4GRMA

The crystal structure of the high affinity tcr a6
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
184
Chain Sequence
EVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVTTGKLQFGAGTQVVVTPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increased Peptide Contacts Govern High Affinity Binding of a Modified TCR Whilst Maintaining a Native pMHC Docking Mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords A6 alpha chain
total genus 35
structure length 184
sequence length 187
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmA02
3O6FA 2CKBA 1U8QA 1UVQA 5F7UA 2I24N 4PRHB 4N0CD 2PR4L 3LKRB 5E6ZA 5EU6E 4Q0XH 4EKXA 2P4AB 3HNTL 2P5WE 4K3JL 1AI1H 2AV7A 3V6ZA 4I5BB 1I1YA 1RZFL 4OI9A 1G6RH 2ED7A 1FYTB 3Q6GH 3PWNB 4AZ8A 2C9AA 2HAZA 3JTTA 2X89D 3NAAH 5IBTL 3CZJA 2YD1A 2FD6L 2R9HD 4WI3A 2X70B 5AUMB 3WEXB 3IDGB 5EBLA 5HDOA 3FQUB 4Z7OE 2ORBL 1FYHB 5HGAB 2OZ4H 4OLWH 3PHQA 4LCWB 1CD1A 4RAUB 4AEEA 5ERWA 3VCLA 1FZOB 3GMLB 4YXKL 1PG7X 5IHZA 4I0KA 4D8PB 4N0CC 4LNRB 3HG1B 2ZPKH 5EA0L 1MPAH 3CC5A 3GI8H 4NNXA 4N9GB 3BD5A 1DUYB 5K93A 3B6SB 4KMTH 1AD0A 3QG7H 1AGDB 5T1MB 3RJDA 1WQVT 3PABA 4MQTB 4YO0B 3GK8L 2F54B 1EAJA 2APBA 2F53A 5F3HA 1ETZB 4QF1A 2BVYA 4JPIB 5CINL 3MRBA 3KYNB 1FAKT 2PYFB 4H8WC 4GG8A 1JF5A 4NNYB 4OCYH 2X4QA 5JHLL 1T22A 4FQJL 1QRNE 3ZDZF 4OCRL 3ZT5A 4PIRF 3BZEB 2ZUUA 2AI0L 4YXHH 1ZA3A 1BX2A 4LSPH 5IROC 3KG5A 3AS1A 4GW1B 2YWYA 3RX5A 3TZVB 2HRPH 3E8UL 4DN4H 3OF6A 3GMOB 2Z31B 5JOPD 1QP1A 5B8CC 5D2LB 2VLJB 1OAUL 3WHXA 4G6FB 4BH8A 1XGTA 3LRSB 1I9RH 4QRRB 5EU6D 4BSWB 4MAYB 1H3XA 3OMZA 4PV8B 4XXDA 7CGTA 4XP5L 1T20A 5EO0B 5IB4B 3QHZL 4EZMA 3QHFH 3HRZB 1ZT1B 4U1IB 5CWSA 5D2LE 5DMIL 3RA7H 2NY0B 2CLVB 1UXSA 1MCWM 5GSRB 4XBPB 5IT2L 5HGDB 5IW3A 2OTWB 4JO2L 4KV5E 4PJBB 4DVRL 2NTSP 3EBAA 3DX6B 3DI3B 1TJIL 5EBLB 1JF1A 5ALCL 5KS9B 1LO2H 2GFBA 5LWYL 4WI9A 1UFUA 3FN0L 4YAQA 2CKBB 2D03L 3G6AA 4M7ZC 1MIEH 3VDCA 1JMZA 3AS2A 3JUYA 1WZ1H 3CFKB 1OARH 4ZPTB 3EO0A 1D9KC 4P2RA 4BH7A 3LKSB 4I5BA 2F54E 3BHBA 3ZSSA 4GKNB 5EORH 2HTKD 5IWLC 3BQUA 5C6TH 1HHJB 4ZYKB 5GS2H 4WGVB 1FFRA 4GJTB 3OKEB 1FPTL 3IFNL 2EXWD 2ADJA 1FORL 1SJHB 2ADIB 2B2XL 1UB5A 2YA1A 4OJFL 5D1ZD 3TNMA 4DGYH 3NPSB 4AEHL 3D3VA 1Z5LA 3LKQA 5EUOB 1FNAA 2ZOKB 1NJ9A 1N4XL 4U4BA 1N5YH 3CIQA 4ZPVA 5D8JL 3BXNA 5F71A 3MLVL 4JFDB 3W2DH 1IKFH 5IW6B 1A0QH 1G9MC 4YXLH 5HYQB 1DQMH 1YNTA 3G6JE 1I3RA 1WCQA 4NFBA 1NGQL 2VLLA 2F8OA 3L7EA 2Z8WC 3ARGA 1ZHBA 1SY6L 2JJSC 1CT8A 3I50H 3MYJA 3VD5A 3QEQB 3ZDZE 3UTTE 4YHKL 5EZLA 5IBUB 2EDEA 1ZLSL 4LLYB 5JXED 4RWYL 5DR5H 4HZLB 2P46B 4PJ5A 4R97C 4DFIA 4PJFA 4L8SC 43CAA 3B3IA 3ILPA 3KNBA 3VD3A 3BDYL 1RJLB 1XF3B 1YMHA 1FLTX 3AMKA 1RULH 1KIRA 4G8EB 5GISH 1KFAH 4LK4A 5D7IA 1ORSB 3QPXL 1ZLVK 1HCFX 4LSTH 1UGNA 1GHFL 1T1XB 3RAJL 4F7EA 1IAII 2OL3A 4QGTA 3MXWH 4MB4A 1I3VA 5KW9L 3VXSE 4FQQB 4G8FA 5SX4I 5KZCB 3S88H 2VAAA 2L7UA 3DROA 1RJZB 1EHXA 5EUOA 3T65A 1Q1JH 5TE6H 4PBWD 1SEQH 2Q8AH 3VA2C 1FFOA 4KU1A 4P9HL 3O8XB 1HSBA 2QADD 4G6FD 2MMXA 3IRZA 2FBOJ 4FG6C 3AAZA 4X0KB 3N9GH 3DVNA 2J8UA 5FYKH 3SE3C 3ETBF 5B8CA 4R90H 2WLZA 5HHXH 3O8XC 3QZWB 2FYYA 2UY6A 2CR6A 4PJEE 1XGYL 4X9BA 4PJ8D 3SPVB 2VN7A 4MDJA 2GI7A 4M6NL 5ADOH 2A6JA 1YEEL 4WU5A 2A9NH 4JY4B 4Y19D 5KVFL 2VC2H 2X4UA 4A6YA 4AK1A 2HJKB 2P7TA 1P7QA 3UJIL 5I19H 1NUGA 4N90D 4JJ5B 1JUFA 5ESVB 3ROOB 6FABL 3FFCD 4AL8L 4BK4A 1EERB 4F9LC 1A14L 2HH0H 4LRIC 1S7SB 5FO9A 5C2BH 5LBSL 3QIUC 2Y6SC 2Y25A 5I1KH 5I8OH 1L7IL 2WW8A 5I8EB 4P3CH 2AJYH 1U3ZA 1XH3B 3RWJB 4FHBD 1C1EL 1BGXL 3KJ4B 3GGWA 4ZXBB 2V7HA 3ARFA 4KKBD 5EZIL 1CXIA 1YMMD 1T0NB 1I8KB 2C3XA 1NBYA 4UINL 4U1HB 5FYJU 4QWWD 4QRPE 1GPOL 1T7ZA 4CW1A 5HGHB 2X4TA 4IRJB 1LEGA 4JM4L 5F21B 5INDA 4OFIA 4PJCF 4HUUB 3RWHA 4KK6C 1F13A 3WJJA 3WBDA 4YEFA 4H20H 4P59L 4Z77A 4JQIL 3MBEB 3MCKA 4G6KL 4PRHD 2A6DB 3GJFA 4C56B 4DOHB 3VXSD 1T66C 2FHBA 2R69L 5DVKA 4Y5VB 1GZQA 3R8QA 4A2MA 1G1YA 1VFBB 4PJXF 1U8OA 4O2CA 3TO2B 2H2PD 2DQEL 4NO0B 1A4KB 1N0XL 2DYPA 1QBBA 5GS0L 3U2SA 1IEAA 1I4FB 4WDIA 3NGBC 4PJHE 2XTJC 5HI5C 2NQCA 4WFFE 2BNQB 3VJ6A 4V2BA 4YHZH 1B2WL 3L1OL 3UBXB 1UENA 2E7BA 1U8QB 2DQDH 3T09A 4Q74A 5CD5C 1UKTA 4NQCD 1OD7A 3V0WL 5J13C 3Q5YA 3U82B 1MCIA 5ESQB 1RZ7H 3WE6A 4DFHA 1Z9SA 3K0WA 3G04A 1VCAA 4XXCC 2ZUSA 2IPUG 5DMYA 3QG6A 1MVUA 3J7HA 3NIFE 5IMKB 1VACA 4KPHH 3JWOC 43C9B 3C08H 4NUJB 3MV7A 4ZS6C 3U9PH 1Q9LA 1I75A 4PRHA 5E6ID 5I75B 5T33H 1FO0A 5ISZA 1LEKA 2HJLA 3VXSB 4U49A 4EN3A 1ZKAA 1FE8L 3C8KA 3OJ2C 3RL2A 4AIZA 3JV6A 3DMMB 2UVEA 5DUPH 4X83A 1Q0YH 4ODWA 2CMRH 2HG5B 5E8PB 3EOAA 1M7DA 4G43B 5JORA 3TJHD 1FLRH 4NGHH 1IAIH 1KC5H 4GG6F 5E8EB 4YHLH 5FYKU 3N1FC 1LD9A 4WEBL 4U1GB 5CD3B 1N6QH 5GSVB 2J6EH 3L7FB 3RVUC 3VXUB 1SEBB 1GIGL 4AJ0A 3HPLB 5TQ2H 3FOMA 4X7EC 3O4LB 2YD3A 5IHZB 4IMLB 2AVGA 4KY1H 3LH2L 5D1QC 4PGJA 2D7MA 3PNWB 3F7PC 1KCSH 1MJUH 2F5BL 3QSKB 5DD3L 5TDPA 3HPJA 5C0AD 3ULUC 2X4TB 1OWWA 4HIEB 2AV1A 4XMKL 3ARFB 4HCRH 4OZFB 2NW2A 5F1IB 5D5MB 4D9LL 5DRZB 3T0DA 3FQUA 4P46B 4U3CA 1S9YA 3QCVL 3MFFB 1M4KA 5FDWB 3S3PA 3VFVB 2VXTH 1M7IA 4Y4HC 3RNKA 1JK8A 3OKNB 4JO4H 1Z9LA 3B83A 3PV7A 4X6FA 3SE8L 1G6RB 1R24B 1UQSB 3U4BL 1BZQK 4MA1B 3S6CA 4OD1H 4O02H 1OAKL 2B5IB 5BRZD 5HTSA 1MHPH 5J9PB 5T3ZH 5IK3B 5LCVL 2Z8RA 4ZUSA 2HA1A 3HC0B 3JWDC 4DTGH 1NANH 1HH9B 1X9QA 3OBAA 3G04B 1J1PL 3O41B 5IWLA 5GIRA 3RVVC 5JNYB 3HMWL 4JG0H 1IGIL 3G6AB 1HH6B 1R3HA 4EBQH 4EUPA 3WJLC 3X17A 3VI4E 1DVFA 1VFOA 3ARDA 4F37K 4XMLL 3RWIA 3IJYA 3K2UH 5D6CB 4X98A 3V95A 5LG1A 2BNRB 4XPAL 2R4SH 5CJXA 5GPRA 1KG0B 5D2NB 3MGOB 2KKQA 3QDHA 3TFKD 1WWWX 1MY7A 3KPMB 2O93L 3QWOA 3TF7C 1YQ2A 1Z0MA 3DURB 5FUCC 4CU8A 4KVCL 3BRFA 4XAKD 4N9OB 4MNHA 4GMTL 3D0LA 3UZVB 1VFMA 5C08D 1F8TH 1S7TB 1MHEB 1RUAL 3TT1H 1T83A 4Y2DB 3D9AL 4Y89A 5IVXF 1DBJL 4LSQH 4JFHE 1CQKA 4XNUH 1LD9B 4GG6E 4N1EA 4L29A 3K8MA 3S3SA 5JQ6L 5J13B 3VXUD 3X3FH 4GW4B 1CFVH 4KK8C 1Q8MA 3TC9A 4AEIL 4UNVA 1A47A 2VZSA 5JORB 4XNMA 1RUQH 4ONHA 3PWVB 5K9QI 4MYWB 2E7CA 3K8LA 1FO0L 5TE7H 4I18A 3VFUB 2NXYB 43CAB 2GCYA 2E5EA 4OF7A 5CP7A 5JW4R 2NMSA 4K3HA 1IEBA 4RA3A 3P9MB 4WWKC 3RDTA 2B1HL 4JPWL 3K1KC 2FR4A 2HLAA 4M7ZB 4PR5B 3HZVA 1CU4L 2IPKB 4M00A 4WO4C 2XFXA 1V8HA 3ZDYE 4J3WA 3KDMB 2XWJA 4HUWB 3REVA 3TA3A 4AMKH 3MLUH 4JREC 5TE4L 3TA3C 1LE5A 4ZD3H 3MA7B 3KLHC 1H8SA 1XGQB 3QDJA 2VL5A 4ZPVB 3VD9A 3QI9D 3HUJF 3LKNA 4OI8A 4WFGE 4DW2H 3Q1SL 4GSDH 1MI5D 2CQVA 3DXAA 4TULL 3HC3H 2YSSB 5I1AB 4X6CF 2PW2B 1PY4A 4NC0B 3KLAA 2PETA 4ISVA 3LKRA 3U7YL 2A2QT 4LKCA 3FRPA 3EJJX 4HBCL 1PYWA 1FNLA 2IPTH 4HC1H 2PCPB 1KT2B 2A0LC 2LTQC 1RAMA 1KGCD 4PRPE 1KELH 4HS3B 4Y16C 1JPFB 4MAUH 4PS4H 4LDLB 4NFCA 3NIDF 5DTFB 3IAPA 5GGTL 4L1DA 3DOSA 4X80L 3WV0A 4P5MA 5DJ0B 1PW3A 4PLOB 4EI5B 3IU3B 2WV3A 2XZQL 3GIVA 3RDTD 4EUPG 3O2VL 5JZ7C 5K9JL 1U58A 2FBJH 5KSUB 3QEHB 2R39A 4J23A 4X98B 4RFEA 1NBZA 3UZQA 5E08L 1XIWC 3O6FC 3BJLA 4MCZB 2DTML 1G6VK 5L2JA 2P8LA 4JRXE 5DQ9B 3BKYH 5I0ZA 2CK2A 3MA9L 3BFOA 1AC6A 4NQXB 3UC0L 1AP2A 3WIIH 1XF4A 2A77L 2OZ4A 2VDMH 1GXEA 1CS6A 1K2DB 1BM3L 3PWPD 2X1OA 3QA3B 1FSKC 3QIWC 5EBWA 4FFYL 4LEXL 4Q9RH 1XR9B 4KTYA 4QO1A 4FABL 4LU5H 4Y2DA 4GW1A 2DQHH 4MAYC 4JFPA 3KJ6H 2VIRA 1HZHL 3IKCA 4I1NB 4TVSa 4ELMF 3R1GL 4ZQKB 1YQVH 3D1MC 1LDPL 1FFQA 3IS1X 1WTGT 3QHTC 2QV2A 2V2TB 4QT5A 5DYOB 3S37H 1N7MH 1W72H 1SJEA 3G5XA 3BT2H 4FXGA 4ZSOB 1A6ZB 2DS4A 3MGTB 4U1LA 4LGRB 1U3JA 1G0XA 2WQ8A 4G6AD 3NCJH 4MJIA 3W82A 3CGTA 1GGIL 3F6IA 1WVZA 1BQHG 4M6ML 4N0UA 2O5YH 3TWCH 1JN6B 3DTXB 5CZVL 5CHNB 1RU9H 1D5IL 5IF0A 2HT3C 4M6OL 3U9UA 2LQRA 1UM5L 2Z8SA 4JLRB 4MAYD 1D5XA 1DBML 1TZGL 4NBXB 3MGAA 4H5SB 4MWFA 5E99L 2HMIC 4IDJH 4XBEH 1A2YA 4XNZB 3FRUB 2B5IC 4JM2B 3CFCL 3MLYL 5A16B 3C6LB 3S35L 1R5IB 4H0GA 4X4XB 2JB5H 3ME0A 5BVJB 4X7SL 1FNFA 1S3KH 3MLRH 2VZ3A 3G5YA 4JJHA 1NFKA 4HH9A 1G7PB 4OLZH 4YDIH 4CU7A 5GGRB 1EZVX 3KLAB 3BQUB 4GBXD 3BIBX 4JHAH 4NUJA 4Y8AA 1I1AD 4LLMA 4JDTH 1CE1L 5H35A 1FJ1B 4YQXL 4L4TD 5HHOB 5ACZA 4G7YL 5F7DA 2EEDA 5KSBB 3S3JA 5ICXB 1RZJL 5JIKA 4GRWB 2AJZB 4PRIB 2X09A 3UDWC 4KUZL 4UAOC 5JHDB 4LQ1A 2J4WL 1IC4L 4BKLA 3HI1B 1HKLL 4MX7A 1FL5B 5CBEA 2I9LB 1SBSH 5FCUL 3SDYL 2DD8H 1FNEA 3L5XH 5C09A 1XF3A 4ZTPL 3KPQB 3RIAK 1FNSL 2BNUB 3W11C 3RKDC 2NLJB 3BKCL 3GSNA 5HHQB 4XCYB 1YPZF 4POZD 2VLRD 4HJGA 4AIOA 3OKOA 1F00I 4BFIA 1Z5LB 2D9CA 2AS5M 1ULVA 3ZZ1A 2ZZUT 4JFDD 3VI3F 5EU7E 5IBLD 5EFIA 4PTUB 1DQLL 1C08A 1IGCL 1YY8A 3GSUB 4QT5B 4WGWB 3OXSB 2VAJA 5MHSD 1I1AA 1ORQB 2X05A 4GRLB 4GW5A 1TNNA 4QWWC 3FQRB 1NDMA 4HIHA 5IESL 2IAMD 4OCSL 4WEUD 4R0LA 1I9JH 5IQ9A 4QHUA 4GRWF 5HI5D 3U0WL 4C83A 2BY1A 3T1FA 1KJ3H 4X7TB 4YBLC 1MLBB 4UNTA 5FYJD 3UAJD 5BQ7B 2HTLC 4TVPD 4XCEA 1KCVL 2DJ4A 1H3UA 5IHUH 4PJ7A 2YUZA 3AS0A 3EYSL 3KYKL 4GKSB 4E41E 2VE6A 3RWIB 5CSGA 3IVKB 4JKPL 2NCMA 3UJJH 1QVOB 4L9DA 3CX5J 3PQYD 2DQJL 4KI5D 2EEAA 1OSZB 4ZFZA 1UJ3B 5GRUL 4FNLL 4HMCA 3H3KA 4PG9B 3ZKSD 4XPHH 1G7MB 2ENSA 5ACMA 3U4EB 3GIZH 4U1MA 4CVZB 1UWGL 1KULA 1U8MB 4M7KH 2X70A 4YFLI 3V6OC 2VDPH 4CVWA 4NKIL 3ZHDA 1ES0A 5DFVC 4D0BB 1MFEL 2YPVL 1IAOB 2BOBB 3SJVB 5HSFA 1U8NA 3NACH 4ZAKA 5IVXB 2B4CH 2H26B 4NHCL 1TXKA 2QQNL 4N68A 5DWUL 1NMAH 1R3HB 2IBZX 4KJWC 3RVUD 4I0CC 2A74B 4PLNC 5FKPA 5B8CB 3HNSL 1QQDB 1YN6A 5E0QA 1TTUA 4XWOD 1D5MA 1FG9C 5H37G 3T0EC 2OR9H 4F9PC 1WFNA 4HIXL 2YPLD 4XB7A 1RMFL 5FCSH 4YHIA 3LZFH 1KPUB 3N1GC 1B0RB 3IS0X 1RJYA 1V3JA 4NQVA 1U0QA 5MERA 1TFHA 2BC4B 2VXVH 5I1GH 1IEBB 2VZTA 3DI2B 1VSCA 2OM5A 4L9LA 5I16A 4YZFE 2Y5TA 2W92A 4JQVC 2EYSB 2P8MA 3QCUL 2C26A 4IRSB 3SDAC 2GK2A 4WFFD 4JKWA 1AE6L 1X7QB 5INCB 3IFPB 1MF2H 1PG7H 1U3HA 4J3VA 2XI9A 4PJ9D 1JTPA 3MRBB 4LQFL 1HINL 3C5JB 4BQCA 5AG8A 4MLIA 2RGSA 4MS8C 4NRZA 1Z9OA 4L4TB 2LFGA 2CLRB 4M1GL 3K4DA 5ANMB 1T5XA 3KXFB 3S36X 2DIJA 1X5HA 4KZDL 1QNZL 1UEYA 3MUZ1 4YIQA 1ZLUK 1YNLL 1AGBA 3M17A 5K33A 1U8NB 4ZAKB 5C0EA 1BJ1J 2ARJA 4HWBH 3OAUH 4S1SH 5FB8A 1BFTA 1FGNL 4TUKH 2VN4A 4KQ4H 2EKSB 3BJ91 3NA9H 1G9EA 3HTLX 3QG6B 2AEPL 1KJVB 2AQ1A 3GO1L 4WW2F 3ZKQD 4WNQB 4HS6B 5DK3A 2EH8L 5DQ9A 1RK1B 2G9HB 2NY1C 3ECBB 1IVLA 1I7TA 4HXAL 4ELMA 5F9OH 3PDDA 2DAVA 3V52L 4UNUA 4GQ9H 5BS0A 2WINA 3X3GH 4OT1L 1JGDA 4D3CL 1TCRA 4KTEL 3BE1L 5D7LE 1HK6A 4WHDA 3HB3D 1OTSC 2CUIA 4NT6B 4FFVD 3IU3A 3TH3T 1T0PB 4GKNA 3G9VA 1W0VA 1HHKA 4P4KD 3G9AB 4YX2H 4ODBD 3RUGF 1TVBB 1A4JA 1JPFA 3KPTA 3UPCA 4KZEH 1CXHA 1PG7W 2RR3A 4MQSB 4PGDB 3C5ZC 1NGXA 5IV2B 3NN8A 2PNDA 2W0KA 3SKMB 2AEQH 2P48B 5BZDA 5F96L 3QUMB 4GS7C 1XEDA 1UT9A 4P5KB 1MRCL 4ZDHA 3T0EE 3H9ZA 3OR7A 1PFCA 4FTVE 3T0EA 1JIBA 5EBMB 2NTFB 4PJGF 5FHAL 4PRBB 3CSBA 3TM6A 5E2WH 5E5MB 4F15B 4ZOBA 1I9EA 4LAJH 1ZGLM 5KOMC 2R0WH 2MPAL 1I7ZA 4O4YL 4XP6H 2W9DH 3B2VH 4O51B 3SO3C 5H2BB 1A7NH 4D0DB 2UUDH 1E4XL 4MA1C 2PYFA 3L3KB 3GFUA 5F1NA 3QEQA 1A6AB 1CI5A 3ARPA 2VABB 4ONGH 3O9WC 3CPLB 2J8UE 4J4PA 4J3SA 4QRTB 1MCNA 2MQ3A 5E8EA 5CSZA 4NZUL 2JCCB 4DVBA 3K7UA 5KJRL 2R4RH 3EO9L 4OM1H 3DX8A 3RTQD 2VOTA 4MVBD 4O2FB 4UQ2A 1G9NL 4RFOL 3GNMH 2ZSWB 3QRGL 4AH2A 4NT6A 2CJUH 5I0DA 2AK4B 2YD6A 1A3RH 1A6UH 2KL6A 2VITB 3GHBL 5E2VL 4TVPH 3H3PL 3ZKXB 4PJXE 1NANI 5HYFA 3GI9H 1MREH 3IDIB 1WCBA 3MLZH 3L3JA 3TESA 2FO4A 2W07A 4MXQD 2MFNA 3ZKXC 2EKJA 4HS8H 3T2OA 3VRIB 5B38G 3G5YB 4PLKC 3LN4A 1AJ7L 2EZ0C 3AM8C 5T1KD 3F58H 1EEYB 1ED3B 4N5UA 1A7OH 1KJVA 3ZKMD 3VGAB 3KLHD 5DJ6A 4F3FB 1NEUA 4I3GA 2NZ9D 1QBAA 3JZ7A 3QIBA 5HGBB 5DD6B 5FDYA 5HY9B 3CXDH 2MWCA 2J8UB 3WNMA 2LVEA 1RUML 1YEJL 4JPKL 2I5YL 3G6DH 4XNYL 4JDZA 1G7PA 1I1CA 4FFWC 5KANG 3MJ9L 3PQYE 5GRXG 4O58H 5CJXC 1Q72L 3N1MC 5CUSH 5BW7C 4ELMB 4FXLA 3WJLA 1RZKH 4ZUTB 3H2WA 1OM3L 1EJOL 4CAGA 2OX5A 3M1BB 3V6ZB 3IETB 4O9HH 2KDGA 4G3YH 2A6DA 1JWSA 3GJFB 3O41A 1KEMH 4PJ7E 2C7UA 2YKLL 4QRRA 4ZG1A 3MOBL 5C7XH 3OXSA 4M9OA 3JVGC 3QQ3B 3RX7A 3ISWA 5TDOB 2DJUA 3CFEB 5C0AE 3VFUA 3DX8B 3WIHH 4MCYB 1WBZB 3B6SA 4Y8DC 3VFPA 3RWFA 3DVIA 1FL6A 4R4ND 3ARGD 4C56A 4HBQA 1QSFE 4E5XA 4AG4H 5L8JB 1I7UB 4CRPA 4U7SA 1XF2A 3KR3H 2VYRE 5TH2A 4RAVA 3PIQA 1MEXH 3MRDB 2NYYD 1GGCL 1QR4A 1N6VA 2YZ1A 5DHVB 1ADQA 4NN5B 4W4OC 5I17B 5F1NB 2W65B 4C54A 2L4OA 4IRJA 3LS5L 2DIAA 1EGJL 3MPCA 5KSAB 5ENWB 2P5WB 1OAXH 5HYJB 4OIIH 1LE9A 4XCYA 1I7ZB 4IMKA 2FO1A 2P8LB 1J0ZA 3E3QC 2ZNXA 1MRDH 1JZ2A 1OGAA 5EU5B 2V5SA 2Y9RT 4NQCB 3P11H 2JJUA 4OZ4A 1YPZB 1YY9C 3U83A 4XNQA 3W9DB 2VDRL 1MELA 1QSVA 3CUPA 2FJFA 2C7UB 5HBBA 4LL9A 1IGTA 1JV5B 4JHWL 5KANI 2OCFD 4ZOAA 4OM0L 1P9MC 4WO4B 5E2UH 2JK5B 2VQUA 4JGJA 2J5LC 1BQUA 3SEPA 4JVUA 5IVXE 1VFAB 2Q1EA 2BNQA 1ZLUH 1HHIB 4XCEB 2HMID 1QLRA 4GXVL 2Q86B 4XPTL 3QZWA 4WFHE 43C9A 5HGDA 5ELIA 3E6FB 4L3EB 4OLVL 3TIEA 2EC8A 2A1WL 4NYLB 1GAFH 1KIQB 5L8LB 3DX6A 3FCTB 2NY5C 1EEUA 2DQFA 2R2CA 3UTZB 2PO6A 2HFEA 1JPSH 1FBIL 4PJDE 3VXRA 1MCPH 4YHOH 1AIFA 5F7EL 2RHEA 4G8GA 4EVNB 5DEGA 3FFCA 2DQIL 3C6SA 7FABL 2DBLH 1EMTL 3JWOL 4NZDA 5E8OB 3FMGL 5DUBA 5IEHA 1J11A 1ZSDB 3SDCA 3Q3GA 1MNUL 5DVOA 4XMPH 1QR1B 3KVQA 3ARDC 1NGWB 4M1DL 2A73B 4UU9A 3OX8B 4RBPK 1GZPB 4UOW0 2OP4H 4JR9L 4ZFGL 1QSFD 1LE9B 2Z91A 3TIDB 3VGAC 4ODHL 5EU3A 1XZ0A 2MKWA 4NKDB 4ZQKA 5E5RB 1A6VH 4PY7B 5DRZA 5GS0D 1YNKH 5D6DA 5HD8D 3BOVA 3D85B 4LRNL 3MRGB 3UO1H 3KPNB 3A67L 3ZE0E 3L95B 4OV5A 2VDOL 1O0VA 4RX4D 1TENA 2GTWA 1U91A 5DFTA 1A7QL 2YD5A 4LHUA 3BIKB 1YNTB 5IUSA 3VXRD 2FZ3A 4OZIF 3CC5B 4M48H 2VQ1B 3BVNB 3CU1A 1DSFL 4PBXA 4V2CB 3BZFB 2D31B 1FVEA 2NNAB 2XYCA 3KPSE 1M1SA 2NY4B 5ESVA 3ROOA 1EDQA 5DD1L 1EGJA 3QNYB 4AEFA 1X6NA 3A0OA 3BH8A 3KPPA 4M7LT 3DMMD 4KK9D 4M7JH 4KI5C 3SDCB 2YWZA 2VLKB 5HHNB 1A6WL 3HNVH 5CEXB 1FYTA 2OK0L 3DVGA 4PJAE 5HI3C 4JHZA 4Z18A 4K9EH 3WMSA 1XH3A 3VI3E 3JTTB 5IHLB 3MCLH 3KPSB 5L6YL 5C0GB 2ZSVB 4PJGE 3NMEA 4XAWL 3TIEB 3EYFB 2AGJH 4PV9B 3CVHL 4R26H 3C60B 3I3DA 4ODXB 1KIPA 5SV4A 1G7LB 2DLHA 3QNXA 3W0WA 3HG1D 1I85C 2APWA 3BO8B 4DCQA 2FD6H 1IGYB 3TCLA 4JN2A 3FHQA 2OLDA 1UWEL 1YEFH 2JK5A 4K3EL 1NGPL 3KXFA 5DRXB 3W5MA 2AJSL 4TOYH 1LWRA 1LEIB 3T4AB 2PTTA 3FT2A 3VXPB 4QRUB 4QHNB 1CLOH 4QY8A 1P4IL 4B0MM 2RCSH 2Q76B 3LOWA 1EHAA 4HIIB 3X12B 5EUKB 3LQZA 1JCKA 1Y6NR 1RIVH 2ZKHL 3VFWB 3MODH 5IBLC 4JREB 3TVMB 1IE5A 5HHMD 4JQXA 5JPNA 3T0XA 4OCXH 3VXQA 1NUFA 4KVNH 2W1NA 5E6YA 4I0PA 2JB6A 5INDB 5I8KH 5AYQA 4MJ5B 5FV1L 3V8OA 3RWCA 3P0YH 4HC1A 4CJ1A 4PR5A 4UIMA 5EOQL 4C56E 2HKFH 1CQYA 3CU7A 5HVHC 2ZUWA 2E3VA 1FGVL 4NNYA 5ESAA 2EC9U 2MSPA 1QA9A 1OTUC 3D48R 3GUTA 1PVHA 2A9ML 3AC0A 3THMH 1T04B 3E8UH 3NPSC 4DN4L 2V2XB 4K94C 3I2CL 2IJ0C 4KRPC 5J11B 4BELD 5DJDB 2HT4D 2LU7A 2IBGA 3N85H 4OF8A 1BD2E 4BUHA 3IAGC 1DCLA 1U8JB 4OD3L 2EE2A 2IG2H 1WWAX 3T3ME 5HYQA 5K9KA 4G9FE 5AD0A 1WGOA 5T1DL 1JGLL 2VZUA 3V0AC 3L7EB 3IFLL 2X1QA 3QIBB 2LU4A 4NHUA 4JN1H 1KCUH 3GSVA 1NSNH 3L3HA 2FWOA 3BPLB 4K7PY 5LWYH 1VENA 4KGJA 4JFFB 2GSIB 1ZWIB 2Y72A 3AB0B 2EC9T 3B9EA 3S36H 5F7LB 2EEBA 1N3NA 2WUCH 3BKMH 4ISVB 1YEKL 5ADPL 1QFUH 1EHLL 4M3JA 1MCFA 2YPKA 3I6GB 4F7MB 4U3XA 2ADFL 4KROB 4NC2B 1DANU 5E2TL 2DYPB 1U8MA 3ZTNH 1BVKB 1C5CH 2NY2C 4RGOH 4QHLB 4K3DH 1A7RH 1BFOB 1W0WB 1DBBL 4BH7B 4Y4HD 5JUEL 1R5VB 4X9HA 3BPCA 4NM8L 1FPTH 3NIDE 4YBQC 3B5GA 3N50A 1XCTB 1FDLL 1ZLWK 3MJGX 1KYOK 5DA0B 1U92B 4H0IA 2IANA 3UYOD 4U0QB 3SO3B 25C8L 5KN5A 1QSEA 3QZWG 2YRLA 3BMWA 3EYQD 3PWJA 2YBRA 2HKHH 3REWB 5I18H 1FC2D 4S0SD 2QHLA 3EOBB 1BBDH 5F6HJ 4WI8A 4N0UB 3LRHA 3IDIA 3BH9B 4IIQC 3DPBA 3VRJA 2H32H 4KHXL 3QDGE 5KVDL 4HIEA 2Z92B 2AJUL 2MJWA 4UT9H 1NUNB 4PGBB 4UMGA 5CJ5A 4F33A 3PHSA 2R2EA 4JFZL 3PNWA 5D70H 2PO6C 3PGDA 4JM2D 3QUYB 4LLWA 3EJYC 4JFEE 3KLDA 4X7FC 5F1KC 1S9XB 2VSDA 2DICA 4YBQD 3H8NA 3ARGB 4TTDD 5LGHH 1MJ8L 1QBLH 2NW2B 1PKQB 2CXGA 2WP3T 2AXJA 2Q3ZA 1RK0B 1XF2B 1RIUL 3BDYH 1MH5B 2MHAB 4BFGA 3B3IB 3PWPE 4Y5YA 5CEZD 4I18B 5FA3B 4IBLT 3TT3H 3BKJL 4G8GE 1D6VH 4BQ8A 3RWCB 3VXTB 5FOBB 5IKCB 3ARFD 3BEVB 3U7AA 5IVNA 3QXUA 3AY4A 4ODVL 4AQOA 1IMHC 1YMMA 3F7YB 4JFEB 3NH7L 4HWZA 5JXEC 4OFYD 2MCPH 2P5EB 5D4QA 1T3FB 3I3BA 3S4SB 3PP4L 3NIGE 4OFVA 4F57H 1T4KA 2YK1L 4CNIB 1J18A 3NTCL 4KV5F 4QHMB 2ZG3A 1FZKB 4HGWB 4PTTB 1IILE 1LK3L 3QEGL 4MDJB 3FONA 2FCBA 2AQ2A 3VCLB 4G8GB 5EUOE 2DLFL 5HDLA 2AEWA 1WBYB 1SM3H 2EYRA 2H1PL 3DO3A 3N9GL 2ZUVA 1JZ8A 1S7RA 4W4OA 2J1KA 2DQFB 3OPZH 1A9EA 5E00B 1PYWB 4YPGB 5KSAC 4JJ5A 1BVKA 1JGUL 2C4FT 1JYVA 1JGDB 5D1ZC 5EU6A 2XICA 4CVUA 1XCTA 4ZFOB 4YGVB 4NNPH 2A6JB 1N5AB 2CH8A 4K07A 4ODTL 4ZFOL 1UB6B 5HHPB 3QXVA 4CN6A 4HKBA 2WUBL 1ADQL 3QI9C 1P84K 2WK2A 4HPYL 1JNLH 4PJ5E 1IC5L 1U95B 2BXYA 1YEDA 1UVQB 2BHYA 3E1F1 1KB5L 3OZ9H 2HLFC 1I3GL 3H0TA 1FRGL 2IPKA 4O2EB 3O9WB 4DKFL 3MRKB 4PJBE 1UH4A 1VPOL 1ZLWH 5D1QA 4E0RB 5LVEA 3ESUF 1OGTB 1ZT1A 4OSUL 2A0LD 4U1IA 4HMDA 1F3DH 2VH5L 2IH1A 5CWSB 5BV7H 1FL3B 5MEPA 2D0GA 1LO3H 3QH3B 4NZRH 3ILPB 1MAJA 1ZA3B 3PL6D 4XXDB 4MNGB 3G08B 1NAKL 5ICYA 2EIZB 5E6IA 3D18A 4G80B 1CDIA 2CK0H 3LIZH 3ZT6A 3CLEH 4LIQH 4GAFB 4LHUB 3EFDL 1G7JB 1HKFA 4XNXH 1XCQA 3AU1B 4LRIA 5B39B 2ESVD 3MCKB 3OB0K 3CDCA 1MQKH 1CGYA 1HDMA 3KPNA 3O45B 3D3VD 1BX2B 1E27A 5DJZB 4U1SB 1DQTA 5GHWH 3T0AA 5HVWA 1KXQE 5J0BA 2G5BB 2VLKD 1H3WM 1UJ3C 1M7DB 3VMPA 5JXAH 3DIFB 2FX8L 3BPLC 3RRQA 1Q0XL 4LBEB 5BO1H 1NCDL 3LN5A 2BFVL 4KKCD 4POYA 4RGNB 1XGRB 3TNMB 3RZWA 3ZYJA 1T89A 4Z8FL 5E8OA 4H26B 1HI6B 5HHOD 2APTA 3HKFA 3OKEA 4FZEL 1MVUB 1OAQL 2QQLH 1U95A 1KN2H 3MLSH 2K3TA 3S34L 4QTIL 1LO4L 5HGBA 2HFGL 4F7CB 4N8VB 5D2NE 4FA8A 3N06B 4ZS7H 4J1UA 4U6TA 5GGUB 3V5HA 12E8L 3IJSB 3QBTB 1R0AH 4Y4FA 1IJ9A 3SGDH 4YBHA 2J88L 3GSNL 4JB9L 2Z91B 3VDAA 3CCHB 4YUEL 1KCLA 5SWQB 4WUUE 4UT6H 2EXWC 4EI5A 4TPRL 5I1JH 2ADJB 1FO0B 1PQZA 5DO2C 5EC2A 4RFEB 4ONFL 4R9HA 4KK9C 3RWDA 3QQ4A 4EI6A 4QGYA 4MA7H 4JO1L 4OB5H 4XHJC 3RY4A 1HOCA 4HUKB 1G84A 1WISA 2O5ZL 3C5SB 5FUOH 1QTYT 4OCNC 1RVFL 3W0WB 1GC1L 3GKWL 3VA6A 5T33L 4HKXB 5DJAA 1D5BA 1WAAF 5TF1L 4Y1AA 3GSWB 2Q20A 4H1LG 5BS0E 4XTRC 4KAQH 4QXTB 1DUZB 3SGJA 5ITBL 4KJPD 1IQDB 4ELKB 3ARGC 2GUOA 3LPWA 5I1IH 5JW4Q 1V7NL 3U1SL 1P4BL 3QXDA 3X14B 1BD2B 4XZUB 4NWTL 3UDWA 4HK3J 2P47B 4KI1A 3L3DB 3FQWA 4PJ8A 5DGQA 3JTSA 3O2DH 3SGEH 4YC2C 4P5TA 1PGRB 2CD0A 3FTGA 1NAMB 2GY5A 1CR9H 5IW1B 5KSAA 3FRUA 3WNLA 3VXMA 1MCBA 1JFQH 5M94B 4UUJB 4MLSA 3TJHC 4OCWH 2AJVL 1D5XB 15C8H 3CLFL 5I71B 1INEL 2XKSA 3KS0J 3ALWA 3LKPA 5IIEA 4LSUL 5KTEL 5DEFA 5EN2A 4Z76A 4XMKH 3QXAB 4OLYL 1T04A 1QHOA 2XA3A 3QQ3A 1CGTA 3ARBA 4OGXH 3BN9D 4NQVB 4CN1A 2X9XA 5JR1L 4Z5RA 4ORZC 4CMHB 1HIMH 5JW4M 1F3DJ 2WBJB 4FQLH 1JHLH 4M1CD 1AI1L 1MWAA 4QOKB 5E03A 1IFHH 3HMXL 3QXWA 4ZNEA 3B5TA 1CWVA 5AUMA 2ENYA 1P7KA 3WS6A 2I07A 4K23L 1DUZA 3O8XD 2JJTC 2IQ9H 4OQ1A 4UOW1 2P8PB 2FB4H 4RQQB 3W11D 2A6KB 3O4LD 5BS0B 1OAKH 3V7AG 1IZJA 4FMFA 3ULVH 4UT7L 3K1DA 1OP3K 1H8NA 3GMLA 2JB6B 3FB7B 2YC1A 3M8OH 1H5BA 4UV7L 5I8CB 4HWNA 2EIEA 3O6LH 4JQXC 3KPMA 1P5UA 4XC1L 1UCTA 1K9TA 2P49B 2AABL 1KCKA 4PJGA 1HHIA 4P4KB 5A2LH 3RVXC 1N3NB 1IM3A 1UH2A 3C2SA 1BMGA 1HXMB 2RAMA 5C0RL 4YWGL 4LLUB 3PUCA 2EECA 5HYSB 3SOBL 1A1MA 4XXCA 3DROB 3QUXB 3WL9A 3OKKB 5GJTL 1QPXA 3CUPB 4XP4H 2VLKE 3ORJA 4LSDA 3VXOA 2PXYD 4A6YH 1LNUB 1YDPB 1L6ZA 4OCYL 1RZIA 4XT1C 5DK2A 4MDIB 1ONQB 3TN0B 4FFZL 3NFNA 4L5FL 5J12C 3LSOB 4L8SA 2YD9A 1NLDH 2E6PA 4GMSH 4LLQB 1HSAA 4C83B 1E6OL 5CEXA 3HAEA 1S7QB 3D2UA 3RWHB 1KENH 2MHAA 3GBNL 2BDNH 2V7NA 4LF3A 2JCCA 4BZ2H 3CXHK 2ICEA 1OW0A 3NFSL 4K8RD 1NAMA 3MRHA 3TJEL 5DRWA 2AXFB 1CFTA 3MYZA 1A6AA 4EN3D 3BVNA 1LEGB 3FO1A 4HXBL 4ODSL 5DVLA 3CDYA 5BXFA 2R2EB 5E4IA 1AFVL 4P5TB 1EVUA 3ZL4H 4NDMB 1LO0L 1GZPA 1EPFA 1UM4H 3GB7B 3MRMB 1NMCB 1U93A 3WLBA 5FUCE 3X13A 4PJFE 4JVPA 3WLWC 2JJVA 1LEKB 5ISZB 4L3CB 5FXCH 4C59B 4ZXBA 4HDIB 2CIKB 1YECL 4JKMA 1JVKA 1P5VA 1F3JB 3C60C 3U30C 1KLUA 1U8HB 1OTUD 3Q5OA 3QJHA 4HG4J 4CN4A 1OARL 5DTFA 5L2KA 4X6BB 2X4OA 4ZUTA 4YDKL 3SCMC 1IGFL 2FIRT 3Q1SH 4GSDL 1ERNA 3RL2B 3HNTH 4K3JH 4P2RB 4GQPH 4X4MA 1HSAB 2KZ1B 5DDHA 1MCLA 1N64L 2HG5A 1ZHKA 1UZ6F 2BOBA 3SJVA 4JRWA 4JKKA 5I1CL 1DFBL 3OKLB 4MS8D 5D7LD 1T1YA 2AKRA 1KEGH 4RNRA 2HJLB 2DQCH 1QYGL 5IHBA 3ECBA 4Y5VC 1T80A 1A5FH 2DIBA 4F3FA 5E94B 3AY4C 1F97A 3C60D 4DQOL 4KKLC 1IKFL 3K46A 1VACB 3WKNA 3TV3L 5F7HA 1U3YA 3LV3A 3QUYC 4MNQE 5C0CE 5CILH 4LLUA 5E08H 3VRIA 3TP4A 4LPTA 5TGBB 2NY7L 4LLAA 1DEEB 4M6AA 4JZJB 3LMJH 4PRAA 4OFPA 3HFMH 1A2YB 5CLWA 4DEPC 4OZGA 4YNYA 1HHGB 3RY5A 3KPSA 2VLJA 3A6CL 4GAGH 2L0DA 3N0PB 3GK8H 4QYOB 1FC1A 3P4MA 1LP9A 5BJTA 4YZFF 1CLYL 2ICWI 3M17B 1T1XA 5HYJE 4Q9RL 2Z93A 4WCYL 5JIHA 4FABH 5DMGD 4E41D 1FH5H 3PGFL 3DSNA 2IH3A 4U1SA 2BY0A 3L3OA 3C09C 3RDTB 3ULUL 1PKQE 3O2WL 4L4TA 4J6RH 1OTSD 2XQBL 1ZANH 5FOJA 3QDAA 2BOCA 1JPST 3C9NB 4KKAD 1E4WL 5B39A 5MEQA 5B38A 1FL6B 3OAZH 3S88L 4KI5F 1U93B 4LDOB 2F5AL 1UM6L 2P5WA 1RJYB 3QIWD 4TRPH 1NCCH 4PJ5B 5LQBH 1MRFH 4X6DB 5D5MA 5IVZB 5E5UB 1K6QH 4FRWA 4N0UE 3WS3A 1FVDA 5L7XH 3L5WB 3C5ZA 3T1WA 5A1AA 3GZKA 4U33A 1UB5B 1JPGB 3KAAA 5CGMA 2FEEI 5DUML 5ADOL 1ZTXL 5C0NC 3TBSA 4OZHE 1AQDA 4WTZG 1I9IH 4EOWH 2JIXA 1RZJC 3R0NA 5E4EB 4HKXA 5DJAB 4ZTOL 3MV8D 4U1KA 4S0TD 5AEAA 2UYLB 1KIQA 2WBWB 2XY2A 4KKCC 5J6HA 2I25N 2E7MA 1INQA 3OKDB 1JE6A 3TLRA 3WO4B 5MP6L 4NO3A 2QSTA 4PP1C 3C6SB 5GXBB 3QWQB 3PWJB 1QFWL 4MD0B 2BVUA 4KROD 5JW5A 1AP2B 4P3CL 1BD2D 1EFXD 4HWEL 5F7NC 1R5VA 3OV6A 4AEHH 5LAXB 5FIEA 3PWNA 3R06A 5FGCB 5JDJA 3V4UH 4RRPG 3O11A 4YQXH 1R3KB 5EIVA 2PW1A 1QHPA 3DV4A 1JRHI 5FV2A 1PQZB 1OAZL 3FQTA 1RZGB 5AZEL 4XVJL 1C7TA 4I3RL 4QRRE 3P2TA 1EO8H 4PJBA 2OI9B 1MCRA 4R8WH 4LP5A 4XHJD 3GSOB 4OGAD 2QADC 3LEVH 5F7FA 3VMOA 5FCUH 5CSZB 2DD8L 3TNNA 2VAAB 5D7JC 4RWYH 1WAAA 4KWUA 2HFTA 4ZTPH 2Z31A 4P9HC 1FNSH 1MLCA 1D9KD 3ARXA 5C0JA 1S9XA 2HVKB 2XRAL 4KMLB 3D85A 3V79C 2VITA 1GGYA 1S7UB 1RFDL 2LABA 4E5XB 1H3GA 3JTSB 3O6KL 1VFBA 1MCQA 2G60L 5KSBF 4I77L 3NABH 4LSTL 4P2QE 3RAJH 4B53A 2V5TA 3BZEA 1EUTA 1KXTB 3OHXB 4IOFD 5EZOH 4R4BB 2Z92A 4PREA 4HQQL 5GGSB 3IB4A 4YHML 1YJDL 2K1MA 3FZUC 3HG1E 4LSVH 5I73B 5CS7A 4X6CA 4GUPA 3SKJH 3ARTA 5GS1A 1RUPL 4R4FL 5GS3A 3W5NA 3I85A 5CIPH 3QEUB 3H0TB 2QBWA 4MD5B 1HHHA 1T2JA 3BWAB 3VFRB 3C8HA 4PB0L 3MLTB 4XNMB 5FM5O 2VUYA 4PJXA 1DJSA 1ODAA 3OB0H 5CAYB 3I75B 4YHPB 3SCMA 2R0ZL 1F3RB 2KUTA 3BO8A 2B1AH 2N7AA 3C09B 3RDTC 5JZ7D 1G7MA 3QCTH 4CVZA 4NFDA 3QISA 1X5AA 1G7QB 9CGTA 4MJID 4JPVL 4XVUC 3DX9B 1L6XA 4NQDE 3WDIA 2FGWH 3GEWB 1ZA6A 3HCVA 3SKUD 5DF0A 3RU8L 4LPCA 5DJYA 2ARWA 4NGHL 1R5WA 5DQJA 2V17H 4YHYC 5K9OB 3TBYA 2OTPA 4IDLA 3TH2T 4NKIH 3NFNB 5M95B 4ZPTA 4RZCA 1MFEH 3OG6B 35C8H 3T77B 4G6MH 5DJ8A 2QQNH 4XWGL 4I3SH 3ZYZA 1TQBC 3RZCD 1C5DB 3CDFA 4UDTB 2PKDA 1RIHH 2HWZH 5AWNL 2QQKH 5C0GA 4M3KB 4NQED 1BZ7A 4R96B 5J3HC 1ZVYA 3GHEH 1PSKL 1NKRA 3RKDD 4Z7QF 5E2JA 3L3IB 4OQTH 1J0IA 4G42B 4UINH 2X4QB 1QA9B 4X7CC 4ENEC 5FYJL 4AT6B 3BI9X 4JANB 4GG6A 3QNZA 4FXGB 1Z6JT 1DQQA 1YY8B 4XNQB 1IT9L 4ZNCD 3C5JA 5A16A 5C0BD 2IC2A 4RBPH 1H5BB 3QCUH 5CP3H 3TZVA 1C12B 1MLCB 3DIFA 3LHPH 5C0JB 4PUBL 1UCBH 5ICZA 1R3JA 5FB8B 5GGVY 3FN9A 4CVXA 5GZNC 2XZZA 1XR8B 3AVEA 2R69H 4IMLA 1WWCA 4RGMC 2DTSA 1AHWA 1HWHB 2D0HA 1S9VB 4HLJA 4BJLA 4OCLC 3GSXA 2CGRH 4UILH 1J8HD 2Y6SD 5I9QB 3HR5B 3MRHB 1KIRB 5IB1B 4TSAH 4XX1G 3V5KB 3I9GH 3VXOB 5I1LB 4MB5A 2EH7H 2XKNB 4G80A 1J5OL 4BZ1L 3RWJA 3D0VA 2NR6C 1XCQB 3AU1A 3PABB 4YO0A 3SGKA 3UTSB 2DQTL 4PRIA 5E8DL 1IM9B 1FJ1A 3BN3B 3MX0A 3DMMA 3U46A 1E0OB 4JQVA 3VWJB 5FYLH 5DHVH 5SWZA 3QDMB 3MV9A 1TJHH 2IQAB 4L3EE 5F70A 1SY6A 2AJZA 1FFPA 3WFDH 4HXAH 1KG0A 5D2NA 1ZMYA 1CL7H 2ZP0T 4F8QA 5HHOE 4NP4H 4A6YB 2YPKB 3I6GA 2R2HB 3EOTH 4NO5A 2CRIA 4QXGH 4J3OC 3IXTA 1A7BA 1W0VB 3T2NL 1TZIB 4YC2B 3S96A 3UTSE 3P9LA 5BOPA 4RMUA 1R5WB 1AR1C 5DQJB 3TT1L 1YZZA 4TSBL 4G6JH 2D0FA 1X5JA 3QUMH 1T1YB 1M6OB 4QXTA 2EDXA 4P23D 4JFFA 5DD0L 4GAJL 1WIUA 1CGXA 5JHDE 5D72L 3MO1A 3NZ8B 4M62L 1HXYA 5FOBA 1RUQL 3KPRB 4LSSH 3VFNB 1DN0A 4NN7C 2BRRL 2X4SB 3TBYB 2D7TH 1EEYA 4PJIA 1NDMB 4RDQG 3RNKB 4LLYA 4EN3C 3BP6A 4K2UH 3MRGA 4JZOA 2VXSL 4DGIL 1NCBH 4JRYD 1C08B 1ITBB 2Y06H 4CNIA 1X5GA 3WS3B 3VXMB 4TNVK 4XCFH 1CF8H 1ZHLA 1YEIH 5EU3B 1CBVH 2X4PB 4M7LH 1YMMB 1XT5A 3IDXH 1J1OL 1CD8A 4JAMA 5EN2B 4UTAH 4LASH 3HZKB 5ESAB 3VRJB 1MOEA 2X1WL 4Y5VA 3FOLA 4TULH 2NY3B 2DN7A 1KCRH 3IF1A 1NGZB 1ZS8B 2BSTB 3MV8E 4D0CB 3EO9H 1RUKH 4ERSL 2YEZA 1SVCP 2DDQH 4P23B 3DSFL 1EX0A 2R0LL 4NRYA 5HPMB 4RCAA 1G1CA 3QO1B 4X6EA 5D1XA 2J12B 3KGRA 1OP9A 2PF6A 2XZAH 5GGTH 1UACH 5TFSL 4LFHG 3O6MH 1QFHA 2DQGH 1IC7L 4QY8B 5I30L 4PJ9A 2ZUQC 3PQYB 3GJEB 4JRYA 4Y0GA 4I13B 1DDHA 5IGXL 1MCHA 3X12A 4RRPA 4UAOB 1QQDA 1YN6B 1ZVSB 1F4WH 5HDQH 5KSUA 1D6EA 1H3TA 2HJKA 4WDIB 1BVZA 4M9PA 3QXTA 4P4RB 4U6YB 1QZ1A 4R7NA 3QWRD 2VDML 3HE7D 3U0TB 1QKZH 4F58H 3CK0L 5I1EH 2W0FB 3P9WB 4I48B 4XWOC 1MAMH 2EDOA 4WI6A 2VXUL 1K8DB 3DNKA 3MXVL 3WXWL 3QUXD 4NCC1 1YYMH 4APQD 2FATH 5AZ2L 1CFNB 2Q7YA 4WUKH 3GBLA 5HYEA 1FNGB 1WICA 2Z35A 4ONOA 3ILQC 1AO7B 4XC3L 3QDGA 4P46A 2R1WB 4JFED 5GGQL 4K8RH 1W72L 1QLEL 5DHVA 2OJZH 1VGKA 2AXGB 2P44B 1CGSL 1CFVL 1FCGA 4WFHD 3WO4C 3FO1B 3CH8A 5TH2B 1MFDL 3DUSA 4U6XA 3VH8G 3MGTA 1S7XA 1BIIB 4YDVB 5F1IA 1FIGH 4CADA 1MCWW 1J1XH 3U4AA 1YMHB 5DMIH 4AG4L 3VFPB 1QOKA 1OGAB 2BP3A 5CCKH 1KXVC 5JW3L 4JO2H 1P2CA 1DBMH 3HE7B 4UB0H 2X4PA 3U9UB 3VFGH 5C09E 1CG9B 5DXWA 2VQTA 4IDJL 4XBEL 1A9BB 4M43L 5D1QB 3MFFA 5D9SB 3ARVA 1F42A 2AJ3A 4OIIL 3OHXA 4PJDF 1WZ1L 3D25B 4U1JB 5I1DB 4HX1A 2CO7B 4CMMB 5C86A 1MWAL 3FJTA 2OSLB 3CSYA 2GIYA 1I7RA 3AREA 4P46D 1OB1A 2D4FA 4URTB 1G6RL 3VG9B 4P2OA 3L5JA 1KPRB 5EZLB 2C3HA 4MD4A 2RFXB 2W9EH 5GRVL 1I8LA 1MFAL 2PO6B 4YDJA 3HAEH 4HT1L 4WI7A 4D9RE 2NPLX 5DEGB 4LPXA 1RD6A 2R9HC 5FKAB 4GFTB 3GDBA 5DUBB 2DMCA 1KN4L 3DARA 4FP8H 5ISZD 1A0QL 3UTZA 4DKEL 3EAKA 5ACZB 2YR3A 1JGVL 2R8SL 3JV4B 4R7NB 4Z95H 1HYSC 5EDXA 2DTMH 3D3VB 5FGCE 4AM0A 3JV6B 5DURD 1HKLH 4TSCL 4QYOA 2GYSA 1DZBA 2BJMH 1JPSL 3WIIL 5CJ8A 4P5MB 2HT3D 4YHOL 4RZCB 2V9TA 4PRAB 4KJYB 1U58B 1MCDA 5DJ8B 5CZXC 1OQOA 3MUGB 5T1KA 4Z7WF 3BHBB 1BFVL 1RULL 3ARBB 2G9HA 4PJ8C 5JHLH 1TNMA 3V0VA 3O3AA 4XPBH 5GRYA 1LDSA 1SVZA 1QPPA 3KJ6L 4UQ2B 3SDXE 3EDKA 4MJ4A 2C1OB 2ATPB 3PHOA 3ULSB 3PWUB 4JRXA 3R1GH 1IQWL 2PCPA 5C0AA 4GKZB 4U1JA 1T7YA 2BVTA 3CPLA 5I17A 4LARL 1B3JA 3RZCC 2ZOLA 1JGEB 1WCBB 3D6GA 2B0SL 1VADB 3VDBA 3F6LA 4LRNH 3UTSA 4EDWL 4Y19B 5IW6A 4K55A 4R0LB 5I74B 3SE4A 1FVCA 4IMKC 4NKQB 4M6MH 4KQ3H 3QXAA 4TNWF 1A1NB 1KCVH 4PRPA 3H7BA 1GZQB 3WFCH 4PRNB 1U8LB 5B21A 3MYJB 1UM5H 1KGCE 1RJCA 2EIBA 2GTWB 4EI5C 3SY0A 1NKOA 3FO9B 4PGEB 3QDMD 5EFIB 1DR9A 4JY5L 3HUJA 4HIJB 1DSFH 4M6NH 5BVPH 1YEEH 1MJ7L 1HNFA 4XX1E 1T21A 2HRLA 1TQCC 5I19L 4JKLA 4HJJH 2R29H 3CFDB 1YDPA 3GIZL 2B8OT 2DQUL 1PEZA 1WZKA 3QO0A 3JVGA 3V4VL 2P5ED 3MLRL 4CKVX 5L8KB 3MRJB 2VXQL 5DD5H 3WL9B 5I8OL 4U6VL 1T83C 5FO8B 4KJQC 4KTDL 4MNGA 3VXRB 2V2WA 4EI5D 2XZCH 1C1EH 1GGTA 5FUZH 3HNSH 5BVJA 1F58L 1CE1H 1P6AB 3LQZB 3SN6N 3H7LA 1GGBL 1NC2B 2C3GA 4YLQT 5ILTH 5BV7C 4CL7A 3DVFA 1JNNH 3W2DL 3GRWL 4X8JB 4X0KA 3T0WA 1YEFL 5L9DL 3SE9L 3O11B 1RZJH 2CRZA 5DC0A 2EDFA 5GGRA 1XGUA 4XVUD 4PG9A 1K3ZA 2R56H 1KIUA 4NO0A 1G6RA 1R24A 1K4DB 1UYWL 1NPUA 4I2XB 8CGTA 1IEAB 3HR6A 5DSCB 5F6IC 1OPGL 4H20L 4O5LH 3JV4A 3LEYL 5ANMA 3CSGA 3FT3B 4KKBC 4OGYL 3L5HA 3QUZA 4ZFOA 1CZ8L 2EICA 3IFOA 4L1HA 4CDHA 3DRTB 4LGSB 1K85A 1HILA 3EYOB 3TYFA 4KVNL 4FTVA 4R7DA 1G9MH 2FJFB 1CGUA 1BQHA 3Q6FA 3P0YL 2AK1H 4H5SA 5TDPB 4ALAH 2GCYB 1RV6X 1U8JA 1AXSA 4RDQF 4WW2B 6CGTA 4YK4B 3WCYA 2GJ6E 3B9KB 3D18B 5HYJA 1GHFH 3MLXL 4LAQH 4LSRL 4HWBL 1BEYH 1E4KC 3OAUL 4S1SL 4HG4K 1KLUB 1U8HA 2VRAA 4L9LB 4PJBF 2OJEB 2FSEA 5MEPB 3WDHA 2H9GB 4KQ4L 4F7EB 5BRZE 3NA9L 2BNQE 1YC8A 3QPQC 3UJTL 1WJ3A 5E9DD 5A3IC 4K94H 1W72A 1MI5A 4QRPB 5JOEA 1G7JA 3LY6A 2IG2L 2X89A 3RGVC 3VFTB 3P40A 4KMQA 1WC7A 1S5IL 4ZAKC 1D9KB 5EOTB 4KPHL 4K7FB 2XTJD 2O61A 4LLDA 3RUGB 3X3GL 3IGAA 3CFJA 3P30L 2UZXB 3O4LA 2EDLA 3CXHJ 3EZJB 3PHQB 2CKBL 4POZC 4ODXA 3STLA 5ALBL 2R1XA 4W6YB 4JY6A 1IAMA 5IEHB 4H1LA 1JPTH 3IFOB 4X4YB 3DYOA 5IB3B 3K4AA 3SKMA 2OXHA 2FX9L 4R7DB 5IG7A 2NXZB 4NCC2 1OSPL 2KH2B 2QHRH 3WUWA 4YHLL 4WV1A 5HYJD 2Y07L 1A14H 2HH0L 3HRPA 2VDNH 4XVSH 1WIOA 2R1WA 2XPGB 3NGBB 4Y5YC 3KPLA 4WEBH 1EZVY 4EN3B 3CMOH 5C2BL 3DECA 1C7SA 5LBSH 4GOSA 4M4RA 5I6XB 3MNZB 4DKAA 1DBKL 4R2GB 4S11A 3ULVF 3LPGA 3P4MB 4M1CC 1BFSA 3RWDB 1ZVSA 2X10A 1NC2A 3DJ9A 3TO4A 4ENED 5J1SC 4U1MB 1OAYH 1TCRB 3MRLA 3NCMA 1A1MB 1HYRC 3LV3B 2VQ1A 5HVGB 1PLGL 3QFJE 5TGBA 1Q9OA 3L9RB 1TQCB 4PRDA 3W0WE 4H0HB 4GRLA 3BQUD 1E4XH 2XG5A 5BOZG 4X6EB 1I3UA 5D1XB 2DWDA 4IIQA 3G6JF 4QOKA 1CDHA 4BSWA 1NL0H 4NZUH 4P23C 1CK0H 4P9ML 4L3AA 5CJOL 4X8XA 3BEWA 1ACYH 3ULUE 3WFEL 3L3JB 1HINH 3RUGE 1I7RB 1QACA 2O5XH 4XBPA 1L0XA 2VZ1A 1MFCL 1RQ5A 3SDXF 1A6PA 4NKMA 3AREC 5MEOB 2EE3A 5T3ZL 4CVXB 1AGFA 1UG9A 3MC0A 5D96B 1SEBA 4GLRI 4QCIB 3ES6B 3SGDI 2H9GA 5D7SH 5BRZB 2C1PA 4JZNB 4CADB 4K7PH 4RFNC 2YA0A 4MNHB 3UTTB 1NFIA 4Z0XB 2D7OA 1BHGA 1VERA 5CGYD 4N1CA 3NH7H 1L9NA 2LTQB 5I66B 4KK8D 1T03H 1XZ0B 2DLGA 3K2UL 4GRLD 4J8RA 4R97B 5A2JH 2C3WA 2VNCA 2OR8A 3CXDL 4FMKA 3DX7B 4QOKD 2BC4A 1WSST 2I5YH 1JZ4A 2EDDA 3K81A 5B4MC 5EO9A 1RURH 4PGZA 1EHNA 3ROLB 2J7LA 2DLFH 1N6UA 3ARDB 3ARFC 5F7WC 3CVIL 1DVFD 4Q6YA 4G43A 4OKDA 5H37H 2H32A 2H26A 2AERT 3S35X 4MXWH 2NY5H 4NQDA 4P46C 3CFEA 3B8YA 4JFOA 4LVNB 3RGVA 4MMZC 1DBJH 3IKKA 2CMRL 5HHOA 2YKLH 3QEQE 4NO3B 3TO4B 4DJMA 4IJ3B 5D93B 4JY6B 1R3KA 1T1WA 2LE9A 5IJVA 5C0EB 4FQXB 1KTDA 4O00A 2AEQL 1QSEE 3V4PL 3MRRB 1EK3A 3S4SG 4N8VA 3LRGA 1IM3B 1ZHNA 3BPNC 3MRIB 4N90E 3LH2H 1ZLSH 4XNZC 1EEZA 1CU4H 1KCSL 2F5BH 1KPVA 1GL4B 4K3GA 4N8CH 3V7AE 2GQHA 2BVOA 4XPFH 2ARJB 4XI5D 3H9SD 1A7NL 5TQ0L 4R6UA 5FA3A 1NGZA 4D0CA 4KRPD 3HAEG 5C0BE 4OZGF 4NQDD 5KAQF 4YE4L 4OZFH 5IKCA 1F4HA 3KYAA 2ZJSH 4YHNA 3QPXH 3L3GB 5D7JB 4G9FD 5CBAA 4JO4L 4IRZL 2I60H 2WBJC 3T8XA 4LVOC 3MQIA 4OLUL 1KBGH 3M45A 3QRGH 5J7CC 3VH8A 3O3UN 3FOLB 2JJTA 3L3KA 3O45A 3P3YA 3EZ8A 4HIIA 2DM7A 5T3XL 2IANE 2AAVA 2V7NB 1Q0XH 5C9JB 1MREL 2QQQA 3HI5L 3K80A 3MNVB 3MLZL 2X7LA 1JRHH 3PWVA 4Y19A 1QLFA 2YN3A 5DQDL 3VFOA 4D8PA 1J0JA 1NDGA 1MSPA 4K71C 3JXAA 2QSCL 5K9JH 4FZEH 4MJ6B 5TPWL 4JFYB 1G0DA 4P5KA 4GXVH 3MRRA 2FBJL 1I8MA 2NY1B 2YMXL 5C09B 5HHXL 3VXSA 2VSCA 1S78D 2FJGA 4PB9L 3ZDXE 1HHGA 4YDLB 2YBRB 5FFLA 1CD1B 1VEPA 4D94A 3H9SA 2BNRE 4KDTC 4L4JA 5FA4A 3F7VA 4UT6L 1RUMH 1N5AA 4JPKH 4TPRH 1EA9C 4QHKI 4E42B 4P4RA 4U6YA 4UQ3A 3OR7B 3IDYB 4HKBB 4D0BA 3B9DA 2DMBA 2NY6D 1CFNA 2Q7YB 1GC1C 4F7MA 3T0BA 4NM4H 3L3DA 2KBGA 4HF5H 3OJMB 5BZDB 5IJVB 1RZKL 2XWTB 1AO7E 1RZKC 4X7DC 1QLRB 4RFNB 3BPOC 2AJYL 1R6VA 5EOCL 5KVGL 5C0ND 3RWGA 1GGUA 3QYCA 2FJHB 5EO0A 3VRLE 5T3XE 5C0IA 3BT2L 3B9KD 4MZ3A 1AXTL 1D6EB 5KVMC 4LEOA 3A67H 4ORGB 1F4XH 3P9MA 1Q9WA 1R5IA 3S4SA 3O6FB 5HYSG 3IVKA 1N2RB 1FO0H 3OGOE 1JTTA 1BBJB 3CDGA 2RFXA 4QRSA 4PGCA 4FG6D 1MJJA 3WD5L 3N1PC 4A2LA 3HRZA 4Y4HB 4U1LB 1IGML 3PWLA 3GSXB 3QDJB 4G5ZH 1XIWB 1M71A 1PD6A 1FYTE 3RWEB 3TIDA 1ORQA 2D03H 5D71L 5TE4H 1GRWA 5CIPB 1A1OA 3TO4C 3CFCH 3F7YA 3LQAL 1S7UA 2Z31C 2HFFA 5D2LA 3CSPA 2BOCB 4M8QA 1A6WH 3NA4A 3LRSA 3MJ7B 1Z3GL 4HKZA 4M93C 5EORL 4OTXL 2AXHA 5IFJB 2VDRH 3CSYB 4WV1C 5EIIA 3TGXA 5C8JB 2I27N 1PZ5B 4OJFH 4PJIE 1TZHA 1FAIL 3RL1B 5JMOC 4JHAL 1IZKA 2ESVA 4PS4L 2GHWB 2E6QA 1SYSB 4JE4B 4WW2C 4H88L 4X80H 1DN2A 4MQXD 5DO2D 3U6RA 3HI6H 1QR1A 5C08E 4IRSA 2WINB 1D7FA 2XZQH 3DXAE 3P73B 4TVPE 5E1AB 1DQML 1MJJB 2J4WH 1NGQH 1OGTA 2L7JA 1NAMH 1INDL 2ZPKL 2GKIA 1MPAL 2OBGA 3VXQB 5CZXD 3GI8L 1E6JL 5C0DB 4KMTL 1HXYB 3JSSA 2ZSVA 4LLVA 3HHRB 3MODL 1FLRL 3ZHLA 3FMGH 4PV9A 1L4IA 2KZWA 3VWJA 3IETA 2J2ZA 4MD4B 1UB6A 2RJMA 2BY3A 3INUH 4WU5B 4C4KT 1J8HB 2ICWB 2XT1B 5DJCA 2OL3L 1JI1A 4FQIH 4Y16A 4DUXA 4YFDB 1QBMH 4OCRH 4QTHB 3E0GA 1F90H 1JN6A 1DQLH 3DTXA 4L9LC 5D7LA 1OT2A 2VDQH 2XN9D 4LSPL 4KHTH 4HV8B 4NQEA 5BCAA 4LFHD 2JJWA 2R0KL 1LP9E 2XFXB 5IESH 4N0YH 4HAGA 3MJ9A 1IBGH 3ZE2F 2VWEE 4I4WA 1XGRA 4HSQA 2GK0A 4BSVB 4RA0C 5DLML 5INCA 2DLIA 1AR2A 4Y4KD 3BESR 1NFIB 3EUUA 4Z0XA 1U6AH 5ID1A 1RHHA 3I75A 3WNNA 2ITCA 2I9TB 2ZNWA 5FO8A 2ZUQB 3LEXB 3TZVD 5J57B 1WBZA 2HN7B 5FYKL 5IT2H 4M8QB 5GGSA 5CHNA 3EYSH 3KYKH 4ZS6D 1T1ZB 4DVRH 4IEFB 2EYTA 1ND0A 2X41A 4L8BB 1AGFB 2A83A 1TJIH 3EGSB 3IF1B 3IFLH 1KACB 5GS1B 3V5DA 3QFDA 1V7MH 3SE8H 5IOPB 3PIQB 4LCWD 4Q2ZA 5EIIB 2H2SD 1FFNB 3UJIH 3HPJB 3QULB 3ARDD 4LNRA 5IBTH 5IB5B 4J3TA 3TEUA 4JGMA 3WFBH 1EBAA 4NQEE 5FYKD 5KVEL 2ORBH 1EFQA 1JP5A 3FFCE 4XCNB 5J1AB 4WIQA 3P4OA 4ODUB 1A21A 2VDKH 4DZBB 1IGIH 2B4CL 4QRUA 4H8WL 4UZGA 3BIAX 4AY0A 1A7RL 5C0FA 4XCCH 3SQOH 5A3ID 4EBQL 2BMKA 3S5LB 4BZYA 2WIMA 5T5NF 2ZUXA 4O51A 5KSBA 3CVHH 1H5BC 2HFEB 3WLWD 3I84A 4XP1L 4H1LH 4PJHB 3IU4H 5C08A 5CEZH 3C5SA 4KK6D 5DGRA 3VXNA 1ZT4B 2PXYB 5D1XC 1F4YH 3FQWB 4J2XA 1KSRA 3LZFL 3ULUD 2FECI 2VWEC 3I6LD 1OOAA 4J4PC 3MROA 1EIBA 1YEGL 1JUFB 3MREB 2CRMA 4D9QE 1IQDA 4ELKA 4Z7VB 1NGWA 1H3PH 3CZFB 1ZLVH 1K8DA 3UROR 2Q86A 4S1RH 4ETYA 1KIPB 3P9LB 2VLMD 4IM8A 1ZSDA 5GGVH 3IDMB 4JFZH 1CE6A 1DVFC 3MV8A 4YK4C 4OLXH 5IFAH 2RCSL 4KRPB 4DCQB 2CO6B 2IGFL 3MR9B 3H9HB 1W0WA 1RJZA 2E27L 3AFLA 2HRPL 3MOAH 3RVTD 3DGGA 1B4JH 1BQSA 4U1GC 4PYHA 3TCXA 1WLHA 4M1GH 4M5YL 2JTDA 4PJAB 1OCWL 1JF1B 2VJXA 4G9DA 1TPXB 3SDXA 3F12B 4RWHA 5T3XD 5MHSE 3GSQB 5C1MB 4JHBA 2FECL 1V05A 1L9MA 4TUOB 1FGVH 2CDGA 2FZ3B 4ETQB 1L7TL 3LD8B 2HT2D 2XA8L 3O2DA 4IJ3C 3VGHA 2XKNA 4WV1B 1ZANL 5C71A 4PPTA 2RIKA 1AKJB 4PY8J 3OXRB 4GW5B 4CMMA 1JPGA 4LDEB 5ALCH 4XVTL 2AEPH 5IVZA 3QFDB 1QSFB 4M61B 5D7IB 4UIKL 2FSEB 2BVQA 2YK1H 4AMKL 5B38B 3LB6C 3NTCH 1J8HE 1PKOA 3NZHH 4Y5XA 3LAFA 5JLZB 2PYEE 2YRZA 5EU5A 3QIUA 2UZIL 2PTUA 5IHUL 3EO1B 5FO9B 2BNRD 3DV6A 3LQMA 5T1DH 1K6QL 1DANT 1X5KA 4M03A 4LVNC 3BXNB 3GBML 1AGCB 1D9KA 5EOTA 2CUMA 4Z7UB 4PD4K 5E24E 3B8SA 5T1LA 3Q2CA 2AW2A 3GMPA 4WW2A 3Q6GL 1FORH 2A9NL 5EBMA 5EWIL 5JA8B 3G5ZB 2VISA 2VC2L 2X4RA 1OLLA 2A83B 3EGSA 4KJYA 3B2UD 3DYPA 3RVXD 2NY1D 3RPIB 2BNQD 2WBKA 4IIQB 3UTPE 1PAMA 3K8KA 4FNLH 1SJXA 4ZNEE 5I71C 3C2AH 1CG9A 4Z0BL 2WUCL 4P2OC 4ODWB 3HLAB 1BAFL 3V6FA 1I7UA 2VDLL 1NLBH 4G7VH 4LCIL 3RJQB 1JTOA 2ITDB 4MA8L 2CUHA 2C5DC 1N6QL 2ADFH 1QFWI 4P2YA 5F89B 3WNKA 3H9SE 5MENE 4BUGA 4YXKH 2F58L 1DEEA 3OKDA 3MUJA 3QQNA 5EA0H 2BX5A 4WWKD 4OIBA 3SDCD 4OSUH 4UBDC 2VH5H 5BV7L 2OR9L 5DFWH 2UWEA 1G7HB 3SBWC 1YEHH 4HS3A 4KRNA 2ID5A 3AUVA 1CTOA 4HFWA 3ZTJG 1M7IB 3QAZC 3R06B 4W4NA 5DJ2A 1CE6B 5F3BB 4JM4H 5IB2A 5GRJH 5GISL 2BRQA 5DMGC 2NY6C 5L88L 1SMAA 2YN5A 2AI0H 4YXHL 3UTPD 1FV1B 5B3NA 5KJRH 5KS9A 4N5EC 4JQIH 4OM1L 5TJWK 2X1XR 2JE8A 3KPLB 2FJGB 3FO0H 3HC0A 5GHWL 4XPGH 3EIFA 2X4RB 3G5VB 4KKAC 5FF6A 3W9EB 3DV6B 5DT1H 4OQTA 4X6DF 3BSZH 5DJYB 5JXAL 4PJCB 2VKWA 4MZ2A 1UQSA 4UBDD 4QRTA 3O3EA 1SEQL 2Q8AL 1NCTA 3BUYB 4W81A 2W65A 4P9HH 2BVQB 2PW2A 1O5DT 4HHAA 5EH1A 5CGYC 5DA4A 3QHZH 4OZFA 2MNUA 3WHXB 4PRPB 4L4VD 4YFEA 3RPIA 4XI5C 5D1ZB 4PJEA 3EYQC 3F58L 4LPVA 1BP3B 1U8LA 4M61A 3NCFB 4CBPA 4XH2B 5E5MA 4R3SB 2F8XC 2ZOKA 3BP4A 4Z7UA 1EV2E 3OKYA 4JG1H 3UTTA 4MJIE 4R4FH 1FYTD 4QNPF 1PZUB 3BEWB 1J7VR 4NJ9L 4UU9B 3MBXH 3O4OB 1VADA 4F15C 3DHJA 4OZGB 4YNYB 4HIJA 6FABH 4BFBD 3C08L 3HZYA 4NSKB 4P57B 4X7SH 1NGXB 4GQ9L 4Z78A 4OB5L 1EEZB 1SJHA 1EO7A 1S3KL 4OZGE 5E7FA 4OKVB 2NZ9C 3OPZL 2FRGP 1FV1A 2BVEA 3FT3A 3CFKA 5ESQA 3WE6B 1JHKH 1HOCB 5KS9E 2K9UA 1Y18A 1FL3A 4OZHF 2OMNA 4FFVC 3BGFB 3BZ4A 1FP5A 1IGYA 3TCLB 3MRPA 2XQYK 4FTVB 5A2FA 4FQXA 2FGWL 3KXFD 4DK3A 2X40A 5ETUA 5BMFH 1JZ5A 4NWUH 3DV4B 4ELME 4JZJA 3HN3A 3MLVH 1G7HA 1MFBL 3HZMA 3C5ZD 4YPGA 4KUCD 3HS0A 3B9KC 3OJVC 5I15H 2LVCA 3PQYA 4ZO7A 2XWBA 3NN8B 4KUZH 4NQUA 5H8DA 4AM0B 1TLKA 3QWOB 1IC4H 5F3BA 5E70A 3T4YB 5CSBA 2Y23A 1KF9B 4NJAH 4XWGH 5EU4B 4OGAC 1VPOH 2QLVB 1A7PH 3RFZC 1WV7T 3RHWF 1GSMA 4I0PD 4QXUH 4DAGL 3TPUA 2WIIB 4G6KH 2FEEL 3WKML 1FFOB 2Q7NA 2SEBB 1PSKH 3VG9C 1MHCA 3CX2A 4JVWA 2F15A 2X5PA 3ZYIA 3FB8A 4LSUH 5KTEH 4RMVA 1NEZB 3RGVB 3OR6B 1ORSA 4YIQB 3V2AR 2F54D 2CDFA 4ONGL 3GMNB 4FOMA 1KFAL 4AQ1B 4JRXD 1VKXB 1FFNA 3VG0L 1FN4B 3CFBB 4CW1B 1WAAE 3MRCA 3BW9A 5I1DA 4Q58C 2B4CC 3LHPL 1RZFH 4FQXD 4PUBH 3U7YH 3ARSA 1F11A 3ZO0A 4O02L 4LMQE 1NQBA 3CAFA 2HN7A 3D25A 2UYLA 4RMSA 1Y6MR 2IQ9L 4HHAB 1MWAB 5JOPE 1Q1JL 5TE6L 3O6FD 4EQ3A 5T5FH 4OD2A 1KUMA 1T2QH 4PRPD 4NOBA 1S78C 4NQTA 3DWTA 4Z8FH 4Q9QH 3H7BB 1F02I 1MUJB 1KN2L 1J05A 4RMQA 1KTLA 2DMKA 1SHMA 4MJIB 4PLJC 2Z31D 2IF7A 3MRNA 1KB5A 1R3IL 3O3DA 4IHOB 3LDBB 3L3OB 1MCKA 3JWNC 4XMLH 4HWUA 2DQTH 5B3JE 4HV8A 5F9JB 2P1YA 1J10A 2DQJH 5F7EH 1BECA 1YEDB 5CBAB 4L3ED 3SOBH 3F7RA 4PFEA 4WENB 2DI7A 5FGRA 2A74A 5GJTH 4QLRA 5DURB 1JF6A 1S7SA 1X3DA 2Q6WA 3QAZB 4Y4HA 4CDGC 4MA7L 1RHHB 1CTNA 4FQJH 1IARB 2E7LA 2YPLA 2IADA 4F37F 4B7IA 4NZTL 4QXGL 4RISH 5T1KB 1J0KA 3NFPA 3MBED 1QSED 1B0RA 3MGOA 1L7IH 2VUOA 5TDOA 1F8TL 5KBNC 3BRDA 4O2EA 4G9DB 4ZFGH 1JMXA 1LDPH 5DHYB 4GMSL 5DK2B 1VESA 1OD9A 3EDFA 1AQKH 2F53D 3MREA 3MOBH 5C7XL 1HQRB 3P0VL 4XGZA 1PX3A 4FQHB 5LAXA 2ZG1A 1OAUH 1FN4A 3CFBA 5JIIA 2AJXH 3VXUE 1N59A 4NQXA 3OKNA 2V9QA 1I9RL 4HW6A 5FKAA 1F45A 3H42L 5D72H 1OHQA 2OMBA 5A2KH 3SPVA 3MROB 2CLZA 3LQAC 4F7CA 5JMRA 3OG4B 3PDOA 3QCVH 4ODSH 3MRNB 1B6UA 5CEYB 4JPWH 5IQ9B 4B41A 1AR1D 1GGCH 3U79A 1KNOB 3OGCB 5SWQA 3FKUS 1MF2L 1PG7L 2Y36L 4LQFH 4JLRA 1EGJH 4RQQA 2OL3B 5L2KB 1JNHA 5LGJB 3VFRA 5E1AA 1MIEL 5HGGS 4UTBH 5F7YC 5IBUG 1ZS8A 1EEQA 1NBVH 3U2SB 4V1DE 4DGVH 4UV4L 2DQEH 2FNBA 1QFWM 1J1PH 4J7RA 3JV0A 4OFYA 4JFEA 2EYSA 4LHUG 3IFNH 3VXME 1P9MA 3G5ZA 1JHLL 4LIQE 3HZKA 4Y88A 3LS4H 5LJYH 5CMAA 3IFPA 2WWKT 4TUKL 5AYUL 1N64H 2FX7L 3BAEL 2HT2C 3D39B 5IFJA 5E9DA 1KLFA 1N5YL 5BZWB 3DUUB 1ZE3C 1DL7H 3B5HA 2FIKA 5I73C 2FLBT 1AC0A 4XBGB 3KPRE 4EXKA 3Q3GB 1A1NA 2PYEB 4XPTH 3K3QA 2FL5B 5HGAA 1A1OB 3JWDH 5C07B 4OLVH 1TIUA 1DBAL 5HI4C 4RAUA 3RIAF 2OR7A 1SY6H 1NMBH 4IRJC 5DMKA 5K9OA 1FZMA 5DJXB 3UPRB 1LP9B 3WUZA 1EO5A 5C0RH 4E41B 1K4DA 2ZCLH 3W0WD 1F4AA 4YGAB 3D9AH 5FHBH 3GMQB 3L5XL 1CVRA 4P2QD 3WIFB 1MCOH 1NC4D 1NCNA 2ZKHH 1AY1H 4ZUWA 4XNUL 4CU6A 3QEHA 5B22A 1URLA 1IAIL 3FAXA 1CCZA 3QUZB 3GSWA 5IB2B 3RKPA 1BZ9B 2F74A 4LCUA 4U05A 3OL2A 4I48A 2EXYC 1NC2D 4L5FH 3SKNB 3KPOA 1MCJA 1U8KA 4P2RD 4F7PB 4NHUB 5SWZD 1CIDA 3PDOB 1G7LA 2GJZA 1JWMA 1N7ML 5IK3A 4NN6C 2P7TB 3I2CH 3U0WH 2CIKA 4Z77B 4K7PX 1QLEH 2OS7A 1JHTA 3J8F7 2WM0A 1F2QA 3DUUA 2W9DL 3B2VL 4HPOL 5D2LF 1AGBB 2M8XA 3EYUH 4J3XA 1YYLL 4QHUB 4HCRL 5MI0C 4HFWB 2AK4A 1GOGA 1WFUA 3OKMA 4R0LC 2FH8A 3BZFA 5I74C 1NCCL 5F44A 3L6FB 1MRFL 4IS6A 3K4ZA 4ONHB 4PV8A 1ZOXA 1ZEAL 1WFTA 4R90L 5LKNA 5IJKC 1XGYH 2BVPB 5EO1B 2EDKA 4JKPH 1AFVH 2WBJA 1KJ2L 4P57A 3WIHA 1ZXQA 1SMOA 3NIFF 4P23A 3WXVL 3U4BH 2IPTL 4HC1L 2IQAA 4P2OB 1IEHA 1A6UL 1MQ8A 1J87A 1XR8A 3CFJB 2D31A 4I0PB 1I8MB 4C56D 4M7JL 1VB9A 3QIBD 4ZTOH 3O81A 4WI5A 1HEZA 1JNHB 3HNVL 4J12A 5HJ3A 4RGMB 4U0RB 2OK0H 1QLFB 3VFOB 1UJTA 1BPVA 4YBLB 4RMTA 1U2CA 1XAUA 4AENB 3NACL 2X4NA 5I1KL 4NHCH 4ZO9A 4OF6A 4GKZA 5DWUH 4NM8H 5C9KA 3PGDB 1C16A 5ITFB 4Z6AT 4WY7L 2PW1B 3G08A 3U0PA 1YC7A 2PUQT 1CFSA 1EXUA 5D7IF 2QSVA 5F1SA 1P1ZB 4PJIB 3WO3B 2BNUA 4P2CG 3RX8A 2M2DA 2EO1A 5I18L 4LEOB 2QJDA 1FZOA 4AYFA 4CJ0A 1QYGH 5BJTB 2P8MB 4KDVA 4H25A 4HGMA 4LOUC 4QRRD 1HXMA 5CINH 3MMEB 4HFUH 4DQOH 3BPCB 1A02N 3DETC 3U4EA 4LEXH 5GQBA 2YXMA 1S7VA 2R8SH 1A3LL 4RSVA 4BYHA 1HZHH 1WEJH 4APQC 4XP9L 3FQNA 5J6HB 1L0QA 4NQDB 3EFFB 2LAGB 5CJQL 5D70L 2IFGA 1LEIA 4ORGA 5TF0A 3P77B 4JFHD 1Q9OB 3L9RA 4JCLA 3MRCB 4IS6B 1DQJB 5J1TC 1NH6A 2F8VA 1NBQA 1S9WA 3MUHL 5FYKE 1M6OA 2XWTA 2NY0D 1CFQB 4Q9BA 1RZ8A 4LCCA 1S7WB 2JJSA 3NCJL 1BFVH 1QNZH 3QO0B 3U30B 2QEJA 3MV7B 1YN7A 4JM2A 2GJZB 1RU9L 3WYRA 4FZ8H 5DDHB 5K9KB 3BUTA 3NABL 3VGDA 3S9DB 4X4XA 3QWRA 5E8NB 2A9MH 1MEXL 2WMPA 3D87B 3FB5B 1X5IA 1CFSB 3LCYA 1MH5A 3MLTA 4P48A 4HKZB 1CGWA 4BH8B 2A6IA 5HHMB 1CICD 3FN0H 4P2QB 2APVA 4KKLD 3W9DA 3GSUA 4NO0D 5ECJE 1RZ7L 3VGEA 5SX5H 1F3JA 5FAAA 2HLFD 5F9JA 5ETUB 1QSFA 3SGJC 3DXAB 3BEVA 4KQ3L 1F11B 1SYVB 1TPXC 1M71B 4DW2L 4HWZB 4GRMA 2XNAB 2R0ZH 3OJDB 4GT7A 4NBYB 2B2XH 1FE8H 3QB7C 5DUMH 4RX4A 3PV6A 4X9IA 4PJ7F 3FO9A 4PGEA 4NOFA 1QO3A 3NAAL 4JZJC 2CIIB 4JDTL 4L3CA 3K2MC 1UWGH 3MV7D 4HJJL 4ESKA 3WNPA 2EIZA 4ODTH 1EHLH 4NBZB 3WN5B 2IH3B 3VRLF 1Z0NA 1K3IA 1A4JB 3VWKC 5L0QC 3T4AA 5IQ7H 2XQYG 1IC5H 4HKJB 4RGOL 4JFQB 1NJ9B 1GIGH 4OGZA 5F1OB 2Q76A 4WFED 1G7IB 2VR9A 4YDVA 4JRYE 4Z7NE 1CLZL 3VW3L 4X4ME 3SDAB 2CLZB 3I50L 1BQLL 3GIVB 3NBNA 2NY4C 4YHKH 3T77A 3MLWL 1T89C 1H8OA 1T1WB 3TFKC 4NZRL 1F58H 1C5DA 4HIXH 1MHEA 1QRNB 1RMFH 1QSEB 1PDKA 1BM3H 1XIWD 3WJJC 1DQJA 5J6GB 3MRFA 2CK0L 3LIZL 1F6AA 3ZT7A 5F7DB 1FNGA 2VXVL 5GZOD 4MNQB 5C0CB 4XMPL 1BVLB 4FFYH 3EJZC 4HD9A 5DZOA 5ICXA 4TQEL 4XRCA 2IBBA 3IDNB 4M1DH 5JNYA 2W38A 2J3SA 2VXTL 3NFPB 1XGUB 3TH4T 1K8IA 3MBEC 5A43C 4JM2C 4RFOH 2FO4B 5KW9H 2FDBP 1A6TA 1DLFL 1OGAE 2DRUA 5GS2D 3IYLW 5E2VH 4QTHA 2C4XA 3VFSA 3O0RL 3V6BR 3UYRH 1FVEB 3TBVA 3D0VB 5KG9A 1JK8B 2CGRL 1RFDH 1U8OB 2UWEB 3V6OA 4X5WA 2BK8A 4XTRD 3BISA 3RA7L 3VH8B 4I77H 4NRZB 2VL5B 4KJPC 4NN5C 4LSRH 1G7IA 5CZKA 5J9PA 1H15A 1TETH 4JFYA 12E8H 4WO4D 2X42A 1R0AL 1NGYB 2GAZB 4Z7QE 4KRLB 1IRAY 1E28B 5BZWA 4MHHG 2UY7A 4JDVB 4G9FB 1UXWA 4HZLA 4GRMB 2WAHA 4OV5B 5ERWB 3MJ7A 2VLRB 1OY3B 1I1FB 4HX1B 3MV7E 4P3DB 3SDDA 4R4BA 5D5ME 1KJMA 1T7WA 4MX7B 3PV6B 5IM7B 2W91A 1LMKA 4EXPX 1FSKB 2V5MA 3QIWB 5D7JA 1PY9A 5DC4B 3BE1H 1GC1H 1XFPA 4OLZL 3P30H 4JFFE 4LMQI 4JY4A 2AGJL 1TVHB 5I16B 4R96A 3RWFB 4NUGH 4WFGD 3KPRA 4FQ2L 1KLGB