4GRMA

The crystal structure of the high affinity tcr a6
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
187
structure length
184
Chain Sequence
EVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVTTGKLQFGAGTQVVVTPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A6 alpha chain
publication title Increased Peptide Contacts Govern High Affinity Binding of a Modified TCR Whilst Maintaining a Native pMHC Docking Mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 184
sequence length 187
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmA02
4YR6A 4E42B 2AAVA 2CKBH 2PCPA 4PP2A 2BRQA 2YRPA 2F54D 5FGSA 2A73B 3ARWA 4LSVH 1HILA 4NC1C 4HIEB 5DEZA 1BFOB 2LTQC 4IS6A 4JKKA 3DSFL 3AB0C 3OKOB 4YEEA 1G7LB 1R0AL 1G0DA 1KIQB 4P3WA 5D2LA 1YEJH 3SCMD 4YHYB 1F3DJ 5I30L 4P57B 2BRRL 1DJSA 1QFUH 4OUUA 1FNLA 3DI2B 3OX8B 3CAFA 3NCJL 2Q8AH 3SDXB 1IL1A 3BWAA 2IANA 3DVIA 1VFOA 1HHGB 4YZFF 2VZVA 2ZUWA 5IFAL 1REIA 5CJOH 4YQXL 4KHTL 1FNEA 5DD6B 3GHBL 3SE8L 3C2AH 4YBLB 1MEXL 3MLTB 4JREC 1FLRL 4HBQA 3UTTE 1OF2A 4HUXB 5D96B 4OCLC 3NOIA 4YXHL 5TF0A 3BQUD 4PGCB 3QRGL 4Y5VA 3DBXA 1T3FA 1I7RA 5DRWA 3BUTA 3MO1A 4K9EL 5D2LF 3RVWC 1WCQA 4XP5H 1X5FA 3TBVB 4XMPH 3WL9B 2NXYB 3ZO0A 3VFSB 4UT7L 2JE8A 1JN6B 3ORJA 4KI5D 5IB3A 4N8CH 4JFFD 1IM3A 2VDRL 5BW7A 1BM3L 3SE9L 2X89A 4M1DH 5FO8B 3LB6D 4B53A 4PGDA 4WW2F 4CJ0A 1KCVH 3FQRB 3MOBL 5IQ7L 1IGIL 5FA4B 5C0RL 5FM5M 3FZUC 3EOAA 4U1HB 4YIQA 3REVA 4M7ZC 3LQMA 5EU3B 3PWJA 1FL3A 1X4YA 3BI9X 1R3IH 3DARA 3K0WA 2ADGB 3MLPA 2C1OA 4IRJD 3ARDC 2ZUTA 4I18B 2X9WA 1T03L 3AREB 2W1NA 1WFOA 2EE3A 1FJ1A 3MCLH 3D85D 1B9ZA 3R06B 4I13B 4U05A 1XF5A 3C6LA 3TVMA 3DVGA 3FHQA 3UBXG 1KCKA 4F7EB 4IHOB 1A0QH 3WXVL 5KJRH 2XZAL 1MCOH 5FAAA 1PLGH 3MR9A 2CRYA 4XC1H 2NY4B 4WVRA 3MTRA 5I1IH 5DSCA 3D3VB 2X7LB 3WV0A 4LLVB 2WMPA 1HI6A 2A9MH 2UV3A 2VDMH 4LLUA 4D9QD 1UQSB 3PDOB 4QOKD 4YDIH 1UB5A 3KPSB 1U36A 5F1SA 1A6AA 5IF0B 3HPJA 1YMMA 4P48A 5EOCJ 3QULA 4TVSa 1P5UA 2O5ZL 3I50H 2FD6H 1F42A 4M03A 1J87A 2A6IA 5JDSA 4Q9QL 4WY7H 1DUYA 1FFOB 1M7IB 3T65A 5GS2H 3B8SA 5IHLB 1MPAL 5DZLA 1A3QA 1TMCB 1ZS8A 1MHPL 4A6YL 3AU1A 3EYSL 2VLRD 3RWIB 2X44D 3MV8E 4RX4D 3ROLB 1A1MA 4Q9RH 1A9EA 1ZA3A 4HUVA 3X13B 1F8TH 4XXCC 3LKPB 1ZHKA 3WO3B 2ZOLB 1QRND 4Z7VE 5LVEA 3PL6C 4UBDD 3H9SD 4EVNB 4M1CD 3TO2B 1IMHC 4I3RH 2NW3A 4HUUB 3SKNA 5GRVL 3OL2A 3D18B 3STLA 4L3EB 3S96B 4BSWB 5DUMH 1OP3K 3VRIB 3RNQA 5HSFA 1E27B 1IEAA 4HJJH 1ZHLB 3QDJE 2HN7A 2JF1A 3TA3B 3DXAA 32C2A 3BRDA 2WP3T 4O9HH 1NGZA 3P4MB 1TZHB 1RUAL 3MGAA 2LVEA 1WBYA 4PJEE 2GW5A 2ZSVB 3MBED 1INEH 1JYWA 4FQLL 1XZ0A 4Z78B 5DC4B 1XF3A 2WSKA 1P2CB 1XGTB 4PLJD 1MJ7H 5I15L 1KUMA 4C83A 1QSEB 3FT2B 4ONGL 4JGUA 4LBEB 2AABL 4GBXA 1X7QA 3NN8A 4K7FB 1RUMH 5IMMA 3U9PL 2CLVA 1I9EA 1FZOA 1UZ8B 5BRZD 4X99A 4XPGL 1U58B 3TH4T 2EYRB 1KLFA 3MRIA 4PYGA 4K2UL 1INQA 5E2VH 1BFVH 1KB5H 3HNSH 4WCYL 1AHWB 3SDDD 2BNRB 5DFWH 3QUXC 1HSAA 3BVNB 1FYTD 3S3SA 2CIIB 4LCWE 2X4PA 4AT6B 1RZKH 2Q86B 1CFBA 1LWRA 3MV01 5DLML 2ERJB 3IF1A 3KYKL 3N1PC 1QVOB 2Z4QA 3WE6A 4N90E 1J8HE 1R24B 5J13B 35C8L 4WUKL 2Y25A 5AZEH 3K81A 2RQ8A 1H9VA 5BO1H 2EDXA 1ZT1B 5BXFA 2B1AL 4BQ6A 5JHDA 1OL0A 4KRNA 3JV5A 1SHMA 2LQRA 2AK4D 3HS0B 2F53E 5JMOC 2Y36H 3GIVA 2VWEC 1JPSH 1IGMH 2A77L 5E2TL 4P4RB 5EZLB 5KW9H 3MLXH 5CLWA 1S78C 2CLZA 2YR3A 4PJ8A 6FABL 3MGOB 3ULUD 4HJGB 1A6PA 3O0RL 3LQAC 4TTDD 4WHYH 3IU3A 3ILPA 3IETA 3SPVA 3W11D 1MCPL 1DBMH 2QSCH 2YD8A 3ZL4L 2I25N 1RZJC 3FTGB 1WT5A 1JPST 4CGTA 2Z31A 2YPLA 5C07B 1RZIA 4WHTB 1LO2H 4PP1D 3WIHA 2IGFH 1JGVH 3GI9H 1MFAH 4ELMF 3X3FL 4OIAA 5D71H 4PRIE 3MV11 3KPLA 5FUOH 3IDJA 4P2QB 1O0VA 3ARXA 2MHAB 1NANI 2F5AH 2DWEA 2F58H 4Z95L 3KYMA 1FH5L 1AKJA 3KWWA 1T21B 3GSXA 5E08L 2RHEA 3HG1E 3VWKB 3HI1A 4LP5A 2LFGA 4NWTH 2DQIL 2VXSL 3SQOH 4N0UA 1FC1A 2GYSA 4IJ3C 5B38B 3QAZC 1Y6NR 3IFOA 3DMMC 4OIBA 3UAJD 3V5KB 4X5XA 5HI5D 1BOGB 4Y5XB 4CVUA 4ZS6D 4LCYB 1H5BB 1P1ZB 2VSCA 3RDTA 1BX2B 1P5VA 2BCKB 4JJ5A 4ZDHB 4HH9A 4ZS7L 5IIEA 1BMGA 4LGSB 3QWRA 3GK8H 2GJZA 1OPGL 4XPHL 5GGRY 4R7NA 1FC2D 3VI4F 3L5WB 4G8GA 5I1DA 2FHFA 2E7MA 3MRCA 3NFSL 3DV4B 2IH1B 3ULVF 4MCZB 1LK2B 3CD4A 1I85C 4XP6L 1Z9MA 4YNYB 3OKKB 4FXLA 2H2PD 5LBSH 3MREA 1YEEL 1BBDL 1YYLH 1AD0B 4FN0A 3VD9A 4Y5YC 5HBBA 5KS9B 2ADIB 2VLME 3MYJA 1HHIA 3T77B 2BVEA 1OGTB 3TT3H 4I0CC 2ZKHL 5IG7A 5GISL 5HD8C 1WIPA 4KK9D 1NC4D 5E6IC 4RFOH 1ZT7A 4Q58C 1V3LA 3SDXF 5HGDA 2CKNA 4JPWH 5T3ZD 3CDGA 4V1DE 1IT9L 3Q6FB 4HGMA 4J2XA 3G6DL 2FR4A 4LHUD 1LE5A 3TC9A 4LMQI 4RA0C 2H9GA 3W81A 12E8L 1A22B 4PG9A 3ILQC 4MXQD 1KYOK 2XWJA 2DMKA 4ODTL 4Y4FC 4RRPG 4KMLB 3V4PL 3QG6A 2VJXA 3ALWA 4DJMA 5IBLC 4IOSD 4HPYH 5ILTL 4ZG1A 3RPKA 5FGBC 4HWZB 3AMKA 4KWUA 5DRXB 3QDGE 4KUZH 5F1OB 4ETQA 3AS1A 4FRWA 3BDYL 1CK0H 2X89D 1NBVH 5AZ2H 2WV3A 3V0WH 4PJBB 4HKJA 4XMKL 4XAKE 3U7YH 3LKOA 4HJ0C 1BQLH 2ITCB 4YHLL 3KPRA 4NKOB 5BVJA 5IW1B 1P4LB 1T6VN 4NUJA 4G6AC 3E1F1 3MLWH 3VXUA 1CFVL 4LF3B 2XY2A 5ANMA 2FWOB 4QRRA 4FQQA 5HY9B 1FGVH 4PB0H 4JGMA 4POUB 2CRMA 1AQDB 3WIFA 1M7DB 4LFHD 1IC7H 1RURL 4O5LL 5JQ6H 1KJVB 5MI0B 4F7TA 4H26B 4F8TA 5FKPA 4MD4A 2B39A 4LOUC 3WXWL 2J6EL 3QUZB 2R69H 4NZJA 4W4OC 2AEQH 1JPFB 4X7EC 4HWBH 4OCXH 4MA3B 3SDAB 1JFQH 4PRBB 2OYPA 1HDMB 1YDPA 3QZWA 4Z0XA 1GGIH 3GMMB 3MROA 3VFNB 1GGUA 1Q94B 1P53A 1CFTA 2VDKL 2BSSB 3C09B 4F9PA 4J6RH 4JM2A 1YMMD 2P4AB 3EOBA 3QIWA 2QQNL 4JKLA 3IFPB 1MJJB 5EDXA 4OFYA 4YDVB 5DVOA 5DMIH 1WZ1L 1VFUA 4HMCA 4S2SA 5GRJH 2LAGB 4UT9H 2QADD 1ZT4B 4KVCH 1CICD 1DLHB 5HYEA 5DZOA 1C1EH 5F89B 4ZUWB 2DQGL 4XPBL 5T1DL 4ONFH 3D25B 1XEDA 4L3CA 5DQDH 5JUEH 3EJZC 3GBLA 3OAUH 3RWEB 3EFDL 4WFGE 4YHPB 3RWJB 5J7CC 4ZO7A 5FOBA 1AIFB 3MV9B 5IEKB 4JM2F 4MD0A 3G08A 2JJWA 5CZXC 4HX1B 3C08H 4LPYA 3VFVB 4LKXA 5I66A 4K71B 4I0PB 3UC0H 4JJHA 2EIDA 4KJQD 5HJ3B 2NY2C 2B0SH 5IFHL 3S97C 3U4BL 1U8HA 1HK6A 2WUBL 1KGCD 4XC3H 3P4NB 4L4JA 4PJ7F 4X4YA 1AI1L 4G9FB 1WFTA 1LEKA 3G04B 4DZBB 2OQJB 3DXAD 3VXQA 5DR5H 3UDWA 5AEAA 1KCUL 2W65A 4U1SA 4YXLL 3ULUH 4P46C 4OAWB 1L7IH 3ECBB 3EGSA 4KHXH 2Y06L 1BD2A 5MEQB 4GXVL 2NY3B 4P23C 2MQ3A 4L4VA 4OLWL 2E8ZA 4YWGL 4JRXA 4XCEB 3NA9H 4LNRA 1T5WA 1AFVL 2E7LA 3QO1A 5CEZL 1DBBL 1AP2B 1DBAH 1AGCB 1MI5E 1MFEL 1P6FA 5DJZA 3TYFB 4KVNL 5FA3B 4BK4A 3NCYP 3SBWC 1J86A 4E0RB 2FEDD 5GJTL 3ZKMC 3FQUB 4WI7A 1J0ZA 4GBXD 5I9QB 2BOCB 4GMTL 1EO8H 2OI9B 3V6ZA 4R2GB 4JO2L 1PZ5B 2Q3AA 4YXKH 3LRSB 5DFVD 4LIQL 4LEOB 2OTPA 3DRQB 3FQWB 4NO5A 4NQCE 4PJFA 1SYSA 5IFJB 4B50A 2DM7A 1QBMH 1FNSL 5F9AC 4I4WB 4MQ7B 3B5GA 4HUMB 5MENB 5D93B 5F70A 2HP4A 1VACB 4GO6B 3U7WH 3FO1A 1DE4B 4MA8L 4LSQL 3RKDC 1UB6B 4YC2C 5KANG 2ICEA 5F6HI 5KSVB 4APQB 2OL3L 4NT6A 3OXRB 2VR5A 1WWBX 1CIUA 2EECA 3F7QA 3MLUH 2H2SC 1KB9K 5F3BA 2B1HH 2FGWH 3PGDB 3T04D 3WJJA 4M5ZH 3DX9B 1YEIL 3L3GA 5GSRB 4MCYB 5F1NB 2AEPH 5I6XB 1HHJB 5T33L 5JHDD 1N64H 4E5XA 2HVKA 2VSDA 2JK5A 2MWCA 1ZVSA 4XNMA 1VFBB 3FO2B 3U1SL 3V6FB 1JBJA 1HCVA 3DIFB 1OSPH 4PJ8D 2VXVL 4ODXA 4KV5E 5E8EA 1MQKL 1U6AL 2KDGA 1M4KA 1HN1A 3P9LB 5MEOB 1TVHB 3KPOA 3OKLA 4JHAL 4K7PH 3K1DA 1IAIH 3GSVA 2Z31D 2G5BA 4L8DB 2ZWLT 3AS0A 2ORBL 4WNQA 1MRCL 1VADB 3FQXB 3OB8A 4PLKC 2XWBB 2FJHA 3HE7B 3U0PB 3A0OA 1EUTA 1LO5A 4C55A 4QXTB 3M07A 4N1CA 4LLMA 2FX9L 5IB4A 1S7UA 2I07B 4KDTC 1NPUA 2XQBL 4IOFD 2UUDH 5T3ZH 2CLRB 5F3HA 1AKJD 3ARFA 4F58H 4PJ9A 1EAPB 2VC2H 3VFTB 2VISA 1O5DT 1EZVY 1FFPB 2CJUH 2E9IA 4LU5L 4FQXC 2VLKD 1H0DB 1HYRC 1FIGH 1AO7E 4YDKH 3TM6A 1NMBH 1EDQA 3QFJA 3SJVA 2V2TA 4M93C 4P2OC 2GK0A 4I5BA 5D1QC 1JUFB 2X4TB 1OM3H 1D5XB 3QXDB 4PRDA 5GJSL 4JRYA 3VXSA 1BIIA 1P69B 5D7LE 3SGEH 2BDNL 3MRKA 4NQEB 3LH2H 3QWRD 4R0LA 2PO6C 2J5LC 3C5ZD 3K3QA 3K8KA 1EFXA 4Y16C 2CMRL 1A3RH 4JO3L 1WTGT 4HIIA 4EN3C 2VDQH 4H20L 6CGTA 3MFFA 3RGVC 3RWCA 2VDNL 4UDTA 3CXDH 3GMNB 4BFIA 1I3VA 3Q5TA 4F57L 2ZNWA 3ZTJG 4CBPA 3HZKB 1MJ8L 5BS0E 1J0KA 5SV4A 2GCYA 3M8OL 5CGYD 4NM8H 1GRWA 1KEMH 2AKRB 3EW3B 2VXQH 3O2DA 3HE6B 5I0DA 1GGCH 1E28B 3D1MC 3DYOA 3WO4B 5C92A 3EBAA 1I1FB 1NH6A 2ZP0T 2A9NL 4P3CL 3L3JA 3QEHB 2ED8A 4Z76B 2YHGA 5SWSE 1BBJA 4DVRL 1F4HA 4P9HH 5HYJA 3OXSA 4X8JA 3QBTB 5HHQA 1NFIB 1MRFL 5EBLA 1GL4B 3EO9H 2FB4H 3E0GA 4XTRC 4R4FH 4GSDH 5DA0B 1YEHL 5IMOB 3MLRL 1CD0A 4DOHB 4HZLB 3IJYB 1X5IA 3B4NA 3IDUA 4MNQA 4UT6L 4Y2DC 1CU4L 1FO0B 2APVA 3FO0H 1HILB 4Y4HB 3SGJA 2VZOA 2W38A 2I5YL 5DI8B 5KVDL 4XNYL 4IS6B 1TVDA 3U36B 4XCNB 1H3TA 3SKMA 2PYFA 3V6BR 4F15C 3BH9B 3DSFH 3OAZH 2VR4A 1R0AH 4F7MB 4OUUB 5I30H 1YUHA 2BRRH 4HLZH 1XR8A 5DJ8B 5DZNA 2IANB 3PGCA 4OGZA 1CDBA 4HWEL 4OD3L 5IFAH 4N9GA 4YQXH 4KHTH 3O11A 3B3IA 5J9PA 1L4IA 4FABH 3L5XL 4QRRD 3C9NB 7CGTA 1P7QA 3GHBH 3SE8H 3PP3H 1MEXH 1FLRH 3KPSD 1B90A 1D9KD 2IPUK 1T3FB 4HFUH 4YXHH 1I7RB 3QRGH 3MO1B 4PD4K 4K9EH 1U95B 3TNMA 3ZE1E 2HT2C 1YQVL 3T8XA 4UT7H 4G8IA 2NY6B 2DIBA 2KQNA 2VDRH 1NCTA 1OSZB 1BM3H 3SE9H 3IKKA 4LPUA 4MAUL 5E8NB 3CC5A 1YEGH 4MMZC 3ZSSA 2ATKA 3MOBH 5IQ7H 1IGIH 3GKZA 3R1GL 1KTRL 3ARGC 5C0RH 1BWMA 1DN0A 1S8DB 3BKCL 3PWJB 5EBMA 3MRNB 4O02L 4JM2D 2C1OB 1N59A 2RBLA 5LGJA 1KIRA 2Y7QA 3QIWD 1KACB 2ARJA 4LLQA 4ONHA 4B41A 1R3JA 1T03H 4GRWB 2CRZA 1I8KB 5CEYB 3TVMB 3C6LB 1D5MB 1RUQL 1AD9A 1CLOL 4M4RA 5EC2A 5L9DL 1ZLSL 3WXVH 3KDMA 4U1NB 3BIKA 4OI8A 5HGHA 2IH3B 3TA3D 5ICXA 3RIAK 4OGAD 1HNFA 1NCUA 2NY0D 4JY6A 4JQXA 4RMWA 2EDEA 1FNHA 1R3LB 3LV3A 4PJIE 1A6AB 3HPJB 2YZ1A 3QQ4A 3K2UL 4PG2A 2ED9A 1DVFA 3ZDZF 2I9LA 4PRHB 1MAKA 3V6OA 4ZOBA 3AS2A 2P45B 4MNHB 5JDSB 3B43A 5T5NG 2O5ZH 4Y4KC 1DUYB 3T65B 1AXTL 5ICYB 4Q9QH 3VD4A 1TNNA 1ZEAL 4IRSC 4K7PY 1MPAH 1BREA 1NMAL 3TH3T 5DURB 4J3VA 3AB0B 4OKDA 1MHPH 4ZSOB 1YZZA 1OP9A 2VITB 4A6YH 1ZA3B 2N1KA 3D39E 5BZDA 1LD9A 4OZIB 3UTZA 4UV7L 1ZHKB 3KXFE 4JRXD 5DJCB 5LXGL 1A21A 2H3NB 4WI9A 3HNVL 2DLGA 3PQYD 4PRNA 3G6JB 4PJCE 5J1AB 2NX5A 3RHWF 3SKNB 1BQHB 4HLJA 4JFEA 1T7WA 2XN9A 2P24A 4AIZA 3LVEA 4QT5B 4N5EC 5I1LA 5CD5D 5C0NC 1N8ZB 1EHNA 1IEAB 5JW4R 3ULVE 3QXUA 1S9WB 32C2B 3GIZL 4CVZB 4UB0H 3T1FA 1NGZB 3WNKA 1X9QA 4U6XB 1I9IH 2PXYD 1UM5L 3UTSD 1K85A 1WBYB 1RUAH 5CJ8A 5SX5K 5GS0H 1G9NL 5C0AE 1NCBL 1K9TA 4FQLH 1Z0NA 2PETA 5DK0B 4P4KA 2E5EA 1FO0L 1LDPL 2BSRA 5CP7B 4J4PC 4M7ZB 3AY4A 1ITCA 2AEWA 1UVQA 4WJ5B 5ERWA 1G7PB 2DIJA 4C83B 5I15H 1RJYB 2BNQB 3IVKA 5C07D 1X7QB 4ONGH 4ZXBA 2AABH 3OJ2C 2CLVB 5JXAL 5K9KA 1ZLVK 5EFIB 1FZOB 3U9PH 2N4IA 5J57B 1PVHA 1C08A 4X99B 3LPGA 4JQIL 4PJGB 2JCCA 4LLYA 3HKFA 4XPGH 3ARSA 3SE4C 4K2UH 1CQKA 5TJWK 1R3KA 4WCYH 3CCHA 4IMKA 1WICA 2DICA 3GKWL 1B0WA 2GUOB 4OD2A 3IF1B 4HG4K 5DLMH 3UO1L 3PNWB 5DS8A 3KYKH 3NIFF 3GMOA 1T7VA 4M61B 35C8H 4I2XA 1KG0A 4WUKH 4CMHC 3UYPA 4I3GA 1MCWM 1K2DA 2B1AH 4YEFA 3U9UB 4WFFE 4RAVB 3GIVB 5CWSB 5EUOA 2A77H 2D0GA 3EJYC 3L95B 4JY5L 4XPTL 2CLZB 1TTGA 5E2TH 1F45A 3ARFD 3WFCL 1SY6A 6FABH 4QXUH 1AGDB 3IU3B 1A7NL 3O0RH 3K7UA 2R9HC 3CMOL 3U6RA 5ESAA 3QWOB 1MCPH 3QISA 4ZFFA 3ZL4H 3PABA 4EOWL 2YPLB 1U92A 3PL6B 1WC7B 4JDZB 4R7DA 5CEZD 3HC3L 2CSPA 4UQ2B 3VXSD 3MNWA 4JRYD 5GGSY 3D3VE 3X3FH 1MFNA 3DRTA 5AD0A 2VL5B 1AXSB 3O9WA 3IDJB 3QIUC 2ZCKL 3GRWA 5FYJE 1EFXD 3T0VA 4FFVD 3PDGA 2DWEB 2DQHL 2H45A 5DUBB 5I17A 4KKLD 5DHYA 1GZPB 2HG5B 1P9MA 3BJLA 4Z95H 3MLYL 3KWWB 1FH5H 4J3UA 5FXCH 4O58L 3HI1B 5E08H 5M7QA 3UTQA 2IFFL 3N50A 4LCCB 4WGWB 4N0UB 3VXMB 5BCAA 2VXSH 3IFOB 1OAZL 3F6IA 3PWUB 3BZEA 4X5XB 4YPGA 3ZHKA 3RDTB 5FYLL 4X6CA 1OT2A 4HH9B 5JW4N 2DQTH 3DI3B 4ZS7H 1IAOA 2VAAB 2VR9A 3OQ3B 3TO4B 4R7NB 5HYJD 1OPGH 4XPHH 4D9RD 5JPMA 4G8GB 2HJLA 2IPTL 3BPOB 4QLRA 3FB5B 1JNNL 3NFSH 1P84J 1MWAB 4L3EE 2X42A 4L9LC 4G9DA 1CDIA 1T2QL 4MNQD 1BJ8A 1CTNA 4XP6H 2IAMB 1S7RA 2QSQA 4LVOC 3KPNA 2GQHA 3C60C 4L29B 2EXWC 1YEEH 5MERB 1X5JA 3ARVA 3MUY1 3C6SA 3MYJB 5JXED 2D9CA 3S7GA 2W0FA 3SKOA 3VI3F 1UZ6E 1SJEA 4RFNC 3CZFA 4CNIB 2JJTC 1RUPL 2ZKHH 3ULSB 5GISH 2G75A 1FYHB 3VFOA 4ZODA 1WZKA 4KC3B 3K8MA 4NNYB 3TN0B 1QSEE 5H35A 1QSFD 2VDOL 1IT9H 3CDYA 2FR4B 1LE5B 1ETZA 1UJ3A 3G6DH 4PG9B 2QSVA 12E8H 3SKUD 2XWJB 4ODTH 3V4PH 4ZUVB 3C8KA 2B5IC 1P7KB 2BNRE 3GSQA 5EBGA 5ILTH 5C0JB 3BDYH 3VG9C 2VLLA 3RTQA 4WEBL 4KKNA 4XMKH 4MHHI 2BXZA 4KKCD 4NUJB 4YHLH 1YNLL 1ZHNA 2HVJA 5FECA 3VXUB 1J1OL 3PWPB 5BV7C 1N5AB 1CFVH 3QG7L 2Q8BL 3MNVB 3WIFB 1G7HA 4YGVB 1RURH 4O5LH 3GSWA 3QO0A 1JF1B 5FKPB 2GITB 4GRWF 4MD4B 4HMDA 1M05B 5T1KD 3DMMB 1S5HB 4KROC 3U46B 1T5XA 3ME0A 3WXWH 5D1XA 2J6EH 4DUWA 3MUGB 4RMRA 5HHXL 1ZGLP 3HB3C 4HS6B 4Z8FL 1U93A 4J7RA 3UJIL 1XGYL 2OZ4L 3I6LD 1ED3B 3H42L 4HV8B 2HH0L 4KKBC 2FNBA 1CD1A 4Z0XB 3PE9A 3MROB 3DETD 4AQOA 2VDKH 4NQVA 3KPPA 1FAIL 4P2QE 1DVFD 4FTVB 1S7QB 5T3XL 1FG2A 2QQNH 4R3SA 4S1DD 1WBXA 2GY7B 1WZ1H 4QF1A 3CFEA 5FK9A 1S7XA 4OB5L 3X14A 2BVQA 4NRZA 5DXWA 2DQGH 4R2GD 1RVFL 4XPBH 4CMMA 5T1DH 4FFWC 2D4FA 4L3CB 5ID0B 1VESA 3JTTB 4CW1A 4NHUB 2AV1B 2NR6D 4Z9KB 3UPAA 1OTTD 3EFDH 5FOBB 1VEOA 4NM4L 4OZIF 3HCVA 3G08B 1NANH 2AGJL 2YBRA 1OB1A 4QKXB 4KRPB 3RVVD 5E1AB 1YQ2A 4NCC2 2NX5D 3G6JF 4TVPE 5L0QC 2LVCA 1PYWA 3WJLC 1AH1A 3QJFA 2V2XA 1H3UA 5GIRA 5IFHH 3HUJE 4RGND 3ZYJA 4X4YB 2JJVA 3U30C 4I0KA 3T0EA 2F74A 4NFCA 5JR1L 3IFLL 1LEKB 1AI1H 4JY4A 2FRGP 4U1SB 4J3WA 4X7CC 1KCUH 1PG7L 4YXLH 4PR5B 1F11A 2NYYD 2HLFC 3VMOA 1JI2A 1BD2B 3O4LE 2GTZA 3HC0B 2Y06H 1MWAL 4GXVH 4L4VB 4MNGA 5HHMB 4WI3A 4GUPB 4OLWH 4PY7A 3VH8A 4YWGH 1DQQB 4NKMB 5DDHB 5KS9E 1JYXA 4P4KD 3T2NL 1AFVH 5DJZB 3L3IB 5CEZH 4KGLA 1DBBH 2FECI 2WBJC 4XP4L 1MFEH 4KVNH 4MSWB 2OS7A 2EKSA 1FVCA 3G9AB 4X6EA 1XF4B 2XPGA 5GJTH 3KYNA 4ZXBD 4IDJH 4F7PA 3UZQA 3V6ZB 5JZ7D 4GMTH 4JO2H 1RK0A 4PJAB 2M2DA 4PJFB 3LZFL 1AXIB 3FOLB 4LIQH 1SYSB 3BZ4B 5ADPL 2ID5A 3U79A 4PJGF 1BEYL 1SJHB 2X10A 5B8CB 5DEFA 1FNSH 4IOIB 1Q0YL 2O61A 3C5SB 2F54E 2JIXB 4HKBB 5C09E 2IADA 3IKCA 4RZCA 4JG0L 1EBPA 4O51B 4M9PA 1RU9L 2NY1C 1F6AB 3LQAL 4MA8H 4LSQH 5C9JA 5IMKB 2ICEB 5C0CB 3CX2A 2OZ4A 2OL3H 1RZJL 1DEDA 4C56D 3V0VB 2B20A 3NAAL 4U1MA 4MJ2A 3CFJA 4HMEA 4PJBE 4Y89A 3EO1B 2PW1A 3N9GL 1YEIH 3DVNA 3NPSB 5J1TC 4E5XB 2HVKB 3RVUD 5T33H 4WI2A 1H3XA 4XNMB 3VD7A 1C16A 3LN5A 3OF6A 5F93C 5GRUL 1HKLL 4CAGA 4MAYC 1MCDA 1DSFL 2VXVH 3VWJC 1QFHA 1MQKH 1U6AH 1BWWA 4WU7A 1MUJB 4J3OC 8FABB 5JA8B 4GRLC 4Y8DC 4JHAH 4RFEB 4XVTL 2AXGA 4ZTPH 4YPJA 1A6ZB 4PRPE 3MBXL 4KH2A 4LFHG 1XIWC 2V5YA 5DJDB 2ORBH 1FZKB 5HHVL 1MRCH 5C6WH 2FJHB 3MA7A 4LLMB 1IAKB 3NZHL 4NKDB 3GMPB 4PJHA 2RCSL 4P2CG 2FX9H 4L4TA 3EDEA 1M7XA 2VAJA 4X80L 3BN3B 3H0TB 4HW6A 1FL6A 3RBGA 4LSUL 3VRJB 1FZMA 2XQBH 4N8VA 2CXGA 3FJTA 2FYYB 4XCYB 3UROR 4JFDB 2FJGA 5C8JB 3O8XC 1J1PL 4LU5H 1MH5A 1SQ2N 3DGGA 5D7JC 1JGEB 4H5SA 1E4KA 4ACPA 1NAKL 2CDFA 3QFJB 3QUXA 4PJ5A 4W81A 4KPHL 3VGFA 1CI5A 3SJVB 4JFOA 1B2WL 1K8IA 4I5BB 4YK4C 3LS5L 4PRDB 1F90L 3GSRA 3IDGA 4HGWB 3IDYB 4I48B 4M5YH 3OKNA 4H1LA 5GJSH 1MNUL 5B39A 4TTGA 3MV9E 2OTUB 3PUCA 2BDNH 4TNWK 1ITBB 3FFDB 1KIPA 2AERT 4LCUA 1EX0A 4Y19B 2CMRH 4JO3H 4K3EL 4F3FA 2YC1B 4X98B 4H20H 2DN7A 2N56A 5I2IA 5F6IC 4QCIA 4D8PA 2VDNH 3DV6A 3ROOB 5IKCA 1NAML 4V2CB 4G9FE 3QDMA 4G6FB 1S7VA 4Z7UB 5KSBA 3JVGC 4GW5A 1MJ8H 1N0XL 2V5RA 1JYNA 4M8QA 1BQHG 4UIKL 3VW3L 3M8OH 3O3UN 3TNNB 1LE9B 1DQML 4M6ML 4U0QB 5JIPA 2VB5A 3FT3A 2VMFA 5D9SB 1JHTB 3L3JB 3RRQA 2A9NH 2YSSB 4P3CH 3KLSA 3VD3A 2W92A 3OXSB 4DVRH 2IFGA 3L7FB 5EBLB 2NY6D 1MRFH 4GRMA 1DQTA 4S1QL 1XGPA 3QNXA 1YEHH 5FF6A 2EDTA 3MLRH 2OMBA 2EDOA 5KSBF 1MHCA 3BYYA 3RZCC 4L8SB 3V7AG 3QXAB 4UT6H 4NYLB 1CU4H 1QA9A 5D2NA 3MRHB 2E7BA 5K93A 5EBWA 5MENE 3BIAX 4UTAL 2I5YH 4XVSH 5KVDH 3VXOA 1Y6MR 2PYFB 4AIXA 5KBNC 5E9DA 3UYOD 1D5BB 2UVFA 1E6OH 4Q6IC 1T2XA 1S7WA 5E8PA 3ARQA 4GS7C 3BGMB 3VRLE 1KLUA 3OZ9L 5HI4D 3RTQD 1XR8B 2H6PB 3S35X 3MMEA 1WJ3A 1KCSL 4P59L 4WV1A 2E7CA 1ND0A 2DQEL 4N9GB 4HWEH 4OD3H 3STZA 4NRYA 1NC2A 5IM7B 1NGWB 5HVWA 4LLAA 1P7QB 4G5ZL 3L5XH 5JOFA 2VRAA 2VOTA 1AGEA 1JCKA 4FQXB 5TDOA 1CGWA 3LKSA 1ACZA 3WD5L 5MHSD 5D1ZC 1G7QA 2PYEA 5MEPA 3LEXA 3SO3B 3VG0L 1BVKA 3OHXB 5ENWA 3TFKC 4F37F 2DBJA 5J89A 1LQSR 1WUNT 3UX9B 4NNXA 3T8XB 4NDMB 1ORQA 4Q6YA 1RK1A 1YQVH 2NZIA 3QH3B 5L8JB 3AM8A 2EDWA 3EHBC 1GGYA 4RMSA 3E6HA 5FYLD 4EI6A 4KRLB 3CC5B 1HQRA 4Y5YA 5ALBL 2APFA 1T83C 4R26L 1BF2A 3VDAA 2VLJD 3R1GH 3VMPA 5EBMB 5DO2C 3BKCH 3RGVB 4O02H 5E6IA 5FYKL 4TNVK 1NUDA 2JB6B 5ADOL 4UILL 2ARJB 4LLQB 2WIIA 4P2RB 1OW0C 3CPLB 1NAMA 4WWKC 5KVEL 4X5WB 1GIGL 1JZ2A 3CSYA 2YMXL 1RUQH 2D0FA 5EC2B 4Z7WB 1CLOH 5GGUB 4Y4FA 2IPKA 2D9QB 5L9DH 1ZLSH 3BIKB 5I73C 5C71A 5HGHB 4D2NA 4H88L 5ICXB 1XH3A 2X41A 1YPZF 5HHNA 3TIEB 1EUUA 1TPXC 1R6VA 1HSBB 3TPUA 4NGHL 4QRTB 4FQJL 1QBLL 2V9TA 4YUEL 3LV3B 2B4CC 4NQEE 1LNUA 3QQ4B 2GIYA 2YD3A 3K2UH 2I9LB 3FZUD 3LDBB 2OK0L 4AM0B 3HR5B 4OT1L 4EXKA 3WIIL 5SWZA 1AXTH 1HXYA 2J8UA 5ACLA 3MRRB 1NCDL 3DJ9A 3ARDD 3OKDA 1ZEAH 2HKFL 3OJDA 5TQ2L 4OLEA 2DJUA 4F15B 1NMAH 1DTUA 1LD9B 2X05A 3U0TA 1QR4A 4HT1L 1Z9SA 1T6WA 2UZYB 2AJZA 4UV7H 5HHOA 2EDLA 5LXGH 3CLFH 4PRNB 3HNVH 5CBAA 1C7TA 3ZKXC 4KTYA 2V5SA 2ZSWA 4QHLA 5DYOA 5TGBA 4JFEB 3T0BA 2XN9B 5KSAC 4AIZB 4LDOB 3QQ3A 4NRXA 5I1LB 2IPUG 5GGTA 3HNTH 1YY8A 1YA5A 5L6YL 1FDLL 4DOHE 1EFQA 3H3PL 4PJAF 2GEEA 4BKLA 3GIZH 1SVCP 3RVXC 3S3JA 5CS7A 1FN4B 5FDWA 3AROA 4P49A 1UM5H 3DURA 2H1PL 1NCBH 1UJTA 3VI3E 3OGCB 3ARGB 2BSRB 3VXRD 1FO0H 1LDPH 1R5IA 3J7HA 2GT9A 4QHUB 3U4EA 3SGDH 4ZNEA 3IVKB 3PL6D 2IANE 3PWNA 3MOAL 4ENEC 4NQTA 1MREL 1QFWI 5K9KB 4L9DA 5T3XD 1RULL 2BMKA 3B9KC 5JXAH 3GZKA 4LGRB 1FFNB 3OF6D 3CFKA 1KJ3L 4RDQF 2V5MA 4JQIH 1OLZA 4TOYL 3ESVF 3BN9C 5D5MA 3HPLB 5DD3L 1CLZL 4G80A 4EEEA 3VE0A 5I74C 1IGTA 2HT4C 3FFCB 3GKWH 4X0KA 2A6KB 5I18L 2VZTA 2GJ6A 4OD2B 4LQ1A 1PBYA 5HGBB 2VQTA 5DS8B 4B7IA 4DW2L 2BSTA 3MJ9L 1N5YL 3UO1H 5F1KC 4P23A 4I2XB 1KG0B 1LP9F 3RY6C 5TF1L 1X5LA 2APTA 2W60A 8CGTA 1K2DB 5EZJA 4L4TD 2LU7A 3EYVB 3JXAA 3ELAT 2BC4A 1RHHA 3BUYB 5D5MF 5HPOA 5EUOB 4M1GL 3NBNA 4L5FL 3P73A 2HLAB 3WSQH 2OJEA 3GEWB 4JY5H 4XPTH 4OFKA 3QZWG 3WFCH 5FUCE 4K8RC 3DX6A 3WLBA 2A6JA 1A7NH 2Q3ZA 3LHPL 1UCTA 4KKAC 3ARBC 3CMOH 2CUIA 4ZFFB 4JDTL 1U92B 1TQBC 4EOWH 5IVXF 3RWDA 3MA9L 3QUXD 4PJ5D 4UMGA 1IRAY 4QYOA 4R7DB 4GRWH 5E5MB 3V52L 3HC3H 3V4UL 4Z5RB 4KY1L 2ARJQ 1J10A 3B6SA 3O9WB 3QEQD 1KTLB 4ORZC 2X4RA 2ZCKH 1OGAB 4AG4L 4E41B 3IDXL 5I17B 1TETL 1E6JH 2DQHH 4PRHE 3JV6A 3MLYH 1XMWA 3W5NA 5EPMA 4Z6AT 3UTQB 2X6MA 4O58H 3QDMD 2IFFH 1A1NB 1S78D 3WUWA 5I76B 4Z7UF 4TUJB 5ACZB 3WCYA 1OAZH 2IALB 1TZGL 1T4KA 2IF7A 3QR2A 4WW1A 3T2OA 4ZUTA 4YPGB 4KK8D 1MCHA 4HGKC 3IAQA 4X6CB 2UYLB 1KJMB 2XKUA 5ISZD 3S88L 5IMLB 1UH2A 1XR9B 3BP5B 5IV2B 4NQSA 1EEUA 4Q97A 3OV6A 5F9WC 3G6JE 5JPMB 1ZE3C 5GS0C 4HKXB 4NQXA 2DQFA 1VCAA 1U3HA 2HJLB 2JJUA 3ULVC 2IPTH 3K1KC 1JNNH 4OZFA 4E9LA 2XRAL 1TZIB 5K9JL 5DMJB 3VGDA 1OQOA 3NIGF 2X40A 1T2QH 4Q74A 4Z0BL 2GTWA 2EH7L 3PWPD 1T0MB 4ORGB 5CLTA 3FN9A 5E0QA 3P77B 4YHYC 4HQQL 3MJ9A 5ICZA 3OAYK 1KEGL 3HC4L 5C2BL 5GRWA 1SJEB 4WUUA 1E4XL 1N4XL 3V7AE 1PX4A 5DHVB 1RUPH 1TJHL 2FX8L 2R0LL 2VH5L 5D1QA 3VFOB 5JW3L 1R5VB 1OARL 2HA1A 1KJ2A 3OPZL 2BNQE 5H35B 4YBLC 1NC2D 4ODUA 4OFIA 3WNLA 5IWLC 4UQ3A 1ETZB 3G5XA 2PF6A 2PTTA 2VDOH 1MCSA 3GMQB 2Z91A 4HEPG 5I8OL 1CQYA 3DUUA 4X6DA 1BQSA 2PYED 1CXHA 3LRHA 4XNZC 2FLRT 15C8L 4FTVD 2ZUQC 1A3LL 3GSQB 1NGYB 5DJ2A 2P5WA 4MGXA 4OSUL 3TBYA 1A2YA 5IB5A 2JKXA 5F7DA 4KJYB 3BISA 2J3SA 3TV3L 1QFWL 2H32A 1S7SB 2BY0A 2MCPL 3QIUB 2AEIT 5INDA 4WEBH 2D7NA 2VE6B 2O93L 4XWOC 1YNLH 2C3VA 2X4SA 4JFQA 4Y0GA 4AQ1B 2ESVA 1MCJA 1D3CA 5HD8D 1BZ9A 2EXYC 4GKZA 4I18C 5E6ID 1J1OH 3AREC 1ZWIB 3QG7H 2Q8BH 2VL4A 4NNPL 3T08A 1V3KA 1QKZL 1WCBB 3GSWB 5IT2L 4NSKA 5FCUL 1N26A 1Y0LA 3ILQD 1F4AA 2C26A 1K5NA 2FIRT 4Y4FD 4JAMA 1EJOL 4LRNL 4Z7WF 2GHWB 4KUCD 2ZUXA 1GCFA 1L9NA 1U8QA 1U93B 3O6FA 5HHXH 5IBLD 4Z8FH 2YPLE 4PV8A 3QNZB 3UJIH 4F33A 3GNML 4AZ8A 1XGYH 2OZ4H 2R23A 3H42H 4NO3A 5D7IF 3IRPX 3JTSA 1J8KA 2WW8A 3SDCC 3VGGA 4HJ0D 4L9LB 4LSVL 43C9A 1FAIH 2V17L 4G6AD 2IMMA 1J0HA 5T3XH 4QTHA 1U8IB 3B8YA 1YN7A 3QI9A 4X83A 2FSEA 5A16B 4LVOB 4CUCA 1JRHL 5CJBA 5SWZD 3HLAB 3X14B 3D0VA 3RP1A 1X5YA 4N0FB 3C60B 4MWFB 2HJFA 4OB5H 4OZGB 3RPIB 1RVFH 5C0EA 4R8WH 4P5TC 4N0UE 3VXME 3VFUA 4RFNB 4LOUD 2LAAA 2W9EL 5E94A 1FIEA 1DEEB 4DAGL 3T4YA 4OF8A 3O3AA 3MV7A 4NM4H 1CL7L 1ZSDA 2AGJH 2E9JA 1HINL 5CKAA 5C0CD 1FNFA 4GXUM 4UINL 1PYWB 4PGZA 4UIMA 2V2XB 4ESKA 3V5HA 1CG9B 1CT8A 4G8GE 4JQVC 4TSBL 3DTXB 3T0EB 3ET9F 1ZVHA 3TYGH 3HAEA 4JDVB 5JR1H 4JN2A 3IFLH 4JY4B 3GSUB 1ZGLB 1S9VB 1FP5A 1YMHA 4OCYL 5J6HA 3NGBB 1PG7H 3FB6A 1OTSC 2AXJA 4XT1C 4EUPA 4FQHA 5FHAL 3L1OL 3FT4A 2KKQA 1MWAH 2F53B 5F72S 5CINL 2O26U 4BH8B 1MVUA 3EJZD 3T2NH 2YN3A 5CP3H 4XP4H 5BV7B 1FVCB 2EE2A 4X6EB 5FYKD 2VWEE 5CZXD 2DWDB 3CFCL 4N9OB 4WI5A 1BVLA 3FB7A 1DBJL 4OFDA 2NY2D 4LEXL 3LZFH 4JKMA 3WS3A 1AHWC 2C3HA 4I8DA 5ADPH 3MRQA 4AEEA 1BEYH 2XA3A 1QG3A 1Q0YH 3NIDE 3IKCB 4CKVX 2KBGA 5HGAA 2YUZA 4JG0H 4IRSA 1RU9H 3IU4H 5C9JB 2ERJC 1WAAF 4ZTOL 3LQAH 4P46D 4CRPA 5KOMC 4YHNA 2GJ6D 4JFDD 5J13C 2GSIB 5JOPD 4MJIA 4P23D 1HHKA 1RZJH 2CXKA 2GAZB 1SYVA 3CFJB 3NAAH 1WTLA 2PW1B 1A6WL 5KAQF 4IEFB 3DVNB 3KPRE 3N9GH 5DEGA 2Q76A 4U6YB 1C16B 3VXUE 1NLDL 2R0WL 3LN5B 2X4QB 4R4BA 3ZKMD 5LJYH 4Q9RL 5GRUH 1HKLH 1IC5L 1YC8A 5IESL 1A4JB 2NQCA 1DSFH 4Y19D 4NBZB 2V7NA 4P5KB 1I8LA 1GGBL 4XHJD 1HWGB 1FLTX 4MA1B 4JM4L 3JUZA 2P8LA 4XVTH 4AENA 3GSNL 4K7PX 3X17A 2DI7A 3MBXH 3MRBA 5HHVH 5L0QB 5IP4A 1I3GL 3GMRB 4OF7A 1GJIA 2W9LA 4PJHB 3QUYC 2H2SD 3NZHH 4J4PA 1J0YA 2I27N 4O2FB 2RCSH 2YPKB 3U30B 4X80H 2Y9RT 4PJXB 1VPOL 4K55A 1SMAA 4LSUH 3O3EA 4O2EA 3VWKC 4JCLA 2HFEB 4NPYA 5IROA 2XTLA 2C3GA 5FM8A 5ESVA 3TBWB 3Q5YA 2MCG1 1J1PH 4GG6A 3QIBA 4Y5XC 4XCFL 1MCNA 1DLFL 1JI1A 4B7LA 1KYOJ 1NAKH 4KPHH 1B4RA 1K8IB 4V1DB 5J0BA 4HIHA 4WENB 1B2WH 5GGRA 3OKNB 3LS5H 4H1LB 1MY7A 1F90H 5B39B 4PS4L 3WNPA 3I02B 5GS1B 1MCEA 5CGMA 1I1AC 2YEZA 5B21A 2YD2A 2NW2A 3MRLA 3QEUB 4ZO9A 4F3FB 4DN3L 3RUGA 5I2IB 4K3EH 3ZKSD 2BNUA 5DK2B 1JGDA 3O3DB 4BSVB 5IKCB 1GGTA 2EYTA 1NAMH 1Z0MA 1I8MA 2DI8A 2HTKC 1ACYL 3CUPA 5C86A 3U48A 1N0XH 2XWTA 4UIKH 3VW3H 3H9HB 4H8WC 2D31A 1A7OL 1BD2E 3GGWA 3W9EB 1QACA 4U7MA 4ZPTA 1DQMH 4M6MH 4EZMA 1T22A 4L4VE 4XVJL 5HHME 4UNVA 5JNYA 4JRXE 4ISVB 4HIXL 4WDIB 4G6JL 4P2OD 1IKFL 5J3HC 3ZE2E 5D1QD 2ZOKB 5FYJU 2CQVA 1B88A 1AGBA 1Q9KA 5KN5A 1K4CA 3EKCA 2WM0A 3GDBA 3ISWA 3IFNL 3L9RB 2PO6D 5KVFL 4S1QH 4YGAB 5HHPA 1K3ZA 4Y16D 3FL7A 4ODWA 3BO8B 4EN3D 1NDMB 5C3TA 4PJFE 1AGFA 5BV7L 3FQNB 1QA9B 4WTZA 3W9DA 1NMCC 5DRNB 3RGVD 1X5HA 4ZAKA 5HDBE 5C08A 5EBWB 4S1RL 1XIWB 5E00B 2P5WD 3L6FA 3FRPA 4QRSB 5HYSA 5EO1A 3HZVB 1CFQA 3MRDA 4Z7VA 5E8PB 3KAAA 2F5AL 1CDGA 4L1HA 3MMEB 4JLRA 3V5DB 3OZ9H 5DC0A 2YUWA 1QZ1A 4WV1B 1KCSH 1IGYA 4P59H 3H9ZA 3ES6B 1EGJL 2DQEH 2ESVD 3UJTL 5EOTB 4RBPH 3QRFM 2XNAB 2QSTA 3QDJA 4G5ZH 5MI0C 4R9HA 4LVNC 3LKSB 1D5ZA 4XTRD 5EU7E 5MEPB 1PFCA 5D7JB 3LEXB 3WD5H 4LSPL 3QUZC 3VG0H 4U4BA 4Y2DD 2OTWA 4BZ2L 4Z7VF 1D6VL 4KFZC 2DLIA 2P5EA 1QLFA 1RK1B 1B4JL 3SDAC 1YECL 3O6FD 1HH6A 4EI6B 5EO9A 4OI9A 2YPVL 1S9YA 1U8JB 2B7DT 4YBQD 5T5FL 5ALBH 1Q9LA 4R26H 2AJUL 1OWRM 1KB5A 1WV7T 1DFBL 2H8PA 4FXKA 2IWGA 4XI5C 4FZEL 3RX7A 5FYKH 4UILH 1TITA 4XZUA 5JO5B 1YYLL 4OZ4A 4PJEF 4POZC 2P7TA 1O7VA 5KVEH 3K4ZA 1MI5B 2YMXH 2IPKB 3CX5J 4G7YL 3W0WB 2QQKL 4RGMB 2VN7A 4LCWA 2GJJA 3RIFK 2NTFA 4OZGF 4XVUC 2N7AA 2VZ3A 5JLZA 4JKPL 2P8MA 4H88H 3IDNA 3QFJE 1J8HA 3EDDA 5CHNA 5HDQL 1M71B 4RWHA 3BESR 3SJVE 3TPUB 1G0YR 3MV7D 1BLNA 5ITFA 3L5JA 4S0TD 4NGHH 4K71C 4I0PC 4FQJH 1QBLH 4YUEH 4Q7DA 2BVPA 2RIKA 4B0MM 1LNUB 3B9VA 4QWWD 5TDNB 5KG9B 2W91A 4RMTA 4BK5A 3PHQA 3ZSTA 2DLFH 3DO7A 4G3YH 3GJFB 3ARGD 5ABDE 1IM9A 4W6WB 1IE5A 1CFSB 2OK0H 5FKAA 1JYVA 4OT1H 3LN4A 4K3DL 1HXYB 1JWUB 2J8UB 5KTEL 3IT8D 1Q9OA 3WIIH 3OKDB 1BFSA 1NEUA 1HNGA 3SCMA 1NBVL 2HKFH 1S7TB 5TQ2H 4Z7UE 2NY3C 5F9DC 5AYUL 3KPTA 2Z8SA 5EOQL 3SGKC 1OTUC 1MFCH 2GK2A 1QEWB 2Y72A 3RWFA 4HT1H 3N06B 5HHOB 1A7RL 1KNOB 3BIBX 4QHLB 4XP9L 4LMQE 3OR6A 3E6FB 5I9QC 3VU2A 1P4BL 4TUOA 2EDFA 2OI9C 2KUTA 4Z77A 3VFPA 2XFXA 3QQ3B 3VFWA 4NC0B 2IC2A 1U8KB 2DMBA 2F5BL 1WK0A 5B3JE 1HH9A 5D1ZB 1YY8B 5ID1A 4OQTL 3UJJL 2DB8A 2R69L 1W0YT 3BAEH 5L6YH 1FDLH 3I75B 5D93C 3H3PH 4BKLB 3D0LB 5BQ7A 3LEVL 3JSSA 3SY0A 4Y4KD 3PP4L 3LOWA 3AAZB 5JORA 5FDWB 3DX7A 1GHFL 1KSRA 3CFDA 1V7NL 3DURB 4IRSD 4APQC 1OCWL 3X11A 2H1PH 5L2JA 3KLAA 1FVDB 1QHPA 3K80A 1JWMB 3ALXA 3I6KB 4AH2A 4OFPA 1C12B 3OG6B 1NL0L 1UA6L 4NFDA 3SGEI 4IRJA 5I6XC 1KBGL 4YH6A 1C5DA 2IQAA 1NJ9A 4UT9L 4HK3N 1HOCB 3HI6L 1R3HB 4X6FB 1MAJA 1MREH 2C7UB 1RULH 3JZ7A 2XV6B 2I60L 3MJ7B 2WK2A 1J1XL 4TOYH 1KJ3H 5IJKA 1SVZA 4G80B 4ALAL 5C0ND 4ZFOB 3CVHL 5DD3H 1CLZH 5I73B 4JG1L 3VE0B 5GPRA 4QGTA 1JZ4A 3P11L 3FB8B 3BYTA 4CJ1A 4X4ZA 4QOKA 4X0KB 5IW3A 3ZE0E 1DP0A 1GAFL 5MP6L 1TPXB 1XCTB 4PY8J 5I18H 2WWMC 4M7JL 1T89C 4J23A 1JZ7A 2BSTB 3HE7C 4JZNA 4OZHA 1U3ZA 2P8PA 4DW2H 5CMAA 1N5YH 3BZFB 4WFEE 3IGAA 1NFDA 3BXNA 5TF1H 5EZJB 1DDHB 3GUTA 2WBJA 2XXMB 4J4PD 1RHHB 2LU3A 5F7FA 5DJYA 5CSZB 2R4RL 1TENA 4Q9CA 3KYAA 1W0WA 1JNHA 3QEGL 3HN3A 5I8CB 4PJXF 2VLRA 2Z92B 1DN2A 3F7YA 4L5FH 4NO2A 4RX4A 3UTTD 3IXTA 3WN5A 4P2RE 3DX6B 2A83B 1CGXA 3BPLB 3F12A 3RI5K 1KPVA 2CDEB 3LHPH 3D2UA 5F88B 2AV7A 4GW1A 3WBDA 1QRNA 3H9SA 1U8OA 3QDGA 3FRUA 1IVLA 4JDTH 1XF2B 1OP5H 3MA9H 2XICA 4HUWB 1EO8L 2AJ3B 3V52H 3QUKB 3V4UH 5H37H 1EIBA 4XCCH 5KSAB 1NGXA 1ERNA 4KY1H 2DQDL 3SN6N 1UM6L 3JV4B 2G2RA 5I16A 3CSPA 2ADFL 1R5WA 4AG4H 3IDXH 5BJTA 3BOVA 1TETH 2ATPB 1VKXB 4ONOA 2X4OA 2XTJE 1W72L 2VNCA 3F7PC 3EJYD 4HFWB 5JIKA 2D7TL 4K3JH 2B1HL 5JA9A 4MAYA 5GHWL 1IGCL 1FBIL 3VWJA 1JL8A 1UXSA 1ZLUH 5DUPL 1MIML 3HE6C 5DFTA 3G5VA 4DVBA 2PTUA 3WO4C 4WW1B 4UU9A 4GRLA 4ZUTB 1TZGH 1DQJA 1PQZA 5A2FA 1UH4A 4WO4B 5C0GA 4PD4J 1LHZA 2BVOB 3C2SA 5IK3B 4JFZL 1MHEA 4ZNCD 1KXVC 1OSPL 1W8OA 3T2PA 4NQXB 2NX5E 4J3TA 1U3HB 2HJKB 4JFEE 3RX8A 3SDDA 2XN9E 1BZQK 1IQWL 4DCQA 4UUJA 1FYTA 3VH8G 1CDCA 3EOYG 3CVHA 2XRAH 2DF3A 4Y4HC 5K9JH 1LEGB 3HMXL 2Q7YB 1FSKC 4Z0BH 2EH7H 1U91A 3E3QE 3MRGB 3MV8D 2WINB 4JFPA 1WFNA 1ORSB 4MX7A 3NCBB 4HQQH 4Y1AB 4QHNA 1XAUA 4ZUUB 3BP7A 5HYQA 2K7PA 4D9LL 1KEGH 2AK4A 3HC4H 4DUVA 5C2BH 4WUUB 2VXTL 2P43B 1G7JA 1E4XH 3WNOA 2NNAB 2FX8H 1TJHH 2R0LH 2VH5H 2VTFA 5JW3H 1HE7A 1RJLB 4YHZL 1KJ2B 1OARH 5I8EA 2C3XA 2C1PA 2KQMA 3OPZH 4PJDA 5DRZA 4NN5B 4AEHL 3L3HB 5D70L 2FLBT 3MRFB 2HRLA 2R0ZL 3QDJD 3KYOA 5H94A 4Y5VC 4CVWA 3DUUB 3VFMA 1UYWL 3ZYZA 2FCBA 5I8OH 3QUMB 3ARBB 2K1MA 1JZ5A 5CBEB 4MS8D 1TIUA 3HAEH 1SEQL 2ZUYA 2BOBB 15C8H 3S3PA 43CAA 4JANA 4PBWD 4YJZL 1A3LH 4WRLA 5DJ2B 3FFCE 1TCRB 5BVPL 2NZ9C 5IB5B 2DBLL 4OSUH 1T1WB 1Z5LB 5F7DB 4EUPH 5EG6C 4LPCA 4X7DC 5FB8B 4QGYA 1HXMB 3C60D 1U8LA 1QFWH 3TV3H 2EXWD 2MCPH 1RAMA 2DLHA 4MDJA 4I2XE 4LPWA 4XBPA 3CXDL 4JFQB 1I7UA 1BZ9B 2I9TA 2D03L 5E2UL 2FEEL 1Z9OA 5FUCC 2B4CL 3ZMRA 3RY4A 4NQCA 4G7VL 3F5WB 4EXPX 3BFOA 4H0GA 4NNPH 3C6LC 3FONA 5EUOE 3TVMC 1W72A 4BUGA 4ZUSA 3D39B 4OV5A 2IBZY 3B2VL 5IT2H 3JUYA 4NSKB 1U8MB 2X4UA 5FCUH 1K5NB 3HMWL 4MB4A 4XNQB 5JMRA 2W07A 5DA4A 2FX7L 4LCWD 1EJOH 4LRNH 2FH8A 3UXFA 4MB3A 4N8VG 3PWVA 2EZ0C 2FB4L 1MFBL 4H0IA 4F33B 4N90D 3T2QA 1J8HD 4I77L 3FMGL 5GGVL 5F9WB 3FCTB 4HK0B 3GNMH 1ONQA 5IHZA 4JKWA 1EEZB 3QNYA 5C0BB 1QNZL 4YDJB 3FO0L 5D7SL 2F53D 5TQ0L 2BFVL 3GSOB 3WFEL 1IM9D 1OGAE 1RZGA 2V17H 4E41E 3QI9B 1G1CA 2FSEB 3K4AA 5C0AB 4YLQT 3HMXA 2J1KA 1GSMA 4LARL 4H1LG 4F9LA 5B39G 1JRHH 1EAJA 4MD5A 4M3KB 1NC4A 1I1RA 1EEYA 5FO9A 2PW2A 4KROD 5T1MA 2W9EH 4WW2A 5F21B 4DAGH 3HB3D 4FABL 1PW3A 4JO1L 4PRID 4LHUA 4X6CE 3ALPA 3JWDC 3DHMA 1CL7H 5ESQB 1T83A 4KKBD 2AJXL 4LGPB 1HINH 5F7UA 1MQ8A 5EU6B 4UINH 4N1HB 4HFUL 1RI8A 4KV5F 4DGIL 4X9HA 1CT8B 3UPRA 1A02N 4F2MB 4AK1A 4TSBH 4XNZB 5HI3C 2ZUQB 1GXEA 3HG1D 1RSFA 1WWWX 1A4KA 2NXZB 1OW0A 5J6HB 1AO7A 3RY5A 1HZHL 4BM7A 4OCYH 1VGKA 1YEGL 3VXNA 1NUFA 3TESA 3L7EA 3FT4B 5DQ9B 5E6ZA 5FHAH 2DQUH 3L1OH 2ARWA 1PEZA 4FFWD 3TZVB 3CH1A 5CINH 1K6QL 5D7LA 1P7HL 1T0NA 1QTYT 1E4WL 1UWGL 4GBXC 1F2QA 2QLVB 2R1YA 3GMLA 4LSSL 4MHHG 4PGBB 4QRUA 5L2KB 2ZPKL 5C0DB 3MZGB 2L4OA 1FVEB 1Y6KR 3CFCH 1AR2A 1DBJH 3MCKA 3WS3B 1T1XB 4LEXH 1HQ4A 5DHVH 4DTGL 5JW5A 4JEGB 4U31A 2ADJB 4X4ME 4RAHA 5IBUB 4K8RL 2VABA 4BQCA 4ZTOH 2VLMD 2CKBB 4MJIB 1HHKB 3RWGA 1SYVB 5SWSA 3SDCB 1FCCA 1KPUB 1RJZB 3P9MA 5D6CA 5GZND 5DEGB 1A6WH 3DVFA 2WBJD 1CICA 4V1DD 2DI9A 2LV4A 4F80A 4PJ8C 5KOVC 2BERA 1NLDH 4R4BB 2R0WH 2X70B 3RNKA 3QXWA 1U3YA 1A8JH 3LKRA 1I9RL 1IC5H 5DTFB 1EVUA 5IESH 2E9BA 4U2ZA 3EFFA 5LKNA 1WT5C 1ZMYA 4P5TB 1G9EA 3OJVC 3D2UD 1G7MA 1GGBH 3H7BA 4G42A 1GPOL 3LPWA 4MXWL 4YO0A 3D69B 3QDGD 3MX0A 4QRPB 2UWEB 4JM4H 4AENB 5GGSA 5TE7L 2OP4L 3CFBB 3GSNH 2NY1D 3I3DA 4RNRB 3MRBB 1WZLA 4XAKD 4GKNA 4ELKA 4RRPA 3CK0L 1I3GH 4HKZA 3N1MC 3MRJB 4PTTA 3RVTC 3M1BB 4HWNA 4UB0L 3PV7A 2OXHA 4K07A 1VPOH 4WTWA 1I9IL 3O3EB 3RX5A 4O2EB 1HWHB 5GS0L 4M02A 4NPYB 3ULVL 5EWIL 4MMXC 5LWYH 4LCCC 1T1ZA 2Z8VC 4GG6B 1FV1B 2R2BA 4MAYD 2ILLA 3QIBB 5IB2A 5HPMA 3HA0A 3VWJD 4OZGE 2X4NA 4GOSA 1RV6X 4XCFH 1X3DA 1DLFH 3RDTC 4JHZA 4GRLD 1KTDB 5GGRB 5IR1B 1H15A 5BZWB 1CLYL 3TO4C 5TDPB 4PS4H 3FOMA 3IS0X 4UOW0 3VJ6A 4J8RA 4BFEA 3BPOC 3S5LA 2DAVA 1NBYB 4RAUA 1T7XA 2NW2B 4UDUB 3QHTC 5K59E 1JHKL 4NO0B 3RUGB 2D7QA 4DN3H 4DKAA 2QKIB 4S10A 3ZE1F 5IB1A 3T0EE 3DROB 2IAMC 2EYTB 1I8MB 1PD6A 3ETBF 1K8DB 4ODVL 2X09A 1ACYH 3F58H 4X9GA 2XWTB 1QRKA 3O8XD 3REWA 3C8DA 3CNKA 4GAGL 3MGTA 5DJ6B 3Q0HA 5C7XL 3ARRA 1A7OH 4G8EA 4WFGD 5D7JD 1TCMA 3IB4A 4EJ1C 4ELMA 4QRQA 3WHE0 4XVJH 1RUKL 1SJVA 5CZVL 4FZ8L 1J11A 3OKMB 3TN0C 4HIXH 2DTML 4G6JH 1IKFH 5DJXA 1AGBB 4QXUL 4ODSH 1K4CB 2AI0L 1BGXL 1KN4L 5E56A 5FM4A 4A6YA 3TPKA 5KVFH 3IFNH 4P3DA 4ODWB 3IXAB 4EIZC 1BJ1H 1K4DA 2Z8WC 2AQ2A 1QO3A 4G8FA 4QY8B 5BV7H 4JN1L 2EE6A 4JGJA 4ZAKB 5C08B 3B9EA 2WLZA 4KK5C 4NQDB 3EYFB 5AWNL 1JZ6A 3IJHA 1FG9C 4U6HA 4U1JA 3U82B 4KK6C 3BGAA 1HEZA 4MXVE 3MJ8A 3MUJA 4S1RH 1QOKA 1NKOA 1G6RB 5EO0A 4PJIF 4D0CA 3KXFA 1RMFL 3FN0L 1CFQB 3GBML 3QUYB 1EO5A 2A0LD 4QHKJ 1P6AB 2H26A 2DYPA 1X4XA 1YNTB 1G7IB 4K94C 1XCQB 3P4LA 5E8OB 1J18A 1TXKA 1FNAA 3LKNB 3TEUA 1QSVA 5FYJL 1WIOA 1KN2H 1EGJH 3UJTH 2VLKA 3MC0A 4IMLA 5F7LB 2VO5A 4E42A 4NQCD 3T3PE 2YZ8A 1PZUB 1GOGA 2PUQT 1I7TB 3GHEL 4JZJB 5IOPB 5CIPB 2A73A 3KLHC 1BZ7B 3B2UC 4LSPH 3RZCD 5ETUB 4FG6D 1MCRA 2DQTL 2P5EB 4BZ2H 1D6VH 1N2RB 2UZXB 4PJCF 3U4AA 1QSZA 3C5ZA 1GZQB 1B4JH 1KIUA 1YECH 1G7LA 1JPGB 2VIRA 3S35L 1I1AB 4P57A 2YPVH 3HUJB 4KRMB 5T5FH 3S36L 3OX8A 4F9PC 4KJPC 4D0DB 2AJUH 4MVBC 3SDXA 1RD6A 5FCSH 1HHGA 3H9YA 4PJHE 1DFBH 2NY5C 2CO6B 4GJTB 4TRPL 4NBXB 3W39B 4FZEH 5AAMA 4PJXE 4KZDL 3O4LB 3S37X 3B9DA 4EI5B 3MLSL 2P7TB 1VHPA 4HUXA 2VQ1B 1JF6A 5JPNA 4PGCA 3UP1A 3FQTB 4G7YH 1CE6A 2QQKH 4HD9A 3TBVA 3WL9A 5JQHC 3VFSA 1FL5B 3TBSA 2P8MB 1QFOA 3TFKD 3L3DA 3IDNB 5CAYB 4JKPH 4HF5L 5CHNB 2W0PA 4KRPC 5E2WL 5KZCD 5HDQH 3BRFA 5FO8A 1BLNB 5ITFB 2YN5A 3K8LA 3EHBD 3FQRA 3S9DB 3OR7A 5FA4A 5E5UB 3S8WA 2F54B 2Z35B 3PHQB 5C09B 3DO7B 5EU3A 3QA3B 2ADGA 2YK1L 5DO2D 1NMCB 3UDWC 3P2TA 1Q9OB 4K3DH 5KTEH 3R06A 3SCMB 1L0YA 4G43A 2J88L 4N0YL 3OAYH 5F7MC 3QDME 4F7EA 4IHOA 2HRPH 4WWKD 1AO7D 1ZLWH 5AYUH 5SX4H 5EOQH 4L3AA 4U3XA 2E7LC 2RJMA 4MJ5A 4OZFG 4CN1A 3D3VA 1YEDB 2DL2A 4LLVA 1A7RH 5D7LD 1W0VB 3PDOA 1LVEA 5H2BB 3O2WL 2FO4B 4XP9H 1Q8MA 3KPSA 1D9KA 4Z77B 1P4BH 3BQUB 1T1YA 4LVNB 1HH9B 4HHAA 3PDDA 3D6GA 2EE9A 2F5BH 4XRCB 5ID1B 2MKWA 4HS3B 2AXFB 3R0NA 3T0XA 5B8CC 3QYCA 4XBGA 2YD9A 4OQTH 3UJJH 4PRPB 4JFFB 3BPCB 5J6GB 2R1WB 3LEVH 3BEWB 5BS0D 2V7HB 3PJSB 1LEIA 5D2NE 2UUDK 3IYLW 1UXWB 3PP4H 3CFDB 1MRDL 4R90L 2Q87A 1GHFH 1V7NH 3ROLA 5B3NA 3KLAB 1OCWH 3VXPB 1W8NA 5F1IB 3L3KB 3W5MA 3KNBB 3X13A 5E9DE 3WJJC 3D87B 4AH2B 3LKPA 2VZUA 3PXJA 4HBCL 3VGEA 2ZOLA 3QWQB 3NPSC 5SWSD 1NL0H 1UA6H 2DL9A 3U2SB 5GGQL 2NY7L 2XKNA 1KBGH 3DUSA 4EVNA 2HMIC 2RAMA 2A74B 1E0OB 1TQCC 3TO2A 3BRGC 1KCLA 4WTXA 3D85B 1G6RL 4HUUA 1L7TL 5EU7C 5IQ9A 3HI6H 2NCMA 3T0DA 3D18A 4PJ7A 4EDXB 3S96A 4OF5A 3FO9A 5KSAD 3VRIA 2I60H 1E27A 2YA1A 1YY9C 1MIEL 4JQVA 4HEME 1J1XH 2X9YA 3TA3A 1PKQB 2F8XC 4ALAH 3WDHA 4G6ML 3CVHH 3NZ8B 4LVHC 4JG1H 3G5YB 1JWSA 3P11H 3FAWA 4QOKB 4S0SD 2HKHL 1TZHA 1GAFH 2FIKB 5I1AB 5MP6H 3RVXD 2ZSVA 4M7JH 3T3MF 4JZNB 1B0GB 2UWEF 5T1LB 4Z78A 3T4AB 1NFDB 3BXNB 4RQQB 1P2CA 1XGTA 4PV9B 2ZG1A 3GUTB 1WFUA 3FT2A 1H3VA 2QV2A 5DJYB 4BJLA 4TVPL 4K7FA 3LKQB 3EZJB 2R4RH 4PJ9C 2VLRB 1UZ8A 3QEGH 3F7YB 2VYRE 4ENED 3IXTB 2EYRA 3B9KD 2HFGL 1I1YB 1IGJA 4C58B 1B6DA 5DD0L 3F7VB 3OKEB 4M62L 1AHWA 2AV7B 2BNRA 1UZ6F 1N6UA 3H9SB 3PQYA 3W0WE 4PREB 3SO5A 1TJIL 4AT6A 2HT4D 2Q86A 2HT3C 3IDYC 1PG7W 4IDJL 3X12A 3L5HA 1IQDB 2D7MA 3HZMB 1EHXA 4R0LC 4H8WL 5DMGD 4IIQA 1C5CL 1BAFL 3OWEA 2CH8A 3OAZK 2DQDH 3OG4B 4KKLC 1V7ML 1UM6H 3GB7B 3C5JB 3HS0A 2R2EB 2J6EA 5BJTB 2ADFH 1NCAL 2PXYA 5KSUB 3KPMB 1CLCA 4MA7L 4GKSB 3UTSA 5EZLA 3MBEB 1UACL 3MGOA 3MRPB 4HJGA 2J8UE 1W72H 4CADB 2V2WB 3MLVL 2D7TH 4XX1G 1V05A 1IZKA 2RB8A 5GHWH 2EC9T 4K8RD 1IGCH 3GJFH 3G5VB 1FBIH 3PP3K 5EU5A 4KKAD 3FTGA 1MIMH 5DUPH 2K9UA 5C07A 1UCBL 4DWHA 5BRZB 5HHOE 4NN6B 4OIIL 2Z8RA 2AVGA 3BP6A 4JFZH 2NLJA 3EIFA 3TJHC 1CVSC 3PIQB 4P2QA 4EUPG 3SDDB 3BKYL 1NEZA 4P9ML 2MHAA 2N7BA 1IQWH 4L8SC 1FYTB 3WDIA 4O00A 3O45B 4ZTPL 3IJSB 5C0IB 2ICWB 1T21A 3SGJC 1UKQA 3VWKA 2P47B 4WFHE 3BKJL 4X6BB 3HMXH 4YHIB 1U91B 3W82A 1PGRB 4JFPB 5B38A 3D39D 3ARZA 5F44A 3V5KA 1BOGA 2R1XB 3KXFD 2AK4B 4A2LA 3ZTNL 4D9LH 1Z9LA 2BZDA 4LCYA 1H5BA 1P1ZA 4LSRL 4DEPB 1BX2A 3Q2CA 2VXTH 4ZDHA 4BQBA 1UKSA 2DYPD 4GXUN 5DHXB 2BSED 4XGZB 2DM3A 4ZNEE 4YHZH 1ZANL 4PJDB 1UWXH 5IBUG 4HULB 4M00A 4AEHH 4PIRF 5CCKL 5GS0D 4WI6A 5H94B 5D70H 3DV4A 3VA6A 3ULVD 2R0ZH 3VFMB 3SO3C 2P48B 2EDHA 4MDIB 4BH7B 1UYWH 4MCZA 1LK2A 3TJEH 4Q2ZB 4Q0XL 2W0LA 4FOMA 5EIIB 4P5MB 1SEQH 4M5YL 43CAB 2YWYA 3OKKA 5T5NF 2WUCL 3H2WA 1VFMA 3TT1L 3NPZB 3T09A 5BVPH 1AD0A 2DBLH 4FQ2L 4H0HB 1WSST 1CDYA 2R2HA 5K9QI 1QLRB 1S9XB 1OGTA 3WKML 3HUJF 4MJ6B 4OGYL 2DLEA 3S98A 2D03H 5E2UH 3Q6FA 3BX7C 2B4CH 1IGFL 4ZUSB 4G7VH 4XP1L 3WS6A 4PGEB 3MNZB 2OL3A 1IEHA 5GQBA 5GRVK 4LDEB 3B2VH 1EHAA 2E3VA 5F7EL 1JPTL 5KS9F 3HMWH 4D3CL 2FX7H 4HWZA 2NXYD 4HIJB 3MJ6A 3UTPE 4JQXC 3VFRB 3MOQA 1A1OB 1PX3A 4HCRL 1MFBH 4MLIA 4I77H 3FMGH 1ONQB 3N0PB 5GGVH 5IHZB 4YR6B 2PCPB 1U3JA 2ENYA 4PP2B 3SGDI 2EDDA 2ITCA 4NKOA 5IW1A 2AQ1A 3QNYB 1P4LA 3LDBC 4WFFD 3V6OC 2M8XA 1QNZH 2I26N 5D7SH 5TQ0H 4R97B 4LF3A 2XTJC 2BFVH 3WFEH 4XWOD 4CN6A 5HY9A 2APXA 1AQDA 4XVSL 1FSKB 2EXYD 4I9WE 3ARED 1MELA 4JFYA 2R8SL 4LARH 3IRZA 1KJVA 1E6OL 1F58L 4H26A 5D2LB 5JXEA 2FDBP 1SEBA 2IEPA 4BELD 2PW2B 4RMVA 4PJBF 1IL1B 5TE4L 3BWAB 1JPFA 1JE6A 3PG2A 2NY4D 4YFLI 4WW2B 5FYKU 3S6CA 1FNEB 1QSFA 4NZUL 4MA3A 3SDAA 3RBSA 3D3VD 4PRBA 4UAOB 5I71B 1BJ1J 4LHUB 4JO1H 1G0XA 3NCEB 4M6NL 1UG9A 5FYJD 1OF2B 4PUBL 2AJXH 2BSSA 1NFKA 3UPRB 4Y5VB 3DBXB 2ZG3A 5DRWB 4DGIH 1IFHL 3OSKA 3SDCD 5D7KE 2MPAL 1TNMA 4YDVA 3E3QC 5IB3B 2DRUA 1T66D 1PDKA 1IM3B 1DLHA 4ZUWA 1VGKB 3VXNB 1MVFA 4KAQL 2OBGA 1HZHH 4PGDB 3L7EB 3CLEL 3D9AL 3D25A 4P4KC 2DS4A 3EOAB 3UPCA 4YIQB 1KXQE 1QR1A 3REVB 3AY4C 1FL3B 4Y1AE 5IEHA 3MFGB 4YHPA 1YNKL 3SE3A 1A7QH 3OMZA 4P5TD 1T0NB 3RWJA 2AP2A 1K6QH 2YXFA 2XI9A 5IEKA 1E4WH 1UWGH 4WUUE 4TPRL 3Q1SL 4HX1A 1FJ1B 1FHGA 2WANA 4LSSH 4I0PA 1XF5B 3DVGB 2ZPKH 4U7KA 5T1KA 1N6QL 5HJ3A 3PV6A 4CU7A 5IVOA 3FRPG 1OAKL 5HYSG 3MR9B 4L3ED 1X5AA 2YRLA 1TVBA 4NKIL 3P4NA 2OX5A 4IMKC 4G9FA 1DANT 3G04A 1AR1C 1ADQL 1F3JA 4X6DE 3RA7L 4DTGH 4J1UA 5DSCB 3CFIC 1HI6B 4LLUB 4FQ1L 4LPVA 3ECBA 2VABB 1UB5B 5MEQA 4K8RH 1EPFA 1OTSD 2R0KL 4GAYA 1YMMB 4OF3A 3MODL 1LMKA 4XCEA 3QULB 2MTPA 1AGCA 5J1SC 3TYFA 2A6IB 3RVUC 4TSCL 2QADB 4WI4A 2VZSA 4OKVA 1QSED 1CICB 1NBZA 4NJ9L 4OM0L 1GH7A 1ZS8B 5CFHA 3AU1B 1RZ7L 3LRSA 2OCFD 2ZUUA 1A1MB 2MQCA 3DRQA 3FQWA 4LEOA 1A9EB 3UZVB 1KULA 1I9RH 1NBQA 4HUVB 4BQ8A 1MCQA 2X1XR 3EFFB 4I4WA 4MQ7A 5MENA 2E7HA 3CLFL 5FOJA 3B5TA 4NO0D 2BNRD 1VACA 2P1YA 5EIQA 1DE4A 4YO0B 1GPOH 4AEIH 4LPTA 1A7BA 1UB6A 4MXWH 5GGSB 5EZOL 2NW3B 5TE7H 3PF2A 2OP4H 3OXRA 3I3BA 4Y7MA 3STLB 4ELKB 3O9WC 3HNTL 3PGDA 2YOCA 1AY1L 3RNQB 3DX9A 1MF2H 1X6LA 3CK0H 4HKZB 4MCYA 2HN7B 2EO9A 5F1NA 5DVMA 3DXAB 1HHJA 1A14L 1P9MC 5BMFL 5C0BE 2Q1EA 1VFBA 3KG5A 3V6FA 3DIFA 4UTBL 1WWCA 1T1ZB 2ZJSL 3ULVH 1M1SA 5EWIH 3V4VH 5AUMA 1XZ0B 4XWGL 4WHYG 1NDGA 2R2BB 5D72L 1XF3B 5IB2B 3P9LA 3ZDYE 4LHQB 5MEOA 3VRLF 2X4NB 2DTSA 4GBXB 3NN8B 4L8DA 5IMMB 1T89A 1VADA 2J4WL 4MB5A 3FQXA 4YHKL 2XWBA 1CLYH 3CJJA 3FOMB 4LLWA 3HE7A 4J8RB 4QXTA 3MRIB 4X4XA 1INQB 4OTXL 4Z7QE 1Q1JL 2I07A 3LEYL 4XX1E 4P2QD 4JB9L 5EU6E 1JHKH 1HSAB 1DBKL 1U41A 3P4OA 2CLRA 1ADQA 4RMUA 2X4PB 5IB1B 2HAZA 3VFTA 4HXBH 3AS3A 1IKNA 1FFPA 1WBZA 3VWKD 4KZEL 1MAML 2Z4QB 3WE6B 1H0DA 4AL8L 4C56A 5BOPA 4ODVH 4LRIA 5A3IC 3MGTB 2RR3A 5GGVY 5BXFB 4GAGH 4M9OA 4OCSL 5C7XH 3BPNB 5JHDB 2CGRL 1C7SA 1JUFA 1PEWA 2X4TA 1D5XA 3QXDA 1RUKH 4U1GC 3R0MA 3WSQL 4NQEA 5CZVH 4FZ8H 5DJXB 4PJ8B 4PY8I 2DTMH 4TVPD 5DJAA 2AI0H 3ILPB 1QBBA 5L2KE 4A6YB 3IETB 3SPVB 1I1AD 1BGXH 5FGRA 1KN4H 5JIHA 5FO7A 5E1HB 4U33A 2Z31B 3GMNA 1RZIB 4CDGC 4JN1H 4FA8A 3HZKA 3OBAA 4U1JB 1ZOXA 5AWNH 5HYIA 1HEZB 3O4LD 3MRMA 2R39A 3KPLB 2AKRA 4N0CC 3RTQC 1E28A 1RMFH 3FN0H 4M6OL 1IEBA 1I1FA 3GBMH 1U8NA 1E6JL 4MJIE 3I85A 3KYMB 1AKJB 2A6DA 3GSXB 2Z93A 1NFIA 5J3HD 2VLKB 5FYJH 4LQFL 5IMOA 3EOTL 1OVZA 4HZLA 1X5ZA 3IJYA 5EULV 1IILE 3GHEH 5C09D 1TTFA 1FO0A 5D1XC 5CEXA 4Y4HA 4JJ5B 5DI8A 2VKXA 5IIEB 4Z7OF 3BW9A 3U36A 4XCNA 2GJZB 3C5ZB 3T3ME 3BH9A 4QRPE 2OR7A 2UWEE 2VIRB 4F7MA 5I1DB 3S35H 3MRCB 3S36H 4JPVL 5DJ8A 1WLHA 3ZTJH 2WWKO 3NTCL 1Q72L 4JFHE 3WFHA 1LDSA 3JWDL 1EXUA 4TRPH 3LMJL 3C9NA 4KZDH 4NCC1 3MREB 3MLSH 5JPNB 5AYQA 1HHIB 4ZMAT 5F8RC 1CE6B 3KR3L 4GG6E 2JJSC 5IG7B 5C3LD 1U95A 3O2VL 3QUZD 4OF6A 3TBSB 4PRPD 3L3DB 5HDLA 1ZT7B 1I7ZA 5HGDB 2DD8L 4HF5H 1OSZA 2G60L 3CDGB 5E2WH 3G6AA 3BGFB 2ITDA 3SDAD 3OR7B 5E8NA 3QXVA 3CU7A 2H9GB 2Y6SC 1S8DA 3MRNA 3U0WL 5M94B 2RFXA 4YFLF 3T0EC 3QG6B 1EA9C 2YK1H 3RUGE 3BT2L 1TJGH 4XI5D 1FZJA 4ETQB 3NGBC 1I8KA 3K46A 5CEYA 4G43B 1D5MA 4N0YH 2J88H 2MQ0A 4POZD 1SBBA 5DMKA 5LGKA 3KLDA 4HKJB 4U1NA 3LKOB 2B2XL 3KPRB 2I24N 5BVJB 5F7HA 1F6LL 4MJ5B 2IH3A 5JOEA 4XVUD 5ANMB 3DPBA 4NOBA 4QRRB 4FQQB 3MV9D 4M48L 5I75C 1R3LA 2ZNXA 4C57C 3O2WH 1MCIA 1D9KB 3HTLX 1T1YB 3QHFL 1B3JA 4F7TB 1IAIM 5EZIL 4I0PD 5T1LD 4HHAB 4MJ4A 2YD7A 3NFNA 4WU5A 4PRHA 2R29L 3KJ4B 1OD9A 1T7YA 2CUHA 4MNHA 4XBGB 5ICYA 3I6GA 3OB0H 4G9FD 1LEIB 2KPNA 3BKML 5C08E 1YDPB 3QZWB 4NQDE 4UZGA 1GYAA 4ZSOA 4U7SA 1MRDH 2VITA 2VXUL 4R90H 1WISA 1O7SA 1CFTB 2VLJA 2A1WL 2IBZX 2NY3D 4OZIA 3KS0J 1OTUD 4JM2B 5INCA 5DJCA 3WIHL 2H3NA 4HBCH 3EOBB 3QIWB 5E5RB 2XKNB 3DUSB 3G6JA 5GGQH 2NY7H 2O5XL 4S2SB 5J1AA 3LY6A 3MSPA 1BQHA 5IQ9B 1G6RH 1L7TH 4KGJA 1FNGA 2QHLA 2ZCLL 3I2CL 4PJ7B 4QT5A 3FO9B 1N8ZA 4CU6A 4R8WL 1NCNA 1MIEH 1S9WA 1WGOA 4CVZA 2NY0B 4WHDA 1JWSB 4AYFA 4G6MH 1MFDL 2Y5TA 4MA1C 5MEND 3EDKA 5KVGL 4U6XA 4M43L 3BSZL 1DQDL 4MD0B 3EYQC 2HKHH 4LNVA 2P5EE 4LKXB 5I66B 4APQD 4OLZL 5DK0A 3BD3A 5CIPH 4LCIL 3JWOC 5CP7A 1HHHA 1U8HB 4DZ8A 4WJ5A 3TYGL 1G7PA 1D5IL 3OKYA 1RJYA 2BNQA 1CYGA 4DGYL 3ARDA 5DVLA 3CMGA 3VXQB 3ZHLA 4TVPH 2W65B 3WHXA 3KGRA 4OUOA 5EUKA 5EFIA 4S11A 3TIDA 1OT1A 3WLWC 3EGSB 4PJGA 5M95B 3V9FA 1IGJB 1UM4L 2HFGH 4JRXB 1E4KC 3HFML 1T5WB 4LNRB 5DD0H 2WBWB 2FH6A 3QO1B 4M62H 3PQYB 1ZHBA 2V5TA 4JFXA 2YD1A 3RHWK 2GUOA 1TJIH 4NFBA 4S1SH 4LL9A 5F96L 3X12B 3PNWA 3CXHK 2WWMD 5GS1C 4M61A 3LD8B 4H8WH 1T04A 4IIQB 3HE7D 4NO5B 1MCCA 1C5CH 1BAFH 1KT2A 1PY9A 3U9UA 1V7MH 3A67L 4RAVA 3HRZA 5CWSA 2PXYB 2V9QA 4UI2A 4OCNC 3UTSB 1QP1A 1NCAH 3FO1B 1CE1L 1QYGL 3IU4L 4MA7H 2YD4A 3L95A 5B4MC 1RFDH 1YEKL 4JO4L 1UACH 4NT6B 4LHUG 2GSGA 1AGDA 4WEUD 2FHCA 1KC5H 3WDJA 5F3BB 1FFQA 3VXRA 3MLVH 3QWOA 4HXAL 4KK8C 3O4OB 5EU5B 4XXCA 3SEPA 3U83A 3L3GB 3TP4A 4U1LA 3PL6A 1WC7A 4HPOL 4JDZA 1UCBH 2JK5B 1TQCB 1ZVSB 1NLBL 2GFBA 4UQ2A 4OIIH 3BP6B 3H6JA 1GC1C 4KMTL 2NLJB 3CZJA 4NQED 4GAJL 2VL5A 1AXSA 2QQQA 4ODXB 1NEZB 5E8EB 2FBJL 3BKYH 4P9MH 4K94L 5DUBA 3OKLB 3KPOB 1GZPA 2HG5A 1S3KL 4LVHB 5D2NC 3GSVB 4KDVA 4NZTL 1L6XA 2G5BB 4KI5E 4JFFE 4WNQB 3BKJH 4LCCA 5DMYA 2COQA 1LO5B 2XG5A 3VXMA 1AE6L 3PWUA 1CS6A 2HTLC 4GH7B 2CR3A 4PTUA 5IB4B 1S7UB 3HE6D 1EMTH 3ZTNH 3VCLA 4WV1C 4LSRH 5F3HB 3ARFB 4YDLB 2VAAA 4PJ9B 3UCRA 4N0RA 3TO4A 2VISB 2DM2A 5J8OA 3AMLA 2ICES 1ZANH 2FBOJ 3FB5A 4M8VA 2G9HA 1UEMA 5CCKH 5IUSA 1MWAA 1NCWL 2VKWA 5DF0A 2NY5L 4OCWL 3ARUA 2V2TB 4LVEA 4WIQA 2GK0B 4Q0XH 1PKQE 2IAMA 5CP3A 4Y4HD 3VXSB 4JRYB 1BIIB 4RWYL 4TULL 4YHML 3AM8C 3MRKB 4D9QE 2WUCH 4QOKE 1OP3H 3TT1H 2OR9L 4R0LB 3QEQA 4L29A 5E4EB 3MLZL 5MERA 1EFXB 2R2HB 4FQ2H 4HZAA 4U1KA 1FFRA 4HIIB 5A1AA 4QO1A 4OZHE 3MFFB 4CNIA 1KF9B 3RWCB 3ULSA 1NFDE 3MACL 4HLZG 3WKMH 1YC7A 4UDTB 4BFIB 2IAND 2BHYA 4HUNB 4PBVC 4NNYA 3TN0A 3HHRB 2C4FT 3NCYS 4OGYH 4TUKL 2GCYB 4X9FA 1IGFH 2VLRE 2OL3B 1JJUA 4XP1H 2KZWA 2BXYA 1G6VK 1JZ8A 4RGMC 1CGSL 2YKLL 3EUUA 4N5UA 5F7EH 1BQUA 4ZUVA 2YS4A 5ISZA 1JPTH 1P7KA 1QRNE 4D3CH 1BBJB 3H9SE 5HYJB 4X8JB 5HHQB 5C0JA 3NFPA 4R4NC 2NZ9D 4HCRH 3TGXA 2DIAA 3MJGX 2OSLA 3O41A 4MNQB 3QPXL 2DQJL 5J11B 4C4KO 3PWPA 3NIDF 1N5AA 3MNVA 1BIHA 4YGVA 4LP4A 5IBTL 1D7FA 4JFYB 3SKMB 1LO0L 1JF1A 4CDHA 1KOAA 2R8SH 2GITA 3C6LD 3TVMD 1F58H 1M05A 1SEBB 1S5HA 2R2CA 3DMMA 3S5LG 1YUHB 1Z6JT 3U46A 3QQ9C 3STBA 3MUGA 3PGCB 4FXGA 4HS6A 5TE4H 3S4SA 2AS5M 4D94A 1QSFB 1MJUL 2X1PA 3O11B 3B3IB 3RIAF 1ED3A 5J9PB 4HV8A 4NZUH 3GBNL 5FEBA 1TFHA 2EZ0D