4GRAA

Crystal structure of sult1a1 bound with pap
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
288
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFMVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The gate that governs sulfotransferase selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase 1A1
total genus 97
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4graA00
2QTFA 4IFBA 4HSEA 4DDUA 4V0KA 1FNMA 3RC8A 4XWAA 4EPWA 2ZRIA 1E69A 5FI1B 4QG7A 4DLRA 4FW9A 2CL6X 5G40A 1QHNA 2V54A 1SVLA 1CIPA 1S9DA 2ORWA 2BM0A 1GOTA 1XTIA 3TRFA 1DADA 2HLDA 2BJVA 1YR8A 4D82A 2B7CA 1EWQA 3I5YA 1JAHA 1P72A 1U2RA 2F1IA 3VR2A 3BJIC 3GJ3A 3MFYA 2ODNA 2CNWA 3CH5A 2I1QA 4RFSB 3NG1A 1EXMA 1MRNA 1ZNXA 2VHJA 1PVOA 5DYGA 2QAGB 4AKHA 4WZAE 1W4BA 1BKDR 1PLKA 1HYQA 4EKDA 4NYMR 5FTJA 5TMPA 2GDJA 3H0KA 2J9RA 3TQFA 3RS7A 2J0UA 3R9XA 1DAGA 4Q00A 4BWYA 3WNDA 4A0HA 2X77A 2Q9CA 1HUQA 1ZUHA 1VDZA 1VHLA 3ZZTA 2OXRA 3U7GA 3AVUA 3BFVA 2CE7A 2HF9A 2ZI3A 4V0LA 1HE8B 4EFMA 1W0JD 4W5HA 4BLSA 5HKKD 2DHRA 3V00A 1HQYE 2O8FA 3VU9B 5BWMA 2ASEA 4HB0A 4DEYA 3QKRB 4KHZA 2VLIA 1U94A 1ZCAA 3QY0A 1ZMXA 1KK3A 1JQJC 2QQEA 3LLMA 1II0A 4Q1AA 4Q01A 3LLUA 4HDOB 3PITA 4JIMA 4PAOA 3NBZC 2HXSA 2GHIA 4LUCA 4BFWA 4NYMQ 3OIVA 5FPYA 4B43A 2HJVA 3MWYW 1E2MA 1CR0A 2WSMA 2B21A 1VYUA 3BRWD 4C7OA 1OV4A 1KYIA 1RIFA 1I4LD 4TN1A 2WM9B 1AS2A 1S96A 4KVAA 4FXPA 3W6PA 1WBBA 2PZFA 3DEFA 2IUUA 2G1KA 1ZC4A 3TKLA 4POAA 3VR4A 3A1SA 4JL8A 1OYWA 3T1VA 2HJGA 4P4TA 1JR6A 3N70A 2OM2A 2JLXA 5AR1A 4B76A 4PXAA 3EPKA 5F9FA 6Q21A 1SVKA 3A1VA 4DLYA 1ZNYA 2IYLD 2ZUBA 4LY6A 2YWGA 2RKOA 1DTSA 5FBLB 2FFBA 3THYA 2ZYUX 1GL7A 3QUSA 4ZIRB 4KAXA 4DCUA 4URYR 3IBGA 4IOMA 4Q48A 1G3IA 3UG7A 2FFQA 1FTNA 3AP1A 1V43A 4M9ZA 1RRCA 1JBKA 1HT2E 4PZZA 4B74A 3UG6A 1GUAA 1GRNA 1NY5A 3EX7C 2QP9X 2PCJA 2JLQA 4IFEA 1N25A 5E3HA 4IOJA 1N5LA 5J4KA 1NN3A 5EP2A 2FGKA 5EE3A 1PJRA 2PZGA 1ODFA 1YZGA 2IS6A 3PEUA 4M8NE 1ANKA 2ZRLA 2IHYA 1P7CA 1G1MA 2KBFA 3K8YA 3PUZA 4Q1DA 4DUGA 2BDTA 3RDPA 1OH8A 3OIYA 1W5SA 4G5QA 4BFXA 3X2SA 1W36C 2JCSA 1CTQA 4JKYA 1A82A 4Z1MD 4UJ3A 1R6BX 2FSGA 5SZHB 5EZ5A 4GT1A 1WF3A 2OSBA 5JCZA 4AI6A 3JZMA 1MV5A 3OZXA 3Q85A 4EFNA 4C7OB 4EQ6A 3PIRA 1OIWA 2GVDC 4BZPA 3C5HA 2QT0A 3TUJC 2GZHA 1OW3B 3CX6A 4CT4B 3BOSA 1W48A 3B6EA 2JJ8A 4OJQA 4Q4HA 3ZD7A 4KFUA 2VF7A 5CJ2A 4MUBA 5JJLA 1M1YE 1C9KA 2WJVA 2IS1A 2ZJ8A 3SBDA 3WRYC 5L3VA 1F2UA 1SULA 3CR7A 3LQRA 2FV8A 5M04A 2FJUA 3OF5A 4F38A 1M8PA 1KNXA 1XPOA 4DB2A 2R6FA 2AKYA 2J59A 1DO0A 1F48A 1TX4B 4TL9A 2BOVA 2CCGA 4CEIA 4BGDA 1X1SA 4A1FA 1MO3A 1OFTA 5FPSA 1NI3A 1VCIA 3PEYA 5KTYA 1W47A 2ZQ5A 4NCNA 1UBCA 3TVTA 4PC2A 4FIDA 3KQLA 4M22A 4JL6A 4MGIR 2QG6A 1OFIA 1R5NA 3NHAA 1Z29A 3GLIA 2YINC 2BCGY 3BIFA 1XXHA 5FUWA 5KSOA 1E2NA 2YC4C 4B48A 5C4MA 4HAVA 2BHRA 2KB0A 1E9AA 1LS1A 4F91B 3IBYA 4L4UA 5JEEA 1KDPA 4Q5IA 3UWKA 2WVJA 1EESA 4B32A 4PO8A 1YE8A 2C5LA 1AGPA 1I4DD 5GJWC 2P65A 1IQPA 5KSYA 5DN6A 3J81k 3IKJA 4Y0AA 1AQUA 2VSXA 4JJKA 3TUIC 1EX6A 2JA1A 1GKUB 2NG1A 1ZM7A 4JLNA 3OAAA 1E79D 1QHIA 4C2UA 2WAYA 2CBZA 4MYTA 3A1UA 3B7GA 1MABA 4Q9LA 1Z0AA 1NVUQ 3TW4A 3IDQA 2XNDA 4D6PA 5JEDA 4FINA 3KFVA 2J45A 5CDFA 3DM9B 3LDAA 3I73A 3L82B 5IF9A 2ZJZA 4TMZA 5JHHB 3U4QB 1X8JA 2P2LA 1E2HA 4E22A 3SS8A 5KNBA 2O8FB 1KY3A 4IXMA 2PMKA 3K0CC 3CPHA 1G17A 4ZPXA 2MMGA 3UATA 3DMNA 4DLTA 3EZ9A 2GETA 2ZSAA 1NKSA 1SXJA 4GP6A 2IT1A 3CKLA 4PZYA 2BMDA 3CRQA 5E4FA 4B3GA 5AUOB 1G6OA 1U81A 5J47A 3GFTA 1YR9A 2Q3HA 1GSIA 2FMXA 3T1QA 4UXHA 2X2EA 4NL4H 4TZ6A 3CWQA 5L8VA 4KYUA 4Q1EA 3LO5A 4NCHA 2ZREA 3AKYA 1N6HA 2P67A 3GJ6A 2J3EA 4RFSA 3AEZA 4P4SA 2ZRAA 5SZKB 2FPKA 4D4JA 2QP4A 4K8OA 5JFGA 4A9AA 1YRAA 4FMDB 1Q44A 4QFMA 2JLWA 2NO7A 4GL2A 2ATXA 4HB4A 3KJIA 1T3HA 3GJ7A 1RRFA 1XCGB 2WJIA 4D4KA 3L0PA 4EIWA 3MCAA 4Q7KA 2PEZA 2ZAMA 4Q1CA 5TVKA 3TSWA 2JLZA 4PC3A 2PCLA 1G3RA 1L8QA 1N6KA 2O8DB 4BLQA 1UBGA 1VIYA 3EIHA 3KKNA 2H92A 1WMSA 3EASA 5FBWB 2FPMA 3VQTA 4N3NA 4DT1A 1MH1A 2I3BA 2ZR9A 1G4AE 3A4LA 4JMPA 1G41A 2QUZA 3QENA 1A7JA 2G77B 1J8MF 2BM1A 4CZ2A 1TQDA 4WW0A 1HE1C 1LB1B 2ONKA 4LOAA 1E2KA 2ATVA 2VPPA 1WE2A 4X8OA 4DUGD 1FMJA 3F3YA 5DISB 4FCWA 2XZPA 4JVMA 3ZS9A 1XD8A 3GLHE 2D7DA 3TQCA 2O8EB 4A15A 2E1RA 2VP6A 4AG5A 1IJFA 3EZFA 3IHLA 2RB4A 3WMGA 5KNDA 3TK1A 3KQNA 3NXSA 3C41J 1HEIA 4XWOA 4IVPA 5B64A 3UK6A 1NVXQ 1NN1A 4OL0A 4OHVA 3WMEA 3CW2A 2W83A 1UKVY 2HYDA 2Q9BA 2FWRA 3B85A 3CH4B 4OJKA 3SJBA 4MQBA 1RYHA 2EFGA 3QXJA 4MKFA 4B34A 1BMFA 1XCPA 3VTKA 2QPOA 4YMTA 1YZKA 3D8BA 2XZOA 4URVR 1LY1A 1OPXA 3QXCA 3L8ZA 2R6GA 2WWFA 1MOZA 2AWOA 4DXAA 1W4CA 5KO2A 1J99A 1ONBA 2OG2A 5DGXA 1IM2A 2QZ4A 1FFHA 4NYJQ 4NYIQ 4PPQA 4XVRA 2DWPA 2X8AA 4OBEA 3AVPA 5HE8A 4GPTA 2ZAOA 3DOEA 3W9YA 2P6UA 1NLZA 1BS1A 1XRJA 3KUCA 1P75A 1LFDB 1E94E 2VEDA 4PC6A 1EFRA 1ZM2A 2WPDD 1QRAA 2QE7A 4V0ME 2HV8A 3QXHA 1CU1A 1W7AA 4A6PA 5BN4A 1JI0A 3DPUA 3CUEF 4RD2A 1AZTA 3QG5A 1XMIA 5FPHA 4MGYR 3PUYA 4HLUA 2OBLA 2VP4A 4UNPA 3OFND 2H1LA 2W00A 1JB1A 2F1RA 5DI3A 2Y8EA 3EAQA 3WNBA 4CEHA 1N6LA 4IHQA 4D26A 4HATA 4XVUA 1R2QA 2DY1A 1L4UA 3PG5A 3B82A 1D8TA 4M21A 3IO3A 1KGDA 4A2PA 2FH5B 2VSFA 2ZYTX 3KX2A 3SHWA 5CDFE 1D6JA 4HI0E 5KDDA 2IYQA 2GZDA 4WVFA 5CYOA 4GRAA 1ZIPA 3K9NA 3KL4A 2ZI9A 1D2MA 4QXAA 2GBLA 3E1SA 3C14C 2ZRJA 2YZ2A 2OCPA 3K9HA 1WDTA 1GWNA 3AF4A 4NP6A 3OESA 4DHEA 2HDNB 3IQWA 4G5GA 1D9XA 5FL7A 1LV7A 2Z43A 1XBTA 4QGFA 4C0QC 3U4QA 3D31A 1Z6XA 3R9IA 3KZ1E 2BEKA 4QJ4A 2C8VA 2JATA 3QPVA 2OESA 4MDEA 1FNNA 4C2TA 3BWDD 1FUKA 2VHCA 1TEVA 1E0SA 3B9PA 3KJHA 5SZJA 3ZIAD 1R5BA 2EFHB 1SHKA 2CHQA 3BH0A 5JCPA 3AGPA 5FOWA 1QHYA 4PQFA 5C4GB 2I1VB 1IXZA 4BFSA 4IDPA 1II8A 2QEQA 3K1JA 5CIWA 4PHGA 3KFXA 4DIEA 1XD2B 4BFTA 3KTAB 1H8HD 1ZM3A 2AKAB 4P4SB 4IVQA 4AWXA 5A0FA 4BASA 1N5IA 4DLVA 3FMFA 2IXFA 5HE9A 5FOUA 1Q22A 1K6MA 4MRSA 4TYYA 2G88A 1SQ5A 4TYNA 3HDTA 3LXRA 3OEHD 3JVVA 2D2FA 4GNKA 5JS7A 3SQWA 2RGAA 3N2IA 2NQ2C 2XOKA 3AUYA 4ITRC 4JZKA 3C4JA 5KSPA 3KUDA 1EFRD 2WPDA 3W3AA 2FG5A 1FQKA 3NDBB 4I1VA 2DFKB 4US2R 1DVRA 4M9QA 2GCOB 4KXFB 2QI9C 4OI4A 1H8EA 3B8HA 1NP6A 3PFIA 3BFXA 1S8FA 3UWOA 3K09A 5AJZA 2OLJA 4OHYA 4ABYA 3THWB 4O0MA 3AVQA 4TTQA 4DWJA 1G8PA 4TLAA 4BZQA 2EWWA 4MKIA 4D0LB 3REGA 2O0HA 4B44A 5JBQA 1XJCA 3I61A 1E0AA 4QBFA 3P32A 4HZIA 2A5FA 1P2SA 1ESNA 1NBMA 5JWRA 2CJWB 5JZVA 1G20E 5JRZA 3FMPB 3I3SR 4Q18A 3CWZA 2O52A 4NTZA 4QC2A 2CDNA 3WY9A 4ZI2A 4W5JA 2EFDB 3Q5DA 3QVUA 4LHWA 1Z2AA 1KI4A 3GLFB 1F60A 3FMOB 2JLYA 2YV5A 4BRUA 3OHMA 4G01B 3SU8A 4R2IA 1Q12A 2AR7A 1JQLB 4TSFA 4Q03A 4EQ6B 1UEIA 3A37A 4RFVA 1YR7A 3O8RA 2AD5A 3HYTA 1IN7A 1E2EA 2CCJA 2FF7A 4LBZA 4Q4JB 2GXUA 1OIXA 2QTHA 5J4VA 5JMTA 4LC0A 3NWJA 2ZYWX 1TF2A 1J8YF 3N5CA 1N0WA 4QGGA 2PT5A 4HZUA 2NZJA 4NDZA 4CT5A 3OEEA 2QSZA 3NH6A 3Q72A 3AF3A 5CJPA 3ZIAA 1DS6A 2WIBA 4JKIA 1CJKC 3K9LA 3PEWA 2ZU6A 4AY2A 3LFUA 4JBWA 1Z06A 4HEJA 1HA3A 4K81B 1VHTA 2WOOA 2W2XA 2G83A 2BMJA 4KBFA 2Z0MA 1SVMA 2OFWA 3CRW1 5EE0A 3BH7A 2HXYA 2ZR0A 2QM7A 2ZRFA 2UZ3A 1DPFA 4PHFA 3TNFA 1DAKA 3QF7A 3IEUA 3H84A 2GEVA 3BORA 1TQ2A 2FEMA 3QOFA 3WHKA 3ZDQA 2YKGA 3NTUA 5AJVB 3B5JA 2ZRBA 4MYCA 5KYKA 3ICEA 3X1ZA 4PO1A 3GJ0A 3F8TA 1COWD 1PV4A 3SYLA 1KKMA 5EE9A 2Q9AA 4P3YA 1CULC 3CX8A 3BD9A 2K5UA 4RKEA 1KK0A 2JIZD 1ZP6A 3IPYA 5LD2B 1P62B 2A78A 3CF2A 1E1QA 2IA5A 2RGEA 3AF0A 1G5RA 4Q9HA 2ANBA 2HF8A 4UXIA 1R0WA 2P5SA 2ZROA 3MJRA 3FKQA 1N3BA 4B2LA 1F2TB 3U6KA 4OKSA 3BH6A 4FI3C 1Z6TA 3A6PC 3QEJA 1J7KA 2DBYA 4Q4LA 2BBOA 4HAWA 2R6DA 3LVRE 4CYMA 4UNRA 1L2TA 3CZPA 1N6PA 2GJSA 1T5IA 3ECCA 4GDFA 1OHHA 5BN3A 3TSZA 4KFTA 1AA9A 1R0XA 4ACBA 2W0SA 3A1TA 1W2HA 3B60A 5IDVA 1AKEA 2WIAA 3ZZUA 1TUEA 1XP8A 4RD4A 3MMPA 2Q0HA 4DSUA 3MLEA 3AVVA 3KKQA 4KV9A 2R62A 2HCJB 3LWNA 1ZUNB 2EYQA 2IYRA 4FMBB 3VR3A 2P6NA 1QG2A 3QF4B 1EFCA 2ODBA 2PT7A 1AN0A 3LW8A 3PENA 2YWFA 2W6JA 1XEWY 2ZE6A 4ZIRA 1CRPA 4M1TA 4JLAA 2BBTA 3KKPA 1EK0A 1EWRA 1Y63A 3O8CA 3FOZA 3UPUA 2W6IA 2F3RA 2QPAA 5FOXA 5EJEA 2J87A 2ERXA 2C98A 5J4HA 1S0UA 2FN4A 4XSHA 2V7QA 4GMDA 4LPSA 5AJWA 1D9ZA 3BFKA 3LY5A 2JJ2A 4URUR 3R7WA 1KTVA 5B57C 2RCNA 1KMQA 4HDQB 2ZIAA 2IWHA 3T06B 3U3RA 1KI2A 3K70D 1Z22A 2QAJA 1XTQA 1T3SA 2EWVA 1QHSA 1GAJA 1G9XA 1ELOA 2NTYC 1FTSA 2FSIA 5JLJA 3E2IA 5L3SB 1AJEA 2OBMA 4Q7JB 1U90A 2HT6A 4NBSA 5FOVA 4B73A 2A9KA 4NE2A 1Z6YA 1XPUA 2AWNA 4JLKA 2PZEA 1DELA 3OAAD 4BLOA 4YMVA 4AURA 4LJAA 2RGNC 4Q9IA 1E4VA 4N0DA 4A0GA 1KI8A 1A2KC 3WXMA 3DZ8A 2MSEB 5DSZA 1X8LA 4GMXA 4L16A 8OHMA 4Z8YA 2O0JA 4C0JA 4OI1A 3I72A 3RS3A 4HAXA 1VG8A 1UF9A 4UNSA 1UM8A 4KFSA 1XPRA 1QDEA 2R44A 1XTKA 4U00A 2WJYA 2XJ4A 1XMVA 4XOIA 5TXGA 1ZM4A 4TYPA 2FPLA 4DEXA 3TSOA 3LW7A 5CM9C 1VYTA 1NY6A 2YOGA 1F5NA 5DIFA 1YZTA 3SJAA 3U7FB 2OCYC 4NCKA 3MUFA 1KO1A 1RZ3A 4ZDJA 3DKVA 3M6AA 5KPDA 2QM8A 4Q7MB 1G5TA 3LBNA 4DBLC 4EUNA 4DLXA 4CVNA 1DG1G 4L8GA 5CK4A 3CRVA 3DHWC 1C4OA 4OK5A 5H1YA 1YZUA 3AP2A 4B33A 2O8BA 5H70A 1P3JA 4L15A 1NLYA 1EFUA 3P27A 1G3QA 1RVDA 4PO9A 5DHFA 4IRUB 2VH5R 5HZHA 1W49A 4RD1A 4TL8A 1E9BA 221PA 4U7DA 3DZDA 2O8CB 1NMXA 4PAQA 5D3QA 3S1AB 2DB3A 4XIGS 2OHFA 2VF8A 2FU5C 1G8FA 5B58C 1XMSA 2H17A 2J0VA 5J4LA 1E99A 3HPRA 5FTKA 2OAQ1 4HLQB 1G18A 3ADCA 2IYXA 4JLVA 3KKMA 4ERNA 3GLHA 2F6RA 3RNLA 4H1VA 1ZAKA 3RLFA 4DCVA 2BIFA 5JECA 2J0UB 2DWOA 1P9NA 3PQCA 4CEJA 3ZYCA 1Z28A 4YONB 3JZAA 3QPWA 2AFIE 1VCNA 1XF9A 5CIQA 4RZ2A 2B8WA 4ZCMA 2RGGA 5FI0B 3U3MA 4R9UC 2XZLA 1DAFA 1ZNZA 4LJ5A 1UPTA 1VG9B 1CJUC 1CRQA 2KI5A 1ZW6A 2AXPA 3RAPR 5KNCA 5FBRB 3H1TA 4TL7A 2YOHA 1WBDA 2LKDA 3U6BA 4HAZA 1II9A 2ZJ5A 3R8FA 4M1YA 1QVAA 3CLVA 4NH0A 4M1SA 5CK5A 2ZJ2A 4LYAA 1NKTA 2IS2A 3ZH9B 1VG0B 4Q4HB 2YC2C 3QXXA 2ZUDA 2A5JA 4YDHB 4X8HA 3UKDA 5F9HA 1MT0A 4W9MC 2ZRCA 5P21A 4YMUA 3IILA 2JDID 2R9VA 1DBSA 1J70A 2C9OA 4HB3A 2ZS8A 4GZLA 1XD2A 4JVLA 2FGJA 4MKGA 2LWIA 2YYZA 1X1RA 2GEUA 5LB4A 1CJMA 1XMJA 3L0SA 3I32A 4LV6A 3VX4A 2JLSA 1I2MA 3RRZA 3KQKA 2DFNA 1FL9A 2DFTA 3BBPA 4IDNA 2NO0A 3K9GA 4XTCS 3FKSD 1JR3D 1CXZA 4JVSB 5FTNA 3BXZA 4XJXA 1EX7A 4WXRA 4AIIA 1W5TA 4LBYA 3ADKA 2IEYA 2AX4A 3IPXA 2W2TA 3KQUA 4OI0A 2PLFA 1I2DA 2QMUA 1ZC3A 1LNZA 2V8OA 1H8HA 2HLDD 1AK2A 2YNMA 4QOSA 4ACAA 3LBHA 2FOLA 2JJ1D 1D2EA 4F4IA 4URXR 3G0HA 1ZNWA 2J0QA 2CNWD 3RANA 3ZVRA 3K0AB 3WYFA 1RFLA 2V7QD 1EG7A 3OEHA 4MYUA 4AD8A 2OUKA 4LYJA 3RRMA 3ZZ0A 3GP8A 5LB2A 2PMDA 2AD1A 1KOFA 2XTMA 1H65A 2NPIA 2NIPA 4OQXA 4OK6A 1TF7A 2IX3A 3GJXC 1K5GA 1NLFA 5EUQB 2ZI7A 4RCZA 4WXPA 2NMVA 1YZNA 2AXNA 4YLGA 3WHLA 3P26A 4D4MA 1VTKA 2QPTA 2ZE7A 1FMLA 1NIJA 2ZVQX 4ZCIA 4QBHA 5FUYA 3D7MA 1ZUIA 3SJZA 1R8SA 1S2MA 2J46A 4Y0VA 2G6BA 1GG2A 3OEED 4O25A 4R71A 1WB9A 2ZYVX 5D3MB 1R0YA 1IY2A 3L0OA 4BPBA 1QHHB 3CB4A 4PHTA 3GLGE 4JBYA 3KJGA 3NKVA 3Q7QA 2FX3A 1VG1A 3GLFA 1AGRA 3WBKA 3W5JA 1U98A 4TYWA 4M2LA 1US8A 1Z0FA 3ND8A 2VBCA 3KQHA 5LBIA 2GVZC 1MKYA 4EPYA 3ADBA 1KMHB 2GRJA 4LDJA 1SKYB 2LKCA 3O8BA 4ZO4A 4PTLA 1P2UA 2ECKA 1XXHE 2LCFA 2IYZA 1NBME 1TU4A 2C77A 1RRPA 1N6IA 2J7PD 1E1RA 3G82C 4HUQB 2WTUA 3THXA 1GNPA 1NN5A 1UJ2A 3U61B 3BAFA 1EGAA 1E4YA 2XTNA 2QMEA 3A4MA 3HU1A 3Q5EA 3CONA 4RJLA 4QBIA 5EXSA 5IRCD 3SQXA 2B92A 1NRJB 2N42A 3U5ZB 3K0AA 3EZ6A 2ZJOA 2CVFA 4NYJR 1HH4A 5FUXA 2CE2X 2BVNA 4US0R 5IHPA 4OQLA 2XAUA 3QKSB 1OFHA 3DDCA 2GA8A 1YVDA 4M53A 3IIKA 4NONA 3GJ8A 1QF9A 1YR6A 5DI3B 4BLPA 3PXGA 4EFLA 1E9DA 2ZR7A 4XD7A 3THYB 5H8WA 1BYIA 3PUWA 5HPYB 4TLEA 5TY0A 4E07A 2B8TA 1W2GA 2IC5A 4L9SA 2VP0A 2C03A 3TAUA 1UAAA 3X1XA 1HT1E 1O87A 4TYQA 2WKPA 2ZM5A 5CB8A 1Q3HA 4RD3A 1D2NA 1NVWQ 2WWIA 4QBGB 1T91A 4DT1B 3NBXX 4NCIA 1E0KA 1XX6A 1E9SA 4BFYA 4TTRA 3VHXA 1AS3A 2GBLC 4PPFA 5JI3E 3SN6A 3F0TA 1SXJE 4HLCA 3W5IA 4V0MA 4B75A 4MITA 2GAAA 2WWXA 2GF9A 3CF6R 5EXXA 2IK8A 3HR8A 4LJ6A 3T1TA 3K0CA 1SVWA 4BQSA 1Z0JA 2UKDA 2GILA 5FBVB 3RS0A 4XH9B 4A6XA 5G3YA 3ZS8A 1VKJA 5D3MA 4EPVA 4LHXA 4PAMA 3CRRA 4IXNA 1DAMA 1W4AA 3VFDA 4B3FX 2G0TA 1E9RA 4RSGA 3SC3A 2JGNA 4Z54A 3CIOA 4KYIB 1WA5A 3G5UA 1KI6B 3VNUA 1ZM9A 3B13B 3H2YA 3MGCA 1JJVA 2R6CA 3DMDA 2QAGC 1PLLA 4V02A 3E5HA 5GJVC 2QGNA 1P9RA 2G1JA 2JLRA 5J40A 1E9EA 4GOKA 1DE0A 2PBRA 4BFUA 3H4MA 4O2RA 3GEEA 2ZRHA 1ZYUA 1FZQA 4KBGA 4NHOA 3QSYA 1AS0A 2XNSA 4RZXA 2RGXA 3A8TA 5DH9A 1PUIA 1OF1A 3D6TB 4A36A 4TT3A 2VRWA 1G5PA 3B1VA 2J7PA 2AN9A 3UXMA 4V0NA 2ZITA 4HZUB 3R8CA 2WSSA 1S9HA 1BO6A 1W0KD 2ONJA 5AUQA 2V1XA 2HEIA 1TQ6A 1S4QA 3SZRA 5B30A 3OE7D 2PX3A 2N46A 1KO5A 2BV3A 2IWRA 2RHMA 4A4DA 2ZSEA 2D06A 1SVOA 4DSNA 3QI2A 2G0NA 1OB5A 1PZNA 4KSCA 2D62A 4LJ4A 4US1R 1WCV1 1ZIOA 2IYYA 2ZI6A 2BWJA 3I8SA 2ZRNA 5BXQC 2XB4A 1ETUA 2ZANA 3PJRA 2UZIR 2GXAA 2RGCA 1Z83A 2FE4A 2CJWA 1F3OA 1X6VA 4DCNA 2IXGA 2F3TA 1R0ZA 1Z8FA 1V5WA 1N6NA 3NBFA 5FTMA 4XWKA 1TU3A 3NVAA 5JWOA 4CW7A 3U7EB 3U3KA 2DR3A 5CLQA 3CPJB 1JPJA 3SBEA 2TMKA 5UKDA 3I8XA 2HT1A 2GK6A 3L2OB 1IXRC 4IOLA 4KO8A 1N2CE 4P32A 4RD6A 2MMCA 4YXWD 4MDFA 1EFHA 4UJ5A 1D5CA 2CK3D 4ESVA 3EPLA 2EQBA 4EPXA 1Z0DA 4B47A 1DO2A 1U8ZA 2WWGA 3TIFA 2QBYB 4LPKA 2N1BA 2R8RA 1FX0A 1KI1A 2QL6A 1KJYA 4B71A 4QL3A 1Q1QA 4AKGA 1DG3A 1HQCA 3AKCA 4BFZA 4HUTA 1MO6A 1TTTA 5JJKA 1ESMA 1ZD8A 3GJ5A 2GJAA 4PR0A 2B7BA 4C0LA 3H86A 3MWLA 5DHAA 3LX8A 4ZCLA 2HYIC 3ADDA 2PJRA 2IBMA 4QHTA 4EPRA 1TPZA 4Q7LA 2H16A 1HV8A 2GZAA 5GJCA 5GJBA 1AKYA 2IF2A 2BCJQ 1P73A 3C16C 3FVQA 2FZLA 1OH7A 2BC9A 4L9WA 4Q1BA 3AF1A 4A92A 1C1YA 4HAUA 1CJVC 2A5GA 1UKYA 2V4ZA 1J90A 1GRQA 3Q7PA 1A4RA 1ZJ6A 5KDOA 3GPLA 3LA6A 3RWOA 4LSGA 2ORIA 4C9BA 2XXAA 2EU8A 1JR3E 5KU1A 3I5XA 4NZYA 1II8B 1B23P 2RMKA 2C2HA 4FWIB 2I4IA 3GFOA 5EP4A 4C4PA 4HB2A 4ZKDA 1A5TA 3EW9A 3MRSA 3O47A 2GEDA 1GVNB 1U0JA 2FSFA 3MD0A 4LJYA 1O3YA 4TMKA 5JJIA 3A36A 5LDDC 4TMTA 3RC3A 3TJZA 2XITA 1CR4A 1T4GA 2F7SA 1W46A 2ZSBA 3NHBA 5DE3A 4II7A 3LVQE 4WZBE 4AG6A 4CDGA 2QRNA 2FEOA 4QGHA 2QE7D 5BYKA 1VIAA 4CRWB 1M34E 4DSOA 1XU4A 4TMVA 3QKUA 3P4YA 1M2OB 4KJZA 2XSZD 3U3OA 4U5XA 1Z63A 1Z3IX 1E9CA 4CEIB 1QBKC 4FMCF 1BYUA 5BYJA 1YQTA 5HZKA 1GFIA 5F2EA 3DO6A 1P9WA 1K8RA 4WIAA 3THWA 3IIMA 4ARZB 5AJYA 1S3SA 4P31A 1E2FA 5C2JB 1XTRA 1N6OA 3ND9A 3SNHA 4DC9A 1S1CA 4TL6A 3EC2A 2AHOA 4E03A 3PCRB 4XSGA 2ZSFA 4S35A 4YDSA 3SJCA 2IHBA 1UKEA 1SKQA 3LV8A 3BB1A 3E70C 1T8UA 1IHUA 2EYUA 2WWYA 1XTSA 4PHHA 1GP2A 4IOKA 1FP7A 5EQTA 4G5SA 1SHZA 1VCOA 5A4JA 3B1YA 3AKEA 1W36D 2VO1A 4XTRA 2GXSA 3P1JA 4IEEA 3V4FA 4ASUA 4DRZA 1VPLA 3Q9LA 3UIEA 4QM7A 1IN4A 4YMWA 1Z2CA 1CR2A 4PQRA 5C1BA 1OKKA 5CYPA 2G9NA 1F2TA 2V55B 1IOZA 3Q3JB 3FHOA 1TAGA 1UKZA 5TDHA 2GWHA 3FFAA 4D4LA 1E2QA 3ZQJA 5FFMA 3B1XA 5AUPB 1P2VA 4CIDA 4WOPA 2REOA 4KU4A 4OHXA 4HDCA 1Z6AA 2IYWA 2ZETA 2F9LA 3OFNA 2ZU0C 4HYYA 5C18A 3ZD6A 1UFQA 2BMFA 4IVRA 3VKHA 2CHGA 2H8KA 5EUMA 4Q21A 3EA0A 1E96A 2NZ8A 2B6HA 2DPXA 1UDWA 2ZJYA 1JPNA 3GLIB 3X1WA 4LJ9A 3CO5A 3CPEA 1Q3TA 3PUVA 1XEFA 1KHTA 4MRRA 1ZBDA 1GILA 2WZQA 2ZI5A 4DDWA 1RJ9A 5AWFC 1XJQA 4A8JC 2ZS9A 4UQOA 4YMSA 1WRBA 1DAHA 2Z6VA 3X1DA 4EJSA 1W0JA 1GL6A 2RGNA 4HAYA 521PA 4RD0A 4DLSA 3ZQ6A 1R5OA 2V1UA 1M6NA 4DLZA 4CGZA 1YHNA 2FFHA 2XSZA 5KUTA 1Q0UA 2J5XA 1FW6A 4CEHB 4DDTA 5FUVA 5EE5B 1E1RD 3HJNA 5H68A 3ZLJA 2PL3A 5LPNA 1SXJD 4C0BA 4BUJA 1M7GA 5TARA 1OH6A 5J4YA 4NCJA 3IQXA 3HP1A 4OQNA 2ZXUA 4RZ3A 3GLGA 1KMHA 121PA 1KK2A 1IY1A 3B9QA 3TLXA 1A2BA 1G64A 1TL7C 1US8B 2JIZA 3EARA 3KXIA 2ZE8A 5JS8A 4U02A 2W2VA 4IDOA 4D80A 2NO1A 4UNNA 3FE2A 4D81A 3LQQA 4PSVA 4AKIA 421PA 2KBEA 2REXB 2RH5A 2P0EA 1VCMA 1VECA 5JWHA 2FZ4A 2O8BB 2OLKA 3RSOA 4OI2A 3TR0A 2H5EA 1XB2A 3HR7A 5CM8B 3WRXC 4LC1A 4MRVA 4Q4AA 1WP9A 4GP7A 5EXTA 1E3MA 1X8KA 1S1MA 1UEJA 1RJ9B 4PSAA 4Q02A 3SEAA 1L4YA 1ZINA 3LAWA 3QBTA 4GSYA 4JLOA 4F4CA 4F92B 3QNUA 4LBVA 3BERA 1YJ5A 5BQ5A 4LHVA 1KNQA 2RGBA 1XDBA 3K70B 4OK3A 2A7QA 1E0JA 1H8ED 1OJLA 1UBEA 3EZ2A 3ASYA 1T9HA 2QGZA 1U8AA 4C0HA 1GZSA 1K5DA 2OT3B 2QENA 3KXLA 2CLCX 5IK2D 5K8LA 1NG9A 4E09A 3CX7A 4RCYA 821PA 5B2ZA 1DAEA 4TMWA 2FNAA 2J41A 1E32A 2F43B 3CRMA 3QJYA 1ZU4A 2X1VA 2ZRDA 4JLMA 1P6XA 5AJXA 1X86B 4YXWA 4A2QA 2H18A 4M0LA 2WOJA 4I81A 3TW8B 1Q1ZA 4JLDA 4B35A 4DCSA 4G3XA 1FUUA 4JYCA 3RHFA 3U2QA 2XEXA 2IUTA 1KY2A 3CM0A 4F93B 3T5GA 3QQ5A 4BE7B 3W6NA 3KKOA 2QY9A 4FN5A 4WA7A 1B0UA 3EG5A 3FDIA 3EC1A 1GM5A 3ASZA 1CR1A 4JBXA 1BIFA 1JALA 4PPGA 2VP2A 4IJMA 3VNVA 1KZ7B 4LYHA 1NSFA 4P4UA 5CB6A 3IEVA 3T15A 3FHTA 1OXTA 1KJWA 3NEYA 4RY2A 2GK7A 3NEJA 3DOFA 1U0LA 1N5KA 4B6FA 1DAIA 4QNMA 1AZSC 3F5FA 5TB5A 4TLDA 1IAQA 1JECA 1TEXA 4A8JA 4NMMA 721PA 1IONA 4FMDF 1LTQA 1QHHA 3AUXA 3GEHA 3HU3A 1Z08A 4LI0A 5FL7D 3AH8A 2IYVA 3RRYA 2VHQA 1GNQA 5ELXA 2GAOA 2QROA 2Q3FA 2YWEA 4BZXA 3VR6A 1NN0A 2OCAA 2CL0X 1Q57A 3ONWA 2OBNA 5KSZA 4C30A 1KI7A 3VHLB 5BW8A 2XGJA 2OZEA 1NMZA 5A5GA 1XEXB 5CITA 1SZPA 1G291 1OYYA 3B78A 2VHUA 1JEDA 1SVIA 4PQYA 2KJQA 1U9IC 4TQUS 4LGMA 3AB3A 2YVUA 4JSTA 3HWSA 5GADl 1Z47A 2BJWA 4Z1MA 4TT3D 2WWWA 3ETLA 4TQAA 5JSZB 1KI9A 4EDHA 1G6HA 1Q1EA 3U3JA 5DN6D 1P4SA 1RYFA 4H9GA 3T5DA 3EPJA 4JLJA 1TMKA 3X1YA 4GBMA 1M7BA 1RRGA 1LF5A 3B1WA 3QPUA 3RVBA 4Q66C 1KZGB 1N0UA 4JL5A 4JJZA 3KTAA 3PUXA 4A82A 2MSCB 2GESA 1KI3A 4Q1FA 4B2IA 1SXJC 2JEOA 1CJTC 1NG1A 1R10A 2WMNB 4AKEA 1ZCBA 3QXSA 4AK9A 4DSTA 1W4RA 2P3SA 1T5LA 2ZS7A 1E6CA 2GXQA 4JT2A 1Y3AA 2A2ZA 1ZVQA 3W8NA 3OIUA 4ZKEA 2ODWA 4B3CA 1N0VC 3LNCA 2A5YB 1CKEA 2A30A 1KAGA 1KKLA 3K0FA 2ZUCA 3WYAA 2WMOB 2GTPA 3C7KA 3FMIA 4QJ5A 1RW4A 1YZLA 3BB4A 1XEXA 1FX0B 5FR1A 3KJEA 4LK2A 3LBIA 2ERYA 4TLCA 3UMFA 5EP1A 3WNCA 3A4NA 3MG9A 3LRPA 2HUPA 3LH5A 5DNYB 3C8UA 2IF0A 1W36B 4KITB 1JR3A 1XCMA 1G21E 1KK1A 1SKYE 3GCGA 2XJ9A 5FH9A 3FWYA 1G7TA 3NBYC 2QU8A 5E95A 1IN6A 4HUQA 4JYBA 5ANRB 2D74A 3FPAA 3BC1A 4OHZA 3THXB 1IBRA 3AKDA 2J0SA 1U9IA 2V6JA 3AF2A 3FHCB 2E9SA 1BMFD 2KSQA 2V6IA 4Q19A 4AC9A 4WBSA 1CS4C 2XNDD 4IEIA 2F9MA 3GEIA 3TR5A 2O8EA 5F3WB 4TLBA 2GNOA 2ODEA 2RHDA 4QRHA 2R6AA 5L3SA 1G7RA 1DARA 2VA8A 3OE7A 2C04A 4A2WA 3U44B 2JLVA 3EPHA 2Z4SA 1QG4A 1YRBA 2CCKA 4OYHA 2QQ0A 4B2PA 1T0HB 4MRPA 1G7SA 3EA5A 2NPFA 3A1WA 4LRWA 3CNLA 4EPTA 1XZQA 2R2AA 1G19A 4S2EA 5JRJA 4RZUA 1A1VA 3TVDA 2BKEA 5G41A 4JLPA 1OE0A 1AIPA 3QKTA 2D2EA 5JI2E 4JT4A 3P4XA 4JLBA 5K8TA 5AK0A 2O8DA 4IW3B 4UXJA 1G4UR 2GCNA 3WYGA 2C78A 5DYIA 1E2IA 3VU9A 4QHYA 3EIEA 1KAOA 2WV9A 1IXSB 2Q6TA 2WAXA 2Z4RA 5K8UA 1OHHD 2VSOA 3QIAA 3QBVA 2EVWX 2RGDA 5EZ6B 4TSFD 4TWZA 1I4TD 2GF0A 4PC1A 4R7ZA 3RS4A 4C0AC 1JNYA 2GJKA 4GOJA 1XD9A 5L3QB 1SXJB 3QG1A 3RSLA 3VR5A 4F7WA 4FD2A 5DLQC 1TADA 4FWTA 2D4HA 3NDPA 4D25A 1T3LA 3IO5A 1M7HA 4P33A 1KIMA 1KI6A 2ZEJA 3FTQA 3AM1A 1KSFX 5KDLA 1G3MA 2DCUA 2CHVA 3GQBA 3GJ4A 2OEPA 4JSYA 5C46F 4ON9A 1N6RA 3KB1A 1QZXA 2W0MA 1NVVQ 3K0FB 2IL1A 3P20A 3WP0A 4LBWA 2VTKA 2JASA 3IHWA 2ZJBA 2QNRA 4PX9A 3BS4A 4LX0A 1JAIA 3UANA 1G7CA 2O8CA 4QJ3A 3TH5A 4L5BA 4MRNA 4I1OA 5EXPA 5EP3A 4HLUC 2JAQA 2CLDX 2NGRA 4NPHA 4O3MA 4WAUA 2BKUA 4H1UA 4KFRA 1UBFA 3SE0A 4TMXA 2ZE5A 2PEYA 3FFBA 5FPKA 2GKSA 2VQSA 1P60A 2AK2A 2H7VA 1CLUA 3CNOA 1DEKA 2C96A 2OV2A 4O2LA 3L43A 3SFZA 2ZJAA 3AQ4A 4URZR 4F4JA 4KLNA 3ICQB 3TUZC 2ZRKA 4FCVA 2CL7X 1FOEB 4G1UC 4PANA 3B1ZA 1XXHB 2YJTD 3CF0A 3V9PA 3JVUA 3CR8A 4DVGA 3AVTA 5L3QA 3C15C 4UNQA 2GCOA 1RE0A 2XOKD 2ZVPX 3C5CA 4ZDKA 1LW7A 4NKRA 4GFDA 3AV0B 4D2IA 1TUIA 1NJFA 4ZDWA 2NO6A 2NO9A 2QN6A 2JJ1A 4MGZR 4GZMA 3MAAC 5GVRA 2EW1A 2OFXA 2XX3A 2RAPA 621PA 3GLIE 4MGKR 4TTPA 1NNEA 1XZPA 4YQFA 3EIQA 3PVSA 2OFOA 3SHFA 3QF4A 1YU9A 1U99A 1GIAA 2VL7A 3GD7A 3M1IA 1OH5A 4MA4A 3K09C 2QAGA 5FOTA 2D3WA 4B6EA 5F98A 4G5RA 4XD7D 4EJSC 1OXSC 2WJGA 3EWAA 5LD2C 1JJ7A 4N1AA 4BEJA 2VHTA 3SI7A 1MO4A 3SFVA 3CZQA 1KDOA 2DWQA 2JDIA 1U0HC 5FL3A 3GLGB 3SOPA 1JXOA 2C95A 2P5TB 2CXXA 2XTZA 4Q4JA 3ZVNA 5FTLA 3FB4A 3WMFA 2JLUA 1MABB 2X2FA 3RABA 5BN5A 1OSNA 2F1JA 2QP3A 4M1OA 4R98A 5E7IA 4Z51A 2XXAB 1P61B 4QM6A 4ASUD 4M1MA 4ILEA 2NOAA 4ZDIA 4B3XA 2WKQA 2OILA 1WQ1R 1JXMA 3QEOA 4W7SA 5G3ZA 2FFAA 1KDRA 2C9CA 3CBQA 3I4LA 3Q8XB 3R20A 1XFAA 1GITA 2ZRMA 2BEJA 2J7KA 1HTWA 3I92A 2IYUA 3HU2A 4LV5B 2F55A 4IKEA 1S3GA 1W44A 5FPTA 2EFCB 3GLFE 3K70C 1J2JA 4IDQA 2YHSA 2KWIA 4X8MA 2QTVB 4CF7A 3U7HB 3K0SA 4G5OA 1FQJA 4B3BA 4AYXA 1CBUA 1MRSA 3ZGXA 1R8QA 1PLJA 3KB2A 3SYKA 2MSDB 1E2PA 5DI9A 4N0EA 1KSJA 1X3SA 4M4SA 2ZTSA 4C0SA 4Q47A 2QMOA 3M4YA 1Q20A 1OFUX 4BLTA 5IT5A 4OHWA 4DJTA 4M9SA 3W8RA 3EZ7A 1KSGA 4LWZA 1E2JA 3M0EA 3TAHA 4W5WA 4LZZA 4KSBA 1TNDA 3W34A 5HCIA 1CEEA 2FA9A 3MSXA 3T12A 1R7RA 3L0IB 1G8YA 4V0OA 3O8DA 2W6ID 3GMTA 4X8LA 3SYNA 2EFEB 4BECA 2GJ9A 4DLWA 2IXEA 3MWKA 1NBMD 1F2UB 1KO4A 1FPMA 2IYTA 2WSSD 3T1OA 1VYVA 1RPZA 2QT1A 1OIVA 1TQ4A 2C99A 1T6NA 2QORA 1NVVR 3W6OA 4I4LA 3VKWA 1SGWA 1XTJA 4MKHA 2SHKA 2OO7A 2KE5A 2Z5FA 2OXCA 2IS4A 3IGFA 3KXKA 1GNRA 4AYTA 4C3ZA 2XB2A 2PLRA 4DZZA 2REBA 4M9XA 3UMRA 1TF5A 2OAP1 4RVCA 1XNJA 3TE6A 2IEZA 3T35A 4KVGA 4PC7A 1KJZA 1Z5ZA 1AQYA 4QGAA 2WHXA 2F43A 1XEWX 3GFPA 3DKPA 5K8IA 1KSHA 4TZ0A 4A0FA 3REFA 5FBQB 4J0QA 3V4RA 1OXUA 3DL0A 2CVHA 5EE1A 4Q9JA 4PPNA 1G8GA 4URWR 1VMAA 2ZRPA 3B2EA 1E2LA 1GL9B 4ESHA 1RC8A 2CK3A 3AVWA 4LJ7A 5AUNB 3QKRA 4DB4A 4QNRA 4BEBA 1EFTA 1QHXA 1DOAA 1OKKD 1HURA 3LD9A 2BMEA 1AM4D 3D3QA 1UDXA 3R9WA 2CMKA 1WXQA 2W58A 4ZV4A 4B3DA 4GI7A 3AVXA 2IW3A 2W6JD 1IN5A 2AFHE 3FKSA 3QVVA 3RS5A 5KPJA 1R4AA 5DO9A 5IK2A 4DKXA 1IN8A 1Q21A 2A5DA 2HCBA 2VP5A 3WP1B 1ZRHA 2JJ2D 3AVOA 1QHGA 1GRRA 3ZVMA 3BE4A 4RKFA 3S1AA 1E1QD 2F1HA 2VIIA 4Q9KA 4JVNA 2DYKA 3QE0A 3VAAA 1P2TA 4G0NA 5HTKA 2WWHA 4MH0R 1LVGA 2Q3MA 5HR5A 3VKGA 1E2GA 1N5JA 3BB3A 2QRZA 4D0GA 5HKKA 4R2HA 5J5CA 4I1SA 1XJ0A 4LYFA 1KO7A 1RKBA 3UMSA 4A0RA 1IY0A 5TV2A 4XVQA 4EAQA 3BGWA 1NMYA 1L7VC 4M1KA 5GVSA 2BBWA 3AGQA 1OXXK 3IIJA 1T8TA 2GJ8A 2Q21A 3NIBA 1OB2A 2GCPA 4C0KA 3RRNA 3KDSE 3RYTC 5FR2A 3SDZA 2Z83A 5E7MA 3SR0A 3IUYA 4KI0A 2ZI4A 5HCNA 1Z0IA 2O5VA 4PSKA 1KDTA 2J1LA 3AP3A 2ZPTX 1NF3A 2H57A 1GTVA 3LX5A 3NC0C 4YC7A 3T61A 4GOXA 1E2DA 2WJHA 4K46A 3ZVLA 4ARZA 4BLRA 3MJHA 2PH1A 3L8YA 1JEEA 3BK7A 2CEAA 3NH9A 3N2EA 4MYHA 3RWMB 3W90A 4I1UA 4DIDA 3CNNA 5KOYA 4ZI3A 3HYRA 3PEVA 4KCGA 3DM5A 2V3CC 1G16A 5KHOC 1FP6A 4Q4AB 1BH2A 2BBSA 4UKDA 4BFVA 2WKRA 3K0EA 3MWJA 4QKQA 4NU0A 3I62A 2E87A 1Z6GA 1E98A 3PV0A 5CLLA 4A8JB 1E9FA 2ORVA 3K53A 1NIPA 3EXAA 2D7CA 2WJJA 4KLZA 2YWHA 1F6BA 2CLSA 1LF0A 1P5ZB 5G53C 3GLHB 1W1WA 1U8YA 1T0JB 3U44A 1GDDA 3NC1C 2PX0A 4LCBA 4AYWA 2G3YA 3VMFA 2WICA 3R7WB 4OQMA 4DLUA 2PJZA 5SZIA 3THOA 2QMHA 4DCTA 1SVSA 4JS0A 4I99A 1QVRA 2DFLA 4KODA 5JSZA 1IJEA 3FYHA 1NSTA 3VX3A 2QA5A 2AL7A 4TQ9A 4DDVA 1MR3F 4P0TA 2WBLC 4D0NA 4FCTA 3RS2A 2IUSA 1NJGA 4BRWA 1COWA 2OE2A 4PZLA 1GKYA 3W3ZB 3AVYA 4FMCB 2YOFA 4WZ6A 3TMKA 3LXXA 1BOFA 3QKSA 1XWIA 3T34A 2OCBA 2QSYA 1GKIA 1Z0KA 1ZD9A 1ZD1A 2O0KA 1YKSA 1KO8A 3WBJA 4EJSB 3ZJYA 1YZQA 3PR1A 5E7JA 4OQFA 3U60B 1CP2A 3TGPA 1E79A 2L0XA 4V03A 5L3RA 4CEJB 5FOSA 3DVLA 2IYSA 2VP9A 1PUJA 1Z07A 2C9YA 5JHGB 1UADA 4NYIR 1OT3A 1OLOA 2X19A 2QBYA 1Q1BA 2A3RA 1M74A 1HY3A 1W0KA 1LS6A 2UVQA 4LJ8A 3I1FA 4QHSA 2AK3A 1MO5A 1G8HA 4M1WA 4LV8B 3OIWA 1CF4A 1ZU5A 3VR1A 2P6RA 2FSHA 4PFSA 3TBKA 3EWSA 4HLDA 1OXVA 1NL3A 2ZRGA 4MUAA 3A58B 4IDHA 2VYFA 4LHZA 2R65A 2V9PA 2ZSDA 2ANCA 3HPQA 4Z8XA 4E5UA 4LHYA 3FGNA 2FDCA 1G3UA
chains in the Genus database with same CATH superfamily
1F9AA 2VRBA 3D3JA 3BGDA 3O5AA 1AF4A 3HBMA 3RC8A 4I6GA 2RIRA 2ZRIA 1E69A 1R6UA 3S2FA 4EPWA 3B7PA 4FW9A 2ZAIA 4C7KA 4RK6A 4L51A 5BSTA 2P6OA 1ZS9A 1B1CA 1A50B 3IAXA 1UL1X 3E9ZA 1GOTA 5BW5A 4A8HA 1EK1A 1KEEB 3SKYA 1FVFA 2CUZA 4BVGA 4CF4A 1ID8A 2OCGA 2LP4Y 5D51S 1DO8A 4HZGA 3E5NA 4CF6A 4LI3X 2JBAB 3R74A 2VYVA 4R1QA 3DQZA 3WLTA 5LBTA 1DQPA 1JAHA 3WLHA 3VR2A 3LJKA 3MFYA 2ODNA 4BNJA 2R5WA 4H35A 4RFSB 2PXXA 3VC2A 3VJMA 3Q10A 5LYYA 3W6ZA 1TCBA 4RTLA 1EXMA 4BO6A 3ESBA 3QFTA 5LA6A 3HVRA 4H08A 2DWUA 2RDMA 3L4BA 3RSQA 2Q5EA 3BXGA 3DFUA 3EH1A 3NP7A 1AMUA 4A91A 1OX4A 4BGEA 4NYMR 2C5SA 2W37A 3H0KA 1T5TA 3KP1A 1Q0PA 1BA2A 2J0UA 4GBJA 3QX3A 1V8ZA 1YS4A 3WLSA 4BWYA 1YD7A 4EY3A 4D3YA 1HUQA 1ZUHA 1VDZA 1CUAA 2QRVB 4OXIA 2O19A 3O8QA 1MW9X 1V25A 2CE7A 2ZI3A 3OIFA 4V0LA 2FVYA 5HKKD 3TD6A 3II6X 3AUKA 1Y9EA 1HQYE 1Z6PA 2YHBA 2Z04A 1O08A 3VU9B 3LTEA 2O8FA 3VVBA 1PNQA 3EYAA 3OJEA 4KHZA 5IABA 3QY0A 3B12A 2NUPA 2JIMA 3ILSA 3LIPA 2HW8A 1BXGA 2D54A 2QQEA 3LLMA 4Q01A 4TQGA 2QXUA 3SIPA 4LGYA 2Z9BA 3TI7A 3NBZC 2IUYA 3MYRA 2R3SA 1Y8ZA 4BFWA 3K2IA 3K0KA 1ADFA 1A95A 1E2MA 1CR0A 4K6GA 2B21A 1VYUA 3BRWD 3DE1X 4ZAVA 4C7OA 1OV4A 4KMMA 3CVYA 1I4LD 2LR0A 2OCDA 3I1YA 4OMUA 4TN1A 1WETA 2A1TS 1PT6A 2DQKA 3Q2KA 3NYWA 2JIDA 4L95C 1QJCA 4PRZA 1D1QA 2BONA 2JNWA 3DEFA 2ONCA 5HDQA 3BMNB 2G1KA 1ZC4A 3RVJA 3JYHA 4MOWA 3A1SA 1I10A 1RT9A 1OYWA 1S2LA 4POAA 5BW6B 3EF3A 3RFVA 2PBLA 2JLXA 2BDEA 2PU7A 2YJ4A 1S89A 5BMVF 5DNUA 3LCCA 2EGUA 3TB6A 1IUKA 1XZHA 3A1VA 4DLYA 2IYLD 3FIUA 3H5IA 1UDCA 4NE7A 2DEUA 1UXOA 4ZRDA 2C97A 2YWGA 2RKOA 4FFMA 2K7ZA 1L5HA 5CDHA 2PAFA 1GL7A 3IV7A 3M2PA 5T64A 2JFGA 4K9RA 5DW3A 4KAXA 4ZIRB 5EJ4A 5C53B 1T9ZA 3WG9A 4EEKA 3ELWA 5KZMB 1GLGA 3RFFA 5LQNA 4IOMA 1ZK0A 4KN9S 3ZZNA 2HNAA 2CHFA 2BPOA 1MAHA 3AP1A 1V43A 3HCOA 3H9BA 4ZO7A 1L5NA 3T3IA 1RRCA 4Z7QB 4EO4A 4KJXA 1DC4A 1O0SA 3DHEA 3FZEA 3QXGA 1JHRA 4LZJA 1GRNA 3LX4A 4RVSA 1BA3A 5DOZA 2PN1A 3NHYA 5JFTA 1P3DA 4ZU1X 5AW7A 2VZEA 4W9NA 2XF8A 2B25A 5EE3A 1PJRA 4P53A 1YZGA 2IS6A 1JJIA 2BKLA 3VV2A 1UBTS 2AMYA 4CMKA 5BNTA 1UBHS 4DUGA 4FXOA 4KOAA 2BDTA 4MNTA 4HGRA 2CLEB 1W5SA 3EAGA 4G5QA 4E1AA 4M8LA 5DYWA 1CTQA 4DUPA 4IZHA 3DE2X 2J48A 4ODIA 3R5JA 3BXPA 2CV2A 4K28A 2ZK7A 1JMKC 3I9LA 2PGJA 3D4IA 3NAQA 5EZ5A 4GT1A 1WF3A 4L8LA 4Z9FA 3L84A 4RADA 1AQ6A 4H0CA 4E32A 5FNVB 5IKXA 3G59A 4AMUA 1T9KA 2BGLA 3MUEA 2O50A 3CLRC 4M7OA 1TZ2A 3RF7A 1SRRA 3ZD9A 1ZGJA 1YIOA 3PIRA 1B3BA 4UAVA 3SDSA 4EQ6A 5LR6A 3MWFA 1K4KA 5C8YF 3NWBA 1OW3B 3VPBA 3B6EA 2JJ8A 2JL1A 4ZRNA 2GAFA 2VF7A 4JIGA 1IUOA 3MBOA 1M1YE 5HKOA 5JJLA 3FA2A 3MGAA 3DLPX 1BCRB 4BEVA 2ZJ8A 2Z8YM 3H75A 1WV0A 4CHGA 3MJFA 3FWKA 1CNFA 1SULA 4FLEA 2XT6A 4HHEA 4PYLA 1V4NA 5M04A 1DPGA 1MJGA 1H4TA 3OF5A 1JHPA 3E9NA 5L4SA 2MYUA 1OD6A 4J1SA 2OL4A 5LZ2A 1M8PA 2HV9A 4RTQA 2H1CA 2ZKLA 3NTLA 2ZIFA 3FZGA 2R6FA 3I34X 1F48A 1C3XA 1U31A 1TX4B 4Z53A 2G80A 1RNLA 3A9WA 1X1SA 4HRAA 3I76A 4JUDX 4UCFA 4XE5A 3OX3A 4Q66C 1A7KA 5FPSA 3SS7X 4DQVA 3NTQA 4NR0A 5KTYA 2OQRA 3D3NA 3PEYA 2PH7A 1PN3A 2JARA 2Z2KA 2IVFA 1Q5PA 3IEKA 4PC2A 3TVTA 5CD1A 4MWEA 3KQLA 1K9SA 2VJBA 4M22A 1LDEA 2QG6A 3HBJA 1QH1B 1OFIA 1TZBA 3MJTA 3QH4A 2AIRA 1DKRA 4BV2A 1JFFA 2NAPA 3W2HA 4BV3A 5DYTA 3L04A 2P2GA 4EO9A 2N75A 1E9AA 1P0MA 2VAWA 4FBMA 5MN6A 1WOMA 4L4UA 5CT9A 1KDPA 2IZ7A 1ZA1A 2ZCVA 3GJSA 1ECLA 1WW3A 1V8PA 4B32A 3OC0A 3K72B 3WLKX 4D3XA 4F8JA 4Y1RB 1EVEA 4WQMA 4PO8A 3C5WP 3E1GA 1LBSA 3O4RA 1DQYA 1OBCA 1YGYA 4JI0B 1KBZA 3PXAA 3VZDA 1I4DD 3LECA 3WB0A 5DN6A 1ONPA 4LFAB 4KEAA 4MPDA 1Q11A 1CC1S 1J06A 2J3MA 3QE9Y 3C3PA 1X39A 1F0KA 4MJ3A 4TKVB 3VI4B 1WHTA 4JJKA 2A0WA 5B3JA 5LP6F 2NG1A 4JLNA 4EATA 3OAAA 2VJCA 3LSYA 4RPGA 1KTIA 3F6SA 2W98A 4GRIA 2IZZA 5BVHA 3DEAA 4KWCA 4CM7A 2XOEA 3PNQA 1Z0AA 3TW4A 3WSVA 3C70A 4B84A 2Q2VA 3SZ3A 2C1EA 1PR3A 4GDMA 3HKEB 5CDFA 4HEHA 2G5PA 1BVUA 2O23A 3H9JA 4ZQEA 4JQSA 1F1BA 3P4UA 4MZXA 4TMZA 2P2LA 4E22A 3SS8A 4ZPXA 3O2SB 4X62B 1SD1A 2C2MA 5KKCA 2JH9A 4FHCA 1QGAA 1YL7A 1TYAE 4FGUA 3CO0S 2HU8A 3F7NA 3EZ9A 3JTMA 4QFBA 3FVWA 1R50A 2BMDA 1QFZA 1YB7A 4UUQA 2EARA 1L8XA 3U26A 3LUJA 1VLZA 5AUOB 4QDJA 4R5HA 1WZ2A 3GFTA 1YR9A 3ZWVA 3A9CA 3HFRA 1FDRA 3KWJA 1GSIA 3T3OA 2QQ5A 3ISJA 1BWSA 4YCDA 1B76A 2A4KA 5I5EA 5L8VA 2EG5A 4TZ6A 4RZIA 3DBVO 2H08A 2ZREA 1N6HA 1USIA 2H1HA 2P67A 2I3AA 2J3EA 3L7AA 3VPAA 5AI5A 2RD2A 3AJRA 3M34A 1G42A 4KVZA 2ZRAA 1MAAA 2R7MA 3MCTA 4QWWA 3VH3A 4WINA 1JG4A 2AI3A 1E58A 5C51B 3SLGA 1N7IA 2AJCA 3KB6A 3T5BA 1GGJA 2GFQA 4PSUA 4ZQIA 5DSTA 4OHPA 1T3HA 3QYPA 3GJ7A 1NWCA 2Z6AA 3A2MA 3EXHA 3URMA 3L0PA 3KOZA 4OQZA 4EIWA 1LDYA 4Q7KA 2ZAMA 1AQLA 2EC5A 2FPRA 3OETA 2HLHA 3RIYA 3AFGA 1IRXA 3QW2A 4PC3A 2PCLA 2Q0QA 1L8QA 5B55A 2O8DB 4LW8A 4BKQA 3EIHA 3KKNA 1HQDA 4F60A 2WJ6A 1IM5A 4N5LA 2D1YA 1FTQA 2YMMA 3K1AA 3I9V6 1PKEA 2X6RA 3H16A 2ISCA 1YMVA 1NI5A 5DXJA 3TQHA 1HDIA 2FPMA 2FX2A 2I4OA 5IC6A 4WLEA 4N3NA 1B26A 1MH1A 2YHIA 3B1JA 3A4LA 4FTWA 1V9SA 1SCJA 4I4NA 2JFUA 5BV2P 1A7JA 4CCWA 2QN9A 1VJ5A 3VYSB 2LW7A 3DV2A 1P5FA 2TS1A 1HE1C 4U2BA 4WW0A 2QX6A 1LB1B 4LOAA 2P0YA 1VIVA 3ZD8A 5DWQA 3GH1A 3QEAZ 3QSGA 1WE2A 2W6QA 4QQKA 4X8OA 4K6HA 4ZANA 4DUGD 4FCWA 2XZPA 3R1IA 4JVMA 3C1TA 4R8RA 2I2CA 3SHTA 3ZS9A 4HVAA 3MQ4A 2D7DA 4N0QA 5DGTA 2VP6A 2Y6UA 3L93A 1MD9A 5E8RA 1LI7A 1Z36A 3T3HA 2Q29A 3WMGA 5LBUA 3NXSA 3PE3A 2FMTA 5DWVA 1IY8A 1HEIA 4XWOA 4FYYA 1FSGA 2PWZA 3B5IA 3QMPA 3K4QA 2MSWA 3OM9A 2PKQP 3PA8A 4N03A 4XWGA 4F6RB 2Q46A 2Y0CA 3JYPA 1Q91A 2Q9BA 1UWLA 1Q16A 2YUTA 3PJFA 1YA6A 2EFGA 1N9GA 3KIPA 4I5EA 2LIVA 1JS1X 1CW2B 2O3SA 1M0SA 2X40A 5ALQA 1BMFA 2JGIA 5IWCA 1KS2A 3GFGA 1O57A 4UATA 1J20A 1LVUA 5LLSA 2WAOA 1GTL1 2F9FA 3GRZA 1PL0A 1Q17A 3EFOA 3P2MA 5COQA 2JD0A 2QYOA 2WWFA 2E7ZA 5KYTA 3PI6A 1V95A 3C6MA 4WBXC 3TXYA 1VSTA 2OG2A 5DGXA 5KO2A 1IM2A 4NYJQ 3U37A 2AN3A 3B2NA 4I4TA 2DWPA 4JQYA 1E7YA 3ZU3A 3KC2A 4OBEA 3DOEA 1NLZA 4Q7QA 1BS1A 2YFHA 3C6QA 3ITDA 3KUCA 3O26A 4CLOB 1XRPA 1W5FA 4X24A 4A6DA 2XQKA 5D6NA 1UT8A 3QXHA 1W7AA 3R5FA 2VCYA 2C2KA 5BN4A 1WPQA 1JI0A 1ODIA 2GCIA 1O94D 3CTMA 3DPUA 4MRAA 5KOHB 2IPAB 5FO0A 3HYCA 4I46A 2DBVO 5FPHA 1SUWA 1FZTA 1U7XA 4FB4A 2OBLA 4DV3B 5AW0A 3P0FA 1GZ7A 4HLNA 1LA2A 3MJSA 4CM1A 2PS0A 3MRTA 1BVYF 4QWMA 4D26A 2AYZA 2Y1GA 3D8TA 2GTHA 3RRBA 4S1VA 2AHRA 1V8FA 1KEUA 3DVRX 4ETIA 2EHJA 1OX4B 1PJ3A 2XB6A 3B82A 1U2ZA 3FKJA 3IO3A 3SD7A 4YP7A 2C3OA 4A2PA 1KYQA 2CNKA 3SHWA 3G0BA 5A7GA 1K68A 1XHEA 4X3CA 5CPBA 2IYQA 3QFRA 5FP0A 2NM0A 3WE7A 1BU5A 2WIDA 1M2OA 1T6ZA 4IUYA 2EP8A 2IXTA 2YX1A 4GRAA 4UTVA 3D0OA 1L0BA 4W1PA 5AJTA 3RBAA 2XZDA 1GGNA 4GEGA 2ZT5A 5CFMA 1D04A 4YIHA 3I37X 2NU6A 2OCPA 3P96A 1V96A 1M1YB 1WDTA 3B5EA 1GWNA 3NOXA 4NP6A 4DHEA 1FIUA 4H6XA 1IHYA 4Z4GA 1D9XA 5BPFA 2HMSA 1XBTA 4RU1A 4Z9BA 3GHHA 1N8NA 4XYMA 3QMVA 4HDRA 2OHIA 4ZC8A 5B1IA 4CIVA 3D0QA 3R9IA 3QVTA 3L0DA 3ND7A 3WTCA 3KYCA 2FUKA 2JATA 1EGQA 2OESA 2I2XB 2H31A 1P91A 4O4IA 3RKSA 2VT3A 1FNNA 2BRUA 3DMRA 4KXWA 5ALKA 7REQB 3HZRA 1TEVA 4BMXA 5AESA 3B9PA 2FOXA 4CFSA 4YQZA 1QHFA 1JWAB 1EUYA 4ARVA 1FJ2A 3I6MA 5EERA 2X7JA 4GR9A 4ALMA 3AGPA 5FOWA 2AF3C 2WQ7A 1AHHA 3LPDA 1IXZA 2ZZMA 2B1IA 4UZEA 3VM6A 2QEQA 3RUEA 1RXWA 5CIWA 4NARA 2QTRA 3KTAB 4A3SA 2EFJA 2ZSJA 3D8NA 1ZMRA 1DEAA 3DPIA 1H9CA 2AKAB 4NQRA 4JT9A 4DYDA 4IVQA 3RYFB 1AQIA 1QGED 1XQYA 2WKSA 1FA9A 2YIMA 3AETA 5HE9A 3WKCA 3OJWA 5FOUA 1K6MA 4Q9NA 4DN6A 1I3MA 1UAYA 3DHNA 4TYYA 1E3IA 1IG0A 1SQ5A 3EEBA 4TYNA 3OWXA 1VRVA 3EIWA 3MS4A 3TE7A 3TOCA 4GNKA 2JB9A 4PG4A 5CPFA 2NQ2C 3CF4A 3VR4H 3UW1A 3L7NA 2DFDA 4TV8A 3E53A 2IRWA 4QYXA 3KUDA 3OE5A 1BGVA 4NV3A 4YWJA 1FQKA 2VT7A 4C6TA 2XPCA 4X6YA 4CTJA 1UPCA 2QI9C 1MDFA 3OZUA 1H8EA 4TS3A 5CGZA 2WD9A 1NP6A 4YS6A 1UZNA 3BFXA 4XOUA 5L7YA 5I47A 3G5MA 1J4AA 3K09A 4LTMA 2J9ZB 2OLJA 3B6KA 1HMPA 4MB6A 3V55A 3ZY4A 4OHYA 3KE9A 3JRNA 1PG5A 3F1KA 4QBKA 2JKZA 1YB4A 1KARA 2EWWA 3QVSA 4HQLA 3LG2A 4LRXA 4E4TA 2VDQB 1RBMA 3BEOA 2OG1A 5JBQA 3HM9A 2WF5A 1JIJA 3DOHA 2IXBA 2QX9A 5KOJB 3RJZA 5JWRA 1UH5A 4AZTA 1G20E 3DDUA 1W85A 2QTCA 3FMPB 1CUCA 1JI3A 1YAJA 1SAYA 1JFRA 3IODA 5H02A 2O52A 2GO1A 4NTZA 4QC2A 4W5JA 3WL4A 3ZOKA 2Q3LA 2QTTA 3FVVA 1Z2AA 4FE7A 4CMEA 2RGRA 1IVYA 1AUQA 4B83A 2R7KA 4UAUA 4CV1A 4POOA 2YV5A 3WGOA 1M10A 3UCFA 2X8BA 3G7NA 3SU8A 5A3QA 2AT1A 4WXEA 5SYMA 1YVUA 1LPPA 2JVKA 2XMDA 3A37A 5DHUA 2AD5A 3N2GA 5F7XA 3HYTA 4LBZA 1E5VA 4LOLA 3E9RA 2GXUA 1V6AA 4RQUA 4TV8F 4Y9DA 3EXEA 4LC0A 4IFIA 4MVJI 4RIEA 3WRVA 5L45A 3ISVA 3GG9A 3OMWA 4W8OA 1JQ3A 5FA8A 2PT5A 4HZUA 1FFSA 2AZXA 1NRIA 1B8NA 3FPSA 2QVYX 4P54A 3P9CA 3Q72A 4WLNA 1X1AA 1FUYB 1PBTA 2GZMA 3C87A 3KR2A 5HCUA 4EY8A 1OQAA 3TR6A 4BX9A 3Q2OA 1KDYA 2QR3A 1Y4ZA 4DV1B 4ALKA 3GRCA 3NHSA 3SZOA 3MWEA 4R9RA 4AY2A 3LFUA 4D3DA 2W6OA 1HA3A 1VHTA 2DQZA 1B7GO 3C39A 2J3DA 2W2XA 3AJ9A 3ZU5A 1IHDA 4K86A 4RXUA 3T3EA 4E7PA 2VRCD 4U3JA 4EG1A 4Y2YA 5HMLA 1M0EA 5TIIA 3B6JA 1T4CB 1N9KA 2JJMA 3TCXB 4TWJA 4D9EA 4YLYA 2JVIA 2P9EA 1WG8A 1Q14A 5EWMA 3WO1A 1VLHA 3IXMA 4WE3A 1OI3A 1XI2A 1MAVA 3IEUA 1LNQA 2G0AA 2X2OA 3DXZA 2YKGA 1U0GA 3VSBA 3L1JA 5AJVB 5DGCA 3B5JA 5FLKA 3VBCA 4DDMA 3K35A 3WYCA 1AUVA 4OHOA 4BNUA 3PT9A 5DEOA 2Q5IA 3E7PA 2FKNA 3SYLA 3JYQA 1CPYA 1P19A 3AW8A 3SYMA 4BAGA 1KK0A 3NJ8A 4YY3B 1E3LA 4MR9A 3M82A 1ZMTA 1S2GA 3L18A 5EHXA 1VIMA 5B1HA 1P1KA 1KEKA 4PRYA 3H19A 4UOEA 4F1JA 1TM7E 2E5FA 5FYDA 2O2JA 3MJRA 4K03A 2P68A 2XKAA 3IFSA 3PQFA 5KYVA 4B2LA 1TT5A 5BT8A 1F2TB 2VCHA 3LT5A 5TPWB 2OHOA 3BTSA 3AI3A 2YDYA 1JLLA 1ISGA 1EUDA 3I1JA 5LSAA 1TCAA 4N18A 3JARB 1J7KA 2DBYA 1UOEA 5DBOA 4NLLA 4MP3A 2R6DA 1NQAO 4ZICA 2A94A 2VG8A 1OFUA 4UNRA 2QRQA 3O4JA 4V1CA 2CLLB 4FDTA 1FX1A 2GJSA 1U0FA 3I6BA 3ECCA 5EJMA 3OCYA 5BR1A 5JW6A 1YQ9A 4GDFA 1L5LA 2EFYA 2PQ2A 3V4ZA 4KFTA 1AA9A 3DH0A 4ACBA 2WHPA 4J0KA 2CUKA 4JJAA 3TXXA 2BP7B 1AKEA 1UXHA 2DZDA 2VUTA 4WGGA 4JXXA 4BE9A 2DR2A 3MMPA 1POWA 1Y34E 2FQYA 2JW5A 1Z33A 2BZ1A 2HCJB 1H1LA 2C7VA 3A3PA 1MIOB 3TX2A 3SYTA 3QF4B 4LZPA 1L5WA 5HF5A 3U56A 2BM8A 1EI9A 4INJA 3BYZA 3GAMA 1PKXA 4HH4A 4F56A 4ZEVA 3GFBA 1E3SA 1FUIA 1EP9A 4MV8A 2YXLA 1PFQA 4M1TA 4JLAA 3BF8A 2WKWA 1EWRA 1KWGA 1PJTA 2Z57A 5ESDA 4BP3A 2QPAA 1RQ7A 5FOXA 3V8VA 1R15A 2JI8A 1G21A 1HEUA 2FN4A 3LGAA 3S40A 3SX2A 4B4OA 4RSHA 4LPSA 1N2ZA 1TUBB 3R7WA 2LIPA 3IDOA 1KTVA 1SR8A 2RCNA 1GXSA 3RR2A 4HQOA 3OM0A 2J9FA 4YRFA 1KAMA 1KMQA 3G0OA 5K4HA 3A6GA 3GGOA 1LSUA 1DC5A 5KWIA 4CLOA 1HYHA 3GJYA 3U4GA 3CW8X 2RI6A 3H8JA 2ID7A 2M9MA 3JWEA 2WUFA 2NV2B 3GEDA 4EL5A 5FOQA 1GAJA 2CN1A 2I4LA 1GUYA 2NTYC 4O2AB 4K5QA 2AOTB 2FSIA 5D5QA 4RE5A 3HV0A 3DC2A 1IHXA 1I6WA 2C2XA 4NBSA 3VJLA 2A9KA 1DFHA 1Y6RA 1Z6YA 2GN8A 3HB0A 2AWNA 4G4JA 3N7TA 2CD7A 4EYKA 4MQLA 5PNTA 4MMYB 1XMOB 5JAOA 1L4FA 1L9XA 1XAJA 3K32A 3N1UA 3V8NA 4BVFA 1QQAA 1NSYA 1WPRA 1LLQA 4IZOA 4Q9IA 1JL3A 4Q34A 4KO1S 4JT8A 4P0PB 2XUAA 1RPAA 3KFLA 4QUGA 3F9RA 3RUPA 3JQQA 1D7OA 1D4OA 2BFFA 2O0JA 5EXEA 8OHMA 4XFJA 1C0EA 5K0JA 2HRRA 1WBJB 2R5NA 1ZONA 4HAXA 2P9CA 1QSGA 1UK9A 5G4KB 4E13A 3ORHA 3HHEA 4KFSA 1KKUA 2G8NA 2V6BA 3QTLA 2R44A 2H5JA 3GA0A 1DQZA 1WPXA 1PDOA 2R1TB 1XRRA 2F17A 3EXFB 3FYUB 3MT0A 4TYPA 2FPLA 1DCKA 2DPGA 3TD2A 4HXFB 3BL5A 3L1VA 4FFWA 1J25A 1QS0A 3SJAA 1QPGA 3WB9A 1NQUA 3L46A 3M6AA 2JS7A 2XD9A 1CRWG 5TMDA 2ZIXA 3RSCA 4CETA 3COSA 1MC4A 1JEJA 1P6QA 3CRVA 1XZAA 4JFRA 2Y1DA 4ZEXA 1JFTA 1FVXA 4B6QA 1Z73A 2WNHA 4R2XA 1XDDA 3ZWMA 2ODPA 1AXEA 4C6SA 2JHPA 1NLYA 3UMBA 5B2EA 3KK0A 1M73E 3HGTA 4MW1A 1SUSA 1XVAA 3OX1A 4DY4A 5HZHA 5BSKA 1ULZA 4HX5A 4E3ZA 1DZ3A 2IYEA 2Z3ZA 2O5EA 3G8YA 4AU1A 3L7DA 5CDTA 5GONF 1HT3A 4MULA 1B2LA 5D3QA 3HNRA 4MW6A 5TEWA 2QV0A 2GPBA 2X76A 1YBMA 2DB3A 3LRXA 5A9RA 1ADGA 2D0IA 4A1OA 1V7QA 3H4VA 1G8FA 4MV1A 3VAZA 3K71B 1WP4A 3ZLBA 4XFDA 1YAHA 5JCJD 4LOIA 2OR3A 4HLQB 3ADCA 2DQYA 2VAPA 1QGZA 1SUCA 3KKMA 4JLVA 1DAPA 4IIBA 3P45A 4NAUA 4H1VA 4WV3A 4DMKA 2G40A 2NT3A 2UZ0A 3ESXA 3NV9A 3RFUA 3V2IA 3EQ2A 2DWOA 1P9NA 2ZBVA 1SHTX 3D59A 3E35A 4W6ZA 3OBBA 1Z28A 4HCJA 1PJSA 3JZAA 2AFIE 4AW9A 3FUXA 1UZAA 4RZ2A 3N53A 3F4KA 1YDWA 2OECA 4J0GA 4RKRA 4MX8A 4R9UC 4FZVA 5FI0B 1DAFA 4J6FA 4MS3B 3ZWBA 1QLJA 1DCMA 1ZNZA 2VRNA 4KE7A 4LJ5A 4B6PA 4CM9A 1QF6A 1CJUC 1TQ8A 1ZVKA 3TPFA 1CRQA 2C31A 3DFFA 3ESDA 2BEWA 2AXPA 3MF4A 4L5JA 3ZX5A 5KNCA 1F6DA 1MJFA 4LNUB 2PKWA 3QFSA 2HWYA 4TL7A 1N32B 1I33A 4K2HA 5JPCA 4G0WA 1FP4A 5F64A 4HAZA 3R8FA 2YL2A 4M1YA 1FYVA 3LF2A 4HYQA 2C4KA 4NH0A 4ATNA 5EJ6A 3P2YA 4B5LA 2BFNA 4LYAA 3ZH9B 8GPBA 2V96A 1OZHA 4BO5A 3NBAA 3TLAA 4P7KA 2ZUDA 5GONA 1D07A 4IF4A 4X8HA 4WXHA 3UKDA 5F9HA 1MT0A 4YMUA 3CUSA 4IP0A 1DBSA 2A0XA 4ZEOA 1LC0A 4CR8A 1LJ8A 2Q6VA 1SCUA 1XD2A 4RXMA 3SJUA 4GVXA 1A76A 4MKGA 3NMUF 3ETGA 5LB4A 5K8JB 1R3DA 3VNAA 3OD1A 4UHKA 1I2MA 2JLSA 2NU9A 2KLHA 2DFTA 1RD4A 4IXDA 3BXOA 4CQLA 1IG3A 2NO0A 4DQDA 1BS9A 2CXTA 6ADHA 2VPZA 2NP6A 4JVSB 3FFWA 1M0WA 4OM8A 1CUSA 1UC8A 1Y1LA 3H65A 4P92A 2XCTB 1QIEA 2V7TA 4CGYA 4EVIA 2GPJA 3BQNB 1X0VA 4OI0A 1GPLA 1I2DA 2PLFA 3PIDA 1YQGA 2JGAA 2H1OA 1LNZA 4LIPD 3SQLA 1JHQA 2ZUUA 2HLDD 1ICIA 2PS9A 2O3RA 3AK4A 3HZOA 3PQ2A 2YWJA 3FLBA 4QGSA 1RRVA 2AJDA 5IZCC 1WL8A 1DB3A 3VPSA 1QFJA 3NGXA 3PC7A 3LBHA 3PX3A 2JJ1D 4JXKA 4PU0A 1CDOA 4MYRA 2CNWD 2J0QA 2WM2A 4LRTB 4R9SA 4CM4B 3ZCUA 3T7RA 3VC7A 3WGKA 1WMDA 3LIIA 3WYFA 2I4RA 4KSYA 1MN6A 4QOJA 3O83A 3ZJVA 2QXTA 3HCWA 2OUKA 4LYJA 3DZKA 3RRMA 3ZZ0A 3S4YA 5LB2A 1BE8A 1M2WA 1SCQA 1KOFA 2XTMA 2NIPA 1N57A 2NPIA 2Y1EA 4PLWA 1YSCA 2QL7A 4MS3A 2MSKA 1QB8A 3GJXC 5BNWA 1NLFA 4LQLA 4AMYA 2UUPA 1YZNA 4YLGA 4X1KA 3HB7A 3WHLA 2AC7A 2VK2A 2Q5LA 3KJNA 1IUNA 2XUHA 1RXVA 1WXIA 1FMLA 1H0RA 2ZVQX 3AINA 3LVBA 3L49A 4QBHA 5ADHA 4CMBA 2VTEA 3OI7A 2QD3A 1A72A 4JB2A 3AJ8A 4CHTA 1R8SA 1S2MA 4Y0VA 3H83A 1QCCA 5DBFA 1UZMA 3OEED 1UINA 3OOEA 4UEWA 5GADl 1OWNA 4PWYA 4R2WA 4S12A 4M37A 3HB4X 4IDEA 5IBPA 1CYEA 4BPBA 1QHHB 1PL6A 2XE4A 5L51A 3IBCA 4BGIA 1U2TA 5AVZA 3IKMB 5JYBA 1OU4A 3NPMA 3NKVA 2OA0A 4AIRA 5CEEA 1JEYA 2NP7A 1YK1A 4XZ3A 1EFVB 3E8MA 2GK3A 4TYWA 3F74A 4LRQA 4M2LA 4KREA 3KDAA 4EF4A 1OGYA 2NSJA 3O95A 5DXFA 2V5AA 1JHXA 1NW8A 1MKYA 3GJRA 4MO2A 4LDJA 4WZZA 1G21B 1T5HX 3O91A 3N2NA 3AKZA 3FRHA 1J0DA 3D7KA 4CPDA 1QKIA 4O2BF 5A5EA 1RAIA 3KETA 1WQ3A 1XXHE 4RHCA 2IYZA 2EGGA 1NBME 4U7JA 2PMFA 3ZXYA 2C77A 1I2ZA 2IHJA 3JD0A 5HVNA 1M34B 2WIKA 3ILYA 4N0MA 5FQOA 1UJ2A 1VSUA 3L02A 4L08A 4P35A 4OH7A 1H93A 2WP8J 3CONA 3UJNA 1C3JA 3WFJA 3ZIDA 3EMVA 3U5ZB 4B4KA 3HJHA 4NYJR 2XIJA 4DCCA 4ZC1A 1T1EA 1SC3A 5C32A 4KXYA 2JBAA 2O2IA 4A16A 4NNPA 5G0SA 3DLBA 4OQLA 1DV1A 4HS9A 4L8WB 5JNRA 1V39A 2GA8A 3EVBA 2HF7A 3KRTA 4M53A 4ZVPA 4KUHA 4EKNB 3O3MB 5CVJA 2FEXA 1H4SA 4BNHA 1CE8B 2B36A 2VHVA 1QGDA 3U39A 4BLPA 4E14A 4HNTA 1GQ2A 2CT8A 4N5IX 2CJYA 1E9DA 1C1HA 1TVMA 4IZIA 2D5IA 4JBLA 3WJ2A 4BBPA 2XMQA 3GBPA 4KTTE 2G5GX 2IC5A 5A06A 2VP0A 4O4HB 2C03A 4C87A 1UAAA 1NASA 1O87A 2WKPA 4I4TB 1Q3HA 4RD3A 3HYLA 1YTLA 3NBXX 2KYRA 2R97A 3LGXA 1RJEA 5E8JA 4DQXA 3PWSA 1ZH2A 4BFYA 4C01A 3WLOA 3DLHA 1AS3A 1OA0A 4R8VA 4YJFB 4HLCA 1BKSB 2GAAA 13PKA 2ZULA 4MITA 3H42B 1EA5A 3HCAA 1QDLB 1BXKA 5EXXA 4KX3A 3HR8A 3VGJA 4RV4A 2DP4E 1C0KA 4BMVA 2DUNA 1EDDA 1A2OA 2PHZA 3Q7RA 5BN5B 4RUKA 3M49A 1NFFA 5EFOA 4CMHA 4A6XA 3T6KA 2VAXA 4LNAA 1NJ5A 2F48A 5GAJA 3ZS8A 1GDTA 3D8HA 2YH2A 1VKJA 1RDFA 2FOIA 3LC7O 4NOJA 3CRRA 5D3MA 1DAMA 5DHPA 4MPTA 1A4IA 2VH2A 3TD9A 1M2NA 4NDNE 3ZCPA 5KHLB 1P1BA 2G0TA 1E9RA 4RSGA 3GMIA 1YBFA 2X4GA 2HCRA 3CIOA 4CMJA 1YIAA 2ZUWA 5D01A 4DA8A 1EAMA 1KI6B 1FYWA 4FGWA 2H4WA 2WJ4A 3BN3A 3SIXA 3VNUA 4WKCA 4L8YA 2P75A 3J7TA 3KD2A 3OQOA 3IR6A 4G8DA 3EDRA 4UPEA 2PSSA 5JE8A 1UXGA 2BMAA 5AD1A 1Y48E 3A4IA 2R1UA 2B2NA 4IILA 2I33A 2YCBA 3GVPA 1YOBA 4YP1A 4BFUA 1FFYA 1U0NA 3ZK7A 4MW4A 1SBTA 3GEEA 2ZRHA 4KR9A 3PD1A 1NQXA 4KBGA 4NHOA 3QSYA 3RRXA 4YUAA 1KAHA 2GO7A 3N8KA 1ECGA 3DTTA 1R27A 3KT6A 4L76A 3AG6A 3F3SA 2H4HA 4W9RA 3AV3A 4HZUB 1XA3A 3HDQA 3ROQA 5KX5A 3A05A 5REQA 1BO6A 2IH5A 1XCLA 5TSDA 5AUQA 1LWOA 4HAOA 1TQ6A 3B6IA 1CSEE 2WYWA 3NGLA 2VHZA 3ZK9A 2HL6A 2N46A 2BV3A 3C8HA 4YAIA 3PLAE 1NNUA 2RHMA 2ZBUA 2ZSEA 5JNTA 2D06A 1SVOA 3IP5A 2OVBA 2EJCA 2I7XA 3D5QA 4YEDA 5C81A 2PTHA 5KU7A 4P7GA 3AHJA 3I8SA 1OZGA 5EJ8A 2YWCA 3LOQA 2ZANA 1FY2A 1OI4A 5IJ9B 1D8AA 2F00A 4UE6A 6LDHA 2I4NA 2CDCA 4GM4A 4ZJPA 1QTIA 1QNFA 1QR2A 3ROXA 2I8CA 4U9HS 1Z8FA 1PEKE 5DNWA 3ZY6A 4C1BA 4CLRA 5MN4A 3CVJA 3NVAA 1JFVA 1UK6A 3U7EB 1E1MA 3U3KA 3U9LA 1VHJA 1VL6A 4EG0A 2O2HA 1JPJA 3AR9A 1Y4AE 3G2JA 5K3OA 4RCVA 3WGVA 4WBNF 5UKDA 2HT1A 2GS9A 4IOLA 3G0GA 4K05A 1N2CE 1PNVA 4YXWD 1EEXB 5EC8A 2A9QA 1I5RA 1XTBA 4MWGA 4HNAB 5K0LA 3A3YA 2BGNA 1JQEA 2CK3D 3JX9A 2Y99A 2ZOSA 4UMVA 3VOBA 5M7EA 1GYPA 4LXHA 2O2CA 2H2GA 2WWGA 3LCJA 2Y1OA 1XTUA 4G0MA 4RO0A 5HM6A 1Z8NA 4I14A 4I36A 1NF8A 2Y4NA 4DQKA 3KLNA 5TQVA 3EVGA 5IYZB 2WYOA 1Q1QA 4GYKA 3GGSA 1TTTA 4F9TA 4MRMB 4LTNA 1ZLYA 4DNFA 2GJAA 1NVFA 3H86A 3MWLA 4LGCA 3Q4GA 5AW8A 4ZCLA 5DK4A 4DABA 5DOVA 4BVKA 3ADDA 2PZBA 2IBMA 1TKCA 3EXFA 3KYIB 4DYVA 4EPRA 5B12A 2H16A 4KL8S 1JG3A 1Q1NA 1U6IA 2GZAA 5TF4A 4DJEC 1EJ2A 3UKJA 4G0ZA 2NVUA 5I8PA 3FSJX 2BCJQ 1UP7A 1J0CA 1AHIA 1MC5A 2R47A 4G0UA 1H5QA 3BMXA 4JEMA 3KS9A 5JMWA 3KWMA 3REQB 4A92A 5D5PA 1BEZA 1CJVC 4HAUA 2A5GA 2A1IA 2OQVA 4F96A 1GRQA 4EUFA 1A4RA 2NV0A 5AW1A 5CXXA 4ETMA 3UT5B 4LSGA 4N6NA 4X7BA 2XXAA 1Y42X 2PD3A 1TO1E 1JR3E 5KU1A 3W1VA 4C88A 1B23P 2R6JA 4K8RB 1MF7A 2C2HA 5F2KA 5EP4A 5JJ5A 3MRSA 3VR6H 1Y1PA 1B8VA 1U0JA 1PGOA 2FSFA 3MD0A 3FSRA 4KV7A 2HMVA 3RVMA 5HFNA 3TJZA 3RASA 2XITA 1PAUA 3O3CA 5DLEA 5ALLA 5B3KA 2W8BA 3PNYA 4FZ5A 5HKAA 4CDGA 4IH9A 5AH0A 3KZXA 2FEOA 1NKVA 1T3GA 4JLWA 4QGHA 2UXBB 3IC5A 2JJYA 3IVXA 2HNKA 4CRWB 4EGSA 3FGZA 1SXPA 4DTCA 1V11B 3WKBA 1MB2A 1XU4A 1GVHA 2LCIA 2YWXA 4CT0A 2VXOA 4IYJA 3DO8A 2CJPA 2D7JA 3TTXA 3QKUA 2PH3A 1KY4A 1NVTA 1QBGA 3P4YA 4GO1A 3N7UA 2A9RA 4U5XA 1J5PA 3DCYA 1SBZA 3W5UA 4FMCF 1BYUA 3SF8B 1ZY2A 3QIVA 2I55A 1B14A 1Z16A 1GO2A 1GFIA 3D1VA 4KXLA 3DO6A 1K8RA 5HBGA 1CNMA 4U2FA 4WIAA 3TEMA 4I5GA 3THWA 4A5OA 4ARZB 5AJYA 4HFMA 5BSMA 1F8GA 4MV9A 1ZJWA 1I5OA 2CXSA