4GR8A

Crystal structure of the catalytic domain of human mmp12 in complex with selective phosphinic inhibitor rxp470c
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
152
structure length
152
Chain Sequence
b'KHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Molecular determinants of a selective matrix metalloprotease-12 inhibitor: insights from crystallography and thermodynamic studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 152
sequence length 152
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2012-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4gr8A00
4H2EA 4EFSA 1K7QA 3RTSA 4AUOA 1JAOA 1UTZA 1GE5A 2ERQA 1OS9A 1PWVA 4XM8A 966CA 1QJIA 5I12A 4GR8A 4GWNA 1USNA 4I03A 3TS4A 1OS2A 1QJJA 2Z2DA 4XM7A 4AXQA 4PKSA 1D8FA 1MMQA 4PKQA 2OY2A 2ERPA 3EDHA 5D7WA 4GQLA 5CXAA 3Q2GA 4WK7A 4JQGA 2PJTA 1H71P 2O3EA 2XS3A 1BSWA 4GR3A 4PKVA 2KRJA 2D1OA 1IACA 4L63A 2XS4A 1WNIA 3LQ0A 1JIWP 1BUDA 1SRPA 1EAKA 2WO8A 3RTTA 2OXWA 3F1AA 4G0DA 4JPAA 1ATLA 1OO9A 3LKAA 3HBUP 4FXYP 1CK7A 3LK8A 4H30A 1I76A 1IABA 4JP4A 4GWMA 1DTHA 5BPAA 1YOUA 4PKWA 3MA2A 1R55A 1PWPA 4R3VA 1UTTA 3LIRA 1G12A 2K2GA 4G9LA 4H76A 1JAPA 2W14A 1EUBA 3DSLA 1SMPA 2OW2A 3K7LA 1KUKA 4DPEA 2OW1A 3I7IA 1G9KA 3GBOA 2DW1A 2USNA 3F17A 3EWJA 2MLSA 1XFWA 3ELMA 4FU4A 3B2ZA 1JIZA 3OHOA 1XURA 1BZSA 3LEAA 4FXQA 3KMEA 4GF1A 3KECA 2JIHA 1GKCA 2W15A 1OMJA 1IAGA 4ZR5A 5D3CA 3F18A 1I73A 1R1JA 830CA 2JT5A 3KHIA 4H1QA 1JJ9A 4Q1LA 3F19A 5BOTA 4DD8A 2Y6DA 3HDBA 1XFZA 4A3WA 3EDGA 4CTHA 3AIGA 2AIGP 1BIWA 1XFUA 1FBLA 1BKCE 4PKRA 1SLMA 3VTGA 2YB9A 456CA 3OHLA 3TT4A 5I2ZA 3KEJA 1YQYA 2W13A 4XM6A 1ZVXA 2AYKA 1PWUA 1ND1A 1BKCI 1XFYA 1OM6A 2W12A 2MZEA 2EROA 1YCMA 2FV5A 3F16A 5B5OA 3LE9A 1CGLA 2J83A 1IAEA 2Y6CA 3P1VA 2J0TA 4AYKA 1AYKA 1ZXVA 5D1TA 3Q2HA 4ILWD 1ZP5A 3DNGA 4PKTA 3L0VA 5L79A 4DF9A 1KAPP 2OW9A 4XCTA 1L6JA 2DDYA 3WV1A 4IN9A 5B5PA 4IJOA 1CXVA 5LABA 3HY7A 1ROSA 1FM1A 3P24A 4HX3A 3ZUKA 1A86A 1JAQA 3B92A 2CLTA 1BQOA 1PWQA 1KBCA 1R1IA 1ZTQA 3LQBA 4WZVA 1GE6A 1J7NA 1XFXA 1KUIA 2JT6A 3B8ZA 1HOVA 3E8RA 1IADA 1BKCA 1Q3AA 4HMAA 1BUVM 4GR0A 3N2UA 2OXUA 1C7KA 2CKIA 4A7BA 1CGFA 2YIGA 2WOAA 1AF0A 5BOYA 1Y8JA 1QICA 2JSDA 1KUGA 1KUHA 4H82A 1A85A 1OM7A 2RJQA 1JANA 2RJPA 4JIJA 2O36A 1Y0VA 3HBVP 3CKIA 1BM6A 5D2BA 2JNPA 3HY9A 2OVXA 1CAQA 1OM8A 4WKEA 3ZVSA 4L19A 2X3CA 3LUNA 4J4MA 2MZIA 3HDAP 3SHIA 1HFCA 3N2VA 2A8HA 2MLRA 2OW0A 1XUDA 2W0DA 4H49A 1QUAA 3HYGA 3G42A 3O2XA 2DW2A 1HTDA 3USNA 2X7MA 1G49A 1QIAA 3TVCA 2X3AA 5I43A 3LGPA 3KEKA 1YP1A 3O64A 2E2DA 5H8XA 3V96B 2D1NA 3LJGA 4QKZA 1G4KA 1RM8A 3DL1A 4FVLA 2DW0A 5I0LA 1G05A 1MNCA 3F15A 2X3BA 3LIKA 3NX7A 1D7XA 3K7NA 3EDIA 4IUWA 1DMTA 1SU3A 3LMCA 1O0QA 1MMBA 2OVZA 1GO8P 1Y93A 1I1IP 1JK3A 2MZHA 1HV5A 5D1UA 1GKDA 1B3DA 1GO7P 1Z3JA 2OZRA 1C3IA 4L6TA 3WV2A 2OY4A 3KRYA 3LJZA 3DPFA 2OXZA 1R1HA 5I3MA 1SLNA 3U1RA 1GE7A 1MMRA 3HB2P 2DDFA 3G5CA 5D1SA 2V4BA 1JKYA 1S4BP 1K7GA 4AIGA 1ZS0A 2QPJA 3KMCA 3EDZA 1BQQM 1SATA 1HY7A 4DV8A 3EHYA 3VI1A 3I7GA 1FLSA 2TCLA 4XBHA 1UMTA 1C8TA 4WF6A 3LJTA 2I47A 1XFVA 4JA1A 1AKLA 5L7FA 1K7IA 3EHXA 3AYUA 3TSKA 3KWVC 1MMPA 4H84A 1CQRA 1JH1A 2HU6A 1HFSA 4WKIA 3AYKA 5CZMA 1KUFA 4PKUA 2SRTA 3ZXHA 1IAAA 1ASTA 3DWBA 4H3XA 5I4OA 2OI0A 5JMYA 1O0TA 1PWWA 4GUYA 2L0RA 3L0TA 1UMSA 2WO9A 1QIBA 1R54A 1RMZA 1B8YA 1CGEA 3LUMA 3LILA 2POJA 1EB6A 3DPEA 2E3XA 1UEAA 1CIZA 1GXDA 2K9CA 1XUCA 3BA0A 5CUHA 2FV9A 2N8RA 3WV3A 4ON1A 4I35A 1D5JA 3UVCA 1ZXCA 1D8MA
chains in the Genus database with same CATH superfamily
4H2EA 4EFSA 1K7QA 3RTSA 4AUOA 1JAOA 1UTZA 1GE5A 2ERQA 1OS9A 1PWVA 4XM8A 966CA 1QJIA 5I12A 4GR8A 4GWNA 1USNA 4I03A 3TS4A 1OS2A 1QJJA 2Z2DA 4XM7A 4AXQA 4PKSA 1D8FA 1MMQA 4PKQA 2OY2A 2ERPA 3EDHA 5D7WA 4GQLA 5CXAA 3Q2GA 4WK7A 4JQGA 2PJTA 1H71P 2O3EA 2XS3A 1BSWA 4GR3A 4PKVA 2KRJA 2D1OA 1IACA 4L63A 2XS4A 1WNIA 3LQ0A 1JIWP 1BUDA 1SRPA 1EAKA 2WO8A 3RTTA 2OXWA 3F1AA 4G0DA 4JPAA 1ATLA 1OO9A 3LKAA 3HBUP 4FXYP 1CK7A 3LK8A 4H30A 1I76A 1IABA 4JP4A 4GWMA 1DTHA 5BPAA 1YOUA 4PKWA 3MA2A 1R55A 1PWPA 4R3VA 1UTTA 3LIRA 1G12A 2K2GA 4G9LA 4H76A 1JAPA 2W14A 1EUBA 3DSLA 1SMPA 2OW2A 3K7LA 1KUKA 4DPEA 2OW1A 3I7IA 1G9KA 3GBOA 2DW1A 2USNA 3F17A 3EWJA 2MLSA 1XFWA 3ELMA 4FU4A 3B2ZA 1JIZA 3OHOA 1XURA 1BZSA 3LEAA 4FXQA 3KMEA 4GF1A 3KECA 2JIHA 1GKCA 2W15A 1OMJA 1IAGA 4ZR5A 5D3CA 3F18A 1I73A 1R1JA 830CA 2JT5A 3KHIA 4H1QA 1JJ9A 4Q1LA 3F19A 5BOTA 4DD8A 2Y6DA 3HDBA 1XFZA 4A3WA 4L7AA 3EDGA 4CTHA 3AIGA 2AIGP 1BIWA 1XFUA 1FBLA 1TVIA 1BKCE 4PKRA 1SLMA 3VTGA 2YB9A 456CA 3OHLA 3TT4A 5I2ZA 3KEJA 1YQYA 2W13A 4XM6A 1ZVXA 2AYKA 1PWUA 1ND1A 1XAXA 1BKCI 1XFYA 1OM6A 2W12A 2MZEA 2EROA 1YCMA 2FV5A 3F16A 5B5OA 3LE9A 1CGLA 2J83A 1IAEA 2Y6CA 3P1VA 2J0TA 4AYKA 1AYKA 1ZXVA 5D1TA 3Q2HA 4ILWD 1ZP5A 3DNGA 4PKTA 3L0VA 5L79A 4DF9A 1KAPP 2OW9A 4XCTA 1L6JA 2DDYA 3WV1A 4IN9A 5B5PA 4IJOA 1CXVA 5LABA 3HY7A 1ROSA 1FM1A 3P24A 4HX3A 3ZUKA 1A86A 1JAQA 3B92A 2CLTA 1BQOA 1PWQA 1KBCA 1R1IA 1ZTQA 3LQBA 4WZVA 3DTKA 1GE6A 1J7NA 1XFXA 1KUIA 2JT6A 3B8ZA 1HOVA 3E8RA 1IADA 1BKCA 1Q3AA 4HMAA 1BUVM 4GR0A 3N2UA 2OXUA 1C7KA 2CKIA 4A7BA 1CGFA 2YIGA 2WOAA 1AF0A 5BOYA 1Y8JA 1QICA 2JSDA 1KUGA 1KUHA 4H82A 1A85A 1OM7A 2RJQA 1JANA 2RJPA 4JIJA 2O36A 1Y0VA 3HBVP 3CKIA 1BM6A 5D2BA 2JNPA 3HY9A 2OVXA 1CAQA 1OM8A 4WKEA 3ZVSA 4L19A 2X3CA 3LUNA 4J4MA 2MZIA 3HDAP 3SHIA 1HFCA 3N2VA 2A8HA 1OZ9A 2MLRA 2OW0A 1XUDA 2W0DA 4H49A 1QUAA 3HYGA 3G42A 3O2XA 2DW2A 1HTDA 3USNA 2X7MA 1G49A 1QIAA 3TVCA 2X3AA 5I43A 3LGPA 3KEKA 1YP1A 3O64A 2E2DA 5H8XA 3V96B 2D1NA 3LJGA 4QKZA 1G4KA 1RM8A 3DL1A 4FVLA 2DW0A 5I0LA 1G05A 1MNCA 3F15A 2X3BA 3LIKA 3NX7A 1D7XA 3K7NA 3EDIA 4IUWA 1DMTA 1SU3A 3LMCA 1O0QA 1MMBA 2OVZA 1GO8P 1Y93A 1I1IP 1JK3A 2MZHA 1HV5A 5D1UA 1GKDA 1B3DA 1GO7P 1Z3JA 2YUFA 2OZRA 1C3IA 4L6TA 3WV2A 2OY4A 3KRYA 3LJZA 3DPFA 2OXZA 1R1HA 5I3MA 1SLNA 3U1RA 1GE7A 1MMRA 3DTIA 3HB2P 2DDFA 3G5CA 5D1SA 2V4BA 1JKYA 1S4BP 1K7GA 4AIGA 1ZS0A 2QPJA 3KMCA 3EDZA 1BQQM 1SATA 1HY7A 4DV8A 3EHYA 3VI1A 3DTEA 3I7GA 1FLSA 2TCLA 4XBHA 1UMTA 1C8TA 4WF6A 3LJTA 2I47A 1XFVA 4JA1A 1AKLA 5L7FA 1XM5A 1K7IA 3EHXA 3AYUA 3TSKA 3KWVC 1MMPA 4H84A 1CQRA 1JH1A 2HU6A 1HFSA 4WKIA 3AYKA 5CZMA 1KUFA 4PKUA 2SRTA 3ZXHA 1IAAA 1ASTA 3DWBA 4H3XA 5I4OA 2OI0A 5JMYA 1O0TA 1PWWA 4GUYA 2L0RA 3L0TA 1UMSA 2WO9A 1QIBA 1R54A 1RMZA 1B8YA 1CGEA 3LUMA 3LILA 2POJA 1EB6A 3DPEA 2E3XA 1UEAA 1CIZA 1GXDA 2K9CA 1XUCA 3BA0A 5CUHA 2FV9A 2N8RA 3WV3A 4ON1A 4I35A 1D5JA 3UVCA 1ZXCA 1D8MA
chains in the Genus database with same CATH topology
4H2EA 4EFSA 1K7QA 3RTSA 4AUOA 1JAOA 1UTZA 1GE5A 2ERQA 1OS9A 1PWVA 4XM8A 966CA 1QJIA 5I12A 4GR8A 4GWNA 1USNA 4I03A 3TS4A 1OS2A 1QJJA 2Z2DA 4XM7A 4AXQA 4PKSA 1D8FA 1MMQA 4PKQA 2OY2A 2ERPA 3EDHA 5D7WA 4GQLA 5CXAA 3Q2GA 4WK7A 4JQGA 2PJTA 1H71P 2O3EA 2XS3A 1BSWA 4GR3A 4PKVA 2KRJA 2D1OA 1IACA 4L63A 2XS4A 1WNIA 3LQ0A 1JIWP 1BUDA 1SRPA 1EAKA 2WO8A 3RTTA 2OXWA 3F1AA 4G0DA 4JPAA 1ATLA 1OO9A 3LKAA 3HBUP 4FXYP 1CK7A 3LK8A 4H30A 1I76A 1IABA 4JP4A 4GWMA 1DTHA 5BPAA 1YOUA 4PKWA 3MA2A 1R55A 1PWPA 4R3VA 1UTTA 3LIRA 1G12A 2K2GA 4G9LA 4H76A 1JAPA 2W14A 1EUBA 3DSLA 1SMPA 2OW2A 3K7LA 1KUKA 4DPEA 2OW1A 3I7IA 1G9KA 3GBOA 2DW1A 2USNA 3F17A 3EWJA 2MLSA 1XFWA 3ELMA 4FU4A 3B2ZA 1JIZA 3OHOA 1XURA 1BZSA 3LEAA 4FXQA 3KMEA 4GF1A 3KECA 2JIHA 1GKCA 2W15A 1OMJA 1IAGA 4ZR5A 5D3CA 3F18A 1I73A 1R1JA 830CA 2JT5A 3KHIA 4H1QA 1JJ9A 4Q1LA 3F19A 5BOTA 4DD8A 2Y6DA 3HDBA 1XFZA 4A3WA 4L7AA 3EDGA 4CTHA 3AIGA 2AIGP 1BIWA 1XFUA 1FBLA 1BKCE 4PKRA 1SLMA 3VTGA 2YB9A 456CA 3OHLA 3TT4A 5I2ZA 3KEJA 1YQYA 2W13A 4XM6A 1ZVXA 2AYKA 1PWUA 1ND1A 1BKCI 1XFYA 1OM6A 2W12A 2MZEA 2EROA 1YCMA 2FV5A 3F16A 5B5OA 3LE9A 1CGLA 2J83A 1IAEA 2Y6CA 3P1VA 2J0TA 4AYKA 1AYKA 1ZXVA 5D1TA 3Q2HA 4ILWD 1ZP5A 3DNGA 4PKTA 3L0VA 5L79A 4DF9A 1KAPP 2OW9A 4XCTA 1L6JA 2DDYA 3WV1A 4IN9A 5B5PA 4IJOA 1CXVA 5LABA 3HY7A 1ROSA 1FM1A 3P24A 4HX3A 3ZUKA 1A86A 1JAQA 3B92A 2CLTA 1BQOA 1PWQA 1KBCA 1R1IA 1ZTQA 3LQBA 4WZVA 3DTKA 1GE6A 1J7NA 1XFXA 1KUIA 2JT6A 3B8ZA 1HOVA 3E8RA 1IADA 1BKCA 1Q3AA 4HMAA 1BUVM 4GR0A 3N2UA 2OXUA 1C7KA 2CKIA 4A7BA 1CGFA 2YIGA 2WOAA 1AF0A 5BOYA 1Y8JA 1QICA 2JSDA 1KUGA 1KUHA 4H82A 1A85A 1OM7A 2RJQA 1JANA 2RJPA 4JIJA 2O36A 1Y0VA 3HBVP 3CKIA 1BM6A 5D2BA 2JNPA 3HY9A 2OVXA 1CAQA 1OM8A 4WKEA 3ZVSA 4L19A 2X3CA 3LUNA 4J4MA 2MZIA 3HDAP 3SHIA 1HFCA 3N2VA 2A8HA 2MLRA 2OW0A 1XUDA 2W0DA 4H49A 1QUAA 3HYGA 3G42A 3O2XA 2DW2A 1HTDA 3USNA 2X7MA 1G49A 1QIAA 3TVCA 2X3AA 5I43A 3LGPA 3KEKA 1YP1A 3O64A 2E2DA 5H8XA 3V96B 2D1NA 3LJGA 4QKZA 1G4KA 1RM8A 3DL1A 4FVLA 2DW0A 5I0LA 1G05A 1MNCA 3F15A 2X3BA 3LIKA 3NX7A 1D7XA 3K7NA 3EDIA 4IUWA 1DMTA 1SU3A 3LMCA 1O0QA 1MMBA 2OVZA 1GO8P 1Y93A 1I1IP 1JK3A 2MZHA 1HV5A 5D1UA 1GKDA 1B3DA 1GO7P 1Z3JA 2YUFA 2OZRA 1C3IA 4L6TA 3WV2A 2OY4A 3KRYA 3LJZA 3DPFA 2OXZA 1R1HA 5I3MA 1SLNA 3U1RA 1GE7A 1MMRA 3DTIA 3HB2P 2DDFA 3G5CA 5D1SA 2V4BA 1JKYA 1S4BP 1K7GA 4AIGA 1ZS0A 2QPJA 3KMCA 3EDZA 1BQQM 1SATA 1HY7A 4DV8A 3EHYA 3VI1A 3DTEA 3I7GA 1FLSA 2TCLA 4XBHA 1UMTA 1C8TA 4WF6A 3LJTA 2I47A 1XFVA 4JA1A 1AKLA 5L7FA 1K7IA 3EHXA 3AYUA 3TSKA 3KWVC 1MMPA 4H84A 1CQRA 1JH1A 2HU6A 1HFSA 4WKIA 3AYKA 5CZMA 1KUFA 4PKUA 2SRTA 3ZXHA 1IAAA 1ASTA 3DWBA 4H3XA 5I4OA 2OI0A 5JMYA 1O0TA 1PWWA 4GUYA 2L0RA 3L0TA 1UMSA 2WO9A 1QIBA 1R54A 1RMZA 1B8YA 1CGEA 3LUMA 3LILA 2POJA 1EB6A 3DPEA 2E3XA 1UEAA 1CIZA 1GXDA 2K9CA 1XUCA 3BA0A 5CUHA 2FV9A 2N8RA 3WV3A 4ON1A 4I35A 1D5JA 3UVCA 1ZXCA 1D8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2E A;  4EFS A;  1K7Q A;  3RTS A;  4AUO A;  1JAO A;  1UTZ A;  1GE5 A;  2ERQ A;  1OS9 A;  1PWV A;  4XM8 A;  966C A;  1QJI A;  5I12 A;  4GR8 A;  4GWN A;  1USN A;  4I03 A;  3TS4 A;  1OS2 A;  1QJJ A;  2Z2D A;  4XM7 A;  4AXQ A;  4PKS A;  1D8F A;  1MMQ A;  4PKQ A;  2OY2 A;  2ERP A;  3EDH A;  5D7W A;  4GQL A;  5CXA A;  3Q2G A;  4WK7 A;  4JQG A;  2PJT A;  1H71 P;  2O3E A;  2XS3 A;  1BSW A;  4GR3 A;  4PKV A;  2KRJ A;  2D1O A;  1IAC A;  4L63 A;  2XS4 A;  1WNI A;  3LQ0 A;  1JIW P;  1BUD A;  1SRP A;  1EAK A;  2WO8 A;  3RTT A;  2OXW A;  3F1A A;  4G0D A;  4JPA A;  1ATL A;  1OO9 A;  3LKA A;  3HBU P;  4FXY P;  1CK7 A;  3LK8 A;  4H30 A;  1I76 A;  1IAB A;  4JP4 A;  4GWM A;  1DTH A;  5BPA A;  1YOU A;  4PKW A;  3MA2 A;  1R55 A;  1PWP A;  4R3V A;  1UTT A;  3LIR A;  1G12 A;  2K2G A;  4G9L A;  4H76 A;  1JAP A;  2W14 A;  1EUB A;  3DSL A;  1SMP A;  2OW2 A;  3K7L A;  1KUK A;  4DPE A;  2OW1 A;  3I7I A;  1G9K A;  3GBO A;  2DW1 A;  2USN A;  3F17 A;  3EWJ A;  2MLS A;  1XFW A;  3ELM A;  4FU4 A;  3B2Z A;  1JIZ A;  3OHO A;  1XUR A;  1BZS A;  3LEA A;  4FXQ A;  3KME A;  4GF1 A;  3KEC A;  2JIH A;  1GKC A;  2W15 A;  1OMJ A;  1IAG A;  4ZR5 A;  5D3C A;  3F18 A;  1I73 A;  1R1J A;  830C A;  2JT5 A;  3KHI A;  4H1Q A;  1JJ9 A;  4Q1L A;  3F19 A;  5BOT A;  4DD8 A;  2Y6D A;  3HDB A;  1XFZ A;  4A3W A;  3EDG A;  4CTH A;  3AIG A;  2AIG P;  1BIW A;  1XFU A;  1FBL A;  1BKC E;  4PKR A;  1SLM A;  3VTG A;  2YB9 A;  456C A;  3OHL A;  3TT4 A;  5I2Z A;  3KEJ A;  1YQY A;  2W13 A;  4XM6 A;  1ZVX A;  2AYK A;  1PWU A;  1ND1 A;  1BKC I;  1XFY A;  1OM6 A;  2W12 A;  2MZE A;  2ERO A;  1YCM A;  2FV5 A;  3F16 A;  5B5O A;  3LE9 A;  1CGL A;  2J83 A;  1IAE A;  2Y6C A;  3P1V A;  2J0T A;  4AYK A;  1AYK A;  1ZXV A;  5D1T A;  3Q2H A;  4ILW D;  1ZP5 A;  3DNG A;  4PKT A;  3L0V A;  5L79 A;  4DF9 A;  1KAP P;  2OW9 A;  4XCT A;  1L6J A;  2DDY A;  3WV1 A;  4IN9 A;  5B5P A;  4IJO A;  1CXV A;  5LAB A;  3HY7 A;  1ROS A;  1FM1 A;  3P24 A;  4HX3 A;  3ZUK A;  1A86 A;  1JAQ A;  3B92 A;  2CLT A;  1BQO A;  1PWQ A;  1KBC A;  1R1I A;  1ZTQ A;  3LQB A;  4WZV A;  1GE6 A;  1J7N A;  1XFX A;  1KUI A;  2JT6 A;  3B8Z A;  1HOV A;  3E8R A;  1IAD A;  1BKC A;  1Q3A A;  4HMA A;  1BUV M;  4GR0 A;  3N2U A;  2OXU A;  1C7K A;  2CKI A;  4A7B A;  1CGF A;  2YIG A;  2WOA A;  1AF0 A;  5BOY A;  1Y8J A;  1QIC A;  2JSD A;  1KUG A;  1KUH A;  4H82 A;  1A85 A;  1OM7 A;  2RJQ A;  1JAN A;  2RJP A;  4JIJ A;  2O36 A;  1Y0V A;  3HBV P;  3CKI A;  1BM6 A;  5D2B A;  2JNP A;  3HY9 A;  2OVX A;  1CAQ A;  1OM8 A;  4WKE A;  3ZVS A;  4L19 A;  2X3C A;  3LUN A;  4J4M A;  2MZI A;  3HDA P;  3SHI A;  1HFC A;  3N2V A;  2A8H A;  2MLR A;  2OW0 A;  1XUD A;  2W0D A;  4H49 A;  1QUA A;  3HYG A;  3G42 A;  3O2X A;  2DW2 A;  1HTD A;  3USN A;  2X7M A;  1G49 A;  1QIA A;  3TVC A;  2X3A A;  5I43 A;  3LGP A;  3KEK A;  1YP1 A;  3O64 A;  2E2D A;  5H8X A;  3V96 B;  2D1N A;  3LJG A;  4QKZ A;  1G4K A;  1RM8 A;  3DL1 A;  4FVL A;  2DW0 A;  5I0L A;  1G05 A;  1MNC A;  3F15 A;  2X3B A;  3LIK A;  3NX7 A;  1D7X A;  3K7N A;  3EDI A;  4IUW A;  1DMT A;  1SU3 A;  3LMC A;  1O0Q A;  1MMB A;  2OVZ A;  1GO8 P;  1Y93 A;  1I1I P;  1JK3 A;  2MZH A;  1HV5 A;  5D1U A;  1GKD A;  1B3D A;  1GO7 P;  1Z3J A;  2OZR A;  1C3I A;  4L6T A;  3WV2 A;  2OY4 A;  3KRY A;  3LJZ A;  3DPF A;  2OXZ A;  1R1H A;  5I3M A;  1SLN A;  3U1R A;  1GE7 A;  1MMR A;  3HB2 P;  2DDF A;  3G5C A;  5D1S A;  2V4B A;  1JKY A;  1S4B P;  1K7G A;  4AIG A;  1ZS0 A;  2QPJ A;  3KMC A;  3EDZ A;  1BQQ M;  1SAT A;  1HY7 A;  4DV8 A;  3EHY A;  3VI1 A;  3I7G A;  1FLS A;  2TCL A;  4XBH A;  1UMT A;  1C8T A;  4WF6 A;  3LJT A;  2I47 A;  1XFV A;  4JA1 A;  1AKL A;  5L7F A;  1K7I A;  3EHX A;  3AYU A;  3TSK A;  3KWV C;  1MMP A;  4H84 A;  1CQR A;  1JH1 A;  2HU6 A;  1HFS A;  4WKI A;  3AYK A;  5CZM A;  1KUF A;  4PKU A;  2SRT A;  3ZXH A;  1IAA A;  1AST A;  3DWB A;  4H3X A;  5I4O A;  2OI0 A;  5JMY A;  1O0T A;  1PWW A;  4GUY A;  2L0R A;  3L0T A;  1UMS A;  2WO9 A;  1QIB A;  1R54 A;  1RMZ A;  1B8Y A;  1CGE A;  3LUM A;  3LIL A;  2POJ A;  1EB6 A;  3DPE A;  2E3X A;  1UEA A;  1CIZ A;  1GXD A;  2K9C A;  1XUC A;  3BA0 A;  5CUH A;  2FV9 A;  2N8R A;  3WV3 A;  4ON1 A;  4I35 A;  1D5J A;  3UVC A;  1ZXC A;  1D8M A; 
#chains in the Genus database with same CATH topology
 4H2E A;  4EFS A;  1K7Q A;  3RTS A;  4AUO A;  1JAO A;  1UTZ A;  1GE5 A;  2ERQ A;  1OS9 A;  1PWV A;  4XM8 A;  966C A;  1QJI A;  5I12 A;  4GR8 A;  4GWN A;  1USN A;  4I03 A;  3TS4 A;  1OS2 A;  1QJJ A;  2Z2D A;  4XM7 A;  4AXQ A;  4PKS A;  1D8F A;  1MMQ A;  4PKQ A;  2OY2 A;  2ERP A;  3EDH A;  5D7W A;  4GQL A;  5CXA A;  3Q2G A;  4WK7 A;  4JQG A;  2PJT A;  1H71 P;  2O3E A;  2XS3 A;  1BSW A;  4GR3 A;  4PKV A;  2KRJ A;  2D1O A;  1IAC A;  4L63 A;  2XS4 A;  1WNI A;  3LQ0 A;  1JIW P;  1BUD A;  1SRP A;  1EAK A;  2WO8 A;  3RTT A;  2OXW A;  3F1A A;  4G0D A;  4JPA A;  1ATL A;  1OO9 A;  3LKA A;  3HBU P;  4FXY P;  1CK7 A;  3LK8 A;  4H30 A;  1I76 A;  1IAB A;  4JP4 A;  4GWM A;  1DTH A;  5BPA A;  1YOU A;  4PKW A;  3MA2 A;  1R55 A;  1PWP A;  4R3V A;  1UTT A;  3LIR A;  1G12 A;  2K2G A;  4G9L A;  4H76 A;  1JAP A;  2W14 A;  1EUB A;  3DSL A;  1SMP A;  2OW2 A;  3K7L A;  1KUK A;  4DPE A;  2OW1 A;  3I7I A;  1G9K A;  3GBO A;  2DW1 A;  2USN A;  3F17 A;  3EWJ A;  2MLS A;  1XFW A;  3ELM A;  4FU4 A;  3B2Z A;  1JIZ A;  3OHO A;  1XUR A;  1BZS A;  3LEA A;  4FXQ A;  3KME A;  4GF1 A;  3KEC A;  2JIH A;  1GKC A;  2W15 A;  1OMJ A;  1IAG A;  4ZR5 A;  5D3C A;  3F18 A;  1I73 A;  1R1J A;  830C A;  2JT5 A;  3KHI A;  4H1Q A;  1JJ9 A;  4Q1L A;  3F19 A;  5BOT A;  4DD8 A;  2Y6D A;  3HDB A;  1XFZ A;  4A3W A;  4L7A A;  3EDG A;  4CTH A;  3AIG A;  2AIG P;  1BIW A;  1XFU A;  1FBL A;  1TVI A;  1BKC E;  4PKR A;  1SLM A;  3VTG A;  2YB9 A;  456C A;  3OHL A;  3TT4 A;  5I2Z A;  3KEJ A;  1YQY A;  2W13 A;  4XM6 A;  1ZVX A;  2AYK A;  1PWU A;  1ND1 A;  1XAX A;  1BKC I;  1XFY A;  1OM6 A;  2W12 A;  2MZE A;  2ERO A;  1YCM A;  2FV5 A;  3F16 A;  5B5O A;  3LE9 A;  1CGL A;  2J83 A;  1IAE A;  2Y6C A;  3P1V A;  2J0T A;  4AYK A;  1AYK A;  1ZXV A;  5D1T A;  3Q2H A;  4ILW D;  1ZP5 A;  3DNG A;  4PKT A;  3L0V A;  5L79 A;  4DF9 A;  1KAP P;  2OW9 A;  4XCT A;  1L6J A;  2DDY A;  3WV1 A;  4IN9 A;  5B5P A;  4IJO A;  1CXV A;  5LAB A;  3HY7 A;  1ROS A;  1FM1 A;  3P24 A;  4HX3 A;  3ZUK A;  1A86 A;  1JAQ A;  3B92 A;  2CLT A;  1BQO A;  1PWQ A;  1KBC A;  1R1I A;  1ZTQ A;  3LQB A;  4WZV A;  3DTK A;  1GE6 A;  1J7N A;  1XFX A;  1KUI A;  2JT6 A;  3B8Z A;  1HOV A;  3E8R A;  1IAD A;  1BKC A;  1Q3A A;  4HMA A;  1BUV M;  4GR0 A;  3N2U A;  2OXU A;  1C7K A;  2CKI A;  4A7B A;  1CGF A;  2YIG A;  2WOA A;  1AF0 A;  5BOY A;  1Y8J A;  1QIC A;  2JSD A;  1KUG A;  1KUH A;  4H82 A;  1A85 A;  1OM7 A;  2RJQ A;  1JAN A;  2RJP A;  4JIJ A;  2O36 A;  1Y0V A;  3HBV P;  3CKI A;  1BM6 A;  5D2B A;  2JNP A;  3HY9 A;  2OVX A;  1CAQ A;  1OM8 A;  4WKE A;  3ZVS A;  4L19 A;  2X3C A;  3LUN A;  4J4M A;  2MZI A;  3HDA P;  3SHI A;  1HFC A;  3N2V A;  2A8H A;  1OZ9 A;  2MLR A;  2OW0 A;  1XUD A;  2W0D A;  4H49 A;  1QUA A;  3HYG A;  3G42 A;  3O2X A;  2DW2 A;  1HTD A;  3USN A;  2X7M A;  1G49 A;  1QIA A;  3TVC A;  2X3A A;  5I43 A;  3LGP A;  3KEK A;  1YP1 A;  3O64 A;  2E2D A;  5H8X A;  3V96 B;  2D1N A;  3LJG A;  4QKZ A;  1G4K A;  1RM8 A;  3DL1 A;  4FVL A;  2DW0 A;  5I0L A;  1G05 A;  1MNC A;  3F15 A;  2X3B A;  3LIK A;  3NX7 A;  1D7X A;  3K7N A;  3EDI A;  4IUW A;  1DMT A;  1SU3 A;  3LMC A;  1O0Q A;  1MMB A;  2OVZ A;  1GO8 P;  1Y93 A;  1I1I P;  1JK3 A;  2MZH A;  1HV5 A;  5D1U A;  1GKD A;  1B3D A;  1GO7 P;  1Z3J A;  2YUF A;  2OZR A;  1C3I A;  4L6T A;  3WV2 A;  2OY4 A;  3KRY A;  3LJZ A;  3DPF A;  2OXZ A;  1R1H A;  5I3M A;  1SLN A;  3U1R A;  1GE7 A;  1MMR A;  3DTI A;  3HB2 P;  2DDF A;  3G5C A;  5D1S A;  2V4B A;  1JKY A;  1S4B P;  1K7G A;  4AIG A;  1ZS0 A;  2QPJ A;  3KMC A;  3EDZ A;  1BQQ M;  1SAT A;  1HY7 A;  4DV8 A;  3EHY A;  3VI1 A;  3DTE A;  3I7G A;  1FLS A;  2TCL A;  4XBH A;  1UMT A;  1C8T A;  4WF6 A;  3LJT A;  2I47 A;  1XFV A;  4JA1 A;  1AKL A;  5L7F A;  1XM5 A;  1K7I A;  3EHX A;  3AYU A;  3TSK A;  3KWV C;  1MMP A;  4H84 A;  1CQR A;  1JH1 A;  2HU6 A;  1HFS A;  4WKI A;  3AYK A;  5CZM A;  1KUF A;  4PKU A;  2SRT A;  3ZXH A;  1IAA A;  1AST A;  3DWB A;  4H3X A;  5I4O A;  2OI0 A;  5JMY A;  1O0T A;  1PWW A;  4GUY A;  2L0R A;  3L0T A;  1UMS A;  2WO9 A;  1QIB A;  1R54 A;  1RMZ A;  1B8Y A;  1CGE A;  3LUM A;  3LIL A;  2POJ A;  1EB6 A;  3DPE A;  2E3X A;  1UEA A;  1CIZ A;  1GXD A;  2K9C A;  1XUC A;  3BA0 A;  5CUH A;  2FV9 A;  2N8R A;  3WV3 A;  4ON1 A;  4I35 A;  1D5J A;  3UVC A;  1ZXC A;  1D8M A; 
#chains in the Genus database with same CATH homology
 4H2E A;  4EFS A;  1K7Q A;  3RTS A;  4AUO A;  1JAO A;  1UTZ A;  1GE5 A;  2ERQ A;  1OS9 A;  1PWV A;  4XM8 A;  966C A;  1QJI A;  5I12 A;  4GR8 A;  4GWN A;  1USN A;  4I03 A;  3TS4 A;  1OS2 A;  1QJJ A;  2Z2D A;  4XM7 A;  4AXQ A;  4PKS A;  1D8F A;  1MMQ A;  4PKQ A;  2OY2 A;  2ERP A;  3EDH A;  5D7W A;  4GQL A;  5CXA A;  3Q2G A;  4WK7 A;  4JQG A;  2PJT A;  1H71 P;  2O3E A;  2XS3 A;  1BSW A;  4GR3 A;  4PKV A;  2KRJ A;  2D1O A;  1IAC A;  4L63 A;  2XS4 A;  1WNI A;  3LQ0 A;  1JIW P;  1BUD A;  1SRP A;  1EAK A;  2WO8 A;  3RTT A;  2OXW A;  3F1A A;  4G0D A;  4JPA A;  1ATL A;  1OO9 A;  3LKA A;  3HBU P;  4FXY P;  1CK7 A;  3LK8 A;  4H30 A;  1I76 A;  1IAB A;  4JP4 A;  4GWM A;  1DTH A;  5BPA A;  1YOU A;  4PKW A;  3MA2 A;  1R55 A;  1PWP A;  4R3V A;  1UTT A;  3LIR A;  1G12 A;  2K2G A;  4G9L A;  4H76 A;  1JAP A;  2W14 A;  1EUB A;  3DSL A;  1SMP A;  2OW2 A;  3K7L A;  1KUK A;  4DPE A;  2OW1 A;  3I7I A;  1G9K A;  3GBO A;  2DW1 A;  2USN A;  3F17 A;  3EWJ A;  2MLS A;  1XFW A;  3ELM A;  4FU4 A;  3B2Z A;  1JIZ A;  3OHO A;  1XUR A;  1BZS A;  3LEA A;  4FXQ A;  3KME A;  4GF1 A;  3KEC A;  2JIH A;  1GKC A;  2W15 A;  1OMJ A;  1IAG A;  4ZR5 A;  5D3C A;  3F18 A;  1I73 A;  1R1J A;  830C A;  2JT5 A;  3KHI A;  4H1Q A;  1JJ9 A;  4Q1L A;  3F19 A;  5BOT A;  4DD8 A;  2Y6D A;  3HDB A;  1XFZ A;  4A3W A;  4L7A A;  3EDG A;  4CTH A;  3AIG A;  2AIG P;  1BIW A;  1XFU A;  1FBL A;  1BKC E;  4PKR A;  1SLM A;  3VTG A;  2YB9 A;  456C A;  3OHL A;  3TT4 A;  5I2Z A;  3KEJ A;  1YQY A;  2W13 A;  4XM6 A;  1ZVX A;  2AYK A;  1PWU A;  1ND1 A;  1BKC I;  1XFY A;  1OM6 A;  2W12 A;  2MZE A;  2ERO A;  1YCM A;  2FV5 A;  3F16 A;  5B5O A;  3LE9 A;  1CGL A;  2J83 A;  1IAE A;  2Y6C A;  3P1V A;  2J0T A;  4AYK A;  1AYK A;  1ZXV A;  5D1T A;  3Q2H A;  4ILW D;  1ZP5 A;  3DNG A;  4PKT A;  3L0V A;  5L79 A;  4DF9 A;  1KAP P;  2OW9 A;  4XCT A;  1L6J A;  2DDY A;  3WV1 A;  4IN9 A;  5B5P A;  4IJO A;  1CXV A;  5LAB A;  3HY7 A;  1ROS A;  1FM1 A;  3P24 A;  4HX3 A;  3ZUK A;  1A86 A;  1JAQ A;  3B92 A;  2CLT A;  1BQO A;  1PWQ A;  1KBC A;  1R1I A;  1ZTQ A;  3LQB A;  4WZV A;  3DTK A;  1GE6 A;  1J7N A;  1XFX A;  1KUI A;  2JT6 A;  3B8Z A;  1HOV A;  3E8R A;  1IAD A;  1BKC A;  1Q3A A;  4HMA A;  1BUV M;  4GR0 A;  3N2U A;  2OXU A;  1C7K A;  2CKI A;  4A7B A;  1CGF A;  2YIG A;  2WOA A;  1AF0 A;  5BOY A;  1Y8J A;  1QIC A;  2JSD A;  1KUG A;  1KUH A;  4H82 A;  1A85 A;  1OM7 A;  2RJQ A;  1JAN A;  2RJP A;  4JIJ A;  2O36 A;  1Y0V A;  3HBV P;  3CKI A;  1BM6 A;  5D2B A;  2JNP A;  3HY9 A;  2OVX A;  1CAQ A;  1OM8 A;  4WKE A;  3ZVS A;  4L19 A;  2X3C A;  3LUN A;  4J4M A;  2MZI A;  3HDA P;  3SHI A;  1HFC A;  3N2V A;  2A8H A;  2MLR A;  2OW0 A;  1XUD A;  2W0D A;  4H49 A;  1QUA A;  3HYG A;  3G42 A;  3O2X A;  2DW2 A;  1HTD A;  3USN A;  2X7M A;  1G49 A;  1QIA A;  3TVC A;  2X3A A;  5I43 A;  3LGP A;  3KEK A;  1YP1 A;  3O64 A;  2E2D A;  5H8X A;  3V96 B;  2D1N A;  3LJG A;  4QKZ A;  1G4K A;  1RM8 A;  3DL1 A;  4FVL A;  2DW0 A;  5I0L A;  1G05 A;  1MNC A;  3F15 A;  2X3B A;  3LIK A;  3NX7 A;  1D7X A;  3K7N A;  3EDI A;  4IUW A;  1DMT A;  1SU3 A;  3LMC A;  1O0Q A;  1MMB A;  2OVZ A;  1GO8 P;  1Y93 A;  1I1I P;  1JK3 A;  2MZH A;  1HV5 A;  5D1U A;  1GKD A;  1B3D A;  1GO7 P;  1Z3J A;  2YUF A;  2OZR A;  1C3I A;  4L6T A;  3WV2 A;  2OY4 A;  3KRY A;  3LJZ A;  3DPF A;  2OXZ A;  1R1H A;  5I3M A;  1SLN A;  3U1R A;  1GE7 A;  1MMR A;  3DTI A;  3HB2 P;  2DDF A;  3G5C A;  5D1S A;  2V4B A;  1JKY A;  1S4B P;  1K7G A;  4AIG A;  1ZS0 A;  2QPJ A;  3KMC A;  3EDZ A;  1BQQ M;  1SAT A;  1HY7 A;  4DV8 A;  3EHY A;  3VI1 A;  3DTE A;  3I7G A;  1FLS A;  2TCL A;  4XBH A;  1UMT A;  1C8T A;  4WF6 A;  3LJT A;  2I47 A;  1XFV A;  4JA1 A;  1AKL A;  5L7F A;  1K7I A;  3EHX A;  3AYU A;  3TSK A;  3KWV C;  1MMP A;  4H84 A;  1CQR A;  1JH1 A;  2HU6 A;  1HFS A;  4WKI A;  3AYK A;  5CZM A;  1KUF A;  4PKU A;  2SRT A;  3ZXH A;  1IAA A;  1AST A;  3DWB A;  4H3X A;  5I4O A;  2OI0 A;  5JMY A;  1O0T A;  1PWW A;  4GUY A;  2L0R A;  3L0T A;  1UMS A;  2WO9 A;  1QIB A;  1R54 A;  1RMZ A;  1B8Y A;  1CGE A;  3LUM A;  3LIL A;  2POJ A;  1EB6 A;  3DPE A;  2E3X A;  1UEA A;  1CIZ A;  1GXD A;  2K9C A;  1XUC A;  3BA0 A;  5CUH A;  2FV9 A;  2N8R A;  3WV3 A;  4ON1 A;  4I35 A;  1D5J A;  3UVC A;  1ZXC A;  1D8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...