4GRMA

The crystal structure of the high affinity tcr a6
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
184
Chain Sequence
EVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVTTGKLQFGAGTQVVVTPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increased Peptide Contacts Govern High Affinity Binding of a Modified TCR Whilst Maintaining a Native pMHC Docking Mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords A6 alpha chain
total genus 35
structure length 184
sequence length 187
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmA02
2XZQH 3KLHC 3X11A 1LO3L 3S3SA 5DMJB 1FH5L 1H8OA 2FZ3A 3B8SA 1DBJH 1SBSH 3MA9L 2FDBP 4OLVL 4YR6A 4MMZC 3BIBX 3G04A 5ADOH 4H0IA 2XTJE 4LDEB 1XF3A 4ORZC 2X9XA 3ZDZF 4KVCL 5J1SC 1JHKL 1OSZA 2DMKA 3QA3A 1XH3A 4I18C 3ZE0E 2X5PA 5T3XD 2VISA 1IGIL 2W9DH 3PE9A 4HKBB 3RWCB 4PJHA 1YEGH 3BN9D 3FOLB 3FQWB 1TMCB 5CILH 2P5WB 3DETC 3HPJA 1MLCA 5DMKA 4ZUTA 5F1SA 3MMEA 4EI6B 2HKHH 2AK4B 3O4OC 1YEHL 2AQ1A 3INUH 3U7YH 1AP2A 1ZT4A 4FMFA 3VXUD 2AKRA 1MREL 1U93A 5EFIA 3UP1A 2DIAA 4G8FA 3UTZA 4C4KO 2NNAB 1WBYA 2VDPL 3K7UA 3T3PF 2JJWA 1NGZA 2IH3A 1KPUB 4OCSH 1NSNH 1UZ6E 4PP2B 4OGXH 4GKNA 4GAYB 1INQA 1H5BA 4WI2A 4FQ1L 3NCEB 3HUJA 4DUWA 3DUUA 5HHPA 1H5BB 4Z78A 4ELMA 1QEWA 4KH2A 3CDGB 4Q74A 4JANA 5J7CC 3KPSE 1I7UB 3O3BB 4YAQA 5KVEL 1R5WB 4OF5A 3WBDA 4R2GC 1MCQA 1NC2A 1Q94A 3W9EB 4ZMAT 1RJLB 2EYTA 3GKWH 4B0MM 2GIYA 3TBTB 1AP2B 1ZT4B 1DQQA 3MR9B 3ULVC 2ZUQB 3TWCH 3QI9D 4POYA 5D7LB 5EZIH 5MEOA 1II4E 5BV7L 5IBLC 2J5LB 1BFTA 2E27L 1E27A 2JB6B 2VZOA 1GOHA 2PTTA 2HFTA 3ZDXE 1BP3B 1IMHC 5C7XL 2OTWB 4YHPA 1S7UB 2XOTA 4OZIF 4FXKB 5J12B 4L5FL 1C16B 5GS1C 1ZA6A 5EO1B 3G04B 4OF7A 5EBMA 2PUQT 3IXTA 1ZHKB 3LKNA 4JZJB 4P5TD 1HOCB 3I02B 3HMWH 3GMNB 4RDQF 1EHLL 5INCA 1A7QH 1KLGB 1ZVYA 1U91B 1ZE3C 3PP3K 4F7TB 3V52L 5CBAB 3CXDH 5LGHL 1CE1H 2HJLA 2H32H 2AV7B 3FT3A 1OAXL 2UYLB 1ZHLA 3L3KB 2HJFB 3PDDA 1NGYA 3STLB 1XGUB 4NC2B 1ZGLA 1IAOA 1HZHH 2OK0L 1A47A 5C9JA 1K6QH 1FNGA 5JTWA 1A9EB 4HS3A 2XTJB 3TO2A 3KPSD 1UWEH 2QADD 1X5LA 5D2LA 5GZOC 3QEHA 4LLDB 2AXHA 3QXDA 4PJ9A 1UACL 4FOMA 3NTCL 1R3LB 2W0FA 1A6WL 1GGTA 4P5MA 4RMRA 5D5MB 5IB1A 2Q8BL 5T1LB 2VABA 2A6DB 2ICWJ 4K8RD 3TPUB 3FONB 2GSIA 1Z2KA 3MV01 3I3BA 5IWLC 1MRDL 4GRLA 3ARQA 3DX8B 1MJ8H 3ARGA 3OMZA 1UA6L 5DUPH 1RZKL 3VXRA 1ZEAL 4G6MH 4HS6B 4GRMB 4OFYD 1X5YA 2AI0H 4L9LA 4N0UE 4Y4HC 2FNBA 4DN3H 2APTA 1SYVA 4U1MA 1LE9B 3AS1A 5ILTL 3BH8A 2G60L 4WI7A 4HS8H 5T1MB 2XXCB 1OGTB 3UBXB 1G7JA 1YN7B 4GMSL 3QWOB 4JY6B 5DHXB 4WHTA 5CSZB 3WEXB 5JW5B 4ODVH 1JV5A 1QFPA 1S7SB 5DJ6B 1F3DH 3D39E 1C5CH 2QKIB 3Q3GB 4XCEB 2R0ZL 2YN5A 1BJMA 1BVKB 3T1WA 4EBQH 3BKML 3SCMB 4F3FB 3QT2A 4G9DB 4JFQA 3V6OE 4YZFE 5IW1A 2CXGA 5D70H 5C9KA 2PYEE 2WP3T 4X9GA 2AK4E 3X3GL 3QUXD 3DARA 3T0BA 1GL4B 5IK3A 1QSVA 2UVFA 5LGJA 1WISA 4PRNB 4ZODA 4RNRA 4DOHE 4RGNB 1U0QA 4Y4KC 1HQ4B 1OAYL 1QBBA 4G6KH 2V9TA 5KZCD 5CJQH 4YXHH 3VWKD 4HWBH 2B2XL 3FO1A 3FRUB 5EZIL 3BPLC 2OS7A 3BWUC 2NY0B 3Q2CA 2UZIL 3ULVF 3FRPG 2E6PA 3F7VA 5IVNA 2EKSA 3RWFA 4XMKL 1W2KT 3V6ZB 2A83A 4HUXA 3C60B 1U8PB 2XG4A 4WEMB 3PL6B 4M6NH 1CTNA 1XZ0A 2P7TA 1G0DA 3GSWA 4K3EH 1S9WA 1CFVL 3OGCB 2YUWA 5DJXA 3WJJC 3ECBA 5HPMA 4TNVF 4U6YB 1J12A 2AJXL 3O8XD 3SKNA 5BS0A 3GSNL 3KPLB 1OW0A 4OKDA 3TJHD 1INDH 1V7NH 1CD8A 1G6RH 3MRQB 1M71A 2VH5L 1Z3GH 5HVHC 2AQ3A 2NY4C 4HEME 1PAMA 2WNGA 2V5MA 4ZS7L 2HFFB 4XMPL 1PZ5B 3JVGC 5L0QC 4XX1E 2K3TA 4MJIE 3KPQB 4M6ML 3DHMA 4R0LA 4LLVB 1ROWA 1KBGH 3F7QA 3RDTB 1D5IH 4WHYH 4X6CA 4Z7NE 2AK4D 4HFWA 3VRJA 1RK1A 1WBXA 3H6JA 5KVGL 3LEVL 3ALXA 1OARL 5DDHB 1QBAA 3C5ZA 5IGXL 4QNPE 2YPKA 3KPSB 4R90H 5B3JE 3QNXA 4YHZL 2Z8WC 1OTTC 3MA9H 2Q86A 1XF2A 4BSWB 3T8XA 4K55A 1G9ML 4KUZH 3MJ7A 3TO4A 2FGWH 2GTZA 3LQAL 1CDBA 2X44D 3WS3A 2E6JA 5I1CL 2R29H 2XZAH 1T4KB 4U05A 1HE7A 5KSAC 1HHGA 4MD4A 3W5MA 3QJHB 1MAML 2IQ9H 5DJDB 1S9KC 3BGMA 4LIQE 4RX4A 3R4DA 2E3VA 3G5ZA 4M61A 5J0BA 4APQA 1BAFL 3RQ3A 1NFDE 1FAIH 2V9RA 1JMXA 4BSVB 5HY9A 2P1YA 5A2KH 4UOW0 4X4ME 3KLSA 4DQOH 3SPVB 5IB4B 1LMKA 2ERJC 3WUWA 1IBGH 1AO7A 1AKJD 2CKBL 2GK0B 4TUKL 3C5ZB 2X09A 3ZKMC 1N5AA 1S5HB 4E5XB 1OL0A 1QR1B 1N6UA 4MYWB 4QHUA 2H9GB 5KS9E 4AMKH 4DW2H 3VFPB 1B0GB 1E28A 4L4TA 5EU6E 3PXHA 3S96B 3TA3B 2DTSA 2CIKA 3SPVA 2Q1EA 3EO1A 2BVPB 3AS3A 2DWEA 3QDJD 1XGYL 5EO9A 1A1OA 1UC6A 2BHUA 1KXQE 1UCBH 3EIFA 4M7JL 2YPVH 4Y19D 4P4KA 2NY6D 2O26U 4I9WD 4WIQA 1YY8A 2VB5A 3MRIA 1RUAL 1B4RA 3V5DB 1PY9A 3GNML 3JWOH 2FEEI 3JV4A 4G3YL 5KTEL 4NJ9H 2HFEA 3RGVB 3BGMB 4LQ1A 4Z5RB 4LASL 2VLRB 1ZK9A 2NTFA 1QFWL 4C56E 1AGBA 1EEZA 2CUHA 1FNSH 1YNKL 2NYYD 2VUYA 4MQXD 1EPFA 1A6UH 1DQML 1S7QA 4TRPL 1ED3B 2GSGA 4U0RC 3T8XB 4IOFC 3BD4A 5TQ0L 2ZOLA 1VFUA 1T22A 1U8LB 4N9GA 4P23C 3PDGA 3PHQB 5KAQF 3TYFA 3V6ZA 5DDHA 5CJXA 1KG0A 3MBEC 1CLOL 1NAKL 4YDJA 2C4FT 1TVDA 3QFJE 3HMXA 1T5XB 1UWGL 1EH9A 3VXRD 1K8IB 4XP1H 1Z0MA 1I1AC 2IPUG 5MEPA 1FHGA 2HFFA 4CKVX 2GJ6B 2MHAB 2PW1A 4RNRB 2A1WH 1KELH 4P2OD 4NSKA 4PTUA 5CHNA 5IK3B 3BD3A 1N64L 2H6PA 5D70L 3KPLA 1T89C 4ODWB 2AP2A 4F7CA 1XGPA 4NWTL 3ZYJA 4KRLB 4M00A 4K94L 4G9DA 2NR6D 3BKCH 3V9FA 3CMOH 1OT1A 1G6VK 2Z35A 1A6TA 4X4XA 2ZKHH 2VE6B 2P4AB 3DWTA 3NZHH 3O9WB 3FAXA 3RWFB 3P2TA 4CBPA 5ESAB 1VESA 5GJSL 5FF6A 2V7HB 1T7VA 4IBLT 4M7ZC 3SOBL 5DD5H 3QJFB 1MPAL 1FG2A 4GQPH 3X13B 1HDMB 3RL1A 3C2SA 3WSQL 4U4BA 4TVPH 3RNKB 3BOVA 2JCCF 5CEXB 4QKXB 4TRPH 4KJWD 5GGTH 4KTYA 1HNFA 4Z8FH 1B3JA 3QDMD 5HYEA 3HI5H 3S5LG 1HINL 5FGCE 1AQDB 2WWMD 4XWOC 1AD0A 2VIRB 2VABB 5C0NC 4OLUL 3DI3B 3X3FH 3VFSB 1A6ZA 1KJ3H 4GH7B 3WNLA 3B5HA 1S9XA 4M3KB 5BV7H 3E6HA 1RU9L 3Q3GA 5BQ7B 2ID5A 5EUOA 1YPZA 1AFVL 3E6HB 4GW4A 5D9SA 3PWUB 4NO0B 3VDCA 3QWRA 1CU4H 1YMMD 1IAMA 1TIUA 4U1SB 4GLRH 3T0ED 1B2WL 3HE7D 1T1ZA 1LP9B 2GKIA 2H32A 2P24B 4OAWA 4E42A 3UBXA 2A6JA 3KPOA 1G7MB 3BRGC 2NX5E 3BH8B 3U4BL 4AIZA 2J3SA 1U91A 3UPAA 2XQYK 1NSNL 5CEXA 1MCRA 2BDNH 4AIXA 5C6TH 3S37L 4PRID 3OAYK 3LVEA 4LVHC 2CK2A 4ZUWB 2YRZA 5FFLA 1J5OH 4LCYB 3BKCL 5GGQH 5F89B 1DEDA 1UVQA 5F7HA 2HN7A 2VLRE 4NFCA 4KVNL 1S7UA 2ESVB 2ADFL 3KJ4C 4WW2C 5B4MC 5T1LA 5CEZE 1CTOA 1V05A 3FQNB 5KSBE 3KG5A 3RZCB 2G75B 3TT3L 2ORBL 3I50L 4AIOA 1HH6A 1PYWB 2MQ3A 3TBTA 1VADB 4OTXH 3LKQA 3S5LB 2XNAA 1TTUA 2E9JA 2HRPL 1EO8L 3K4DA 5EOQH 2I60L 5F9WC 4ODWA 5HHME 2DOCA 4QT5B 2BRRL 4XPGL 3CDGA 1ULVA 1FL6B 4IRSC 3HFML 1U8MB 4H1LG 4P3CL 5KVMC 1INQB 3IKKA 3WO4B 1ZLWK 1KCVL 3EYUH 5AWNH 2P5ED 5EU6B 5MEPB 1GIGL 2IH3B 2PTUA 4OM1L 3VXNA 3HI1A 1HYRC 4JN2B 5IKCB 1A7BA 1FYTE 2ED8A 4RFNC 1T2XA 1D5ZA 3K0WA 1U93B 5CEZD 5EC2B 4XRCB 1BREA 1EGJL 3GHBH 4Z77A 1DUYB 1OAZL 3DVGB 3O3DA 4MA1B 1EVUA 4JN1H 5TQ2L 4HJJH 3W2DL 4YHPB 2J8UE 1RMFH 1CGSL 5J1AA 2MKLC 3G6DH 1UWXK 5I2IA 3OKMB 4L8SA 4OV6F 3C5SA 1NGXA 3PQYE 3QCVH 4XPTH 3NBNA 1DLHB 2ED7A 3RWDB 4Q9RL 3QPQD 4GAJH 2R1WB 2GJJA 2BY0A 2RCSH 3V4PH 4NJAH 5I19H 6FABL 5IW3A 2IAMC 1XF4B 5GSRB 4JRYD 1R5WA 1KTLB 1DTUA 3QUMB 1HHJA 2X9WA 4ZFFB 5HD8C 3RX5A 3QUMH 4Q7DA 4L4VD 1CXEA 5IM7B 5E00A 4F9LA 3X11B 3BE1H 4XBEL 4L4VB 5DT1L 3HRPA 3TN0C 1E4KC 3FN0L 4X7SL 4MJIA 4YBQD 1AGCB 4HKXA 4LCCA 3FN3A 3ARPA 5E2WH 4Z0BH 5ADPH 4JEGB 4GJTB 4IRJC 4XP5H 4I3SL 3V7AG 3D2UB 1S5HA 1BAFH 1X7QA 4E5XA 3SBWA 1AE6H 4OCRL 5LG1A 1Q9LB 3T2PA 3MACL 2P5WA 4PGEB 5E08H 1OAQH 3FOLA 3FQWA 1D5XB 1A14H 1AKJA 3FFDA 1N26A 2Y6SC 1GRWA 2Z93B 2L7JA 4JJ5A 5KANG 5L8LB 5C0FB 1VGKB 3WFBH 1NH6A 1INEL 1UQSA 1Y18A 3KDMA 3QDJA 1ZA3B 5I71B 2R23B 4RAVA 3QJHA 5DJDA 4K3JH 4L9LC 4PJIF 1T5WB 2GEEA 3ARFC 3QIWD 1V7MH 1RFDH 5CLTA 1ZLVK 2MKWA 3BGAA 4QF1B 2HWZH 4XXDA 4LQFL 1BZ7A 1EFXB 1BQLH 2ITCA 3QIWB 4HULB 3AAZA 1MRCL 4FQJH 5JDJA 1IC4H 4QGYA 2BXZA 3IETB 1MFBH 2BOBA 5D8JL 4RGOL 4NJ9L 4BSWA 4G6JH 4W6WB 1DN2A 4IIQA 5JHLL 3QCTH 2X42A 3V4PL 2V2TB 5I1LA 1FRGL 3T0AA 4NNXA 1DQLH 2XTLA 1N0XL 4U7SA 3ULUC 4PJXB 2ARJB 3MX0A 4MA7L 2J8UB 2DLFH 3G5YA 1VGEL 5HVFB 2W1NA 4CU6A 4OT1H 1F00I 4OZGF 3SDYH 3GMQB 5AD0A 2IBBA 5F7EH 5A43C 3I6KB 4NKMB 4Y2DC 3PGFH 5A40E 4PRIE 2EC8A 4K23H 2IQ9L 3ELAT 2HKFL 1KPVA 2ZSWB 1HWGB 1M71B 1U3JA 1CS6A 1ZS8A 1QOKA 4KK6C 5EZOH 2RIKA 1M7IA 3TLRA 1CLYL 1GOGA 3UPRA 3FO0H 4EVNB 3T08A 1MLBA 1I8MA 1OAUH 3OXSA 4QRQA 4RIRA 4ZSOA 2VQ1A 2R0LL 3ECBB 5BO1L 4RQQB 5FGSA 4F2MB 3QSKB 4NN7B 5DYOA 1G84A 3NGBC 4D8PB 1IARB 2ATPB 3UTOA 1U8PA 1F8TL 4LSVH 2AJUL 4C55A 1N6QH 4ZO6A 1NC4A 2E8YA 4GG6F 4ZDHB 2R1XB 4HK0B 1FLTX 3SJVD 4DWHA 3ULSB 3I85A 4POZC 4LCWE 4F80A 3DURA 2FO1A 4BYHA 2W92A 1IEHA 3IF1B 2X1OA 1MCWW 2BNQB 4ZO8A 3M17A 3SGKC 4N8PA 4LSQL 3DPBA 1KLFA 3VD4A 3RWHA 3EDKA 5DT1H 4X4YA 1J8HB 1NANH 2R2CA 5DMGC 1G6RL 3G5XB 3TA3D 2DYPA 1X5FA 4G6JL 3QHFL 4PRNA 5D8JH 4ZUSB 2AJXH 2K7PA 4G6AC 3KXFD 4UILL 3O6ML 4JFHD 5TDOA 1GGIL 2P5EE 3ARBD 4WTWA 1RU9H 3PWPB 2BNRE 3EDJA 1IQWH 4PJHE 3NN8B 3OR7B 3C5ZD 2F9BT 2VXVH 3NA9H 5I18H 1SMAA 4PB0H 3FO2B 5EC1A 1S7SA 1P7QA 1SQ2N 1B0RA 3VXQA 2NR6C 3E6FA 4TSAH 1GZQB 3CH1B 4WI3A 5DLMH 4WHTB 1V3LA 4NM8L 3PGFL 3B9KB 5IVZB 4EUPG 3ZTJG 5DMGD 3HG1E 4MWFA 1GAFH 3RTQB 4GUPA 4GKSB 4XTRD 4PY8I 4NGHL 1MLBB 1LE9A 1QLFB 1U42A 3B5TA 3UPRB 3SCMD 4G6AD 5DZNA 5JPMB 4UNTA 4LBEB 5C0BD 1U9KA 1BHGA 2B1AL 1KN2H 3KPRD 1JVKA 2Y06H 4KI5C 4RX4D 5IOPA 1ZEAH 4G6ML 5E7FA 1BBJB 5LVEA 1ZVHA 4AQOA 1WUNT 1IM3B 2PXYC 4JKPL 4NQED 2IALB 1NCDH 5GGTA 4X4ZA 3VFGL 5HI5C 3UO1H 1EO8H 1N4XH 5EA0L 1T89A 5B39G 2NX5D 4HGWA 4HK3J 5BVPH 5FKAB 1NLDL 5IBTH 1KC5H 2YUXA 2JCCE 3OHXA 1QSFE 1X5JA 3GRWA 5I1LB 2MSPA 5TF1H 2V2TA 3NZHL 4AK1A 1NAMA 4Z7WA 5C08B 4FQXA 3FTGA 2A0LD 4LLYA 4LSRH 3P30H 2F8VA 2O5YL 4EBQL 2E9IA 4ELMF 4HS8L 4ZTPL 1NCBH 3HB3C 4R97C 3T0EC 3HE7C 4OM1H 1UM5H 5D7IE 4QF1A 3UC0L 2Y5EA 4AL8L 4RMWA 4OF8A 2KBGA 1RQ5A 2VERN 3L3DB 4FFZH 4G8GB 4IHOA 1YDPA 1YPZF 1F90L 4IDJL 4OCWL 3C08H 4Y1AB 4R4FL 1EGJH 3GHBL 5CZVH 5J3HC 1HHHA 4LPXA 1LK2B 1OARH 5DS8A 3GGWB 5TE4L 5IMKB 4HDIB 1NQBA 3C60D 4F7MA 2YBRB 5K9QI 2J2ZA 3T0EA 4ELME 2F54E 3VD5A 3PNWB 2NW3A 4P9HH 3BESR 3BMWA 3STZB 1EXUB 2YC1B 4BZ2H 2AABH 5DC4B 3G6AA 4Y7MA 3RJDA 4YE4L 4ERSH 1WCBA 3DJ9A 3R1GL 5D7LA 3WD5L 4YPJA 4YK4C 4Y5YB 5C0RL 1A9BA 1RJLA 1QSZA 2EYTB 3L9RB 4WO4B 1NC2B 3W9EA 4R96A 5TQ0H 1NDMB 4MJIB 1VDGA 3WLBB 1H9VA 2FX9L 2WM0A 3DO7A 5J3HD 2B1HL 4E41E 1VA9A 5GGTL 4L3EE 4HCRA 4KI1A 2EC9T 4LVEA 3S88H 1AXSB 5CILL 3Q6FA 1XGQA 4OF6A 3QIBC 3NFNA 3VD7A 5TE6H 1X44A 3DGGB 1TZIB 4PJ8B 4JVWA 3A67L 5CP7A 3RVUD 2ENYA 3UJIH 4E41A 4WI8A 5D1ZA 1NMCC 3FB5B 4J23A 4ZPVB 5E4EC 4ZUTB 2BNUA 3RJQB 4HUUA 4APQC 1FSKC 5I2IB 1TJHH 4PJHB 3T1FA 4EI5D 5ACMA 4X0KB 3NAAL 2R2HA 1UM5L 1XH3B 1LO3H 1UXSB 1RZFH 1EHXA 5D6DC 3EFFA 4LKCA 2IMNA 3JUZA 5MP6H 1JNHB 3ARSA 4HF5L 2XKNA 1XF3B 3RIFF 3IDIB 4X9HA 4N68A 5IKCA 3GSOA 4P3DB 1VKXA 5JOEA 3AUVA 2FB4H 2A9ML 1KYOJ 4JRXA 2FL5B 4QTIH 2FZ3B 1CZ8L 3VW3H 3OF6A 3OXRB 3QDMA 4GW1A 1LO0H 1FYTD 4ODHH 4BZ2L 4K3DL 3VFMA 3IVKA 2PXYD 2F53A 4S1RH 1FNLA 4ZFGH 4YHZH 2EH8H 3H9SD 2B5IC 1HSBA 1QSEB 1AJ7L 2L7UA 1YYML 3WLWD 2VLLB 1ORQB 3BPOC 1QUNA 3CLFH 4O2EB 5D7IA 3T4AA 1G1CA 1NAKH 1C08A 2CDEA 3VFOB 2VL5A 5C6WH 4P2QE 5HHMD 4YHKL 3G6DL 5ILTH 2A38A 4FQ2L 3D3VD 2PYFB 3RZCA 2EC9U 3M8OL 3W9DA 1TVHA 5ENWB 2DL2A 4U1HA 4I2XB 5EIQA 4U1GB 4U2ZA 1P53A 1Y6NR 4BKLA 5FGRA 2HN7B 4XP6L 4LEOB 3DV6A 1RI8A 5DD0H 4WHCA 2BRRH 3BFOA 1VCAA 1JFQH 1MOEA 1RJZB 3L3IA 4ZG1A 1AD9B 3VWKB 2OI9B 3MUHL 5F88A 2IH1B 3MV7B 5I1IH 1BZQK 4LSPH 2ZCLH 3P9MB 2BRQA 2R2BB 2D4FA 4O5LL 1OTTD 4OLZH 4PG2C 4LLQB 4S0SD 5JIPA 3EJZD 3O2WH 4DAGH 5CINL 5GRVL 4JFYB 3OKEA 3L95A 4OB5L 5E8PA 3SDCC 1HIML 2H32B 1GZPA 1X4XA 5BZDA 2X4OB 1SYSA 4HUWB 4ELKA 1EEYB 1A4JA 4U1LA 3FN9A 5D9SB 2Y06L 1WC7B 1LO2L 3DETD 5C09D 2V9QA 3BZFA 5D2NE 1TJIH 3WUWG 2NY2C 4JFOA 3ZT7A 4JG1H 3GZKA 4MNHA 1LILA 1LWRA 5JMRA 5HI4C 4AJ0A 4YEEA 4G8GD 2W9LA 1J0HA 4Q97A 1KULA 1AQDA 4PJBF 3UTQB 3RX8A 1WQVT 4PRIA 5IR1B 3ES6A 1EJ6A 3CZFA 3IRZA 4WNQA 2VLJE 1RZJH 1WAAE 5I16B 1FZMB 1FNHA 3RNKA 3MRMB 4F57L 2NW2A 4UTBH 2ZPKL 5F93C 2CQVA 4F9PC 2EH7H 2V5YA 4LHUD 4NM8H 2IAMA 3HE7A 2D7NA 3V5HB 5JXEA 4M9OA 3EAKA 4C83A 3QEQA 3UAJD 4MQSB 3TF7C 5JW3H 2XTJD 3QEUA 1EVTC 4PG2A 5JMOC 1IZKA 3FMGL 4X4XB 4FQXC 1A64A 1NUNB 1RUKL 5D4QA 1U58B 5EIIA 3FRPA 1LDSA 5M95B 3P77A 3ISWA 3IDMA 1RVFL 4U3XA 4X6EA 4GS7C 4JJHA 5KG9B 2YEZA 5LXGH 4Y4KD 4L8BA 3KYOB 7CGTA 3TYGL 3T77A 4NT6A 4IRJA 4K07A 3MREA 4NKDB 4OIAA 1W0WB 3GDBA 3VFGH 2NY1D 1UCTA 2DM4A 1YZZA 4JFEE 4LFHD 4PTUB 5CHNB 2IWGA 4GAJL 1SVZA 2QHRH 3IGAB 3BJ91 5ETUB 3NCMA 4IOSD 2G2RB 1IKFL 1CLCA 5C71A 3CX2A 2A73A 3CZJA 2R0LH 1HI6B 4FFYL 4BH8A 2SEBB 4KXZI 1I7ZB 2ZNXA 5IHZA 5FUCC 3GKZA 1Q0YH 1H15B 3MLVH 4FG6D 5D93B 3NOIA 4F15B 4EDXA 5DJYB 1JPSH 4N9GB 2CKBB 3KLAB 4P2QD 3H8NA 2KZ1B 4NQEE 3STBA 1HHIB 1XEDA 3U0TB 3JV6A 2NY1C 4RFEB 5AEAA 4YHIA 4KI5F 2YMXL 4GSDL 5I74B 4P4RA 5IEHA 4LLMA 2CGRH 1SVCP 5MERB 5MHSE 1EEZB 5SX4H 2ZPKH 2WWKO 4UUJB 1DSFL 1IM9D 1RIVL 3QO0A 3MCG1 1AGEA 1P1ZA 2XACC 2MWCA 1PEWA 4HIHA 3VXPA 3DYPA 3BAEH 1D5BB 3PHOA 3MV7E 2V6HA 5EOTB 1F97A 5DC9B 2AEQL 2H2PD 1YA5A 4Z7OF 3H3PH 5EO9B 4Y5VB 3FB7A 1AC0A 3ULVL 2IPKB 5ID1A 4E9LA 3CSYB 3X14A 4KC3B 5BV7C 4WU5B 3TBSA 3SDXA 1M7DA 3CVHL 4QYOA 2ZUTA 2C3VA 4WCYH 2DMBA 2FX7H 5LGKA 3MFGB 1FZJB 1UXWB 2KZWA 3W0WB 4GXUM 1JRHI 4U33A 2AERT 3WXVH 1NCCH 4NUJA 3MLUH 1XGTA 3F5WB 1HH9A 1K9TA 4BSVA 5B38G 3ARGD 4P2QB 4TULH 4POUB 5JA9A 3ROLA 3TH4T 1FIEA 5C92A 4M1CD 5D6DA 1ITBB 3HRZB 1SEBA 2OP4L 3OKNB 4LCWD 1CFSA 1J1XH 5DD6B 2VITA 2XWTB 1DANT 4PJFF 5C0GB 2VLKB 3GSNB 5E9DD 1MJJB 4XP6H 4J3UA 4Z18A 1K85A 3PQYD 3TGXA 1H3PH 1MJ7H 4P5TB 1H3WM 3D0VA 4JHWL 3O6FA 1CXFA 3BO8B 5DD3H 1QSFD 2J8OA 1FAKT 4PGBB 4PJ9D 3W11D 3QIBA 5FV2A 4TUOB 4PRPA 5IQ7H 1I9IL 2N7AA 4I0PB 1RK1B 1MRFL 2UV3A 2ZG1A 3NACL 1MCLA 2D31A 4XP9H 1QHPA 4PGCB 4LPUA 5ICYA 4RWYL 1NPUA 1BLNA 1I7RB 5JUEL 3HI6H 1KB5H 1S7VA 1OP9A 3QQNA 3EOAB 3AM8A 4ZAKC 3J7HA 5GJSH 3L6FB 3U36B 2CH8A 3RAJH 1XGRB 4RZCB 1NMBL 4Q2ZB 5GGSA 5ECJE 1TVBA 5C0DB 4IS6A 3MUY1 3MO1A 5D1XC 3BGFC 5A1AA 1SJXA 1LO5B 3CDYA 1S7RA 2R4RL 3C8KB 2EXWD 1JPFA 3GSXA 3DGCR 2DLFL 3BYYA 2NY5L 4PJGF 4WW2F 1SY6L 4ONHA 4YJZL 4UAOC 5CJOH 4FTVD 1VHPA 1MCPL 3ILQC 4D0DA 3BKJH 4NRXA 4JDVA 1OAYH 3PL6A 3HUJF 5D71L 5H37H 3FOMA 1DFBL 1Y0LB 3HN3A 4OCRH 4PV9B 5DK0B 4X9FA 3WFEH 4C4KT 3EOTL 5I1EL 1QLEL 2FLRT 4MJ6A 4NRZB 5CBEB 4XCYA 1DBKH 3VH8G 5EU7E 3GMOA 2QLVB 3LPFA 4FHBD 1CD1A 1D6VH 1A1NB 2OR9H 5HHOD 4KTEL 4H5SB 4OZ4B 4F33B 1KIQB 4KK9C 2IPTH 5C09B 2OL3A 2WUCL 2C7UA 4NKOB 2XFXA 3KPRE 2FHCA 5H2BA 4UI2A 5JIIA 3OKLA 3PWNA 5ITFB 4JQIL 5FKPB 2VZTA 2DD8H 4PJXE 4J8RB 3JUYA 4WWKC 5IG7B 1FC2D 3IFLL 2IANB 3KPTA 5J9PB 5E2UH 1S5IL 5DJAB 2X4PB 2MCG1 4NO5B 4FQCL 4PUBH 4AH2B 3S34H 4IOIB 3QULA 4K9EC 4MNQB 2R1YA 1UZ8B 4YNYB 5INDB 2QQLH 5E8DL 2CLVA 2DTML 3DYMA 1CGUA 3IDNA 3AGVA 1W0VB 3BZ4B 5FCSH 3MLUL 4K3HA 1RZJL 2OXHA 2XZCH 3UTTE 4BFIA 4RMSA 4KVNH 1K8DB 1H3GA 3HHRB 4O00A 3DYOA 4OIIH 5FYKU 5C0RH 5LQBL 3IJYA 2FEEL 4XVTH 3DMMB 4JKKA 4HC1A 5DRZA 3SGKA 4ALAH 4NC1E 1IBGL 5FDWA 2DMCA 4HHAA 3GMPB 5DRWB 5T3XE 3FT2A 1DANU 3GJFB 1X4YA 3T0DA 2EDXA 4KDVA 4NQXA 5JHDA 2GTWA 1BJ1J 4QRSA 4R4FH 5BZWB 4IRSA 1FVCB 5D5MF 2GSIB 2HTKD 4P4KC 1DN0A 5FHBL 3VXME 1UB6A 3ARRA 1CT8B 3P4MB 4CDHA 1DDHA 3G9VA 2HLAB 1YQVL 4K9EL 3RRQA 5JO5A 4ZO9A 1AGDA 3EZ8A 2A9NL 2DJ4A 1I3RB 1U8QB 3NIGF 3RVWD 1JGDB 2C4FU 1MHCB 3HLAA 4KAQH 4RWYH 2P8LB 3C5ZC 3GHEH 4MCYB 2FJGA 5IJVB 5TQ2H 4Y4FB 3AB0B 2F19L 4OD2B 5EULV 5C9JB 4AYFA 4R7NA 4OKVA 3IDYB 5CEYA 5A16A 2UYLA 4WW2A 1QR4A 1Q1JL 3ZDXF 4PJAB 5CBAA 3P11L 1EUTA 1Z5LA 4X7TB 3LRSB 3ILQD 3U2SA 3VWJA 3RFZC 3ZKXC 4KMQA 3UO1L 5INCB 3KNBB 1MCDA 4H25A 2X70A 3LH2H 3MTRA 4R26H 1UWXH 1TQCB 5EO1A 1F3JB 1F58L 4XC3L 5IMMA 1VB9A 3WDJA 1BOGA 1N2RA 3KPRB 4NQSB 1C16A 5IBUB 1CE6A 1TZGH 1Q9OA 3P0GB 5D1ZC 1MHHB 1O5DT 2VLRD 4OTXL 1Q72H 2GY5A 2DS4A 5E94B 4JO3L 3WNNA 3CFEB 1LNUB 1G7IB 4EUPA 4QNPF 4DZ8A 1FE8L 1PGRB 1DJSA 2JJVA 3W5NA 3QB7C 2ICEB 5ISZB 3V79C 1N59B 1JZ5A 4XWOD 5GISH 3MLZH 5FYJD 1FQ9C 5I30H 5J57B 3UTSD 3BEVB 3ALWA 1X6NA 4Z7QE 4R8WL 1FV1A 5FUOH 2DLGA 4MAYD 3ALPA 5F7DB 2I9TB 3GK8L 4YIQA 1I1AB 3DUUB 1ZGLP 5I75C 2A9MH 5DEGB 4HWBL 5DUBB 3GBNL 1TTGA 4YDIH 2G5BA 4GG8A 1ETZA 3TBVB 1F3RB 5DURD 1T04A 1JNNL 1MCOL 1UT9A 5C0CE 4CMHB 5F1NB 5CD3A 5IMOB 2DI7A 4XVUD 4DVRH 1FNSL 1YNKH 1YEIH 2FD6L 4PRHA 4GLRI 2YSSB 4WTXA 7FABH 5BXFA 5DJ8B 1OCWH 3AU1A 4MD0B 2DKUA 4I1NB 5EUKA 35C8H 6CGTA 3LSOA 3X3FL 2Q87A 1MIEH 4B41A 3BPCB 3C8HA 3RA7H 2R4RH 5L2KD 5ITBL 4XBGB 2JKXA 4MZ3A 3GMLB 4RDQG 3GJEB 4TOYH 2FX7L 5J6HA 2OX5A 2X4QB 4OLYL 3ZKSD 5B38A 3RVWC 5FB8B 5FYJL 2Q76B 4YH6A 5JDSB 2EDTA 3HCVA 4DGIL 4UTBL 3WN5A 1KIRA 2EDNA 3BI9X 4L3CA 4M43L 4NIKB 2PYEA 4HKJB 4BZ1L 3DTXB 2AJ3B 4LCWA 4LLAA 3HZVA 3DOSA 2IBZX 2D03H 3AMLA 4XB8A 5FYJE 1OM3H 4AQ1B 5I6XC 4PJDA 1J1PH 2EDKA 2ZOKB 5EUOF 1EERB 4YDKH 4QXUH 3OKOA 1O7SA 1MRDH 5DVKA 2BSRB 4GKOA 5GPRA 5IFHL 4QXTB 2P8PA 4Y4HD 4XP4L 1PSKL 3MBEA 1LD9A 1B0WA 1PDKA 3O6FD 4U6HA 4WW1A 4BH7B 3HNTL 2YWYA 1TJIL 1ZT1A 4JKLA 2ZCKH 3RWJB 3UTPD 2RJMA 3SGDI 4APQD 3HC0B 1A6PA 4U1JB 3HZYA 2F5AH 4O2FA 4N0RA 2XQBH 4S1SH 3P30L 4PLJC 1MRCH 3I6GA 4NN6C 2CDFB 3QBTB 4QRPE 4MQ7B 4ODTL 1FL5B 2ZUQC 5DURB 3EYQD 4MMXC 5SWSE 4MQTB 3QO1A 2MCPL 4MAYB 2XZQL 2J5LC 1U8HA 3DLQR 3FQRA 5L7XH 1CXIA 4CVZB 4UU9A 3H2WA 1ACZA 4ZOBA 1Q0XL 1LK3H 5F1KC 4GO6B 4JZNA 5F7NC 3B6SA 2NY5C 3EJYC 3F7PC 4WV1A 1Q0YL 3D25B 3OKDB 1NBQA 1T1YA 4Z0XA 4NUGH 4X5XA 5DA4A 4RRPG 1VACA 2VDQH 3WIFA 2RBLA 4WCYL 3HS0A 4GXUN 4PLJD 1T6VN 3CIQA 1J9CT 1J5OL 2NMSA 1S8DA 2BNQD 1BIIB 2CIIB 1QQDA 4Z7VA 3MYJA 3WNOA 1ADQL 1CVRA 5EWIH 1YY9C 4HLZG 4H88H 4Y1AE 4NHCL 3Q1SH 5DLML 5FA4B 4Y5XB 4Z95H 4JKWA 1DQDL 3IAQA 3MV9A 2OP4H 4D94A 5IV2B 1JZ4A 1H3XA 3AXLB 3WLWC 1LP9E 2G5RA 1HQRB 5EZLA 1GPOH 3S88L 3ZTNL 3SQOH 2XPGA 2XRAL 3RKDD 2NCMA 1FO0H 1FYTB 5JORB 2NQCA 5E8EB 2R9HC 2W0KA 1VFAB 2YUZA 5L8JB 3QUYD 5C0CB 4XNUH 2E7LA 2AI0L 1MIEL 5TDPA 1BQHG 4MD5B 4HPOH 4GKZB 1ZWIA 4OI8A 2RCSL 5GRXG 4GBXB 2RAMA 3I2CH 1RZGA 4XT1C 1G7HA 3FB6B 2F8OA 3JWNC 4MGXA 3RWIA 5I1AA 5I1DA 5CGTA 4Y2DA 1F6FB 5FO7A 1R3IH 2NY3B 4BELD 3HE6C 43CAA 3MACH 1CGSH 1X5XA 5AZEL 3QEQD 2DQIL 3S37X 3WKML 2V2WA 1OP3H 3S36X 2CDGB 5ISZE 3ARFD 1TITA 4YWGL 5E5UB 1J18A 5F96L 3IAGC 3PWLA 1H5BC 2V17H 1N0LA 4X6BA 3HAEB 3GUTA 4XNZC 4NQVB 1KIPA 4IIQC 3ARYA 3MFFB 5ABDE 2N7BA 4NNYB 3E2HC 1RZIB 1MI5B 3FQXB 1T0NA 5E4IA 4WV1C 1XAUA 3PJSA 5F44A 2OJEB 1U8KA 4D9LL 2HWZL 1KJ2H 3E8UL 1E4XH 4HQQH 3VCLB 2X4RB 2F58H 4F7PB 4K71B 3QXTA 1M1SA 2ARJQ 2H3NA 3L3HB 1K4DA 3C6SB 2CPCA 3ZE0F 4WUUB 3R06A 2DYPD 1NCTA 4OZFG 2FO4A 2VAAB 5TJWK 1L0XA 3NCYP 3OSKA 5DWUH 4RGNE 4S1DC 2D2OA 3LDBB 1FGNH 1G7PA 4Y16D 4C56D 3MQIA 1IGTB 2GW5A 4M7LH 4P2OB 5IB3B 1OLLA 2IAND 5IFAL 4BFEA 3DX9B 1JGEA 1P4LB 4M48L 1IEAB 1KTDA 3TNMB 3ULUH 4CNIA 1WK0A 5C1MB 5E9DA 2YZ1A 1IGJA 3IKCA 3PG2A 4KQ3L 2LTQB 1QZ1A 4PG9A 3O2DL 5ELIA 4LLUA 5ITBH 2B4CC 4NQUA 2XN9A 1XR9A 4MVBC 3TEUA 1NCAH 3QUZB 1NCBL 4LCCC 2DTMH 3GBLA 3MJGX 4UDTB 4CRPA 1MHPH 3EO0B 3P4NA 1ZT7A 3TN0A 3GUTB 2BOCA 4JFEB 1D5MA 2XG5A 1UGNA 3DIFA 1BVLB 2VDNL 2NYYC 3WN5C 1YECH 4OIIL 3UTPE 1IGMH 1RIHH 1WVZA 3U6RB 4YFLI 1ZHNB 4P9ML 4JZOA 1NANI 2R8SL 1YYLL 4EOWH 4GXVH 5AYUH 3BRFA 4GMTH 1EUUA 2DICA 4WFED 4K7FA 1BJ8A 2IPTL 2V17L 5JLZA 2NX5A 3D18B 7FABL 1JL8A 5CJXC 4EN3D 2NY2D 2EIZA 3KHQA 1HKLL 1EA9C 3VXUE 3M1BA 2MQCA 2E7HA 1YEIL 3V0AC 32C2B 4YGVB 1H3UA 4G9FE 2C1PB 3R1GH 3DXAE 5DHYB 4U1NB 5IFJB 3R0MA 1ZLUK 2F74B 3MCKA 3ULUF 2FATH 5BRZE 3CK0L 4YO0A 2JJTC 3AMKA 3IU4L 3KPNA 2XA8L 5FYLE 1H3TA 4JO1L 2QQNL 4NRYB 4A6YB 2P48B 1MCEA 1CDYA 4KXZH 5KSAA 3OJDA 1AR2A 3EYQC 4XPFH 4XPGH 4PJ5B 2PF6A 4M48H 3LQZB 1XFPA 4XTRC 3BHBA 4NM4H 4PLKD 2BNQE 1WZ1L 5AUMB 3MGAA 1JNLH 3RPIB 4UDUB 1RZ7L 1EAPB 3IDJB 1UM6H 2AXGB 5ID0A 3THMH 2C3GA 2VLKD 4UILH 4U49A 4ZPTB 5KSBF 1N6VA 2C3HA 5CKGA 4PRBA 2W38A 4NZDA 3IFPA 4LPYA 4Y4KB 1S7WA 3QUXB 2EDHA 3FO9B 4EKXA 3RGHA 4YE4H 3L7FA 4Z7WE 3V5KA 3NPSC 5IEKB 1MHPL 3RUGA 1B9ZA 2WUCH 3HB3D 5GQBA 5IFHH 4H8WL 5FK9A 1DUZA 4OLZL 4LVOC 1SEQL 4JDZA 1BZ9A 4WY7L 3QH3A 1D6EA 1BIHA 4XWGL 2B0SH 4JLRB 3B6SB 3IDGB 1MAJA 3BVNB 1JF5A 4P57A 15C8L 4KAQL 1J0JA 3LEXB 4UINH 4PLKC 4JFFB 4YHOL 1R0AL 5DGRA 5CKAA 1QKZL 1IQDA 4MA3B 5EOQL 3T4YA 3BUYA 3MNVA 3V0VA 3PGCB 4HJGB 4A2MA 4RGOH 4PJEA 1UM4L 4YXLH 4KK5D 4P3CH 1XF5B 2FWOB 1GGBH 3IRPX 4U31A 2R0KH 4DGYH 1G9MC 1WBZB 3V7MA 1UH3A 1VEPA 3O8XB 5DQ9A 3VXSB 2AJSL 3VGAB 2FATL 1J1XL 2VZSA 1BF2A 5KVDH 4G9FA 4CJ1A 4PLOB 5GGVL 3VFUA 4D0CB 5L0QB 5B8CC 4KKCD 2C4XA 2CJUH 4OZHE 2N56A 1RZFL 4H8WC 4NQEB 2MTPA 2EE6A 3SDYL 4G7VL 5K59F 2X4UA 4JREB 3JVGA 2APWA 2QADB 4HMCA 2DDQL 5DTFA 4NP4L 2AV1B 3O6KH 4WI5A 1ADQH 4MLIA 4KJYB 1NCDL 3NFPA 3C5JA 1KEGL 5D7SL 2VXTH 5BRZB 4TSCH 4ZUVA 4PS4L 4ZNEE 3C87A 5F21B 2UWEF 1FVDA 2JJTA 2YKLL 4HXBL 3WHXA 4Z7OE 3D48R 2JIXB 1LGVA 3WIHL 3B2VH 4X8JA 5TH2A 2BC4B 3H0TB 3ILPA 1SJVA 4MCZA 5I73B 3WL9A 1PKQB 3I75A 5LBSL 4FFVC 4XPHL 5AAWA 3LSOB 1ZMYA 5IB5B 3MXWL 3TJEH 2C3WA 4XBPB 3V7AE 3ARZA 4HCRL 2AK1H 4OQTH 1ZVSB 5FYLH 4RAUB 3M45A 3RIAK 1A5FH 1A7NL 5JXEC 4YPGB 5DD1H 5KS9B 1S7TA 3MJ9H 1T7XA 5FYKD 2Y36L 2LV4A 1BBDH 3HZKA 1IGCH 4PRPE 3EYVB 3WD5H 2CLRB 1W8NA 1XR8A 4YHYB 4J6RL 5I66B 3ZTNH 4QRTA 4HXAH 2D7MA 3AM8C 4ZAKA 1MUJB 5CSGA 1JHKH 1ORSB 4FFVD 4YK4B 3B43A 4EXKA 4RISL 3NABH 1QACA 4Z9KB 3TESA 3HKFA 1K4CB 2FR4B 2FJHA 4JFDA 1R3KA 3CFKA 3MOBH 2DM2A 2UWEA 3BEVA 3MLSL 3IFNL 4QXGL 2ICWB 5FECB 4R3SA 1C5BL 2CRZA 4OSUL 3P73A 2YXFA 5GHWL 2JJUA 4JG0L 4BZ1H 4FA8A 2ICWI 1J0IA 3SY0A 4WY7H 1LO2H 5F97E 1FFNB 2NLJA 1G7IA 3VXUB 4EUPB 2AEIT 1ADQA 5EZJA 1NGWB 3L3OB 2CMRL 2ICES 2P8MA 1BFOB 1A6UL 4FQQA 5CMAB 1IM9B 1KOAA 2AJZA 1WGOA 2BSTA 3VGBA 3N50A 5JHLH 1BFOA 1CE6B 1LE5A 2P5WD 4I77H 1DBML 1I9RH 1IC7L 5EU5B 1T0MB 5D1XA 1FFNA 1OQXA 1QHOA 2NLJB 3DROA 1P7HL 2GHWB 2JK5A 5JOPD 3DXAB 1RK0B 1I1CA 4YBLB 1JPGB 1CG9B 4GAGL 1YEDA 2J1KA 1KJ2B 2AEPL 3A6CH 4CMMA 4D0BB 2OZ4L 5MENA 4W4OA 3IJHB 5F9JB 4DKFL 2B2XH 3BN9C 3D1MC 4ODTH 1I8LA 3SDXF 5CJQL 4KJQC 2CLZA 3VGDA 1A0QL 4L8DB 5DEFB 3MNWB 4MXVF 3D87B 5EU3B 4M9PA 1AHWA 3O2DA 3W39B 2PXYA 1TFHA 3CVHA 5GGUA 3K2UL 1P4BL 3Q5OA 5F1OB 2ADIA 5EORH 5BW7A 3MODL 3LKOB 5AYUL 3H9ZA 3BKMH 1LEGB 4YPGA 2JTDA 5SWSD 2VR4A 4UIMB 2ILLA 5KSAD 4PRDA 3WO4C 2ZP0T 5E1AA 1LEIB 1ZSDB 3MBXL 4L9DA 4KJQD 2KL6A 4KKBD 3RNQA 3GJFA 4NO3B 2CD0A 3ULVD 4FQ1H 2H1PL 3LPWA 4G80B 3GSVB 5EWIL 3MRJB 3DNKA 3I75B 2FBJL 4KMTH 1TENA 4PJBB 2EXYD 4M7ZB 2H2PC 1U36A 1YECL 2CO7B 2YPLA 3I84A 3RIAF 4QHMB 1MREH 1G7LB 3EZJB 4I48A 4U1KB 5D6CB 4LHUB 4RGMC 4I4WB 4Q9RH 2YD4A 4PJGA 1QD0A 2FIKB 4FZ8L 1CD0A 2Q7YB 3SJVB 1UG9A 3NCBB 1S7XB 3MV11 3W81A 2Q8AL 4M62H 3N1MC 5L2KA 2H8PB 5C0JB 3V4UL 4R0LC 4YDLC 3L3JB 4WRLA 2EYRB 4JFDE 2VR5A 3QHTC 2YPLD 4KKBC 4OLXH 4G9FB 1H0DB 1KJVA 3CH8A 3QDJE 4OQTA 1AHWC 5GZND 1D9KB 3MRDB 4MJ5A 2GUOB 3OB8A 5DWUL 4JRYA 4DEPB 4ZD3L 3FQUA 2D7OA 4WI9A 4PJEB 1MWAA 2NY7H 1CF8H 1TZHB 2I27N 1CE1L 4O2CB 4W4OC 1YNTA 4P2RB 4V2BA 3MRNA 4ZQKA 3V0VB 3MNVB 3P4OB 5DSCB 2WIMA 4OZHA 3LS5H 2IPUK 2W91A 4MDIB 3L5IA 3SDCD 1HILB 4NHUB 4KJPD 2HMIC 3U9UA 2ZCLL 3CD4A 1NC2D 2X40A 1W72A 4QTHA 5KVFL 1NKOA 5DJ2B 5EBGA 5I8EB 4HC1L 4UT9H 1WZMA 4X5WA 1GH7A 5EA0H 4N0UB 5EZOL 2ADFH 3G6JA 4U6TA 5IB2A 1J05A 3L5HA 4RFOL 4UV4L 1HILA 4NHUA 5IEKA 5IMLB 5JOFB 4R4BA 2GITB 1G6RA 4Y4KA 3GIVA 4P46A 3QIWC 3ARBB 2XY2A 5L2JB 5TGBA 3KWWA 1PQZB 5D2NB 3S3PA 4OZIA 1MWAB 1FORL 4FZ8H 3RPIA 2APFA 3WJLA 4TSBL 4OZIB 2VO5A 3QDAA 1F6AB 4Q9QL 3F62A 2QL1A 5DQJB 5H94A 3QP3A 3DX6B 3QUML 2DF3A 1MVFA 4I0PA 4M7KL 5DUMH 3N1PC 3ARED 1U6AL 5FCUL 3MRBB 5E03A 4F58H 4NFDA 1J05B 5CAYB 1LEKB 4LCIL 2EYRA 2J88L 1MCOH 2FSEB 3O6FB 4M6OL 1X5AA 4OZHF 3C6LD 5FYLD 1ES0A 1X5ZA 4M8QB 1KNOA 3OG6B 1SJHA 3IU3A 2HTLD 4LNRB 5DJZB 2J6EA 2OR9L 2VZ1A 3MRLB 4WJ5A 5LBSH 1NBVL 1JTOA 3O6MH 5F72S 2ENSA 4Y2DD 2J6EL 4UT7L 1FJ1B 4I48B 4HIEA 2EECA 4U1KA 2KDGA 1D7FA 3KXFA 5DMIH 2WBKA 4QRPB 1QO3A 4LEXL 4KVCH 4QRRE 4KK8D 1VSCA 1EHNA 5C0AB 2WWMC 1B90A 4XVJH 1T20A 5C07D 3TV3L 4M5ZL 4BQ6A 3TVMA 2F54A 2FIRT 3MRDA 5E8NB 5D96C 4PJIE 5T5NF 5JW4Q 5E2TH 4Q0XH 5IT2H 5C70A 1C7SA 3ARDB 4CW1A 3BZDA 1ZHBB 1RD6A 1L7TL 3TBSB 3TN0B 3T0VA 3BH9B 1A4KB 3P4NB 2JB5H 4OFKA 4DN4L 3SJVE 1FDLH 5ID1B 3GSUB 4X8XA 3DVNA 4LU5L 4Q58C 2YRPA 5K9OA 1AXTH 1UB5B 3EOBB 3RPKA 3UYOD 1Y6KR 1YC8A 2IQAB 2XWJA 3CFJB 3SJVA 3IFNH 4HIJB 5EOTA 2ATKA 1IGJB 3LS4L 5HGHB 1OF2A 5DI8B 5HHVH 3TFKC 3U7YL 2OR7A 4PRAB 1I85A 3TBYA 1IEAA 1KTDB 3QG7L 2V2XA 2FECL 4TVSa 1G7LA 4QHMA 2HFGL 2F5AL 1WWWX 1JGEB 2OL3H 2VYRE 5I15L 4XB7A 5I1HH 2X4NB 2EO9A 4OJFH 4XCNB 5GRWA 4D9RD 3EUUA 2QQQA 2X4TB 1JPGA 3OKKA 3V4VH 5HGBA 3DXAA 5CEZL 1U95A 3BISA 3MROA 1QA9A 3GRWL 4U7MA 4KGJA 5D72L 5SV4A 3L3HA 1CWVA 2H3NB 3MXVH 3VWJC 1YMMA 1EMTL 2IADA 3PWVA 3EDEA 5I17B 5DRNB 3TH3T 3MV8B 3F65A 2F19H 3ZDZE 5LCVL 2AVGA 1QYGH 2XZZA 2F5BH 3OB0H 5BO1H 1TCRA 5A3IC 5IHZB 1A7RL 1FFPA 1I7ZA 1MI5A 3FQXA 1DVFB 1NBZB 2FGWL 2P44B 5T5NG 1FL3A 1JRHH 2MQ0A 2XTJC 3N1GC 5SX4I 2GI7A 1CFTA 2G2RA 4R3SB 3Q5TA 3TPKA 3W39A 1IAKB 3ZE1E 4PBXA 1K5NB 3HAEG 1E0OB 4R9HA 3BW9A 5AG8A 5EN2B 1FNFA 3IFOB 4L29B 4UBDD 2DQFB 1HINH 1OGAB 3VFNA 1MCJA 1EAJA 4U6XB 4Y2DB 1A1MB 4UTAL 3DRQB 2BVTA 3VH8A 3P77B 3RY4A 2EYSA 2V5RA 4YWGH 4PJCE 3JTSB 4PIRF 4ODUB 2PO6A 2BNRA 4C57C 2A77L 3MRKB 5JR1H 4GKZA 1DL7H 1DBBL 2NY6C 4I18A 4OZFB 8FABB 2J4WH 1EGJA 4LGRB 4YFDB 1YNLL 3P0VL 5T33L 4ISVA 3RGVD 3GNMH 2DDQH 1RVFH 1CICD 2ADJA 3BWAB 2UZYB 4M7JH 4HPOL 1GHFL 3MRMA 3KS0J 3U82B 3MRPA 4LLWA 2ICWA 3KXFE 3SDDA 5FECA 1Q9KA 4MCZB 5IV2A 4WNQB 4NZRH 1JHTA 1FFQA 4N5EC 1BMGA 1E6OL 5IR1A 4YFLF 4G8GE 4WFFE 3SE9L 4PRHD 4M5YL 3GRWH 3MLTA 1QBLL 1NJ9B 5D71H 3GSRB 4GQ9H 1EO7A 4HV8A 4BSJA 5CCKL 3C5JB 2EDYA 3GFUA 1F2QA 3OPZH 4DN3L 1V3MA 4PBWD 1DLFH 3TFKD 2X4SA 1MPAH 3UPCA 2BFVL 2XWBA 4FABL 1QSFB 3FFCD 4WWKB 1IGFL 3QDGA 4NQEA 4X6FA 1QRNE 2Y6SD 2CSPA 3U0PA 3V6FA 1JWUB 1CLOH 4WGVB 5EPMB 1YQ2A 1CDHA 4NO2A 3GEWB 5E8PB 2I60H 1FO0A 4QGTA 3NIGE 5KW9L 3UBXI 2QSCH 3VXSA 2XN9E 2R0ZH 1BGXL 1KC5L 1AXIB 3BXNA 3MRGA 2VXSH 5I15H 1IC5L 2FWOA 2UZXB 1YMHA 3V52H 3BEWB 1KCRL 4NUGL 3MNZB 2JF1A 3F6LA 1GGYA 1BQHA 1NBYA 4M1GH 4KRNA 1AD9A 2X10A 4YQXL 3JV5A 4ZFOA 5TH2B 5L8KB 1NMCB 2FEDD 1JP5A 2A6IA 5E4EB 4PJFA 2BHZA 5E99H 4Y4HA 1IAIM 3O4LA 2APXA 4IEFB 2VXQL 1J87A 1FSKB 1OB1B 1Z9SA 3CC5B 1Z0NA 3LEXA 2YA0A 5HVHB 5C0ND 5JA8B 4NO2B 5DTFB 3RWEA 3MJ6A 5JZ7D 4AG4H 2HVKB 4XAWL 3LZFL 5E2JA 1ORQA 4XMKH 3BPNC 4PJAF 3DUHA 3G5VB 3L7FB 4OCMC 4D0CA 4P5KB 2XA8H 3GO1H 1KT2A 2HH0L 4HKJA 4AENA 2IGFL 5DQ9B 4LSDA 4NDMB 1AQKH 2Q76A 3AB0C 2FHBA 2M26A 3HE6A 3SDAD 1YN6B 3CFIC 2Z9TA 1HCFX 2M8XA 5DR5H 5J6HB 4UBDC 4HJGA 5BMFL 4ZFOB 1JBJA 4MA8L 4PPTA 4M7KH 2VLME 4JCLA 5HDQL 1BFSA 4MA3A 5C3LD 3BEWA 5FO9A 4LAJH 1UXSA 3CXDL 1KCSL 3DMMD 4X6CE 4XH2A 5HYSA 1R5IB 3O9WD 5EG6C 1XT5A 5BXFB 1JK8A 4EN3A 4ISVB 5ERWA 3IDUA 4IRZL 4XZUA 4JO3H 2VWEC 5TE7H 2QSCL 1C5BH 1D6EB 1FFOA 2YR3A 8FABA 5JQ6H 5GGRB 2IFFH 4LVNC 4D9QD 2KUTA 4K7PY 4R90L 2ZG2A 1JZ3A 2EH7L 4Z95L 5I76B 4HZLB 1OWRM 3WXWL 2W9EL 4HUMB 3BZEA 3QUKB 1F58H 4XC3H 5K9QG 1JZ7A 2VDOL 1OLZA 5B4MD 1K3IA 4XNMB 2AGJH 2DI9A 3SDCB 3GHEL 3OX8A 3JWOC 1NJ9A 2O5XH 5CCKH 3BQUB 2CR3A 5E8OB 3QRFM 1CIDA 3LN4B 3NCFB 3QI9B 2E7BA 1G0YR 3TZVC 3LS5L 3B2UC 1NMBH 5GIRA 3SKJL 5ACZA 2H2SD 4HBCL 4N90D 2OZ4H 3UMTA 4NC1C 4LLWB 4JM2C 4HIXH 1MCIA 1Q9WB 4HIIA 1A02N 4ODXB 4OLEA 2F54D 1PX4A 5KVFH 1U8OA 2Z4QB 5FUOL 1TCRB 2GJ6E 1XR9B 1CFVH 1EXUA 4ZO7A 1MCFA 2EDFA 5J13B 1VGEH 3MCKB 4M7LT 3QG6B 3FT4A 4PV8B 5I17A 5DFTA 4HDIA 4HKZA 4F7MB 1I8IB 3K8MA 1U3HA 2R56H 4UB0L 5MEQB 4ALAL 1GGCH 3JTSA 2YZ8A 5HGBB 3U4EA 1YEGL 2ORBH 3LRSA 4TUJB 1Z5LB 2X4NA 2APVA 4LARL 4EI5B 3N1FC 3O3EA 1RSFA 5KS9F 3KJ4B 4M43H 4WW2B 4KK8C 3BW9B 3L5WB 4KTDH 3EOYG 3QPQC 4S1QL 4WUUA 3TJHC 4JY4B 2VUOA 2FX8L 4HIJA 4K7PL 3DBXA 4MCYA 4JM2F 2IAMD 4TSAL 3QG6A 4QOKD 1JGDA 2NXZB 3K2MC 1KFAH 4TNWK 5E8DH 3U7AA 1F4AA 1EEUA 2Y36H 3P9LB 4ETYA 4RA3A 3K74B 5TFSH 1ZLSH 4QRSB 3OKYA 5E9DB 1I3GL 2DQTL 3CPLA 2HVJA 3QI9A 4ORGA 1U95B 5BMFH 2VLJB 5FEBA 3PQYB 2ZUXA 2VDLL 5C0AA 5EO0B 3O3EB 4RGND 3VXOB 3O0RH 4XNMA 4F8QA 3BP6A 1KACB 3CUPA 4KY1H 1MCSA 3U4EB 3QUKA 3KXFB 5H35B 4XGZB 4XP5L 2Q6WA 1RUPH 3SKOB 5TDPB 4H88L 4Z7NF 5SWZB 1KB9K 4F7PA 5GS0D 1QSED 2IQAA 4LCUA 1SJHB 3IU3B 4Y19E 4OCYH 1I1FB 4MAUH 3CCHA 4OB5H 3QXWA 1U8KB 5JW4N 2QQLL 3PJSB 3CGTA 4U0QB 4EN3B 2I07B 2R1YB 1JYXA 2VSDA 2Z4QA 1TJGH 1LDPL 2RQ8A 2IANA 3BD5A 3RVTC 3HAEA 1ZHBA 1CU4L 2YA2A 3OKLB 5E6IA 5ITFA 5D7IF 2IFGA 4FFZL 5CP3A 4ZNEA 5CIPH 4JRWA 4Z7VF 5ESQB 4ZS6D 4R2GB 1MNUL 2GY7B 2ADGB 4OZ4A 4F33A 4XMLL 3LV3B 3OX8B 3SDCA 2OCFD 4Z7VB 3QQ3B 2AXFA 4WEBH 4ETQB 2GT9A 2DB8A 1UA6H 2RGSA 4QRRD 4G8EA 1RZKH 4HIEB 4L8SC 4YLQT 1IKNC 4ERSL 5IMLA 3HC3H 1MHEA 3V6BR 1VACB 2WINB 3PIQA 3RVXD 2DWDA 1PZUB 3MRLA 5J12C 1U8NB 3VD3A 2G9HB 3QUYA 5IQ9A 4C58B 4G5ZH 5TPWH 5EUOE 1L6ZA 5DJ2A 5I8EA 1EZVX 3R0NA 1VEMA 5D5ME 2OTUB 3I50H 1MFDH 1PFCA 4NCDA 5E99L 3MO1B 3PGDA 2VDLH 1RZ7H 4PJ9C 4XH2B 4LCIH 3REWB 2XRAH 3QO1B 4Y19A 2NY5H 1J11A 1SMOA 2DKSA 3MRNB 2VRAA 3BT2H 2Y07L 3VFVA 1XCTB 4DOHB 1F6AA 3N06B 1FPTL 5F1IA 5GSVA 1I7RA 4OD1L 4EIZC 4NN5C 3MLRL 4FQPA 3S4SA 2CK0L 2ZUSA 3QAZB 2DQDH 3S37H 5C6TL 1T1WA 4H20L 3VFRB 4AENB 2CIIA 1PLGH 4BH7A 1CD9B 4PJXA 1CICA 1KN4H 3D3VB 2OXGA 4R4BB 5CSBA 5KANI 2X1WL 4ZYKA 2FD6H 1WFNA 4NPYA 2Z92B 3OKOB 3MRFA 4OFDA 3RX7A 3K1DA 2CRMA 5GRJH 3HI6L 3TV3H 3QDGB 5B39A 4K8RC 3ULUL 1RV6X 2Z31B 4WV1B 3K3QA 2IBGA 1OCWL 1HEZB 4XNQA 4P99A 1MJUL 4NBXB 3WFCL 2F15A 4QTHB 2PYEB 2JELL 3HR5A 4L3CB 3JXAA 5JNYB 4K71C 5FHAL 3LEYL 4PJ7F 3ZDYF 1OW0C 3MBXH 2O93L 4PJXF 4WHDA 4Y4HB 2YD7A 4QHNB 2BVOA 3ET9F 4CN4A 2YS4A 1I7TA 3D2UD 5FXCH 2WBJC 4YBHA 2APBA 2RFXA 5KVDL 1FL5A 1S9VA 1Q9KB 3C6LA 2ZSVA 1E4XL 4FXGA 4HQQL 3VRIA 4TULL 1YMHB 1RULL 3CSPA 5DJCB 5EOCJ 4G7VH 4LSSH 3V4VL 3T0WA 5LWYL 4X4MA 2P43B 5BJTA 2QR0A 2ZCHL 4W70A 4MDJA 3SCMC 2EDEA 4WU5A 3KYNA 2DM3A 2ZJSH 4UQ2B 3OB0K 1I1YA 3LKSB 4MXWH 1JWUA 5D2LF 1QKZH 2PYED 3LKOA 5GGVY 4WWKA 2FJFB 1O0VA 3ULVH 2D7TL 4OZIE 2EEAA 3BKYH 1A14L 2OMNA 1BEYL 4PBVC 1OPGL 3UZVB 3VH8B 3FHAA 2EKJA 3GMMB 3O2DH 2OBGA 4EEEA 5FOBB 4HLZH 2J8HA 1DVFD 3WN5B 1I1AA 5EU3A 2I9TA 3HMXH 5FV1L 1SM3L 2NY0D 25C8L 4QHLA 3RHWK 5GSRA 1PLGL 4WUUE 1AI1H 4IM8A 4JB9L 1OTUC 4GAGH 1KELL 5K9JL 2ICEA 1C1EL 3EW3B 1RK0A 1TQBB 3CU7A 3PL6C 4P23A 1BPVA 1T1XA 2HJKB 3TT1L 4I5BA 1DVFA 1NBZA 3JBG7 4Y8DC 4JFHE 5CP3H 3ZO0A 4AEIH 3CFCL 4L3EB 1H15A 1MCNA 5BOPA 3GSNH 4YUEH 2YD3A 5EZJB 4RCAA 1MFEH 2UY7A 2BX5A 2HJKA 3IB4A 1TDQA 1UYWH 1YUHA 4PGDA 3OKKB 4CN6A 2NXYC 2WP3O 3W0WD 1FN4B 4NZTL 3ZL4H 1AQKL 1R3IL 2X7LA 2PXYB 4QXGH 2BVQB 4U3CA 4G6KL 5F96H 5C0AE 5FHBH 3W2DH 3GBNH 1FL6A 3CFKB 3H9SB 5F7EL 4KKLC 2ESVD 3VJ6B 4CADA 2WUBH 1XIWC 5GRUL 4DKEH 4L8BB 2BVQA 4KMTL 5MENB 1J7VR 4IJ3C 3CFJA 4X6EB 1HH6B 3H9YA 1I3RA 1U8QA 1P7KB 1P2CA 4Y8AA 4NBZB 1JRHL 5D1XB 1L7TH 1U6AH 4AZ8A 3HZKB 3BP7B 1HHKA 1CT8A 3WE6A 5C0IA 2NXYD 1CFNA 5JIHA 4MSWB 5HI5D 4QXWA 4S0TD 1IE5A 3B5GA 3ARDA 1BFVL 4FQJL 5K59E 2IADB 1JI1A 1JNNH 1T1XB 3NGBB 4ZUWA 2VLMD 1P4IL 5L88L 4HWNA 4R4ND 4YC2B 2CO6B 1KF9B 1FZMA 1IC5H 5SWQB 3C6LB 4ZUUB 3GMPA 5LAXA 5A2IH 1K2DA 1UADC 5HHNA 3B3IA 1R3KB 1EX0A 4HFUH 4QY8A 1I7TB 4CJ0A 5J11B 2XIDA 3VWJD 4BK4A 5DR5L 5HXMA 1DBBH 4JDTL 1FJ1A 3MGTB 1HK6A 1F8TH 4B7LA 5ICXA 1FVEB 4HWUA 4PD4J 3MLYH 1WWCA 2AS5M 2E5EA 2DQEL 4JFXB 1X5HA 5KAQG 4P59L 5ACLA 3MA7B 3GSUA 3H9HA 2CLRA 1UM4H 4Y16A 4NFBA 3PWJA 4LF3B 4RRPA 4JPVL 1RHHB 4NPYB 5B21A 2BK8A 1JE6A 4ZYKB 2P46B 4QOKB 3MRCB 4MDJB 1FZKB 4UNUA 1DSFH 2XY1A 1FNEA 4ZFGL 5L2KE 3CMOL 5HYFA 5IVXB 4NKOA 1JCKA 1UKSA 2R2BA 5GS2D 4GOSA 3X12B 3BDXA 5JW4R 5T3ZL 3LKPA 1KIQA 4N0FB 3SKMB 3WJJA 1E4XI 2RFXB 3ARBA 2BC4A 3H0TA 5L2JA 4GG6B 3DV6B 1Q1JH 5F71A 2BVOB 5I73C 5AZ2H 1QO3B 3WHXB 2D0HA 3CAFA 3REWA 3TNNA 4EZMA 4U1HB 4HJ0C 4NQCD 2GCYB 1K8DA 4GBXD 4ENEC 1RJCA 4BFIB 2OTUA 4XNXH 5DVNA 5E56A 3LH2L 3UCRA 4WJ5B 5DJZA 1P84K 3C09C 1QLRB 3GSQA 4OFYA 1JFQL 1NUDA 3QQ4A 1QG3A 2PR4L 1W72B 4TTGA 2VZUA 3UX9B 1JZ2A 3REVB 3CXHJ 2GCYA 1MHEB 5FYJH 3RBSA 5J9PA 2J88H 5IBLD 5ALBH 4OZHB 4EOWL 4FN0A 4ZAKD 3ULVE 1OHQA 3RKDC 3ARVA 2EEDA 1WWBX 4UV7L 5TDNB 5H2BB 4YHKH 1VENA 5K93A 4P2RA 3B9VA 1GAFL 1AFVH 1VPOL 4OCXH 3LKPB 1DQMH 3ZLQC 2DQDL 4N0CD 5C09A 1BLNB 4NQTA 3FQUB 1VKXB 5SWZD 3X17A 3GSOB 3VG9C 1CXKA 1BOYA 5HDLA 3CVIL 1CQYA 2OJZL 4PJ5A 5HJ3A 3B2VL 2ZUVA 5TDNA 2NY4B 4XCYB 3HC4H 5KVEH 5MI0B 5EU7C 1KUMA 1RHHA 4O4YL 2WMPA 3FOMB 1NAMH 5TE4H 3LEYH 1EDQA 3CSGA 4FTVE 1QFHA 4M5ZH 3REVA 4J3WA 3RTQD 5IW6A 3H9HB 5F6IC 2WK2A 4YO0B 1MJUH 3D39A 3QQ4B 5IQ9B 2EEBA 1HYSD 4U1NA 1WTGT 5HYIA 2I9LA 2PETA 3TH2T 4W68A 4F9PA 3QWQB 1FVEA 3SKOA 2OQJB 5C0GA 3INUL 4JPIB 4YHML 1KPRB 2C3XA 3FO9A 3O11B 1ZLSL 3L7EB 2RHEA 4QY8B 1WCQA 1XGRA 3QQ3A 3ARGC 4CDGC 4OLWL 1YNTB 4HT1H 3ABZA 5TF0A 4N0FA 2AXGA 2CRYA 4DGYL 5SWQA 1S7VB 1G9EA 4PB9H 1IL1B 3BHBB 1E4KA 5IUSA 1ZANL 4X80H 1T03H 2AEWA 1WT5C 2BP3A 4J4PA 4YDVB 5F6HI 1QR1A 3VG0L 4QOKA 4MZ2A 2CGRL 3P9LA 3OF6D 1MEXH 3TM6A 3SO3C 3D6GA 3F12B 1KCRH 5DK2B 3OZ9L 2R2EA 1YPZE 3PABB 3N85L 3MA7A 3P3YA 3QXUA 3NH7H 1I1FA 1A6WH 1TJGL 1KBGL 2VSCA 4XVJL 3RHWF 3NIFF 5DHYA 5DVLA 1EMTH 2C1PA 5C08D 3IKCB 2VQUA 1DQLL 4DTGL 5ICXB 4MNGB 4IMLA 2XWTA 5D6CA 2WV3A 2ZZUT 2UUDH 3TA3C 25C8H 1MFNA 3T3PE 1NL0L 2YD1A 4G8GA 4MVBD 3CUPB 3LAFA 4LPCA 4G9FD 3WNKA 1TXKA 3TCLB 3F8UB 5IWLA 2B8OT 2X41A 5H37G 5D7LE 3WS3B 1LO0L 2A74A 1NLBH 3LY6A 3WS6A 2AK1L 3F5WA 4PGDB 3MC0A 4WUKL 4DKAA 2O5YH 3RZCC 3CPLB 3UROR 4GBXC 1I8IA 5KOMC 1HZHL 2OK0H 1AJ7H 3D69A 4FNLH 4Q6IB 4UIMA 3DIFB 3O4LD 4KV5F 2H2SC 2WQ8A 3QCUL 2DRUA 4MSWA 1HCVA 4EIGB 5C0IB 1NGWA 4UDTA 1UJ3C 1T0NB 4U0RB 3KVQA 1P7QD 4LLVA 1CGVA 3GIZH 3UZQA 1KXTB 4RSVA 5DFVD 3NMEA 4OLWH 3T65A 2DQHL 4XNYL 5GS0L 1O7VA 1HKFA 4OF3A 4KMLB 4WFHE 5B3NA 2W9EH 4JY4A 1AHWB 2J8UF 3P0YH 4JFDB 3CJJA 4P59H 3WIHH 3VJ6A 4L8DA 4CADB 1UEMA 4RFNB 4WU7B 3NAAH 5BS0B 1BWMA 1R5VA 5F9JA 1IGTA 5IB3A 5IHLB 1ORSA 4LLMB 1P5VA 3ZL4L 1B6DA 3LN5A 4YHIB 1JYVA 4KZEL 1Y6MR 4S10A 4LMQE 3S4SG 2JK5B 4QHKI 3SE9H 3NIDE 4LHQB 4QCIA 1B0RB 3VXQB 1P7QB 5L7XL 3VXMA 5GS2H 2XZCL 3VCLA 1I1YB 3LKSA 4UOW1 2I26N 3QEQB 2AJZB 3UDWC 3LDBC 9CGTA 3HI5L 3O81A 1HSAB 4Q6YA 5JHDE 3PWPA 5IF0B 4NNYA 1U8OB 1KCLA 4U3HA 1LO4L 4ODXA 4S11A 3ARDD 4X6BB 3P73B 3O9WC 4P46D 5I16A 3VE0B 3K80A 4HLJA 5ACZB 1S9VB 4G5ZL 3ES6B 3SGEI 1MAMH 4UMGA 5HI3D 1DL7L 1SM3H 4QOKE 4D9RE 3GI8H 3MODH 3WMSA 3TZVD 2VXSL 3LRHA 4NKDA 2DQCL 4IRJD 1OTSD 4OT1L 4HPYL 1C1EH 5D1XD 4OSUH 5FOBA 5I1DB 4P49A 2FH8A 4NO0D 3LHPL 3A6OA 1NC4B 2Z31A 3GB7A 5HGGS 2FJFA 1L9MA 3PDOB 3EYVA 3VGHA 1S78C 3RU8L 4MXWL 1DBMH 4KK5C 5CSZA 1T83A 4FQIL 4KZDH 5M7QA 3ROOA 5FO8A 1NCNA 4C83B 3E0GA 2QR0B 4UT9L 4AL8H 2WQRA 3EYOB 4RAUA 5M94B 3Q6GL 2CUIA 3I6LD 4Y2OA 4JZJC 1NLDH 4HWZA 3P40A 4JQXC 4LLQA 2VZVA 4CVZA 2BJMH 4X7DC 2N4IA 3S4SB 1PJ9A 1FBIH 1ZS8B 2XT1B 4FXGB 3VRIB 3KGRA 1PKQA 1N5YH 2BNRD 3VWKA 4GS7B 3CLEL 3ILPB 4Y19B 3BUYB 1BQHB 1VFOA 3I6GB 3MNZA 1DP0A 3S8WA 4QHNA 1AY1L 4WTZA 1FC1A 3BSZL 3HE6B 1FVDB 4I3SH 4U1JA 5IB1B 5JNYA 4LHJB 2OM5A 4NDMA 1NUGA 3S35H 2PYFA 3LB6D 4P57B 2GJZB 1LD9B 5C09E 2OL3L 4DJMA 5DZLA 4GG6E 5D1ZD 3K4AA 1KEGH 2G9HA 3EYSH 4NQCA 5C2BL 1QFUL 4OLXL 2WINA 5HTSA 1QSFA 4JPKL 3E2HB 4FMKA 4ZS6C 3MZTA 4LCWB 3UJTL 1JGUH 1CICB 2D7TH 4JZNB 4X9IA 1ZAGA 4PRBB 3EHBC 1GGUA 4F15C 3GI8L 3VD9A 1T1WB 2OTPA 2GAZB 3VFRA 5L88H 4JM4H 2YMXH 3MYZA 2AEPH 3A6CL 3QUXC 4PJGE 4DGIH 1MEXL 4O4YH 4CU7A 2DLTA 1K6QL 1XF5A 3A67H 4I0KA 5GSVB 3MV7A 1PY4A 3K81A 1N7MH 4Z7VE 3B83A 3S98A 3SDDB 2VXUH 3K8KA 1JNHA 3PF2A 4W6XB 4TNWF 2XV6B 1LDPH 5L9DL 4M93B 5EUKB 4QRPD 2DBJA 4ZSOE 3SE3A 4RFOH 4UV4H 3MRGB 4KRPC 5IF0A 1JZ6A 1OGAD 3I3DA 3EYOA 3BVNA 3IDGA 3SEPA 1L9NA 2ZCKL 1BGXH 5DO2D 3FB5A 1X7QB 5FO8B 4KJPC 2DLHA 3D2UA 4LCUB 1C08B 3U48A 4I18B 4OZFA 5IMOA 5I1EH 3PDOA 4PJ8A 3RUGB 5FYKL 2Q6WB 1OD7A 2XWBB 4YUEL 3AY4C 1HSBB 4PJ5E 1REIA 5CEZH 1ETZB 4NQDE 2AJ3A 4JFED 3CFCH 3DTXA 3DRQA 2V7NA 4G7YH 3O8XC 3WSQH 1U8JA 4KHXL 1GCFA 3KYKL 3BP6B 3K8LA 3QDMB 4GW1B 1R5VB 3HCVB 4K7FB 2NY7L 1EAPA 3IDJA 2ADGA 5B38B 3MLTB 1A7RH 4WI4A 1KTLA 4N1EA 4DFHA 2BSSB 1IAKA 3VG0H 1WZ1H 2AKRB 4JREC 5GS0H 3QIUB 5E6IB 4GSDH 3VE0A 2QHLA 2XXMB 3MRPB 2I25N 1CFTB 2DI8A 2Q3ZA 4X6DB 3FKUS 2K7QA 1MQKL 3EO0A 3BWAA 4O02L 1A3LH 3N85H 4M4RA 3V6OA 5GGRY 3VI3F 3AY4A 3LQAH 1HSAA 3OV6A 2AGJL 1WFTA 1FCCA 5SWSA 3MXVL 2VDOH 1H8SA 3RTQC 4JFDD 4NQSA 1OAZH 2VLJD 1N2RB 3TO4C 3VXMB 3VDBA 5CJ5A 4S1SL 2QSTA 5IQ7L 5FGCB 1F3JA 5I1JL 3MROB 1UENA 2H45A 1HYSC 4LIQH 4ODUA 4U6VH 4YR6B 3L5WA 4JO1H 1D5IL 4OGZA 4XCFL 5C7XH 3LN5B 5B22A 4XCNA 1WZKA 1WAAA 3HA0A 4I8DA 1OQOA 1QPXA 1N3NB 2VR9A 4YXKL 4MNGE 4N5UA 4DN4H 3PQYA 1Q38A 1RUMH 2J12B 4FZEH 3R06B 5DUML 4OV5B 3FTGB 3I9GH 1AXTL 4M4PA 2P8LA 2LAGB 1D5MB 4LSSL 1INEH 5AAMA 5LWYH 4N8VG 5FKAA 4OZGB 2HYMA 5IIEB 4DGVL 1HNGA 2JE8A 5DK2A 1U2CA 1MFAL 1RZIA 2AAVA 2N1KA 3IDYC 4M5YH 1DDHB 4OGXL 5E94A 1YJDL 5IIEA 3P4MA 3K4ZA 4URTB 4O58L 1EJOL 3D69B 4L4JA 2O5ZL 3DBXB 4PG9B 1YMMB 1EHAA 3M07A 4LEXH 1IM3A 3ARFA 5E8NA 4XX1G 4S1QH 5DHVH 3BN3B 1QFOA 4KTDL 1QLEH 2V2WB 2EIBA 5SX5H 4PREB 1T7ZA 1YY9D 1T3FB 5CZVL 4POZD 1VPOH 1A21A 4U1IA 1N3NA 4XNYH 4JFFD 3QHZL 4LSUL 3WFDH 1E6JL 2K1MA 1NCWL 1RZGB 2YD5A 4KKLD 5F3BA 2FECI 2QQKL 1PD6A 3IAPA 1NGQL 4IMLB 1BF8A 1U3HB 1OF2B 5DI8A 4NNPH 4TN9A 3QDGD 4Y4FA 3SBWC 1E4WL 1XIWD 2XWJB 2HT4C 3FT4B 4PV8A 1KNOB 5SWSB 3WNMA 1FE8H 3B4NA 3NN8A 1A7OL 4LRIA 5K9OB 3PABA 4UIKL 1JK8B 2VMFA 5JO5B 5JORA 4NO5A 4AH2A 1AY1H 3F12A 2CJUL 1R5IA 2C26A 4ZXBC 1A4KA 5T5FH 5DXWA 4YHLH 4HSQA 4X6DA 4PJDE 4TPRL 4J8RA 2EE2A 1ZKAA 4I2XE 1FFRA 1Q9WA 3RY6C 4J7RA 2DYPB 4PJEF 4F9LC 3WFEL 5D7JB 1PKQE 1RUML 1N64H 4KPHL 2EDJA 3FL7A 5JHDB 1J8HA 4Y5XA 5EORL 2BSSA 1J86A 1IL1A 3FT2B 1CI5A 5JPMA 2QSVA 3Q0HA 3HUJE 4BFGA 5C2UB 2D9QB 3MYJB 4KQ4H 4CVXA 2EDDA 2V7NB 3LOWA 5IVZA 3DHJA 3FB6A 4V1DD 1G0XA 3DMMA 2R1XA 3IJYB 1KPRA 1L6XA 2D4DA 3DVFA 3O9WA 5I76A 2F8XC 3G5VA 3VI4E 4Z7UE 2LABA 3CH1A 5IB2B 3QISA 4NRXB 3WIIH 2F58L 3D25A 3OKDA 4LNRA 3LRGA 3QRGL 3S6CA 2NY0C 4GRLC 5IESH 3MUJA 4M8QA 1A5FL 3NH7L 4U6VL 1L4IA 3UDWA 5CFHA 4YNYA 5INDA 4PRHE 1D9KD 5IW6B 3VA6A 2RB8A 3RDTD 5I0DA 3MRBA 2B1HH 4NWTH 4LVNB 3D85A 3RUGE 1G9NH 2AJVL 4M6NL 5HYSB 1EBPA 2DLEA 5F70A 2A6IB 4ZUSA 4K3DH 4NSKB 4PJHF 1IC1A 1ZTXH 1P6AB 3G5XA 4HG4J 3OQ3B 3OJMB 4H0HB 2YOCA 1NCWH 4ONGH 1WIPA 2B5IB 3GMQA 3VXTA 4K9EH 1M6OB 1NC4D 4LQFH 1K8IA 4HIXL 3BQUC 5MEND 3BPOB 4FP8L 5DMYA 1A22B 3S7GA 2GAZA 2BSED 2IBZY 1MF2L 3GIVB 3E3QC 1S8DB 1FZKA 3D9AH 3MBEB 1KG0B 2B4CL 1IGYB 1A3RL 5DQDL 5EPMA 1D9KC 3TYFB 3BSZH 3EDFA 4L5FH 2CUMA 2DQIH 1KTRL 4Z0XB 3D0VB 3V0WL 2DM7A 4ONFH 5GS1A 4M8VA 2X4SB 3GSQB 1S7XA 1OAQL 2BHYA 2QSQA 2GJZA 3O2VL 4YX2H 4HAFA 4I4WA 2OI9C 4QRQB 2VLKA 4LHUA 3T2OA 5JQ6L 4PJEE 5C0DA 3ORJA 3OKNA 3FCTB 1B4JL 3ZTJH 1KPVB 2ZSWA 3B3IB 1Y18B 3KDMB 3GMLA 3U36A 3HZMA 3MRIB 5FGBA 4WO4D 4YFEA 1HIMH 3BIAX 3QNZA 4ZUUA 3SKMA 3UYRH 4J4PD 4G80A 3BPCA 4CGTA 1LK3L 4MJID 1HH9B 3OAZK 2R29L 2XZAL 4OFPA 3DSFL 1UXWA 5IESL 5IVXA 3BXNB 4JY5H 4L8CA 3S96A 3TA3A 3LHPH 3QRGH 4PRDB 4PGEA 2LQRA 2JJSA 1FO0B 2C3VB 4OZFH 3BX7C 5BS0D 3P11H 4XP9L 2UVEA 1G9NL 2AJVH 1TZGL 4GAFB 3PWJB 4LF3A 3QIBB 2IC2A 1WLHA 3QG7H 1QTYT 3U83A 1SY6H 5C0JA 2BNRB 2PO6B 2M2DA 3IETA 5T3XH 4GG8B 4Y5XC 4MS8D 3ZKMD 1MJJA 5DUBA 3RUGF 1D5BA 5E7BA 5F8RC 1AIFB 4APQB 2H26B 3RVVC 4J4PC 4HV8B 1PX3A 4JCMA 4X9BA 2VKXA 1AGEB 3MNWA 3QO0B 1J0YA 4IMKC 3EYFA 4ZXBA 4R2GD 1TPXB 3CLEH 1SEBB 5EN2A 2D0GA 2YPLB 4KDTC 1KN4L 4MD4B 1HHGB 5HHNB 5DHVB 1K2DB 3PV7A 1XMWA 3ROLB 4D0BA 1KJ2A 4J3SA 1CF8L 1I3UA 1JUFB 5J6GB 4DK6A 3GI9H 1G9MH 4KUZL 2A9NH 1IQWL 3MLXH 1T0MA 3T0XA 3QNXB 4CAGA 4WI6A 4YHNB 3MOAL 3RVXC 4QYOB 3MV8A 2BSTB 1IM9A 4F7EA 2I24N 4NWUH 4ODSL 1WBXB 1CDJA 1FRGH 1HHKB 4KUCF 3CSYA 3OAZH 1X4ZA 5F1NA 4R0LB 3Q6GH 5KW9H 4P23B 4JN2A 5FM8A 3V4UH 5CZKA 4JB9H 3HTLX 3T09A 3KNBA 3SDDD 1IKFH 2R4SL 4L4TE 5EU6A 4F37K 3WO3B 1A1MA 2R39A 4Z6AT 2UWEB 4PJAA 4WU7A 3U46B 5DZOA 4L29A 4HWEL 2KH2B 3IFOA 4JRYE 3S34L 2VC2H 1J1OL 2XICA 3QUMA 4PJCF 4ZFFA 2HTKC 5A16B 4V1DE 3H9SA 1QRND 4QEGA 1FGVH 1XF4A 3LKQB 2X7LB 1CGWA 4CMMB 1YEDB 2VDNH 2YHGA 3HLAB 3T65B 1DEEB 1YUHB 1FL3B 4K3EL 1RUKH 3GIZL 3ZKQD 3C5SB 1XR8B 2G75A 4XHJC 4KKCC 5EU5A 3ZE1F 5E2UL 5I9QC 5TE6L 4MLSA 5J1AB 3I9GL 2ESVA 5H8DA 4MJ4A 2QJDA 3O3DB 4P9MH 4TNVK 5I74C 4CW1B 1Q9OB 4XPAL 1DUYA 5EOCL 4IRSB 4Q6IA 2IAMB 5F89A 1B6UA 2VKWA 1J0ZA 1J8HD 5DJCA 5D7LD 4JM4L 2A74B 1KCKA 1JUFA 4X6DF 1YC7A 1PKOA 2FCBA 4K7PH 5GHWH 3NCJH 4BJLA 3U2SB 3CXHK 3HNSH 2IG2H 5D1QC 2C1OA 3ARBC 4QHLB 4TTDC 1K4CA 2FR4A 4L1DA 5CEYB 4R7NB 4MNHB 4MNGA 2H26A 1JYNA 4P2CG 4NN5B 1AIFA 1N5YL 1IGIH 2BY1A 3S97C 4GW4B 5CUSL 1GSMA 3O4OB 2CLVB 1ES0B 2EE9A 1WC7A 2X4UB 3H3BC 3DVNB 1A4JB 1JV5B 2R2EB 3RZWA 3FQNA 2HLAA 1OD9A 5AZ2L 1RFDL 5DJAA 1IGML 1CXHA 3BH9A 3KYNB 5SWZE 4OUOA 4DKFH 1DN0B 4YQXH 3CX5J 2ZUUA 3L95B 4OF0A 3DX6A 3LEVH 4L8CB 2F54B 4AEEA 3MCLL 2C7UB 3P9MA 4KHXH 4DK3A 1T20B 1XCTA 3SGEH 1HDMA 5IHUH 1BQUA 3RL1B 1CBVL 3J8F7 1ZGLM 4HH8A 3HZMB 1P6FA 5FDWB 4P46B 3MSPA 3O6LH 3F6IA 3FCTA 4WFGE 3U4BH 3FONA 3O11A 1NKRA 4JKPH 1OTUD 1RUPL 4LPTA 3EFDL 1P9MC 4JPIA 1NFDB 4HBQA 4HH9A 2Q8BH 43C9B 3G6JB 2YKLH 4OBSA 1MWAH 4JFOB 4D0DB 2I9LB 1KV3A 5ICZB 2AV1A 4XNQB 3BZ4A 1VERA