 A;  2WOA A;  3LGP A;  2JT6 A;  3DPE A;  1OO9 A;  1CGE A;  5I43 A;  3LE9 A;  3HBU P;  4WKI A;  2K2G A;  4PKT A;  3BA0 A;  3NX7 A;  4FVL A;  1QIA A;  3DTI A;  2ERO A;  4H82 A;  3TVC A;  1OS2 A;  2ERP A;  4PKU A;  2OY4 A;  3P1V A;  4WF6 A;  2OW2 A;  5I12 A;  2YUF A;  4WZV A;  1K7G A;  2MZE A;  2DW2 A;  1BUD A;  4ILW D;  1OM7 A;  3B2Z A;  1AST A;  1A86 A;  3WV1 A;  2J0T A;  2YB9 A;  1BKC I;  1GO8 P;  456C A;  3VTG A;  1BSW A;  1G4K A;  1B3D A;  5JMY A;  1YOU A;  3HB2 P;  4H30 A;  2JT5 A;  1ND1 A;  1AF0 A;  1PWW A;  2K9C A;  2V4B A;  4I03 A;  4AUO A;  1MNC A;  1OM8 A;  2JNP A;  3O2X A;  2AYK A;  2I47 A;  3EDG A;  3I7I A;  4G9L A;  1MMR A;  3KEK A;  1KUF A;  1HY7 A;  3MA2 A;  1G05 A;  1OZ9 A;  2DW1 A;  2AIG P;  2A8H A;  1GE7 A;  2O36 A;  1AYK A;  2OW0 A;  4PKQ A;  1JIZ A;  4GWM A;  2Z2D A;  4JA1 A;  4XM6 A;  1JAP A;  2YIG A;  3F16 A;  1ATL A;  2OVX A;  1ZS0 A;  2WO8 A;  3TT4 A;  1C7K A;  5L79 A;  1GE5 A; 
#chains in the Genus database with same CATH homology
 1OS9 A;  4H76 A;  3OHL A;  5D2B A;  5CZM A;  4A3W A;  3LEA A;  1HV5 A;  3DTE A;  830C A;  1BIW A;  2L0R A;  4IJO A;  2CKI A;  5BOY A;  3RTS A;  1QIB A;  4H2E A;  5CUH A;  4PKV A;  3RTT A;  3G5C A;  3L0T A;  966C A;  4FU4 A;  2RJQ A;  1CK7 A;  1R1H A;  2N8R A;  4JQG A;  5H8X A;  3N2U A;  3DWB A;  1KUG A;  4PKW A;  3HYG A;  1CGL A;  1JAN A;  3LIR A;  4GR0 A;  1XUR A;  1FM1 A;  3LJG A;  1EAK A;  4GWN A;  3DPF A;  1SLM A;  1IAE A;  1ZXV A;  2W15 A;  1R55 A;  4L6T A;  3EHX A;  1SAT A;  2Y6C A;  1G9K A;  1EUB A;  2JIH A;  3KMC A;  1CIZ A;  3SHI A;  3OHO A;  1Z3J A;  3Q2G A;  4DV8 A;  2OZR A;  2PJT A;  4PKS A;  1UMT A;  3LMC A;  4GF1 A;  1ZXC A;  4QKZ A;  1A85 A;  4XBH A;  4JPA A;  1BQO A;  1MMP A;  3HDA P;  4J4M A;  1KUH A;  4H84 A;  4G0D A;  1H71 P;  1JAQ A;  1ZVX A;  1R54 A;  1XFW A;  3WV2 A;  3KEC A;  1GXD A;  4XM8 A;  4FXQ A;  1G49 A;  4ON1 A;  2OXU A;  5CXA A;  3ZVS A;  4IUW A;  1DMT A;  1CAQ A;  3CKI A;  3N2V A;  5D1T A;  4AIG A;  5B5O A;  1QJI A;  4HMA A;  1PWU A;  2DDF A;  1HOV A;  4Q1L A;  1EB6 A;  2OY2 A;  4AYK A;  3TSK A;  3KWV C;  2X3C A;  4H1Q A;  3F19 A;  2O3E A;  3HY9 A;  2X3B A;  1OMJ A;  1KUI A;  2E2D A;  2W14 A;  3KEJ A;  1XUC A;  3LJZ A;  1QIC A;  1PWQ A;  1JIW P;  1BKC E;  1CGF A;  1XUD A;  3TS4 A;  4FXY P;  2JSD A;  4WK7 A;  3DL1 A;  4GQL A;  2WO9 A;  1K7Q A;  4A7B A;  1IAD A;  2QPJ A;  3LIK A;  3ELM A;  3GBO A;  1JK3 A;  1UEA A;  5BOT A;  2USN A;  2DW0 A;  2HU6 A;  2FV5 A;  1KAP P;  3K7N A;  2SRT A;  3UVC A;  2MLS A;  1O0T A;  1BKC A;  3LK8 A;  1Q3A A;  2MLR A;  1S4B P;  1J7N A;  4GR3 A;  2XS4 A;  2J83 A;  1JJ9 A;  1FLS A;  3K7L A;  3HDB A;  1ROS A;  4GUY A;  1SU3 A;  3Q2H A;  5I4O A;  2KRJ A;  1PWV A;  1R1J A;  3LUN A;  3EWJ A;  1HFS A;  3F18 A;  1SMP A;  4XCT A;  5D7W A;  3DTK A;  2OXZ A;  4GR8 A;  4DD8 A;  4HX3 A;  1HFC A;  1UMS A;  5LAB A;  3P24 A;  3F15 A;  4DPE A;  1HTD A;  2MZH A;  1XFX A;  5B5P A;  4R3V A;  1PWP A;  1QUA A;  1FBL A;  3G42 A;  3LQB A;  4L19 A;  5D1U A;  5L7F A;  1I1I P;  1RMZ A;  1CQR A;  1KUK A;  1UTT A;  1CXV A;  1IAG A;  1YCM A;  2W13 A;  2TCL A;  3ZUK A;  3O64 A;  2MZI A;  3E8R A;  3B8Z A;  2OVZ A;  2W0D A;  3LUM A;  3L0V A;  3LJT A;  4I35 A;  3EDZ A;  1D8M A;  1UTZ A;  3LIL A;  1B8Y A;  1O0Q A;  3EDH A;  3DSL A;  1RM8 A;  1GKD A;  3EHY A;  4WKE A;  2E3X A;  1XFU A;  2X3A A;  3AYU A;  1XFZ A;  1WNI A;  2RJP A;  1QJJ A;  1ZP5 A;  3F1A A;  3KME A;  1GE6 A;  1C8T A;  3WV3 A;  5BPA A;  4CTH A;  2FV9 A;  2POJ A;  3F17 A;  1D8F A;  4DF9 A;  2OW1 A;  1Y93 A;  2Y6D A;  1JAO A;  2X7M A;  2OXW A;  1BUV M;  2W12 A;  1BQQ M;  1XFY A;  1IAB A;  2OW9 A;  1JKY A;  1Y0V A;  4IN9 A;  3U1R A;  1C3I A;  5I3M A;  3DNG A;  2CLT A;  5I0L A;  3VI1 A;  1MMQ A;  4JP4 A;  1SLN A;  4PKR A;  3HY7 A;  1BM6 A;  1K7I A;  1D5J A;  5D1S A;  4EFS A;  4L7A A;  1GKC A;  4ZR5 A;  1IAA A;  2D1O A;  4L63 A;  1USN A;  3HBV P;  4AXQ A;  1GO7 P;  1G12 A;  2OI0 A;  1KBC A;  2XS3 A;  1R1I A;  1YQY A;  3AIG A;  4H3X A;  3KRY A;  1AKL A;  3V96 B;  1OM6 A;  1IAC A;  3ZXH A;  1I73 A;  3USN A;  1MMB A;  2DDY A;  1ZTQ A;  1SRP A;  1Y8J A;  5I2Z A;  3LQ0 A;  1DTH A;  3AYK A;  4H49 A;  3KHI A;  3LKA A;  5D3C A;  1L6J A;  1I76 A;  1D7X A;  1XFV A;  3B92 A;  2D1N A;  4JIJ A;  1JH1 A;  2ERQ A;  3EDI A;  1BZS A;  3I7G A;  1YP1 A;  4XM7 A;  2WOA A;  3LGP A;  2JT6 A;  3DPE A;  1OO9 A;  1CGE A;  5I43 A;  3LE9 A;  3HBU P;  4WKI A;  2K2G A;  4PKT A;  3BA0 A;  3NX7 A;  4FVL A;  1QIA A;  3DTI A;  2ERO A;  4H82 A;  3TVC A;  1OS2 A;  2ERP A;  4PKU A;  2OY4 A;  3P1V A;  4WF6 A;  2OW2 A;  5I12 A;  2YUF A;  4WZV A;  1K7G A;  2MZE A;  2DW2 A;  1BUD A;  4ILW D;  1OM7 A;  3B2Z A;  1AST A;  1A86 A;  3WV1 A;  2J0T A;  2YB9 A;  1BKC I;  1GO8 P;  456C A;  3VTG A;  1BSW A;  1G4K A;  1B3D A;  5JMY A;  1YOU A;  3HB2 P;  4H30 A;  2JT5 A;  1ND1 A;  1AF0 A;  1PWW A;  2K9C A;  2V4B A;  4I03 A;  4AUO A;  1MNC A;  1OM8 A;  2JNP A;  3O2X A;  2AYK A;  2I47 A;  3EDG A;  3I7I A;  4G9L A;  1MMR A;  3KEK A;  1KUF A;  1HY7 A;  3MA2 A;  1G05 A;  2DW1 A;  2AIG P;  2A8H A;  1GE7 A;  2O36 A;  1AYK A;  2OW0 A;  4PKQ A;  1JIZ A;  4GWM A;  2Z2D A;  4JA1 A;  4XM6 A;  1JAP A;  2YIG A;  3F16 A;  1ATL A;  2OVX A;  1ZS0 A;  2WO8 A;  3TT4 A;  1C7K A;  5L79 A;  1GE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...